(data stored in ACNUC7421 zone)

EMBL: AL591977

ID   AL591977; SV 1; linear; genomic DNA; STD; PRO; 270050 BP.
XX
AC   AL591977;
XX
DT   21-OCT-2001 (Rel. 69, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 7)
XX
DE   Listeria monocytogenes EGD-e, complete genome, segment 5/12
XX
KW   .
XX
OS   Listeria monocytogenes EGD-e
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [2]
RP   1-270050
RA   Glaser P., Frangeul L., Rusniok C.;
RT   ;
RL   Submitted (06-JUN-2001) to the INSDC.
RL   Glaser P., Institut Pasteur, Genomique des Microorganismes Pathogenes, 25
RL   rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE.
XX
RN   [3]
RX   DOI; 10.1126/science.1063447.
RX   PUBMED; 11679669.
RA   Glaser P., Frangeul L., Buchrieser C., Rusniok C., Amend A., Baquero F.,
RA   Berche P., Bloecker H., Brandt P., Chakraborty T., Charbit A.,
RA   Chetouani F., Couve E., de Daruvar A., Dehoux P., Domann E.,
RA   Dominguez-Bernal G., Duchaud E., Durant L., Dussurget O., Entian K.D.,
RA   Fsihi H., Portillo F.G., Garrido P., Gautier L., Goebel W., Gomez-Lopez N.,
RA   Hain T., Hauf J., Jackson D., Jones L.M., Kaerst U., Kreft J., Kuhn M.,
RA   Kunst F., Kurapkat G., Madueno E., Maitournam A., Vicente J.M., Ng E.,
RA   Nedjari H., Nordsiek G., Novella S., de Pablos B., Perez-Diaz J.C.,
RA   Purcell R., Remmel B., Rose M., Schlueter T., Simoes N., Tierrez A.,
RA   Vazquez-Boland J.A., Voss H., Wehland J., Cossart P.;
RT   "Comparative genomics of Listeria species";
RL   Science, e1252229 294(5543):849-852(2001).
XX
DR   MD5; 8ae9ed8c65769c921e011e4217b21480.
DR   ENA-CON; AL591824.
DR   BioSample; SAMEA3138329.
DR   EuropePMC; PMC1273839; 16239585.
DR   EuropePMC; PMC154633; 12454178.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00616; LhrC.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01481; rli53.
DR   RFAM; RF01491; rli54.
DR   RFAM; RF01493; rli37.
XX
CC   E-mail: pglaser@pasteur.fr
CC   Phone: +33 1 45 68 89 96, Fax: +33 (0)1 45 68 87 86
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270050
FT                   /organism="Listeria monocytogenes EGD-e"
FT                   /strain="EGD-e"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:169963"
FT   regulatory      56..61
FT                   /gene="lmo0850"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69..215
FT                   /transl_table=11
FT                   /gene="lmo0850"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8P6"
FT                   /protein_id="CAC98928.1"
FT                   /translation="MDNNQKDLNQVIRQLKEKGIVVEKTKSRKDIWKSVSSKAMPNMTL
FT                   RLQ"
FT   regulatory      426..431
FT                   /gene="lmo0851"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        439..1197
FT                   /transl_table=11
FT                   /gene="lmo0851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8P5"
FT                   /protein_id="CAC98929.1"
FT                   /translation="MKKEAVNQQSIYVHIDHVINNVATSGISFCDFLNGVGQPPENILL
FT                   IKHNIEDASYNAHTAFHYLEPGDLANISKENFNPLCWIDFEDVELLNQLTPQEVAEMLY
FT                   LAHTGRHLRSPFYYKLQNNFVYLTREDGRYNKVYYRNLNHFYMLLSYVIARKTAELVNE
FT                   KGIFSFGKKKYVAEPPVELLKKMADHFKDGACIALDDVVRTRTQIEVPIGHGLTEEMTE
FT                   LEISSKIYYEEEVAKLVYDLKQNEWKYIEK"
FT   regulatory      1264..1269
FT                   /gene="lmo0852"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1277..1831
FT                   /transl_table=11
FT                   /gene="lmo0852"
FT                   /note="similar to transcription regulator TetR/AcrR family"
FT                   /db_xref="GOA:Q8Y8P4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="PDB:5C4Y"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8P4"
FT                   /protein_id="CAC98930.1"
FT                   /translation="MTKKLIKEVALTLFAEKGYDGTALSEIAKAVGIKTPSLYAHFASK
FT                   EALFLEVYQDSIQMELTELGRVAEREDLVGEEKLQSIFFVATDFSSNPDEKKFFQRAVF
FT                   YPPKSLFQELKEETKTYEQLTNRILRETLEKIVSEEALVRWMHVFYALLDGLSVEHGIY
FT                   DETEFELRRKSAWAVLASLLK"
FT   regulatory      1834..1839
FT                   /gene="lmo0853"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1848..2189
FT                   /transl_table=11
FT                   /gene="lmo0853"
FT                   /note="similar to E. coli SugE protein (transmembrane
FT                   chaperone)"
FT                   /db_xref="GOA:Q8Y8P3"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8P3"
FT                   /protein_id="CAC98931.1"
FT                   /translation="MAWFYLIMAGLSEIVWAFGLKESHGFTMLGWSLLTIAFLIVSFGL
FT                   FSISMKSIPIGTAYAVFTGIGAAGTAIIGMIFLSEGVSFWKIVSLIVLLTGIIGLKLVD
FT                   GNESEKEAK"
FT   regulatory      2176..2181
FT                   /gene="lmo0854"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2192..2512
FT                   /transl_table=11
FT                   /gene="lmo0854"
FT                   /note="similar to E. coli SugE protein (transmembrane
FT                   chaperone)"
FT                   /db_xref="GOA:Q8Y8P2"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8P2"
FT                   /protein_id="CAC98932.1"
FT                   /translation="MDWIFLLVAGLCEMVFVVMLKLSDGFKKVGYAILTIIFMSASFFL
FT                   LSLALKTIPIGTGYAIWTGIGAVGSVTLGMIVFKERKSVGKLLFITMIIAGVVGLKLTS
FT                   GV"
FT   regulatory      2650..2655
FT                   /gene="ddlA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2662..3774
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="GOA:Q8Y8P1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8P1"
FT                   /protein_id="CAC98933.1"
FT                   /translation="MKTKLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAAPIYITNE
FT                   GEWIQGPLLSGKLDFVEQLRFSATDTIKLATTESEKSEGEAISPAVLEADGQETVVFPL
FT                   LHGPNGEDGTVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLI
FT                   DWKNYQEEMVAEMEEVLTYPVFVKPANLGSSVGISKATNKKELVDAMTEAFLYDRRVVV
FT                   EQGVVAREIEMGVLGNDTPVCSVPGEILPEGAVATFYDYKAKYQDNNTALIIPTEVDPE
FT                   ILEQMKEYAIQAFLGLDASGLVRADFFLTEDNQLFLNEVNTMPGFTPYSMYPLLWQETG
FT                   LPYGALIERLVDLAKERHAAKNALKYKLED"
FT   regulatory      3788..3822
FT                   /gene="ddlA"
FT                   /regulatory_class="terminator"
FT   regulatory      3822..3828
FT                   /gene="murF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3838..5211
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamino
FT                   pimelate-D-alanyl-D-alanyl ligase"
FT                   /db_xref="GOA:Q8Y8P0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8P0"
FT                   /protein_id="CAC98934.1"
FT                   /translation="MKKTVGEVVAMLDSSIHVDAFRDVVITGVCFDTRQIKSGDLFVPF
FT                   VGNVRDGHEFVGQAREMGAVATFWQKNVPNPPTDFPVILVEDTLLALQELAAKYIQQVK
FT                   PKVIAITGSNGKTTTKDIMAAIVETTYKVHYTGGNFNNHIGLPYTILTMPEDTEVAVLE
FT                   MGMNHRHEIEVLSKIAKPDIAIITNIGEAHIEYLGSREEIAKAKLEITAGLNPSGILIY
FT                   PHEETLLLGNINGDFRQLTFGKSEAAEIYPLEIRAEAEGTSFITNWEPELEIFVPIIGE
FT                   HNVFNTMAAMLAAREIGIEGEKIQSALKNMERSKSRLEWITTKSGARILNDAYNSSPTA
FT                   LKTVLKTFMHMDSSGKPKYLVLADMLELGDLSTKLHQESAEVLENDTIQKVFLYGDAMK
FT                   AFGEVAESKIGQGKVHHFDTKESLETALLSEIKGNEWILVKGSYGMGLKDVVENLIIK"
FT   regulatory      5263..5268
FT                   /gene="lmo0857"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        5278..5991
FT                   /transl_table=11
FT                   /gene="lmo0857"
FT                   /note="similar to carboxylesterase"
FT                   /db_xref="GOA:Q8Y8N9"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8N9"
FT                   /protein_id="CAC98935.1"
FT                   /translation="MVACLCIHGFTGSPSEVKPLADYLREHTDWDVLAPTLPGHDHLRH
FT                   LKNVTYKDWIVFVDSILSQMLKEDDEVYIIGFSMGGLLAGWLARHYPEVKKLVLLSTAV
FT                   NAMEWPQLVENSKQVLTEAKEVTLKNSPMFKRYQKKVTETPWTSTLQFKKMVALAKPVF
FT                   EHIEIPTFIAQGSADQVVPAEKSVNFLMESIPGPKELFILEGSKHVICQDEQADKLFAA
FT                   VLTFLQKDVAVLNTK"
FT   regulatory      complement(5990..6032)
FT                   /gene="lmo0858"
FT                   /regulatory_class="terminator"
FT   regulatory      5998..6036
FT                   /gene="lmo0857"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(6003..7028)
FT                   /transl_table=11
FT                   /gene="lmo0858"
FT                   /note="similar to transcription regulator lacI family"
FT                   /db_xref="GOA:Q8Y8N8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8N8"
FT                   /protein_id="CAC98936.1"
FT                   /translation="MKKVTMQDIADRLNITKNSVSQALGNKNGVSEQTKLAVFKMADEL
FT                   GYKYKREIAREVVKEKFALLATSFALSQRSFFGEIIDNMKQSIIAHQAELIIFPVTDEE
FT                   AATNQLPEQLTSENWTGIFLLSHINTDYSKKVIDLGMPVVLIDHHDPHLKADAVISQNK
FT                   DGAFMAVEFLIQNKHQKIGFLGDVTFSPSYEERLEGYKKALQYYHIPFNKKYAITRIKE
FT                   EQTTLYRTLDELDELPTAWFCVNSGLGFILNTYLQSKGYNIPKDLSIICFDNTEFTVLS
FT                   NPQLTTMCTNLSFMGEKAVELMYNRIRKPDEGFVHLALATNLIARDSVGENKKTDSASE
FT                   S"
FT   regulatory      complement(7035..7040)
FT                   /gene="lmo0858"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      7258..7263
FT                   /gene="lmo0859"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        7273..8592
FT                   /transl_table=11
FT                   /gene="lmo0859"
FT                   /note="similar to putative sugar ABC
FT                   transporter,periplasmic sugar-binding protein,"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="PDB:4GQO"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8N7"
FT                   /protein_id="CAC98937.1"
FT                   /translation="MKIRKIAIAALSVVVAGSLLTACGGGNSKSDDNGKTKVTFWAAPN
FT                   PTQVKYWDEMAKAYEKENPDVTIEVSQMKESPSSEATIQSAIASKTAPTMSENINRSFA
FT                   AQLADSKAIVPLNDVKGLDDVVKERNMSETMDSWKFSDGNQYVLPVYSNPILFAWRLDT
FT                   LKELGYDAPPKTYSEALEVGKKLKAKYPDKVLWAKGDLSDPTAWMRWFDFFPLYDAASK
FT                   GNAFVEDGKLVADDKAGTELLTFMSELQKNKLLLASKATDPFETGTSIMADNGPWTFPN
FT                   WDEKFPELKYNENYAITAPLVPDSMVNEENVATYADSKGVVMYAQATDKEKEAAMDFLK
FT                   FVYNDDKNDLKFLETTNLIPARDDATENETFTAFFKENPELEVYAANVPYSIPAMDDAK
FT                   YNDIQQIIGEEAWNPIVRGEKKPTKAWSDMKKAEDGVLQE"
FT   regulatory      8570..8575
FT                   /gene="lmo0860"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8589..9467
FT                   /transl_table=11
FT                   /gene="lmo0860"
FT                   /note="similar to sugar ABC transporter, permease protein"
FT                   /db_xref="GOA:Q8Y8N6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8N6"
FT                   /protein_id="CAC98938.1"
FT                   /translation="MKRRNNKLGWSFTSPYLIFTAIFFLVPLVWSIWLSVTDWNMMSPE
FT                   INFVGFDNFIKAFTSPAVQAAFFVTYKFLIVFVPMALIISMIVAVLVNGLPKFKGLYLV
FT                   AFFLPYLSSGVVTSLIVQGLLSYNSALNVFLRGHFGWDIDWLGTPMSALVIISLMIAWK
FT                   MSGYYALILISGLASINHEIYEAAAMDGSGRFRTFWKVTVPMLYPALFTVIVLAVGVSF
FT                   GIFTEVYQLTGGGPNFATNTWQMEIFNQAFVNLNSGYASAISLMAATVTFASIGVIKKM
FT                   LEKWGQRNGWT"
FT   regulatory      9440..9445
FT                   /gene="lmo0861"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        9454..10287
FT                   /transl_table=11
FT                   /gene="lmo0861"
FT                   /note="similar to sugar ABC transporter, permease protein
FT                   -"
FT                   /db_xref="GOA:Q8Y8N5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8N5"
FT                   /protein_id="CAC98939.1"
FT                   /translation="MVGHNSKAGKIVRYILTTLLMLIMIYPFIYLVLNSFAAWDQVDKK
FT                   LIPTEFTTRSWDWLFGNSVVAAPAPWIHAFINTIIVSTIATGLMLLFGLMVGYALAKVD
FT                   FKGKKIVNNAILFQMFFPAIILLIPQFLMITDFGLLDTYAGMIIPTMLSLWAVFMYTNF
FT                   FKAIPDTLIEAAKLDGASDLKILFRVVLPMSKSITTVIFLFLFTDRWTNLLWDMLVTKS
FT                   DGTVTLNVLISQMFGPYATYPGPMYAASVLLTLPLIILFLFFSKKFQEGMQFTLK"
FT   regulatory      10289..10294
FT                   /gene="lmo0862"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        10303..11835
FT                   /transl_table=11
FT                   /gene="lmo0862"
FT                   /note="similar to oligo-1,6-glucosidase"
FT                   /db_xref="GOA:Q8Y8N4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8N4"
FT                   /protein_id="CAC98940.1"
FT                   /translation="MEFWRRSVFYEIYMKSFQDSNGDGLGDFKGLTSRLDYLVDLGIDG
FT                   IWLTPFYPSPQVDNGYDVSDYCDINPDYGDMTDFRAFMKAADARGIKVIIDLVLNHSST
FT                   EHTWFKESRSSKTNPKRDYYIWREKPNNWESFFGGSAWEKDELTGEYYYHSFAKEQADL
FT                   NWANEAVRAEMEQVLAFWLNEGVAGFRLDVINNLTLVLEFPDNPVASGEMEHVYDRNQS
FT                   GLEQALEDIASFCRKERDVFLVGEISSDKLPEIARYSSKKMLDVTFNFNFGSVDQLDAK
FT                   SVFTTLNEMETALNEGQWPTLFFGSHDMSRFRSRLASGDIVKTQLLAFLMLTAKGVPFI
FT                   YYGEEVGMPDLTFSSVKEMRDIQGTAAYYQALQTGTDEKQALEIAIEKTRDKARGPMIF
FT                   PDGKPFTLGEPWIKMATLPEEEARMMWDFYQALLAFRKENDFKEMEYTFLKLDGEVLSY
FT                   QRGEFIFLLHFGEEEITYPLQGNYQLVFGEAMMVENGIRMGAHTGIALRVEE"
FT   regulatory      11825..11830
FT                   /gene="lmo0863"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        11837..12751
FT                   /transl_table=11
FT                   /gene="lmo0863"
FT                   /db_xref="InterPro:IPR015045"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8N3"
FT                   /protein_id="CAC98941.1"
FT                   /translation="MNTIENLLQVYRENSAAFGTRITLNGAGDKDVYNITAPFHWLGQE
FT                   YIAGRVESRDSEFSEVRFFEKTETDKYQLVENTTVLALQDPFVTFVQGELIIGGVEVFP
FT                   KETDPTMLDWRTNLYRATSLTNFKQILAGPIGMKDLRIKELADGRILVLTRPQGEKGGR
FT                   GKIGAIVMDSLTELTIEKIEAAPLLKRNFSGEEWGGGNELHLLEDERIGVLGHIACFDE
FT                   AGNRHYYACSFQLNEDFSQIEQEKIIAERANFAPSEPKRPDLADVVFSGGLIRNPDGTA
FT                   TLYAGIGDSDAQKLAIPDPFKNN"
FT   regulatory      12756..12761
FT                   /gene="lmo0864"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        12773..13840
FT                   /transl_table=11
FT                   /gene="lmo0864"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8N2"
FT                   /protein_id="CAC98942.1"
FT                   /translation="MNIYRYEENPLITPLDVKPIHEGFEVIGAFNAGVAEYNGEVLLLL
FT                   RVAEKPVSENPEVVLAPVYNATSNELELQPFRLDDENYDFEDPRMIRSKAKLEGFSYLT
FT                   SLSYIRIARSKDGHQFTLDEKPFLYPFNEYQTFGIEDARVTQIGDTYHVNFSAVSEFGV
FT                   ADALVTTKDFENLEYQGNIFAPENKDVLIFPEKINGKYYALHRPSLKSIGNLDIWIASS
FT                   PDLRSFGDHRHLLGIRPGEYDSGRVGGGCVPIKTEEGWLILYHGATEENRYVMGAALLD
FT                   LNDPTIVLKRTKTPILEPVADYEKNGFFGDVVFACGAIQEGDTLHMYYGVADTSMAGCD
FT                   MKISEILHQLEVENK"
FT   regulatory      13822..13828
FT                   /gene="lmo0865"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        13837..15510
FT                   /transl_table=11
FT                   /gene="lmo0865"
FT                   /note="similar to phosphomannomutase"
FT                   /db_xref="GOA:Q8Y8N1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8N1"
FT                   /protein_id="CAC98943.1"
FT                   /translation="MTWKHYLSAWQNADLSNEWRRELQRVEEEQERFDGYLTFGTGGMR
FT                   GKMGIGTKRINLFTIRRVAKGLGDYVVANEGAEMGVAIAFDSRHHSGAFAQETAKVLAA
FT                   QGINVYLSDSIRPTPALSFCVREKGAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVA
FT                   QEIAGYLEKITDIFTIPVRELPNPLVTPLGKEMDDAYLNALTAVVSRPDLLADYGNELR
FT                   ICYTPLHGAGKELVMRGLLENGFSETTIIAEQSEPDGDFPTVISPNPEEENSFDLAKKL
FT                   AKEIQADIILATDPDADRLGVAVLNKQATYQILTGNQLGALLLNYILEAKTPVTGADTM
FT                   INTIVTGDLGGKIAYDFGINHIQTLTGFKFIGEKIAEMEGTEKNFLFGYEESYGYLIAP
FT                   FVRDKDAVQAALLTAEMALFYKKEGTTLLGKLTNLFEKFGYHKEYLHTITLDDSDGITK
FT                   MIQVIDALRKEPIFMPEITVVEDFLTSKRTNFVTMEVTNIELPKENVLKFYLMDSSWFA
FT                   IRPSGTEPKCKIYFQTSGETEEIATKAMNELRKRVLAVWD"
FT   regulatory      15517..15557
FT                   /gene="lmo0865"
FT                   /regulatory_class="terminator"
FT   regulatory      15949..15954
FT                   /gene="lmo0866"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        15962..17524
FT                   /transl_table=11
FT                   /gene="lmo0866"
FT                   /note="similar to ATP-dependent RNA helicase"
FT                   /db_xref="GOA:Q8Y8N0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8N0"
FT                   /protein_id="CAC98944.1"
FT                   /translation="MTKFSEFGLDEKIVKSVNRMGFEEATPIQEKTIPLGLEGKDLIGQ
FT                   AQTGTGKTAAFGLPMIHKIDQKSNNVQALIIAPTRELAIQVSEELYKLSYDKHVRVLAV
FT                   YGGSDISRQIRSLKKNPQIVVGTPGRILDHINRRTLKLDHVETLVLDEADEMLNMGFID
FT                   DIETILKEVPAERQTLLFSATMPDPIRRIGERFMHSPELIRIKAKEMTALLIEQFFVKV
FT                   HEKEKFDVLSRLLDVQAPELAIVFGRTKRRVDELSRALDMRGYVAEGIHGDLTQAKRMS
FT                   VLRKFKEGKIDVLVATDVAARGLDISGVTHVYNYDIPQDPESYVHRIGRTGRAGKEGMA
FT                   ITFVQPREMGYLRIVEETTKKRMQPLQAPTWDEAFAGQLRVATEKIQEAITEENLADYK
FT                   TFANELLEKYDATDIAAAMLKMLAKEPDKTPVHITEERPLPSRGGGGYKGKNGKGGKGG
FT                   GYRGGSGKGGSYRDRNNSGKGRRSGGGSGGGSGSGGGGNRDRRGGGEQRSGGNKGNYSQ
FT                   KSK"
FT   regulatory      17554..17606
FT                   /gene="lmo0866"
FT                   /regulatory_class="terminator"
FT   regulatory      17966..17971
FT                   /gene="lmo0867"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17979..18467
FT                   /transl_table=11
FT                   /gene="lmo0867"
FT                   /db_xref="GOA:Q8Y8M9"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8M9"
FT                   /protein_id="CAC98945.1"
FT                   /translation="MKMKILTVNAIIAALYVVLGMIVAPIGFMALQFRIPEIFNHLIVF
FT                   NKKYFWGIIVGVFITNLFFSGLGWIDLVFGVAQSAISLLLMIGISKYVKGIIPRMIINT
FT                   ILFSVTMAIIAWELVIVFDLPFLITWATTAASEFIVMGVGIPLMYLLNKRLNFRKMID"
FT   regulatory      18476..18493
FT                   /gene="lmo0867"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(18499..19056)
FT                   /transl_table=11
FT                   /gene="lmo0868"
FT                   /db_xref="GOA:Q8Y8M8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8M8"
FT                   /protein_id="CAC98946.1"
FT                   /translation="MNNYIKVHQPLNVDLRTQKTQTKLYTVLERFYLEGRTFESISIKD
FT                   LCEQAQISRATFYRHHEEIIQIIEVQILRTMQYFSLEFDQIILTKENIQRLILRSIQKN
FT                   PLLFQAIFWSRAENIFLDVVSGEILRISLLKEISFSDSNFIPNCFARMILSLAAEIQQS
FT                   NKDYTNGQLVELIQEAARFLQK"
FT   regulatory      complement(19063..19068)
FT                   /gene="lmo0868"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      19146..19151
FT                   /gene="lmo0869"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19159..20157
FT                   /transl_table=11
FT                   /gene="lmo0869"
FT                   /db_xref="GOA:Q8Y8M7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8M7"
FT                   /protein_id="CAC98947.1"
FT                   /translation="MKIITIEEHFESEVITNEINKVTGNLVSGQVNPEMFQYMQKELPS
FT                   AAEMQDTEKRLGFMDQHGIDMQVLSYGNSSPQNLDPKISVSLCKRANDELAKVIQQNPT
FT                   RFSGFAVLPVGSPEDAAIELKRAVEELGFKGALVKGQFENKYFDNSFYYPIFEMAEKLD
FT                   VPISFHPSFIPETITEQYFASDAWSDVVTGVFSSAGFGWHMDVGIQVVRMILSGIFDKL
FT                   PNLKIITGHLGEMVPMFLERMDDTLGHWTTLEHKISDYYRTNVYITPSGLLYRNEWKFL
FT                   LNELDENHLIYALDYPFVKPENAGTFLDMLDLTDEVKAKIAHKNAEKLLHL"
FT   regulatory      20159..20164
FT                   /gene="lmo0870"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        20173..20484
FT                   /transl_table=11
FT                   /gene="lmo0870"
FT                   /db_xref="InterPro:IPR018757"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8M6"
FT                   /protein_id="CAC98948.1"
FT                   /translation="MTLSKEQIKATKSEFAENLALADLTIVEVAKELNTSQVKIERIFN
FT                   LKQRSLNDGWILRNYLLRKVTEVGKTPVPFTALSGDYHGYWFLDGEEIDSGILSKGNH"
FT   regulatory      20490..20519
FT                   /gene="lmo0870"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(20517..20870)
FT                   /transl_table=11
FT                   /gene="lmo0871"
FT                   /note="similar to B. subtilis YtcD protein"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92DE4"
FT                   /protein_id="CAC98949.1"
FT                   /translation="MTKVYNIGVEATLEVIGGKWKPVILCHLREGKKRTGELKRLIPNI
FT                   TQKMLTQQLRELEKSGVIIRKVYEQIPPKVEYSLSEYGESLSEILNKLCLWGENHVDLL
FT                   LTKNEDIVLLKRD"
FT   regulatory      complement(20877..20882)
FT                   /gene="lmo0871"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      20985..20990
FT                   /gene="lmo0872"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        20998..22164
FT                   /transl_table=11
FT                   /gene="lmo0872"
FT                   /note="similar to antibiotic resistance protein"
FT                   /db_xref="GOA:Q8Y8M5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8M5"
FT                   /protein_id="CAC98950.1"
FT                   /translation="MDMKKVNPNLTLLALAISAFGIGSTEFISVGLLPLISSSMGVSIS
FT                   TAGLTVSIYALGVMVGAPVLTTVTAKMNRKNLLLLVMLVFLIGNLVSAFAVSFGMLLTG
FT                   RVVAAFAHGVFMSIASVIAADVVHPSKRASAIAVMFTGLTVATVTGVPLGTFIGQLFGW
FT                   RMSFLFIVAIGVIAIIANFFLVPKNLSNGKSISFKSIGQLLVNKKIVMVLLMTAFGYGG
FT                   TFVVYTYLSPMFSGMGYSTSMIVILLIVYGVMVAIGNTIGGHFANERPAKALFIMFSLQ
FT                   GVTLLLLQFTSGNAILGLMTIMLMGFFAFMNVSGLQLYVVQLAERYLPETVSMASALNI
FT                   SAFNIGIALGAFIGGLVAEYIGLSYTPIVGFLMVFIAIILTFYMKKDK"
FT   regulatory      22177..22212
FT                   /gene="lmo0872"
FT                   /regulatory_class="terminator"
FT   regulatory      22355..22360
FT                   /gene="lmo0873"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        22372..24390
FT                   /transl_table=11
FT                   /gene="lmo0873"
FT                   /note="Similar to transcriptional regulator
FT                   (antiterminator)"
FT                   /db_xref="GOA:Q8Y8M4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8M4"
FT                   /protein_id="CAC98951.1"
FT                   /translation="MKLNQQCIQILDFLMEQEDFKNIGYISNALGCSERSVRYSLEKID
FT                   IFLHEQTLPALIRHTRKGVLLPEKNIVNPVVRKFKQQITPKKYRYSQEEVQQFLLLKLL
FT                   LSEEVLPVTYFEEVLFISRSSVLNHLRAIEGELFLNNLDLSHQPRHGFLVTGNLITKTS
FT                   LFARSFLRFINIREFYQFLDSENSLSKKGELFFYNLFELEILQEVNREAHSVEENMTRA
FT                   MDEQLYLTLIAILLKQHEAKVDFQFTADFVAVDELDKALEIIIGSLKQYQYGREDEAVI
FT                   EAFVTGICEKMGEIYQVDFVHGDTDFYTQIKAHIKLMIRRVRAGVIIENPIFNEFMRDN
FT                   REIFMRVKESLEALKPLLPISVSSQEISFLAIYFASEVQRNKQTVEMKPNLLIICPEGV
FT                   AVSKMIAIQLKRMFEFESIQTIGLRKFKRAMMNDFDFVISTVDLPDMQDTKVLRIHSYL
FT                   QKEDMELLQKHLRMKLVKSDKQIINKFSKILAIIGENTQITNLSKLEFDLLEALISDEG
FT                   ETPKRLIPTFEFTEEAIVMEETCPTWRQAIKLGTKRMEQLKVIEPSYHEKIIHNLKVYG
FT                   PYMVIAPGVVIAHAGASDGVLMDGIGVTIIEDGIMFFDRYEEPVHVIFTLALKTKEAHL
FT                   IVEQLMKLALNEEKMQKIKMASSKRDIYHYVKSAIFE"
FT   regulatory      24391..24396
FT                   /gene="lmo0874"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24405..24734
FT                   /transl_table=11
FT                   /gene="lmo0874"
FT                   /note="similar to PTS system enzyme IIA component"
FT                   /db_xref="GOA:Q8Y8M3"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8M3"
FT                   /protein_id="CAC98952.1"
FT                   /translation="MDIEKISFSLISLAGDSFSKLIEALQAAKESDSELVEQLLKEADD
FT                   LMIEAHKVQTEMLIQETRGEQANFSVLLVHAQDTLMNTILASTLIREMIEMHQEIKTLR
FT                   KEEEK"
FT   regulatory      24721..24726
FT                   /gene="lmo0875"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24735..25070
FT                   /transl_table=11
FT                   /gene="lmo0875"
FT                   /note="similar to PTS system, beta-glucoside enzyme IIB
FT                   component"
FT                   /db_xref="GOA:Q8Y8M2"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8M2"
FT                   /protein_id="CAC98953.1"
FT                   /translation="MEINQLHVLLVCNLGASTGVMVTKMKEIAQNSEKLTNTDVKIEAH
FT                   PAGELREHIEDFDVILVGPQIKHQLKHLSEIAAEYNKPIQVIDTKDYGTVNGANILKDA
FT                   IILKLNK"
FT   regulatory      25076..25081
FT                   /gene="lmo0876"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        25090..26415
FT                   /transl_table=11
FT                   /gene="lmo0876"
FT                   /note="similar to PTS system, Lichenan-specific enzyme IIC
FT                   component"
FT                   /db_xref="GOA:Q8Y8M1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8M1"
FT                   /protein_id="CAC98954.1"
FT                   /translation="MSSKNKQSFMNRFIAFMEKYFEPVAARIEKQRHISSIKNGMIALI
FT                   SVLIIGSFSLIISAIGNMFPAGSVVKEFFVQNAAALNLPFQFTFGLLSIYAAITISYSH
FT                   AKQMKVPVLHSVMAAVMVTLILNTKMVDGVLNTEFLDSRGLFIAIFAALISVELIGLFI
FT                   RKNITIRIKGLPAGIATTFEAIIPLVVLLFSAVGLSILMQSVTSGQIIPEAFTTMLAPA
FT                   INSIDTPYAVFLICFLEMLFWFIGLNGYAILIGFVLPFMTQYLGANAAAYAAGEPIPHV
FT                   FAPNFWDYFMGFSGSGITGALVILALFSKSRELKAVGKVSVVPAIFTISEPVVFGLPIC
FT                   FNPYLFIPFVLGTPILAVGQWFVFHFGWVRPPIANVGGTPIPLAQYLATMDWRAIILII
FT                   FVLAAAVCMYYPFFKMYEKSLIKEEEVVSERQAAHDALDLDF"
FT   regulatory      26422..26427
FT                   /gene="lmo0877"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        26436..27164
FT                   /transl_table=11
FT                   /gene="lmo0877"
FT                   /note="similar to B. subtilis NagB protein
FT                   (glucosamine-6-phosphate isomerase)"
FT                   /db_xref="GOA:Q8Y8M0"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8M0"
FT                   /protein_id="CAC98955.1"
FT                   /translation="MKLIINENEQLVAETVSRRIIELVKEKPASLICIAGGDTPLLTIE
FT                   ALIKANQAGEVDFSNTQFVGLDEWVGLGRETKGSCIQTLYDAFFDRLKNVSSEQICFFD
FT                   GKATSLTDECARVDKFIDDRGGMDFILLGIGLNGHIGFNEPFVPVDVNCHVVELDDVTK
FT                   RVMSKYFDTDLPLTHGISLGMQQILAAKEIFLVATGEKKIDIVKQVVEKEPTVAIPATL
FT                   VKDSNTMLVVDKIAASGVEA"
FT   regulatory      27150..27155
FT                   /gene="lmo0878"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        27164..28117
FT                   /transl_table=11
FT                   /gene="lmo0878"
FT                   /note="similar to oxidoreductases"
FT                   /db_xref="GOA:Q8Y8L9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8L9"
FT                   /protein_id="CAC98956.1"
FT                   /translation="MEKIIVNGRKNGQKIEIACSNLVMGAGDFLRADNMDFAGPVLDQY
FT                   FEMGGNIFDTARHYRHSEKAIGAWMNMRGNRDSVIIQTKGGHPVREASDVPRVTPEAIH
FT                   EDISVSLDTLQTDHVELFALHRDNPDVEVGSIMEAMHKEVEAGRVYAIGLSNWELSRII
FT                   EANEYAVNHGLTPLSFNSPNFSLAKVNRPRWENCVSANEEMIRWHEATNLPLFSWSSQA
FT                   GGFFSGRFSEEDTSDTEMVEVYYSEANWERYSRAKQLANQKGCTPIQISLAYVLTQSFP
FT                   TAAVIGPENTTELQSSVAAAGIKLTASEVDWLDLKA"
FT   regulatory      28122..28127
FT                   /gene="lmo0879"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28135..28902
FT                   /transl_table=11
FT                   /gene="lmo0879"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8L8"
FT                   /protein_id="CAC98957.1"
FT                   /translation="MNIKEKLAVQLYSVRKEMERDLEGTLRKIHEIGFHYVQLDGMRGN
FT                   DSREVRCLLQKYELKVIGMHIKHDRFMNDLDGIIEEAYFFDCKTIFDKYIEEEDQTTAG
FT                   YMATKAALINAAEKLHPLGFRIGLHNPEYDFNECIHGRRVMDYITDPVDGICIYAEPDT
FT                   YWIRAAGHDETEYIKRYSGRAPIVHMKDFLSGFELEDMDNNLVEIGQGEVDFRAIIEWG
FT                   EVNGVEYYCIEQDRSKRDMFETLEASYQYLLQL"
FT   regulatory      28912..28930
FT                   /gene="lmo0879"
FT                   /regulatory_class="terminator"
FT   CDS_pept        29020..30408
FT                   /transl_table=11
FT                   /gene="lmo0880"
FT                   /note="similar to wall associated protein precursor (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8Y8L7"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8L7"
FT                   /protein_id="CAC98958.1"
FT                   /translation="MKKRWLVFAIICLIITGFLSPKAEAATDYGSSFFTNVSLQNQNGE
FT                   QATNFKENSKVRVAYDFVITQPVASGETMTLTIPDQLKLINYGGFPLMDSQGNTIANAT
FT                   IDQVTGTITLTFTDYVNTHTDLSGSLFYNATFNSKNIQTDQVNPIAFPVKNTTQTVTPY
FT                   ISKVNSGGGTGSPTIVFKQGRMDDKDLSILHWTVTLNNALTPIDNAVYTDTLGSGQNLL
FT                   GSATIKYRDANKKVIATNIQPIALDADRNFELSIGALNNQSVVITYDTKITTKQKSYTN
FT                   KATLSGDNLDAVSRNATVNDYGSGGQGTGTPPAPPVKEEPPFIPAEKQPIEKTVETDFG
FT                   PLEIVKDSEQNGKIKVIYKVKDGDTLPGVANKFDVSVAEIKDWNNLTSDTLQAGQKLQL
FT                   TIEKTLLSKITVPPVQKVTSTTRVDGVVKATGVLPHTGDSNPFIPFVTGLSLIALGFTF
FT                   GRKS"
FT   regulatory      30415..30455
FT                   /gene="lmo0880"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(30415..30444)
FT                   /gene="lmo0881"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(30452..30928)
FT                   /transl_table=11
FT                   /gene="lmo0881"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8L6"
FT                   /protein_id="CAC98959.1"
FT                   /translation="MKKKGYVLLIIALLSLTLNWLPEIAHAQKETTATTYTTATTSELM
FT                   DMFLPYPIQNPYIETTKNSAELMFVTEEAASITTETNNQTQSIAGSTENHQFTLANLQP
FT                   GNNLVTITATMADGTSESKTITINLPEEPKKDSKSFHDHSKNQQVTHRKKGHLL"
FT   regulatory      complement(30937..30942)
FT                   /gene="lmo0881"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      31050..31055
FT                   /gene="lmo0882"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        31062..31544
FT                   /transl_table=11
FT                   /gene="lmo0882"
FT                   /note="similar to B. subtilis YdbS protein"
FT                   /db_xref="GOA:Q8Y8L5"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8L5"
FT                   /protein_id="CAC98960.1"
FT                   /translation="MELDNLEKKLPEKIKTVWRQTEGIAVLVFLLCSVAAAIILYYTGA
FT                   SVWWSAIGFGLTVLYAAFIYLFIIPFRFARWSYQIKPDEMEIQHGIIFRSRVLIPMIRI
FT                   QHVETEQGPLLRRQKLVSLSITTAAKTHKIEAVNESESDELRHHILELVKVAKEDV"
FT   regulatory      31522..31527
FT                   /gene="lmo0883"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        31537..33012
FT                   /transl_table=11
FT                   /gene="lmo0883"
FT                   /note="similar to B. subtilis YbtB protein"
FT                   /db_xref="GOA:Q8Y8L4"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8L4"
FT                   /protein_id="CAC98961.1"
FT                   /translation="MFEERRLHPIALIKEIITNVRRNIVPIVVGLFSVFRAINSNGYLP
FT                   DWAVYLIIVIVILLILTPAVLKYITYKYTLEDQGIRIKYGLIFRKNTYIPYERIQTVQK
FT                   KQWFFFIPFNVCQILIETAGGNGKAEADLVAVPVGVVDELKDLRDGKKRDIQEAVPETE
FT                   ETTVEVAEAPEKTVMLQTKQLILMAVTSGGVFGTLLIVLAFMQQFREVIPTDWMEAQAE
FT                   ELWKMGIIVLIVLIVLILLVLWGISIVTTLFKYFQFKLMKYPNSLVVEKGLLERNHTTI
FT                   SLSRIQGITIIESPLRQMLGLVAVKVTTAGNSGDEKLTGDILLLPIMKKALAIKTLKEM
FT                   LPDYLFEIEEMECAPKASLRRFLQIYLIWTIIPAAVASILFFPLGLISIILPILAGIKA
FT                   IASYRATGIFTDKHTLLVQSRPIFSKLTHIIRKERIQGLSLRQSIWMEKGGSRHLNVWL
FT                   KSGSTSAEAYVRYINQDLAIKVYNWYSPSKTTN"
FT   regulatory      33143..33148
FT                   /gene="lmo0884"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        33161..34540
FT                   /transl_table=11
FT                   /gene="lmo0884"
FT                   /note="similar to protoporphyrinogen IX and
FT                   coproporphyrinogen III oxidase (HemY)"
FT                   /db_xref="GOA:Q8Y8L3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8L3"
FT                   /protein_id="CAC98962.1"
FT                   /translation="MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETV
FT                   KRDGFLIEKGPDSFLARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVM
FT                   GIPTDKEALLASTLVSEIGKARALQEPTMERNNQERDQALGDFFEARFGKELVKTIIEP
FT                   LLSGIYAGDIYKMSLRATFPQFEQTVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGG
FT                   LDALPKAIAAALPKENLHTAKQATEIVKKNNAYEISFADGDKMEADGVIIAATHDALIH
FT                   LLAETTTEPFAGQPLTTLATVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKW
FT                   PHMVPKNKMLLRGFVGKAGETWLEQASDEAIVSAVLRDYAEIMDLHAAPLFYEVSRMKS
FT                   AMPQYLVNHQDRLKQLKKNIKTDYPGVFFAGMSYEGVGIPDCIAGAQTAAKELVDYLEE
FT                   V"
FT   regulatory      34530..34535
FT                   /gene="lmo0885"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        34542..34898
FT                   /transl_table=11
FT                   /gene="lmo0885"
FT                   /note="similar to holo-acyl-carrier protein synthase"
FT                   /db_xref="GOA:Q8Y8L2"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8L2"
FT                   /protein_id="CAC98963.1"
FT                   /translation="MIKGIGLDMIDLERVKQVVEKNPRFIERVLTEKEIKQFEKYEGNR
FT                   KIEFLAGRFAAKEAYAKANGTGFGKHLSFTDVEILQVEDGRPHVTLPVKSGENVFVSIT
FT                   HTARSAAAQVIIEI"
FT   regulatory      34901..34906
FT                   /gene="dal"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        34917..36023
FT                   /transl_table=11
FT                   /gene="dal"
FT                   /note="similar to alanine racemase"
FT                   /db_xref="GOA:P0DJL8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DJL8"
FT                   /protein_id="CAC98964.1"
FT                   /translation="MVTGWHRPTWIEIDRAAIRENIKNEQNKLPESVDLWAVVKANAYG
FT                   HGIIEVARTAKEAGAKGFCVAILDEALALREAGFQDDFILVLGATRKEDANLAAKNHIS
FT                   LTVFREDWLENLTLEATLRIHLKVDSGMGRLGIRTTEEARRIEATSTNDHQLQLEGIYT
FT                   HFATADQLETSYFEQQLAKFQTILTSLKNRPTYVHTANSAASLLQPQIGFDAIRFGISM
FT                   YGLTPSTEIKTSLPFELKPALALYTEMVHVKELAPGDSVSYGATYTATEREWVATLPIG
FT                   YADGLIRHYSGFHVLVGGELAPIIGRVCMDQTIIKLPREFQTGSKVTIIGKDHGNTITA
FT                   DDAAQYLDTINYEVTCLLNERIPRKYIH"
FT   regulatory      36216..36220
FT                   /gene="lmo0887"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        36229..36507
FT                   /transl_table=11
FT                   /gene="lmo0887"
FT                   /note="similar to B. subtilis YdcD protein"
FT                   /db_xref="GOA:Q8Y8L1"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8L1"
FT                   /protein_id="CAC98965.1"
FT                   /translation="MLEKENRMIISVELTQEMIQELDVVVEKEKMGRSEVIMEATQQFL
FT                   QEKRARELRDEMERGYAEMATINFAIACECTHVEAEAEDRNISILGG"
FT   regulatory      36498..36503
FT                   /gene="lmo0888"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        36511..36858
FT                   /transl_table=11
FT                   /gene="lmo0888"
FT                   /note="similar to B. subtilis YdcE protein"
FT                   /db_xref="GOA:Q8Y8L0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8L0"
FT                   /protein_id="CAC98966.1"
FT                   /translation="MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVA
FT                   AITAKIQKAKLPTHVEATRKDGFEKDSVILLEQIRTIDKQRLTDKITHLDEDLMAKVNK
FT                   ALEVSLGVVEF"
FT   regulatory      37093..37098
FT                   /gene="RsbR"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        37110..37946
FT                   /transl_table=11
FT                   /gene="RsbR"
FT                   /note="highly similar to positive regulator of sigma-B
FT                   activity"
FT                   /db_xref="GOA:Q8Y8K9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8K9"
FT                   /protein_id="CAC98967.1"
FT                   /translation="MYKDFANFIRTNKADLLNDWMNEMEKQSDQLINDIAKEAMYEETS
FT                   KEFVDLIVSNVTENGSKFNEKLDDFAEKVVHLGWPIHFVTTGLRVFGLLVYTAMRDEDL
FT                   FLKREEKPEDDAYYRFETWLSSMYNKVVTAYADTWEKTVSIQKSALQELSAPLLPIFEK
FT                   ISVMPLIGTIDTERAKLIIENLLIGVVKNRSEVVLIDITGVPVVDTMVAHHIIQASEAV
FT                   RLVGCQAMLVGIRPEIAQTIVNLGIELDQIITTNTMKKGMERALALTNREIVEKEG"
FT   regulatory      37937..37942
FT                   /gene="rsbS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        37952..38308
FT                   /transl_table=11
FT                   /gene="rsbS"
FT                   /note="highly similar to negative regulation of sigma-B
FT                   activity"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q92DC5"
FT                   /protein_id="CAC98968.1"
FT                   /translation="MGIPILKLGECLLISIQSELDDHTAVEFQEDLLAKIHETSARGVV
FT                   IDITSIDFIDSFIAKILGDVVSMSKLMGAKVVVTGIQPAVAITLIELGITFSGVLSAMD
FT                   LESGLEKLKQELGE"
FT   regulatory      38299..38303
FT                   /gene="rsbT"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        38311..38721
FT                   /transl_table=11
FT                   /gene="rsbT"
FT                   /note="highly similar to positive regulation of sigma-B
FT                   activity"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8K8"
FT                   /protein_id="CAC98969.1"
FT                   /translation="MTFQSCVKIINEWDIVAARQLGRKISKEIGFGTVDQARITTAISE
FT                   LARNIFLYAGRGEICIEKVSESGKQGMIIVAKDKGPGIVDIRKVMQDGYTTSGGLGAGL
FT                   PGVKRLMDSFDIESSIEGDSKGTVITTTKWVR"
FT   regulatory      38721..38726
FT                   /gene="rsbU"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        38738..39742
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /note="highly similar to serine phosphatase RsbU"
FT                   /db_xref="GOA:Q8Y8K7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8K7"
FT                   /protein_id="CAC98970.1"
FT                   /translation="MEKAFEGKYRDILIQYLEHQDEEILYTCEKLSREAMEERVSPEEI
FT                   VHLHRSVLELYGKELPDFVRLSFDVLLEIMVGYGLAYMEHLSLRTEQKELRSEIAQAED
FT                   MQKTLMKTEVPEHDELDFGVISVAARQMSGDYYSFTEEGDKQIGIALADVIGKGIPAAF
FT                   SISMIKYALAGMTGDDRKPSIVLESLNQVAEENINDNMFITMFYGLYHEDTHLFEYGSA
FT                   GHELGLYYQHKENSFSDLYAKGLPLGVDKNAIYRQFDKKIEVGDAVFIMSDGVTETRTA
FT                   NGFIEREELTEIIAAHISLSAEKMVHAIYDQLVKMQNFELHDDFTLICIKRTK"
FT   regulatory      39881..39886
FT                   /gene="rsbV"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        39892..40236
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /product="anti-anti-sigma factor (antagonist of RsbW)"
FT                   /db_xref="GOA:P0A4J8"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4J8"
FT                   /protein_id="CAC98971.1"
FT                   /translation="MNISIEIKERDTDHIDIFVAGEIDAYTAPKVKEALEVYQVKEGIV
FT                   LRIDLTEVSYMDSTGLGVFVGAFKSLRQRQSELVLFGLSDRLFRLFEITGLSDIIEIKN
FT                   VEGEMNGNNA"
FT   regulatory      40206..40211
FT                   /gene="rsbW"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        40220..40693
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /product="sigma-B activity negative regulator RsbW"
FT                   /db_xref="GOA:Q8Y8K6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8K6"
FT                   /protein_id="CAC98972.1"
FT                   /translation="MATMHDKITLQLPAKPEYVSLGRLSLSGIASRAGFSYEAIEDLKI
FT                   AVSEAITNSVKHAFKGEEDGEITVEYLIYEDKLEVRVSDNGTSFDLETRKQEIGPYDVG
FT                   EDAEMMRIGGLGLFLIETLMDDVKLYYDEGVSVVMTKYINEKQVEENAKSIST"
FT   regulatory      40656..40661
FT                   /gene="sigB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        40671..41450
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /product="RNA polymerase sigma-37 factor (sigma-B)"
FT                   /db_xref="GOA:Q7AP79"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP79"
FT                   /protein_id="CAC98973.1"
FT                   /translation="MPKVSQPDKEAKEKVYIWIAAYQENGDQDAQYNLVVHYKNLVESI
FT                   ARKYSQGKSFHEDLVQVGNIGLLGAIRRYDATFGKSFEAFAVPTIVGEIKRFLRDKTWS
FT                   VHVPRRIKELGPKIKNAVEELTRELQSSPQISDIADFIGVTEEEVLEAMEMGKSYQALS
FT                   VDHSIEADSDGSTITLLDVVGGTDDGFERVNQRMLLEKVLPVLDEREQKILQYTFIENR
FT                   SQKETGELLDISQMHVSRIQRQAIKKLREALQNEEVE"
FT   regulatory      41437..41442
FT                   /gene="rsbX"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41451..42050
FT                   /transl_table=11
FT                   /gene="rsbX"
FT                   /product="Indirect negative regulation of sigma B dependant
FT                   gene expression (serine phosphatase)"
FT                   /db_xref="GOA:Q8Y8K5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8K5"
FT                   /protein_id="CAC98974.1"
FT                   /translation="MNKAVESNNLFVFQRSKALQQYCGDVYYTHEDENGFLYVLSDGLG
FT                   SGLEANRAAKATVDAIKEDIHADITDMLEKANQAVSGLRGAAIAIIKGDYLTKTLYYTG
FT                   MGNIRFYMIGIEDKLIFPLSGSGFLSGRKQKYRLQSFKYKPDSKFLMHSDGLVLSRVRK
FT                   SLESPLCVVKTGHLIERNILDIPTDDVTFMVGKFPE"
FT   regulatory      42057..42099
FT                   /gene="rsbX"
FT                   /regulatory_class="terminator"
FT   regulatory      42245..42250
FT                   /gene="lmo0897"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        42257..43882
FT                   /transl_table=11
FT                   /gene="lmo0897"
FT                   /note="similar to transport proteins"
FT                   /db_xref="GOA:Q8Y8K4"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8K4"
FT                   /protein_id="CAC98975.1"
FT                   /translation="MKKVLLNSVKGYTWARFRKDLLAGIIVGIIALPLAMSFAIASGVS
FT                   PEYGIYSSFVAGIIVSIFGGSKFQIAGPTGAFIPVLLGIVLTYGYQDLLVAGMMAGVLL
FT                   CLMGIFKIGTLIKFIPRPVTIGFTAGIAVTIFMGQVGNFLGLTGMEKHESFVANMKEIW
FT                   LHLDSWNFYSVLISCICMLVLFIFPKILPRIPAPLIGLVVTTAIAMLFFPDALPTIGSA
FT                   YGNIPSTFPPFEFPDMTFANMSKLIGPAFVIAMLGGIESLLSAVVADGMTNTKHNSNRE
FT                   LIGQGIANIVTPMFGGIPATGAIARTATNINNGATSRVSGVIHGVFVLLTLLVLAPVAV
FT                   NIPIAAMAPILMLVAWNMSERKTFQHIIKLKSGDTLVLVITFLLTVFASLTVAVEVGLL
FT                   LAVVLFAKQMGSSMQIEEIEPEGAEIAPHLHEKISIFTIRGPLFFGAAQIFQQNIIKAI
FT                   HVKPKYLILRMGKVPIIDATAEGYFHQIEKEFSKQGGQILITGLTDKAKESLKGSGLYD
FT                   RIGEEHFFSHTEDAIHYAENALNK"
FT   regulatory      43944..43949
FT                   /gene="lmo0898"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        43959..46136
FT                   /transl_table=11
FT                   /gene="lmo0898"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8Y8K3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8K3"
FT                   /protein_id="CAC98976.1"
FT                   /translation="MEQMQDKIMKLVQKSLTYKPAQINAVIKLMEEGNTVPFIARYRKE
FT                   MTGSLDEVEIRDIEETFEYVTKLENRKEEIIRLIDEQGKLTDELRAAIVKAEKHQALED
FT                   LYRPYKQKKRTKATIAKEKGLEPLAEWLMSFPSNADPLTEAANYISEEKEVESAEAALL
FT                   GAHEIIAEQISDEPSFREWIRNFTRKFGMIESRAKNAEADEKGVYEMYYEFNEMIGKVA
FT                   SHRILAFNRGEKEDILRVQVQVDTTKIFQYLFEKVIQNRNSATRPYVEEAILDAYKRFI
FT                   GPAIEREIRGELTDKGEEQAIHIFSENLRKLLLQPPLKGKIILGVDPAFRTGCKFSVLD
FT                   QTGKVLEIGVVYPHTAKARRPEAKQKIAEILSTYQVEVIAIGNGTASRETEQFIVEVIR
FT                   ESNSNAYYCIVNEAGASVYSASETAREEFPDYQVEERSAVSIGRRLQDPLAELVKIDPK
FT                   SVGVGQYQHDVAQKRLNETLTFVVETAVNQVGVNVNTASASLLQYVAGLNKTVANNIRK
FT                   YREENGSFASRKELKKVPRLGAKSYEQSIGFLRILEGENPLDKTAIHPESYKAAEQIVK
FT                   AAGFGLKDIGSEDLKAALQALSIPEEAEKLTIGKETMRDIIDNLIAPGRDLRDELPAPL
FT                   LKQDVISMEDLKQGMELQGTVRNVVDFGAFVDIGVKQDGLVHISKLSNSFVKNPMDVVS
FT                   VGDVVTVWVDEVDTKKNRIALTMLNPNGSVK"
FT   regulatory      46121..46126
FT                   /gene="lmo0899"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        46136..46603
FT                   /transl_table=11
FT                   /gene="lmo0899"
FT                   /note="similar to B. subtilis YdcK protein"
FT                   /db_xref="GOA:Q8Y8K2"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8K2"
FT                   /protein_id="CAC98977.1"
FT                   /translation="MNQAELQRHMEEVSLQFFQKEFRHQAVFNARLRTTGGRYLLKSHN
FT                   IEMNPKYLENFGLAYFIGIMKHELCHYHLHLEKKGYQHRDQDFRELLKKVDAPRFCATI
FT                   PREITMHEYTCKSCGKSFLRQRRFNVNRYRCGSCGGKLIQTDSKKIYTENP"
FT   regulatory      46152..46194
FT                   /gene="lmo0898"
FT                   /regulatory_class="terminator"
FT   tRNA            46656..46728
FT                   /product="transfert RNA-Asn"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 85.46"
FT   tRNA            46732..46819
FT                   /product="transfert RNA-Ser"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 53.95"
FT   regulatory      47191..47196
FT                   /gene="lmo0900"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        47202..47594
FT                   /transl_table=11
FT                   /gene="lmo0900"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8K1"
FT                   /protein_id="CAC98978.1"
FT                   /translation="MDNKLEFTTIDEYITQAPPETKEVLQKIRETIKAAAPEATEKISY
FT                   QMPTFYLEGNLVHFAVAKNHYGFYPASSGIAAFESKLGNYKHSKGAVQFPIKEEVPYEL
FT                   IKEMTLFRLAENKQKAAEKLAKKKKK"
FT   regulatory      47601..47636
FT                   /gene="lmo0900"
FT                   /regulatory_class="terminator"
FT   regulatory      47727..47731
FT                   /gene="lmo0901"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        47739..49025
FT                   /transl_table=11
FT                   /gene="lmo0901"
FT                   /note="similar to PTS system, cellobiose-specific IIC
FT                   component"
FT                   /db_xref="GOA:Q8Y8K0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8K0"
FT                   /protein_id="CAC98979.1"
FT                   /translation="MNKFMELLGEKLMPLAAKLGENRYLTTLRDAFMLAFPLTMFGSIA
FT                   VVLMNLPFWSDETKAVLQLYLGNAQSATMSIMTVFVVFGIGYSLSKYYKVEAIYGGAVA
FT                   LASFLILTPFFFNSPDGELITGALSLDRLGAKGMFIGMITGFIAAELYRFFVQRDWTIK
FT                   MPAGVPPAVAKSFAALIPAILTLSIFLAINVMVQFFFHTNLHDVVYTVIQKPLVGLGSG
FT                   IVPTLIALFFVQVLWFFGLHGQIIVNSVMDPIWNTLMLENLDAYKAGLPLPHIITKPFM
FT                   EVFTVGMGGSGMTLAVVIALAFLMKSKQSKEIGRLALGPGIFNVNEPVLFGMPIVLNAT
FT                   ILIPWIIAPLIVTTLNYFVMAAGIVPAPTGVAVPWTVPIVINGILATNSWLGGALQVVD
FT                   FFIVLIIWYPFLKLVDRTNIARESEAAIK"
FT   regulatory      49090..49095
FT                   /gene="lmo0902"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        49106..49819
FT                   /transl_table=11
FT                   /gene="lmo0902"
FT                   /note="similar to transcription regulator (GntR family)"
FT                   /db_xref="GOA:Q8Y8J9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8J9"
FT                   /protein_id="CAC98980.1"
FT                   /translation="MVKYELIAADIREKINNGTYPPESILPDQVSLCKAYDCSRMTIKK
FT                   AFDVLALEGLVYRQRGAGTFVMKNALANKQDASLRDYDGLTKMMGDNRISSKIIAFDIA
FT                   FPDEKTQEQLLIKADQPVYKLIRLRLLDGAPYVLEHTTMPADLVPGLTREILHHSIYAY
FT                   LQDSLGLVLSGAFRKINADKPSEYDQEYLACGEHDPVLEVEQVVYLKDGRPVEYSRSRH
FT                   RYDTRSFIMVDHREK"
FT   tRNA            50017..50088
FT                   /product="transfert RNA-Glu"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 70.15"
FT   tRNA            50116..50188
FT                   /product="transfert RNA-Asp"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 65.02"
FT   regulatory      50302..50307
FT                   /gene="lmo0903"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50316..50696
FT                   /transl_table=11
FT                   /gene="lmo0903"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8J8"
FT                   /protein_id="CAC98981.1"
FT                   /translation="MDLVKNGKVLELVHPNGNWTLIKEEGFSPVQITVAAVAACSGYVY
FT                   QTLLEKKRIDINDLSIHTDYEQDQESAVHVLTKINVTFTVDLVDKSNQAKAEKTVHLVK
FT                   DACPVAKSLDPSIEINEIVVFK"
FT   regulatory      50710..50727
FT                   /gene="lmo0903"
FT                   /regulatory_class="terminator"
FT   regulatory      50795..50800
FT                   /gene="lmo0904"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50810..51484
FT                   /transl_table=11
FT                   /gene="lmo0904"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8J7"
FT                   /protein_id="CAC98982.1"
FT                   /translation="MAEKTIVEKLQLAKYKEAVILNQPDGADYFQNLANYEEKLADKQY
FT                   DLIFDFVETLEELITFVQKVIAENKLSVDGYLFFAYPKKGNKKFATYVHRDELMPALKT
FT                   DEEGYVDGSTLKFTRMVALDETYTVVGLKEATKLKAKGVKKNNPSADEYADHVPLVAEF
FT                   LADKGDLQVFYNNLATGYQRVWARYIYSAKQPATQEKRRLEMVDILSQGYKTKDLYRQG
FT                   KK"
FT   regulatory      51482..51516
FT                   /gene="lmo0904"
FT                   /regulatory_class="terminator"
FT   regulatory      51600..51605
FT                   /gene="lmo0905"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        51615..52112
FT                   /transl_table=11
FT                   /gene="lmo0905"
FT                   /db_xref="GOA:Q8Y8J6"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8J6"
FT                   /protein_id="CAC98983.1"
FT                   /translation="MANYINKERRQIDFDPFDLRIIAVPEVVAVQFKPRSEHTLLIRIA
FT                   DVGATYQPLKHESLFEAILPVHFNDINEEDDYWGLSDKEQAEMKLFNEVHRDLIYNFVD
FT                   EHPDFTQIVVHCHAGVSRSSAVAMAIAEHLGDTDTYEKLQVIKRYLPNPRVLAIMRGEA
FT                   YL"
FT   regulatory      52134..52139
FT                   /gene="lmo0906"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52148..53497
FT                   /transl_table=11
FT                   /gene="lmo0906"
FT                   /note="similar to glutathione Reductase"
FT                   /db_xref="GOA:Q8Y8J5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8J5"
FT                   /protein_id="CAC98984.1"
FT                   /translation="MEKHYDYIAIGGGSGGIASINRAAMHGAKCALIEPKFLGGTCVNV
FT                   GCVPKKVMWYGAQIKEAMDLYADAYGYQVDASFNFQKLVENREAYIERIRGSYKNGLDN
FT                   NNVDWIKGYAEFVDEKTLRVNGELVTADHILIATGGEPALPSIPGAEFGITSDGFFALK
FT                   ELPKKVAVVGAGYIAVELAGVLQQLGSETHLFVRKHAPLRNFDPLLTDTLTEIIEQSDM
FT                   TLHKHAIPQKVEKNPDGSLTLSLEDGRTETVDTLIWAIGRKPVIKGLQIEKSGVELLES
FT                   GHIAVDKFQNTNVAGIYAVGDVTGHYELTPVAIAAGRRLSERLFNNKKDAHLNYENIPT
FT                   VVFSHPAIGTVGLTEPEAIEKYGKENIKVYTSSFTSMYTAITDHREPCRMKLICEGKTE
FT                   RVIGLHGIGYGVDEMIQGFAVAINMGATKADFDNTVAIHPTGSEEFVTMK"
FT   regulatory      53511..53516
FT                   /gene="lmo0907"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        53526..54200
FT                   /transl_table=11
FT                   /gene="lmo0907"
FT                   /note="similar to phosphoglycerate mutase"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8J4"
FT                   /protein_id="CAC98985.1"
FT                   /translation="MGKKLSLYFVRHGQTYLNKNLRMQGWADTPLTPEGIEIVKESGRG
FT                   LAETEFVAAYSSDLHRTIATAGHLLKENKHAFGLTLEPLSEFRETFFGSYEGEKGDVAW
FT                   NEIAHHMGYANQEELFQKADVRETMNGTKAADPTGDAEDFMTFWTRVEQGFLHVINRHR
FT                   ETGGNVLIVAHGNTIRNIVHELEPSMDEAVILDNASVTVLAYENGLFKLERLNDTSHFK
FT                   KA"
FT   regulatory      54207..54237
FT                   /gene="lmo0907"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(54207..54237)
FT                   /gene="lmo0908"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(54243..55379)
FT                   /transl_table=11
FT                   /gene="lmo0908"
FT                   /note="similar to membrane proteins"
FT                   /db_xref="GOA:Q8Y8J3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8J3"
FT                   /protein_id="CAC98986.1"
FT                   /translation="MKFSRFRDSKLFFWTIEILAVVAILFVLLQMKYIFSPIGIIVSTL
FT                   FMPILVAGFLFYLFNPLVLFLEKRKVPRLLSVIVIFIAFITLVVLAVMQLGPTLADQVA
FT                   ELAKAIPGYWQDFEKWLQGLSNNSALKDIDMKQELEKLNISLPKIMSVVVDGVASSFGA
FT                   IVSFVSSFVMILVTVPFIVFYMFKDGHKFVESSGKFFPAGIRSEAKQIIKEMNKTISTY
FT                   ISSQAIDCMFVGLFTFIGYLIIGQPYALLFGFIAGATNIIPYLGPFIGAAPAVIVALFT
FT                   SPVQALLVIVVVTIVQQIDSNLLSPYIMGKSLSIHPLTIIIILIVAGNLAGIFGMILGV
FT                   PLYAVVKTIIVNVNRLIKLRRGQLAIDNNLPNPDTPKK"
FT   regulatory      complement(55387..55392)
FT                   /gene="lmo0908"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      55507..55512
FT                   /gene="lmo0909"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        55520..55912
FT                   /transl_table=11
FT                   /gene="lmo0909"
FT                   /note="similar to transcription regulator, GntR family"
FT                   /db_xref="GOA:Q8Y8J2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8J2"
FT                   /protein_id="CAC98987.1"
FT                   /translation="MLLAIDLQSDEPIYTQICNQIIEGMAKRELLPGDKLPSVRSLGAD
FT                   IGINFHTVNKAYQILKQEGFIQIHRQKGVVIHPDGVAKADELFFTKLQTKLKPLIAESV
FT                   VRGVTEEKWLEVSKAIFDEMHGRRVE"
FT   regulatory      55905..55910
FT                   /gene="lmo0910"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        55915..57018
FT                   /transl_table=11
FT                   /gene="lmo0910"
FT                   /db_xref="GOA:Q8Y8J1"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR014574"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8J1"
FT                   /protein_id="CAC98988.1"
FT                   /translation="MEIIIYIFVSIAIISLQAITPFVIRKSECFGVNVGERANRNAELT
FT                   QLKKQYVGQVILWTSFVAIIGIALIQGFHSSENTQAGIFIASMFSQLIVSFIIYYRFHH
FT                   TTLQWKRDKIEAGEISTNSIIMVDTSFHRRKMVISYTWFIVPLLIFIITLAITVVFYST
FT                   APVDFPIHFDMSGTVTDTVAKSPRVVLLLPMMQLGMIALFIFINFVIARSKQTVENENP
FT                   TDSLKRNMLFRQISSKAMLIMCTIMVIDFLIMQVVTLLALPAEWMMVTMIISVVLILFG
FT                   TVLLAVKVGQGGSRLKFADQPDGVNKPIRDDDSFWKAGVIYFNRNDPALFVEKRFGIGW
FT                   TINTARPVAWLSFVIIIAVIILISILF"
FT   regulatory      57087..57092
FT                   /gene="lmo0911"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        57101..57604
FT                   /transl_table=11
FT                   /gene="lmo0911"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8J0"
FT                   /protein_id="CAC98989.1"
FT                   /translation="MAIRLKRLEEWEGFTGIALVREGLKAEALHTEIKTAFKEILQLAR
FT                   ELDDFSKQKIFYGISVHNIEDGITHYSAIPVEQKYSNLKEPLEWIEVPAHTYFVAEHIQ
FT                   DTDIGESYEEIARAIQEKNYKPYITANNPVFDPLPFKLEVYTKQGSDETNIEIRIPVVK
FT                   ELHT"
FT   regulatory      57611..57632
FT                   /gene="lmo0911"
FT                   /regulatory_class="terminator"
FT   regulatory      57704..57709
FT                   /gene="lmo0912"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        57718..58530
FT                   /transl_table=11
FT                   /gene="lmo0912"
FT                   /note="similar to transporters (formate)"
FT                   /db_xref="GOA:Q92DA4"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:Q92DA4"
FT                   /protein_id="CAC98990.1"
FT                   /translation="MGYYSPQEVTEITIEKGTQKANSSTLTLVLLGFLGGAFISLGYLL
FT                   YIRAVGTMPHEWGSFATLIGASLFPVGLVCILLGGGELITGNMMAVAIAWYDKKISFQQ
FT                   LLRNWAIVSVMNLVGAFFVAYFFGHFVGLTEGDFLPKTLATAGAKINDPFWVAFVSGIG
FT                   CNWFVGIAVWLCYAAKDFAGKILGIWFPVMAFVAIGFQHVVANMFIIPAAIFAGYYSWA
FT                   DFIWNVIPVYLGNVVGGAVFVSLFYFLAYKKNAPKKVKEEIHQPIEEN"
FT   regulatory      58540..58575
FT                   /gene="lmo0912"
FT                   /regulatory_class="terminator"
FT   regulatory      58741..58746
FT                   /gene="lmo0913"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        58754..60220
FT                   /transl_table=11
FT                   /gene="lmo0913"
FT                   /note="similar to succinate semialdehyde dehydrogenase"
FT                   /db_xref="GOA:Q8Y8I9"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8I9"
FT                   /protein_id="CAC98991.1"
FT                   /translation="MSIKETALPKVQTKLFINGKWTDGDNKETKDIVNPANGDVIAKIA
FT                   QAGPSETKKAIKAAKDAFPDWAKMELADRVKLLHKIADLMEEKADTLAKIMTLEQGKPL
FT                   KESKGEVLTGVENFRFAAEEARRLYGETIPAPNNHAFIVKKQPIGVVAAITPWNFPGGM
FT                   VTRKLAPALATGNTIVLKPSGDTPLSALAIFEIFEEAGLPKGVANIVMGSSKEIGETLT
FT                   DSDDVRKLTFTGSTKVGQTLFKQSADTLKKISLELGGHAPFIVFDDANLDAAVNDLVAA
FT                   KFRNNGQVCVSPNRIFVAKEIKEKFTKALVAKVEQLKVGNGLDDVNVGPLIREDAIDKI
FT                   DKQLKNATEKGAKVLTGGGRLTGSDYDKGNFYKPTVLDNVTRKMDIFYEETFGPVIPLI
FT                   TFETEDEAIEMANDSEFGLASYFYTKDLARVEKVGAALEYGMVGANEIAISNPETPFGG
FT                   VKHSGFGRENGHYGMEEYIQVKFINLKYRD"
FT   regulatory      60239..60261
FT                   /gene="lmo0913"
FT                   /regulatory_class="terminator"
FT   regulatory      60350..60355
FT                   /gene="lmo0914"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        60363..60668
FT                   /transl_table=11
FT                   /gene="lmo0914"
FT                   /note="similar to PTS system, IIB component"
FT                   /db_xref="GOA:Q8Y8I8"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8I8"
FT                   /protein_id="CAC98992.1"
FT                   /translation="MKNILLICGSGASSGFMAAAIRKAAKKRGEQVTVKAASESQIDER
FT                   INEIDYLLIGPHLAYMLDDLKQKVADKDVLVSIIPQATYGTLNGEKALDLILNMEG"
FT   regulatory      60658..60663
FT                   /gene="lmo0915"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        60673..61941
FT                   /transl_table=11
FT                   /gene="lmo0915"
FT                   /note="similar to phosphotransferase system enzyme IIC"
FT                   /db_xref="GOA:Q8Y8I7"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8I7"
FT                   /protein_id="CAC98993.1"
FT                   /translation="MNNKVMDFMTNKFAPKVNKVVKNPWVSAIQDAIMSALPLVFVGSL
FT                   VTIVSLLKNLFPGMPDFSMISNFSFGMFGLVVAFLIPYYLMEKKGNSSQKLISGATGLV
FT                   LFLMLLFPTISADGDAVFILSRFGATGMFLSITTGLFVGCVMNFAAKRSFFSEDTPIPD
FT                   FVVGWFNSLLPITFILIVGWLITVQFNIDFFEVIVAVFSPLASIVQSYPGFVLSVFIPA
FT                   FLYTFGISGWVMMPAIYPVYMAGLAENSQAVANGASASNIATQETVYALISIGGVGTTL
FT                   SLSIMMLILSKSLQLKAIGKAVIVPSIFNINEPLFFGAPIAFNPYLMIPTWINAFLVPS
FT                   IAYFVMSMNLVSIPAQSFLLWYMPYPVTSYLATQDFRGVIACLAIIVITWLVYLPFFKA
FT                   YDNSLLKQEKLDAVETEKEMVTN"
FT   regulatory      61943..61948
FT                   /gene="lmo0916"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        61956..62306
FT                   /transl_table=11
FT                   /gene="lmo0916"
FT                   /note="similar to phosphotransferase system enzyme IIA"
FT                   /db_xref="GOA:Q8Y8I6"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8I6"
FT                   /protein_id="CAC98994.1"
FT                   /translation="MSEQDYVEETDSLNELSMNILIHAGNARNDLVKGLNHLEELEFNE
FT                   AEEFIASAKREIVIAHSLQTDTLQLEASGNQIRYSTLFCHAQDTLMTAKSEILIGEHML
FT                   RLFKKMTELTKK"
FT   regulatory      62305..62310
FT                   /gene="lmo0917"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        62318..63769
FT                   /transl_table=11
FT                   /gene="lmo0917"
FT                   /note="similar to beta-glucosidase"
FT                   /db_xref="GOA:Q8Y8I5"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8I5"
FT                   /protein_id="CAC98995.1"
FT                   /translation="MFENYQFPKDFLWGGAIAANQAEGAFKVDGKGISLADLHKYHKGK
FT                   TNDEISEEQHKGVSLADIKASIEDKINYYPKRHGIDFYHTYPEDLELLAEMGFKTFRTS
FT                   LDWTRIFPTGEETEPNEAGLKYYDQLIDKIIELGMEPIITILHYETPVEIVLNHGGWHN
FT                   RKVIDLFEKYGKTVLDRYNKKVKYWIVINQINLIQFEPFNSTAIPYDAVDDYLSATYQA
FT                   VHNQFVASAKIYEYGKALNPDLMIGTMLADCTAYPFSCDPDDIVLAMKRNRMEYFFADV
FT                   QFQGEYPQYALNYFEENNIHIEITEEDKAILQKNTMDYLALSYYYSQMVDSKRNDLDPA
FT                   SITPNPHLKANPWGWAVDPKGLYNALSQYWDRYHKPIIIAENGFGMYDKLENGEIHDDY
FT                   RIDYLSAHLKEMKRAMYGGVEIIAYCAWGPIDIVSCSSAQMEKRYGFIYVDLDNEGNGT
FT                   GKRIKKDSFSWYKKVIESNGEDLEA"
FT   regulatory      63827..63832
FT                   /gene="lmo0918"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        63842..65740
FT                   /transl_table=11
FT                   /gene="lmo0918"
FT                   /note="similar to transcription antiterminator BglG family"
FT                   /db_xref="GOA:Q8Y8I4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8I4"
FT                   /protein_id="CAC98996.1"
FT                   /translation="MDTQKEILAYLHKQENKWVTSNELAAFCECTTRTIRNNIYKINEV
FT                   TPNLINSTKQGYQINLNIPFEFQSESDVTERKSKLLLELIKNSTKGVDLFELADILYIS
FT                   EVTLKKDIQQLKNELKEADVKIVISKDRIKLIGKERAKRKYMISLLYEEGGYRESIKSR
FT                   IQEMIEFVSIDKLQNIVKEVLAQESITTNQYSMMNIVLHYAISIVRIQQGNTLIETQKT
FT                   LIRKHSKEYEISKKIAKILSEEYQIHFSEAETKQLGLLYVGLQNEQSANANHGELDQFV
FT                   DKKIIDALKIVLANVEETYLIDLQNEQLFIKLAIHVQSLYYRSRYKAYTRNLSLLDIKT
FT                   SYPVTFDIAVYISSLLQEKLAIDFNEDEISFIALHIGSFLESENRDYIRLEIGLLVDDY
FT                   HDLRTNMLKKLRARFDNEATIELIENEDYEENFDIILTTNRDVALEKAGSIFIHPLLTT
FT                   KDIKKITSRIQTKKKILENNIRGQQIDRYIVRSLYSNQIDPSELTPAKIREQMISKMEK
FT                   QTFVTPEFKEKVEKREQMAPTSFPSGIAIPHSIKNDALQSGVSIMTLQEPIYWNDVKVK
FT                   IITLVAISKKDATEFNDFFEKFVEIVSEPINTKRLSMVESFEEFIRKLKMMMEESE"
FT   regulatory      65753..65782
FT                   /gene="lmo0918"
FT                   /regulatory_class="terminator"
FT   regulatory      66016..66021
FT                   /gene="lmo0919"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        66031..67602
FT                   /transl_table=11
FT                   /gene="lmo0919"
FT                   /note="similar to ABC transporter ATP-binding protein
FT                   (antibiotic resistance)"
FT                   /db_xref="GOA:Q8Y8I3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8I3"
FT                   /protein_id="CAC98997.1"
FT                   /translation="MSTIEINQLKIEVADRVLVEIPHLLVSKKARIGIIGQNGLGKTTL
FT                   MEVIAGAKEATSGTVTTQGKLAYIKQLSTDTSTKSGGEKTRKATQHAMRQNPSVLLADE
FT                   PTSNLDVESVKHLERQWSDFHGALIIISHDRAFLDALCTEIWEIKNQKIHVYKGNYHAY
FT                   LEQKQQQENQAELAYKEFKNKKKQLQASQTHHEIEAGRIVKPGKRLNNKEASAFKAGKG
FT                   TQQKKQHSTIKALEKRIERLGNVEKPHTTKPIKIITPDNRVIKKGNTILSAKETAYEIA
FT                   GRKLFETKAFSIKAGDKVALIGENASGKTTFLKEIIQENPNLLCNPQAKIAYFDQELNG
FT                   LNQTKSLLENISEISVQTKQVNREVLGSMHFKESDLHKEVRMLSGGERVKLLLSMLLLS
FT                   DANFLILDEPTNYLDIYAMEALETLIKQFAGTVLFVSHDRTFVNHVAEQLLVIENNEMN
FT                   FHRMTFAEYEESKAPSRITEEDKLILEMRMSEIAAKLMQPNLKPTEKAILEQDYQEIIT
FT                   KRQQFS"
FT   regulatory      67581..67616
FT                   /gene="lmo0919"
FT                   /regulatory_class="terminator"
FT   regulatory      67712..67717
FT                   /gene="lmo0920"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        67724..68764
FT                   /transl_table=11
FT                   /gene="lmo0920"
FT                   /note="similar to B. subtilis YcgR protein"
FT                   /db_xref="GOA:Q8Y8I2"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8I2"
FT                   /protein_id="CAC98998.1"
FT                   /translation="MFSHLPDSFLQMNTIFISILIEALPFVLIGVFIAGFIQMFISEQF
FT                   IAHVIPKNKFLAVIVGSLIGVFFPSCECGIVPIVRNLLAKGVPLHAGIAFMLTAPIINP
FT                   VVLFSTYVAFGSTWEVPLLRVAGSLVVALVVGNIIAYLYKGTGLKDRFLKYEAASEKVA
FT                   VPAANIALAGGPVESATTNFQVLTTEAVPAEVAHTNHAHHHHGEEHTHTKMTLSQKIWH
FT                   TVQHAVDEFFSVGKYLVFGALIAAAMQTYIKTSTLVSIGHGPILSILLMMVLAFVLSLC
FT                   SEADAFIGASFRSVFSTQSIVAFLVFGPMLDIKNLMMMLGAFKAKFVLLIVTSVTIVVF
FT                   LYALVI"
FT   regulatory      68770..68775
FT                   /gene="lmo0921"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        68783..69622
FT                   /transl_table=11
FT                   /gene="lmo0921"
FT                   /note="similar to B. subtilis YcgQ protein"
FT                   /db_xref="GOA:Q8Y8I1"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8I1"
FT                   /protein_id="CAC98999.1"
FT                   /translation="MFRVFILFGFGFYLMQLHISGDISKYINMKYAYLSFSAMIAAFLL
FT                   AIIQLIMVFRDEDIGAKTEHMGHTHDGENTILKKIMVYGLLSYALIAGFLFPVATLDST
FT                   IVSAKGFHFPKNNAAGDDPYAQNQFLRPDTSGYFGETDYEKMMAKEKAEIIDQNPIKVN
FT                   DSNYLMTMEILYNYPGEFTGKQIEFTGFVYNDEVTKDNNLFLFRFGIIHCVADSGVFGM
FT                   LVQMPEKTNLKNDTWLTVKGTITQEYYSPFKMNIPSVQVESYKEVAKPKSVYVYRKY"
FT   regulatory      69696..69701
FT                   /gene="lmo0922"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69711..70631
FT                   /transl_table=11
FT                   /gene="lmo0922"
FT                   /note="similar to pantothenate kinase"
FT                   /db_xref="GOA:Q8Y8I0"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8I0"
FT                   /protein_id="CAC99000.1"
FT                   /translation="MNDYNHYFHFPREEWRKLEVSKDQILTAEELEEIRGLNDRISLQD
FT                   ISEIYLPLIKLIAIQYHEAIFIHGEKMEYLKKKESRAPFIIALAGSVAVGKSTTARVFK
FT                   LMLDRWFSKTRQVELVTTDGFLYPNKVLEERGIMDKKGFPESYDRDRFAKFLTDLKANK
FT                   EDVEIPLYSHFTYDVLDETRVIHNPDIVIIEGINVLQADQHESLFPSDFFDFSVYMDAN
FT                   EADIKKWYLERFFMLRETAFQDESSYFHPYTKISKQEAETFALGVWDTINGVNLKENIE
FT                   KTKYRADLVLQKGTDHLISDIYLRK"
FT   regulatory      70632..70669
FT                   /gene="lmo0922"
FT                   /regulatory_class="terminator"
FT   regulatory      70735..70740
FT                   /gene="lmo0923"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        70748..71221
FT                   /transl_table=11
FT                   /gene="lmo0923"
FT                   /note="similar to ABC transporter, ATP-binding protein
FT                   (N-terminal part)"
FT                   /db_xref="GOA:Q8Y8H9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8H9"
FT                   /protein_id="CAC99001.1"
FT                   /translation="MSEIAIKVSNLDVKIGKKQILTDMTLEIEKGEIFGLIGPSGAGKT
FT                   TLVKTIIGMEKATIGTTEVLGKVMPNLPVISKIGYMAQSDALYTDLTAKENLDFFASLY
FT                   SIKGAAKKDRMNYAATLVNLQQDLTKKVNNYSGGMKRRLSLAISVLADPDVLI"
FT   CDS_pept        71203..71469
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lmo0924"
FT                   /note="similar to ABC transporter, ATP-binding protein
FT                   (C-terminal part)"
FT   regulatory      71454..71459
FT                   /gene="lmo0925"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71469..72584
FT                   /transl_table=11
FT                   /gene="lmo0925"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:Q8Y8H8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8H8"
FT                   /protein_id="CAC99003.1"
FT                   /translation="MRILAIVKRIINQFRRDKRTLALMFLAPLLLITLLTYLFEGDTVK
FT                   PVVGVSGLSDSMVKELKANDLTIKTYSENTDVTAKIKDANLDAFFKQNGEKLEVTYENS
FT                   EPSLSKEIGLKLQKALMTEQQAQAKNQAKATGEALAKAGIDPNSIPTLTASPEKLTLST
FT                   DYVYGDKDTSFFDTISPIFIGFFVFFFVFLIAGISFLRERTTGTLERLMATPIKRIELE
FT                   LGYLIGFGIFALLQSILVAVFSIQVLGMMQNGSLFYVLLITLTLGMVSLALGILLSTFA
FT                   NNEFQIVQFIPIVIVPQVLFCGIFPLDGMADWLVWIAHIMPLYYGANALTSIMVKGEGF
FT                   ASFATDFYILLGFVLVFVILNIFALKKYRKV"
FT   regulatory      72592..72597
FT                   /gene="lmo0926"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72607..73263
FT                   /transl_table=11
FT                   /gene="lmo0926"
FT                   /note="similar to transcription regulator (TetR/AcrR
FT                   family)"
FT                   /db_xref="GOA:Q8Y8H7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8H7"
FT                   /protein_id="CAC99004.1"
FT                   /translation="MDAEGDIIRQMLDLTEKETKMSEKQRRIVAASIELFAEKGYAGTS
FT                   TNEIAKKAGVAEGTIFRHYKTKKDLLMAITMPTLIGGVIPFLAQSFVKEVFESEYPDFQ
FT                   SFIREIIVNRFDFAKENGKVIKIYFMELFYHDELRIQFSEIFMTHVKGQFDQMIDYYKE
FT                   RGEIVDMPNSTIMRALITNIVGFMLTRFVVMPDVEWDDAKEIDDTVAYIMRGLGK"
FT   regulatory      complement(73257..73288)
FT                   /gene="lmo0927"
FT                   /regulatory_class="terminator"
FT   regulatory      73268..73299
FT                   /gene="lmo0926"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(73294..75255)
FT                   /transl_table=11
FT                   /gene="lmo0927"
FT                   /note="hypothetical transmembrane protein"
FT                   /db_xref="GOA:Q8Y8H6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="PDB:4UOO"
FT                   /db_xref="PDB:4UOR"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8H6"
FT                   /protein_id="CAC99005.1"
FT                   /translation="MKDWKIKIQTFLSKNYGFFVLAVILYWLKTYIAYQLEFKLGIENL
FT                   MQQILLFINPLSGAIFFMGLALFAKGRRSFIWIIVIDFLMSFILYANIVYYRFFSDFIT
FT                   LPNLNAKQMQNMGDMGSSITALLSWHDIIYFADIIILIALLAFRFVKPNKTARIRARKV
FT                   VGVLTLGIAMFFGNLGLAEIDRPQLLTRTFDRNYIVKYLGMTNYQIYDAVKSTESSTQR
FT                   ALADSSDVTEVLNYTKSKYAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTP
FT                   FINSFFKDQNTLSFTNFFHQTGQGKTADSEMLLENSLYGLPQGSAFTTKGQNTYESASA
FT                   ILGQQGYTSAVFHGNYKSFWNRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFK
FT                   ESEEYLSSLQQPFYTKFITLTNHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESV
FT                   KSFVDYLKKSGLYDNSVIIMYGDHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIH
FT                   VPGVQGGVQEQYGGQVDLLPTLLHLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITP
FT                   TYSMIGGNMYNQQTGEPIATETKEMKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKV
FT                   DPSKYNYNKKKSTDSSDK"
FT   regulatory      complement(75262..75267)
FT                   /gene="lmo0927"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      75501..75506
FT                   /gene="lmo0928"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        75513..76136
FT                   /transl_table=11
FT                   /gene="lmo0928"
FT                   /note="similar to 3-methyladenine DNA glycosylase"
FT                   /db_xref="GOA:P58621"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58621"
FT                   /protein_id="CAC99006.1"
FT                   /translation="MEAMITKEFFESKTTIELARDILGMRLVHQTNEGLLSGLIVETEA
FT                   YLGATDMAAHSFQNLRTKRTEVMFSSPGTIYMYQMHRQVLLNFITMPKGIPEAILIRAI
FT                   EPDEQAKQQMTQNRHGKTGYELTNGPGKLTQALGLSMQDYGKTLFDSNIWLEEAKLPHL
FT                   IEATNRIGVPNKGIATHYPLRFTVKGSPYISGQRKNSIRTGIWK"
FT   regulatory      76233..76238
FT                   /gene="lmo0929"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        76245..76913
FT                   /transl_table=11
FT                   /gene="lmo0929"
FT                   /note="similar to sortase"
FT                   /db_xref="GOA:Q8Y8H5"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042007"
FT                   /db_xref="PDB:5HU4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8H5"
FT                   /protein_id="CAC99007.1"
FT                   /translation="MLKKTIAIIILIIGLLLIFSPFIKNGIVKYMSGHETIEQYKASDI
FT                   KKNNEKDATFDFESVQLPSMTSVIKGAANYDKDAVVGSIAVPSVDVNLLVFKGTNTANL
FT                   LAGATTMRSDQVMGKGNYPLAGHHMRDESMLFGPIMKVKKGDKIYLTDLENLYEYTVTE
FT                   TKTIDETEVSVIDNTKDARITLITCDKPTETTKRFVAVGELEKTEKLTKELENKYFPSK
FT                   "
FT   regulatory      76919..76954
FT                   /gene="lmo0929"
FT                   /regulatory_class="terminator"
FT   regulatory      77016..77021
FT                   /gene="lmo0930"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77029..77760
FT                   /transl_table=11
FT                   /gene="lmo0930"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YhfI protein"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8H4"
FT                   /protein_id="CAC99008.1"
FT                   /translation="MKLTVFGHWGGYPVANEGTSSYLLEEAGFKLLIDVGASAVSIMQN
FT                   YIDPDDIDAAIISHYHPDHVADVGILQHIRLLSQKKEKPPVLPIYGHKEDERGYSYLEM
FT                   ANVTKVIEYKADDTLEIGPFKVTFLKTIHPVPCYAMRIEAAGKVFVYTADSAYQDSFIP
FT                   FAESADLLVTDTNFFHDLAGKTKVHMASTEVAKIAKEANVKSLLLSHLPEVGDLEVLKQ
FT                   EAAAIYKGEIALASKGFTKTF"
FT   regulatory      77771..77776
FT                   /gene="lmo0931"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77784..78779
FT                   /transl_table=11
FT                   /gene="lmo0931"
FT                   /note="similar to lipoate protein ligase A"
FT                   /db_xref="GOA:Q8Y8H3"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8H3"
FT                   /protein_id="CAC99009.1"
FT                   /translation="MYFIDNNNEKDPRINLAVEEFILTELNLDEPVLLFYINKPSIIIG
FT                   RNQNTVEEIDTEYVEKNDVIVVRRLSGGGAVYHDEGNLNFSFITEDDGESFHNFAKFTQ
FT                   PIVEALKRLGVNAELKGRNDLLIDGFKVSGNAQFATKGKMFSHGTLMYDLNLDNVAASL
FT                   KPRKDKIESKGIKSVRSRVANISDFMDQEMTTEEFRDLLLLYIFGVEKVEDVKEYKLTA
FT                   ADWEKIHEISAKRYGNWDWNYGKSPKFDLTRTKRFPVGAVDVRLNVQKGVITDIKIFGD
FT                   FFGVKNVADIEEKLVNTTYKREVLAEALVDIDVKEYFGNITKDEFLDLLY"
FT   regulatory      complement(78774..78813)
FT                   /gene="lmo0932"
FT                   /regulatory_class="terminator"
FT   regulatory      78785..78813
FT                   /gene="lmo0931"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(78819..79424)
FT                   /transl_table=11
FT                   /gene="lmo0932"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8Y8H2"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8H2"
FT                   /protein_id="CAC99010.1"
FT                   /translation="MTFWQDMMNFFSYDNLMYWLSEYRNLGPLLAFLLPFIEAFLPFLP
FT                   FIVFVVVNVNAYGLLIGFLISVIAAIAGSLCVFLLARKFGQTRFLRFISGHKQIKRVME
FT                   WIDRHGFSPIFILLVMPFTPSSAVNIVAGLSKIKVYQFILALVGGKLIKVFAISYIGYD
FT                   FVDLIHQPLKLAILAVSVVILWFVGKRLEHWMSGKNLK"
FT   regulatory      complement(79432..79437)
FT                   /gene="lmo0932"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(79507..79544)
FT                   /gene="lmo0933"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(79549..80496)
FT                   /transl_table=11
FT                   /gene="lmo0933"
FT                   /note="similar to sugar transferase"
FT                   /db_xref="GOA:Q8Y8H1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8H1"
FT                   /protein_id="CAC99011.1"
FT                   /translation="MEKSIEYSCIVPVFNEEEVLLKTYKRLTEVMQTLDGPYEIIFVND
FT                   GSRDLTKSMLQKLSAEDSCVKAIHFSRNFGHQIAITAGANYAHGKAVIVIDADLQDPPE
FT                   LIIEMVEKWKEGYQVVYAQRLKRKGETFFKKQSASLFYRILTKLTDINIPVDTGDFRLM
FT                   DAQVCRELAGLHEKNPFVRGQVSWLGFKQTALHYERDERAAGETKYPLKKMIKLSIDGI
FT                   TSFSYRPLKLASYLGVLTAFIGFIYLIIVLFQRFFTDTTLTGWTSIIILQLVFGGTILF
FT                   ILGLIGEYIGRIYDEVKDRPLYIIEEENGFSDQK"
FT   regulatory      complement(80505..80510)
FT                   /gene="lmo0933"
FT                   /regulatory_class="ribosome_binding_site"
FT   tRNA            80867..80937
FT                   /product="transfert RNA-Gly"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 73.1"
FT   regulatory      81022..81027
FT                   /gene="lmo0934"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        81037..82176
FT                   /transl_table=11
FT                   /gene="lmo0934"
FT                   /note="similar to B. subtilis YhbA protein"
FT                   /db_xref="GOA:Q8Y8H0"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8H0"
FT                   /protein_id="CAC99012.1"
FT                   /translation="MVVKQKADYAALKEELIAYAYEIGIQKIGFTTADPFLFLKERLLE
FT                   AEALDLFTGFEHPVIEERVYPELIFKEPQSIIAIALAYPSKLKEAPVSKKGARRGVFAR
FT                   ASWGIDYHTVLREKLALLETFLIERLPDVRMKSMVDTGELSDVAVAERAGIGWRGKNTL
FT                   LITPEYGSWVYLGEMITNIPFEPDTPASDLCGSCNQCVKACPTGSLLGEGKMNPKICLS
FT                   YLTQTKDFLDEKYREVLHNRLYGCDTCQVVCPYNRGHDFHFHEEMEPDPELVRPELKPL
FT                   LHISNRAFKEQFGDMAGSWRGKKPIQRNAIIILARYKDKTAVPDLIDCLQNDPRPVIRG
FT                   TAGWALRKIGGRDAEEAVERALQTEQDVQVLQELTAIPN"
FT   regulatory      82185..82191
FT                   /gene="lmo0935"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        82197..82706
FT                   /transl_table=11
FT                   /gene="lmo0935"
FT                   /note="similar to B. subtilis CspR protein, rRNA methylase
FT                   homolog"
FT                   /db_xref="GOA:Q8Y8G9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8G9"
FT                   /protein_id="CAC99013.1"
FT                   /translation="MPNHIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTDDKML
FT                   KRAGLDYWDNVKLSYYDSLDEFFEKNEGGEFYYITKFGRHVYSDIDYSDTNKDYFFVFG
FT                   KETTGLPDALLQENEENCLRIPMTDHIRSLNLSNTAAILAYEALRQQNFGALLQEPNYD
FT                   RKIFQD"
FT   regulatory      82706..82711
FT                   /gene="lmo0936"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        82719..83459
FT                   /transl_table=11
FT                   /gene="lmo0936"
FT                   /note="similar to Nitroflavin-reductase"
FT                   /db_xref="GOA:Q8Y8G8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8G8"
FT                   /protein_id="CAC99014.1"
FT                   /translation="MNQAIDAILGHYSVRKFEDKDLTEEALTLLIKSAQAASTSSFVQA
FT                   YSIIGITDKDIREQISAIAGNQPYTVQTGQLFIFVADLARHHAILEEHQVDTAALETSE
FT                   KWLVSVIDAALAAQNMAIAAESLGLGICFIGGIRNDVEQIAEILDLPPYTMPLFGLTIG
FT                   HPVANKEKAKPRLPQDLVYHENSYKKMNPETLAEYDKQIKTYYNERTAGKRVEGWSEQI
FT                   ARGLGRPSRLDLKAFLEKQHLNQK"
FT   regulatory      complement(83454..83497)
FT                   /gene="lmo0937"
FT                   /regulatory_class="terminator"
FT   regulatory      83465..83497
FT                   /gene="lmo0936"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(83509..83670)
FT                   /transl_table=11
FT                   /gene="lmo0937"
FT                   /db_xref="GOA:Q8Y8G7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8G7"
FT                   /protein_id="CAC99015.1"
FT                   /translation="MLGIIWGIIVVLLAVWLLGIIFHIAGGLINILLVIVLILVIWNLI
FT                   QMARNKRK"
FT   regulatory      complement(83680..83685)
FT                   /gene="lmo0937"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(83758..84216)
FT                   /transl_table=11
FT                   /gene="lmo0938"
FT                   /note="similar to protein-tyrosine-phosphatase"
FT                   /db_xref="GOA:Q8Y8G6"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8G6"
FT                   /protein_id="CAC99016.1"
FT                   /translation="MVKVVFVCLGNICRSPMAEGLFRKEVANAGLTDEIKIDSAATGTW
FT                   NLGKPPHRGTQEVLKKHGVDYQAMRARKISDADFKEADFIIGMDQQNLADLNALNNNPD
FT                   VIIRSLMSFVSGQEDKDIPDPYYTGDFDETERMVTEGVKALLAYITKK"
FT   regulatory      complement(84224..84229)
FT                   /gene="lmo0938"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(84229..84975)
FT                   /transl_table=11
FT                   /gene="lmo0939"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8G5"
FT                   /protein_id="CAC99017.1"
FT                   /translation="MTIWVENENKGATEQTIHEKETEIGLILPTDYKQLLLKQNGGLIR
FT                   KNHFPTSEPTSYGLDFGEIYYLGSLDELLTDIPEQKDVELAGKQVYFHRDESRYLGFSY
FT                   MDNTSEPSIIYVDFETLQTLVVAENLAAFLEKLYFSPFPIDLAEHFPIKKLNQILAASN
FT                   VQKTKQLLELLEDYPDKKWYLETLLGLLEKQEIPYNLVVCSLFENQLLYFRRKLVPELV
FT                   EQIFVRLKACDGINKVTVAELYKEWN"
FT   regulatory      complement(84984..84989)
FT                   /gene="lmo0939"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(85020..85063)
FT                   /gene="lmo0940"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(85071..86033)
FT                   /transl_table=11
FT                   /gene="lmo0940"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8G4"
FT                   /protein_id="CAC99018.1"
FT                   /translation="MDYLNALEEAWGMDDTSEKVKLLEQAIASADMYNDVESAVEAREL
FT                   LIETCLTAGFPKKQLKAFSWLVKKWEDDDSSVDTFDLFWNYKWISEQIATFDEIPKTQI
FT                   NRLLEDMKLKFEQQNYSLRPYYKVCTLDAMWMGEVEKAKQFFVKWNNTEADHLNDCRAC
FT                   ETCAQASYYYFIKDYEKAKETATPIINGKLACAEVPHYTYGDMALVYLELGDAEMAQEC
FT                   FDKGYPLVEKQIALIQPLSYLLKYLVKTNQTEKAREVLDVHKEIVLQAESGMDRLLFLQ
FT                   AAYSLFDREKEADLVEMTETLTAKFDARNENSYYQDLLK"
FT   regulatory      complement(86040..86045)
FT                   /gene="lmo0940"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(86065..87039)
FT                   /transl_table=11
FT                   /gene="lmo0941"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8G3"
FT                   /protein_id="CAC99019.1"
FT                   /translation="MDYLNDTQTVWGMEDTPEKIKVLERIITGADAHNDVESGIEARDM
FT                   LIETCLTVGFPKKQLQAFSWLISKWEDEDNDVYIDSEDLLWKYKWISEHVPTFDEVSKA
FT                   QIDGLLNDMKVKFEQENYSLRPYYKVCTLAAMRMGDVEKAKELYNKWSTTKADYLNDCP
FT                   ACERNDQVNYYCFVQDYEKAKEKAKPIIDGKQRCAEVPHLTYGNMALAYLDLGDAKMAQ
FT                   ECFDKGYPLVEKQISLIPPLGQLLRYLVSTNQTEKAREVLDTNLEIVLQAEAGLDRLIF
FT                   LQAAYPLFDREKEADLVEMTEALTAKFDARNENNYYQNRLEAY"
FT   regulatory      complement(87047..87052)
FT                   /gene="lmo0941"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(87051..88856)
FT                   /transl_table=11
FT                   /gene="lmo0942"
FT                   /note="similar to heat shock protein HtpG"
FT                   /db_xref="GOA:Q8Y8G2"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8G2"
FT                   /protein_id="CAC99020.1"
FT                   /translation="MENYSHRFQVNLAGMIDILSNHLYDEKDVYIRELLQNATDAIRAR
FT                   KKIDSTLEGKIHASLTGDNNEKTLIIEDNGIGLTEDEVHAFLATIANSSKGEKNFDGES
FT                   SNDFIGRFGIGLLSCFIVSDEIVMISTSQKDGGTTEWRGKADGTYSVRKIETDTREPGT
FT                   QVYLRLRAGLEDHPECEDVEYLINTLKKYGASLESNIIVEMNGLEEEINSWTKQFSDKE
FT                   TLSTLSREQIIQYGEYILGTHFQDYFLIENESGRTFGIAYMIPHAVQMNAIRKNTVFLN
FT                   KMFVTSEANNILPDWSFFAKCVIWTDELQPVASREAFYKNERLTSVASELGVALKKGIE
FT                   TLPEEALMKLLATHYLGFKALASEDAPFLKLIYPYLPVRTLNGEEKLGDIIAKNDVIYY
FT                   TYSVDDFRQIKDIARSSGMTLINGGYSYDSPILAQLSYFVEGTEFVLIQPEEMTDKLRP
FT                   MTADEKQAYQPILTEMNSMMAEFDTDVLIKHFEPKDLPIIFIHSTATQELRELERAVEE
FT                   TTSVFSDILESIQKEQEPAPLAHLYLNLDNELIKRLFTSEKTVKELSVIVNVLYIQALL
FT                   LGHYPLKRKEMVLMNQNMLRILEML"
FT   regulatory      complement(88865..88870)
FT                   /gene="lmo0942"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      89044..89049
FT                   /gene="fri"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        89059..89529
FT                   /transl_table=11
FT                   /gene="fri"
FT                   /product="non-heme iron-binding ferritin"
FT                   /db_xref="GOA:Q8Y8G1"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="PDB:2IY4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8G1"
FT                   /protein_id="CAC99021.1"
FT                   /translation="MKTINSVDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEK
FT                   MDDLYSEFGEQMDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVG
FT                   TLELLRDEYQQGIELTDKEGDNVTNDMLIAFKASIDKHIWMFKAFLGKAPLE"
FT   regulatory      89543..89580
FT                   /gene="fri"
FT                   /regulatory_class="terminator"
FT   regulatory      89746..89751
FT                   /gene="lmo0944"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        89762..90064
FT                   /transl_table=11
FT                   /gene="lmo0944"
FT                   /note="similar to B. subtilis YneR protein"
FT                   /db_xref="InterPro:IPR008326"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8G0"
FT                   /protein_id="CAC99022.1"
FT                   /translation="MNIEVTDQANKWFHDEFDVANGNGIRLFAKYGGSNSSLHPGFSIG
FT                   LTAEKPQEAAVAEKKEDLIFFIEDHDYWYFKDHDWKIDYEPKTEEVLFSFKEKVK"
FT   regulatory      90080..90119
FT                   /gene="lmo0944"
FT                   /regulatory_class="terminator"
FT   regulatory      90165..90170
FT                   /gene="lmo0945"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        90177..91307
FT                   /transl_table=11
FT                   /gene="lmo0945"
FT                   /note="similar to C-terminal part of B. subtilis ComEC
FT                   protein and to ComEA"
FT                   /db_xref="GOA:Q8Y8F9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8F9"
FT                   /protein_id="CAC99023.1"
FT                   /translation="MTKKLVICISLIAIFLSGCSFSEPSTSKSNITEKTLNGATFTFFD
FT                   VGQGDSTLIQAEDGTTILIDTGRQDDDRILTYLKEANVKKIDLLLLTHPHADHIGNADK
FT                   VIATYNPKEIWMDGLTFSSSIYEKVIDAALASDAKYKEPRRGEKATFGPFNLEVLSPDK
FT                   LENDANNDSIAVKITYKDISAIFTGDAEKGREREMVDSGANLEADILDLGHHGSSTSNQ
FT                   PFFLDKVKPQVAVYSAEMANSYGHPHVEVLEWLKERDIKTYGTDVNGTVIIETDGEKIH
FT                   VQTEKSGTPKPGSSYNKENSTQKTEDATSEELPESINLNTASSEDLQLLPLIGPALAEK
FT                   IIAERPYQSIDDLKKINGIGDGIVRQIKEQGIAVTK"
FT   regulatory      91303..91308
FT                   /gene="lmo0946"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91317..91544
FT                   /transl_table=11
FT                   /gene="lmo0946"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8F8"
FT                   /protein_id="CAC99024.1"
FT                   /translation="MKKAILDRIEDGKAVFLLEPDQTEWQIDKEKLDSSIKEGDIVTIS
FT                   ETNEIMKHPQETEEMKNRIAEKLERLRGRN"
FT   CDS_pept        complement(91743..92960)
FT                   /transl_table=11
FT                   /gene="lmo0947"
FT                   /note="hypothetical transport protein"
FT                   /db_xref="GOA:Q8Y8F7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8F7"
FT                   /protein_id="CAC99025.1"
FT                   /translation="MNSDLTNKKILTRSSKVMLVLGIVLIAANLRTPITSVGPLLGMIQ
FT                   SDLHLTNTMAGLLTTIPLLAFAGLSPFVSKLSRALGMEVLIFVALLTLVLGSLLRPFGG
FT                   ELNLFAGTFMIGLAIAVGNVILPSLIKKEFPFKLGLMTGVYSISMNLCAAIAAGLTVPI
FT                   AMNNRFSWHGSMVFWAILGIVALVIWLPQLKYNQRSTEKIATHLVTTSVWKSPLAWKIS
FT                   LFMGSQSAIFYISIAWLPNILADQGLSSTSSGLMLSLMQFAVMPITFIIPIIAGRMKNQ
FT                   QLLVGISILFFLIGIFGIMFASGSILILSIAIIIYGIGSGMSFSLSMMFFNLRTTSATE
FT                   SADLSGMAQSIGYLFAASGPILFGTLHDALGSWQPTLYVLVGITMLMLYCGLDAGRNKF
FT                   LFSQKK"
FT   CDS_pept        complement(92957..93646)
FT                   /transl_table=11
FT                   /gene="lmo0948"
FT                   /note="similar to transcription regulator"
FT                   /db_xref="GOA:Q8Y8F6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8F6"
FT                   /protein_id="CAC99026.1"
FT                   /translation="MVEKIERKSLAEQVYDQIKAEITNGTWKIGERIPKEADLMAEFGI
FT                   SRNTLREAIRALAHIGLLETKQGDGTFVRNNSELNAIMQKRVRESTVQEILEIRHALDR
FT                   EAVILACDRRTEEDVETLEKYRQQCQLATEKNDVGAFVKADSALHLTIVKTAHNDLLLD
FT                   MYVNILEEIQFSITSTTEMSPEANQHKGHAALVKAIEKRNKEQAAHEVTEYITLFKRIA
FT                   AKNGEKK"
FT   regulatory      complement(92967..92972)
FT                   /gene="lmo0947"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(93653..93658)
FT                   /gene="lmo0948"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      93758..93763
FT                   /gene="lmo0949"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        93768..94814
FT                   /transl_table=11
FT                   /gene="lmo0949"
FT                   /note="conserved hypothetical membrane protein"
FT                   /db_xref="GOA:Q8Y8F5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8F5"
FT                   /protein_id="CAC99027.1"
FT                   /translation="MNWLEKLKENDTARRVLVFVLLGVVLYLLRSMIDLILLTFIFAFL
FT                   VTRLENVILKRVRVPRKLIVIVLYSLVAVFLYVAIVHFLPILINQISQLVDSLVKLYNN
FT                   PSDNTIVKWIVGFLKESNIQKYLQAGVDFIIASLSGIGSVGLSFFLALILSLFFSLEKE
FT                   RVTSFTGQFMTSKVGFIFKEAAFFGKKFVSTFGVVLEAQLMIALVNTFITTIALYLMDF
FT                   PQLLSLSIMVFVLGLIPVAGVIISCIPLVLIAYSVGGFQDVVYILITVVIVHAIETYIL
FT                   NPKLMSSKTNLPVFYTFIILIFSETFFGVWGLIVGIPVFVFLLDILEVRNAEDLKKRTL
FT                   FGRKKKVD"
FT   regulatory      94799..94835
FT                   /gene="lmo0949"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(94802..94838)
FT                   /gene="lmo0950"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(94823..95722)
FT                   /transl_table=11
FT                   /gene="lmo0950"
FT                   /db_xref="GOA:Q8Y8F4"
FT                   /db_xref="InterPro:IPR010315"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8F4"
FT                   /protein_id="CAC99028.1"
FT                   /translation="MKKVIILIIALAVIITGFWIIFLQFEPTKKEAKEPTVTANKTTTK
FT                   EQNSVSEIAIPTLFVHGYSGTANSFGGMINRLAEDGDVTKSLVMNVAADGTVSSKGDYD
FT                   KFSHNPTIQVIFEDNKSSAANQTQWIQNVMKELKNNYHIEKVYAVGHSMGGVSLTSYIE
FT                   KVGNDKTYPVLEKLVLIGAPLNGLVIGDDGVTAYDLTDSGPKKSSDRYSEFMKNKQKIP
FT                   TNLHVLNIAGDTLNGTKSDGSVSVASALSGKFIFEGQAASYEEKTFTGKNAAHSKLHEN
FT                   TNVDAEVADFLWGIEKVD"
FT   regulatory      complement(95729..95734)
FT                   /gene="lmo0950"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(95743..96564)
FT                   /transl_table=11
FT                   /gene="lmo0951"
FT                   /db_xref="GOA:Q8Y8F3"
FT                   /db_xref="InterPro:IPR010315"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8F3"
FT                   /protein_id="CAC99029.1"
FT                   /translation="MLKRVFFSIILPLGCLVGAIFILLTINTTYPKAANDSIPTIFIHG
FT                   YRGTDRSLHGMIRRFDQKYDWGTESLTVNVSPDGEISTTGTYNKKEKNPLINIVFEDNR
FT                   ATLPQQSMWTKKVMSYLQQNYAIKKFNAVGHSMGGGAWVSYLASYEKNKSYPQVNKIVF
FT                   LAVPFYPEEYVNGDQQVDIKNANNVHAKFAEKMAKVLPNNTEIMIIGGNLEDGSNSDGE
FT                   VKLDSVLYGEKLFAHQKVTTHVIKGPQATHSSMHESTVVDKYVGQFLWGEK"
FT   regulatory      complement(96574..96579)
FT                   /gene="lmo0951"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      96707..96712
FT                   /gene="lmo0952"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        96722..97180
FT                   /transl_table=11
FT                   /gene="lmo0952"
FT                   /db_xref="GOA:Q8Y8F2"
FT                   /db_xref="InterPro:IPR025273"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8F2"
FT                   /protein_id="CAC99030.1"
FT                   /translation="MIKRTGEIVLAIIGLVLSLLAQAFIAIIGLLMISGSKGKEGLTTF
FT                   YNNYYKTMTEWEIPKKEVPDPDRVLDFVQTLSWTALTGGLITLALGIFGIYYIFKNKKP
FT                   VFAGYLFLAAGVVSLLSTALISFIPALLFIVAAILCFVRKPKSTFSGL"
FT   regulatory      97188..97210
FT                   /gene="lmo0952"
FT                   /regulatory_class="terminator"
FT   regulatory      97260..97265
FT                   /gene="lmo0953"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        97274..97501
FT                   /transl_table=11
FT                   /gene="lmo0953"
FT                   /db_xref="GOA:Q8Y8F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8F1"
FT                   /protein_id="CAC99031.1"
FT                   /translation="MKNKVGIIAGAVGAVAGVLACAAVYVVKKQQPPTPFDEVNDIRTR
FT                   YADKEISETELEENNMISEGGVSSLQYEEK"
FT   regulatory      97515..97559
FT                   /gene="lmo0953"
FT                   /regulatory_class="terminator"
FT   regulatory      97722..97727
FT                   /gene="lmo0954"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        97735..98049
FT                   /transl_table=11
FT                   /gene="lmo0954"
FT                   /db_xref="GOA:Q8Y8F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8F0"
FT                   /protein_id="CAC99032.1"
FT                   /translation="MRAILIGVLIILLIAMILIVLLPAILAMVGAVLGFWSLKKLLEAR
FT                   SVGEKVIYGVLIGVGALIILANLKGILVVVIIGAIIYFLTRNKNKPRKNDDVFDYPYNK
FT                   "
FT   regulatory      98051..98056
FT                   /gene="lmo0955"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        98065..98910
FT                   /transl_table=11
FT                   /gene="lmo0955"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8E9"
FT                   /protein_id="CAC99033.1"
FT                   /translation="MANLFEKMKQWNKEVSEKIEKREEKRRNSVSYYMDKTKQEMKDAE
FT                   RMVEKQRELKSLFYKEYKEMEVYVEKRRHQAEIAKEAGETKLADFALEEVAQYEEQLEA
FT                   TKAHYDQASEQLEKLELRMHEMRLKWKNLKTQHLAEMAEKNATETSEKMDKVIHDMSWG
FT                   SVSDYHEAQKQRDLAEEAEKKADMSKELSQSFDDLMDELEKKTKKSKEIIKDKAQNFTT
FT                   MVDEIIEREKQNFKKPEKASMEDQLNELEKEAAKEKPKEEKEVLIPELEKKEEENETDK
FT                   "
FT   regulatory      98920..98952
FT                   /gene="lmo0955"
FT                   /regulatory_class="terminator"
FT   regulatory      99084..99089
FT                   /gene="lmo0956"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        99099..100232
FT                   /transl_table=11
FT                   /gene="lmo0956"
FT                   /note="similar to N-acetylglucosamine-6P-phosphate
FT                   deacetylase (EC 3.5.1.25)"
FT                   /db_xref="GOA:Q8Y8E8"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8E8"
FT                   /protein_id="CAC99034.1"
FT                   /translation="MANKVITNATIYTGKGVLENAFVRFDKQILEVGSMADFQADKAEE
FT                   VIDAKGQKLVPGFIDVHSHGGYSFDAMDADPEALRKQVNGMLNEGITTYFPTTMTQSHE
FT                   NIEKALKVINEVAQTEPVIGGIHLEGPFVSKVFKGAQPEEYIQAPDLELFKKWFDISGG
FT                   LIKLVTYAPEHDTSADFENLCFELGVVPSIGHSNDVREHLKTSKATHATHLYNACHRMT
FT                   HREPGVPGHVLLERGINAELIVDGIHVHPDMVKLAYQMKGPEHLCIITDSMRAKGMPEG
FT                   KSELGGQTVIVKDKQARLEDGTLAGSVLTYDDGFRNMIKFTGCSVEEAVLMSSGNQARE
FT                   FNLTQKGAIEAGKDADFNLLDEDLHITATYSFGKKHS"
FT   regulatory      100234..100239
FT                   /gene="lmo0957"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        100248..100952
FT                   /transl_table=11
FT                   /gene="lmo0957"
FT                   /note="similar to glucosamine-6-Phoasphate isomerase (EC
FT                   5.3.1.10)"
FT                   /db_xref="GOA:Q8Y8E7"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8E7"
FT                   /protein_id="CAC99035.1"
FT                   /translation="MQLITTENKLAGSKKALEIIEKGITSGEVNTLGLATGSTPETLYA
FT                   ELVKSDVDTKNVTTTNLDEYVGLAASDPNSYHYYMNDLLFSKKAFKESFLPNGEATDAE
FT                   AECARYEEILSEHPIDIQVLGIGTNGHIGFNEPGTSFDSITHKVVLTDSTREANKRFFE
FT                   REEDVPTHAYSMGIKSIMNAKKIILLAFGENKAQAIKETIKGPVDVNCPASVLQNHPDV
FT                   TVILDNEAASLL"
FT   regulatory      100954..100959
FT                   /gene="lmo0958"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        100968..101690
FT                   /transl_table=11
FT                   /gene="lmo0958"
FT                   /note="similar to transcription regulator (GntR family)"
FT                   /db_xref="GOA:Q8Y8E6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8E6"
FT                   /protein_id="CAC99036.1"
FT                   /translation="MIDKQSGIPIYIQIQSEIKKKMEDGVWKVGTSIPAERQLAEMFHV
FT                   SRMTVRQAIQGLVDDNILQRRVGAGTFIAEKKLTERLEAVTSFTNLMLQEGKVPSTRIV
FT                   SYGIRPASTQEQEALQLPENSNVMKIERIRYGDRVPILYEVAAIPEKIASLLTKEDIMD
FT                   SLYKAIELKLGQPIGEAEQIMEASLVSEKIAPYLDVKLGSPVMKLRQITTLEDGRPFEF
FT                   TRSQYVGSRFQFVARIKQ"
FT   regulatory      101697..101736
FT                   /gene="lmo0958"
FT                   /regulatory_class="terminator"
FT   regulatory      101797..101802
FT                   /gene="lmo0959"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        101810..102865
FT                   /transl_table=11
FT                   /gene="lmo0959"
FT                   /note="similar to undacaprenyl-phosphate
FT                   N-acetylglucosaminyltransferase"
FT                   /db_xref="GOA:Q8Y8E5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8E5"
FT                   /protein_id="CAC99037.1"
FT                   /translation="MSWMIIFICFGASVLLTPLIRKIALYFDITDKPDQRRINIKPIPS
FT                   LGGLAIFISFTIGMFLLPIENEFLWPLLIAAFVMVLTGLLDDIMEFKARYKLIGQITAA
FT                   FIIVFWGNISIDFINLPFGGEIHFGMLSIPLTIIWIVAITNAINLIDGLDGLAAGVSTI
FT                   ALLTILGMAFIMGDALVIMIASVLIAGTLGFLPYNFNPAKIFMGDTGALFLGFIISVLS
FT                   VMGFKNVTFISLIVPILILGVPISDTLFAIIRRMVTKQPIAMADKSHLHHCLLRLGFTH
FT                   RQTVILIYAIAALFSLFAFIFTMSTLWGSMILIGVLLVLIEVLIETLGLVGSSYRPLLN
FT                   LFKLTKEEKID"
FT   regulatory      102865..102889
FT                   /gene="lmo0959"
FT                   /regulatory_class="terminator"
FT   regulatory      102967..102972
FT                   /gene="lmo0960"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        102978..103886
FT                   /transl_table=11
FT                   /gene="lmo0960"
FT                   /note="similar to proteases"
FT                   /db_xref="GOA:Q8Y8E4"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8E4"
FT                   /protein_id="CAC99038.1"
FT                   /translation="MEIIATADSMKQAEQLLRAGVDRLYIGNSQFGLRLPYSFSVEELR
FT                   EIVHLAHQEGKKVTVAVNSLMHNEHMEKLPGFLEQLADMEVDAVTCGDPGAIMLLSEMA
FT                   QPIPFIYDAQTFVTSAEQISFWEKQGAIGAVLARELTEGEIKTIAHSLTIPVEVLVYGP
FT                   TCIHQSKRKLVTNYERIVEMEDDTSKERGLYLREPNDETSQLPIYEDESGTHIFASEDV
FT                   SLVPYLADLYEAGLKTWKLDGVLAESENFVQIASLLVEAKEATLKGQFVAEYFVNKLTE
FT                   LQPQTRKLDAGFYLKNPDDVK"
FT   regulatory      103885..103890
FT                   /gene="lmo0961"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        103900..105126
FT                   /transl_table=11
FT                   /gene="lmo0961"
FT                   /note="similar to proteases"
FT                   /db_xref="GOA:Q8Y8E3"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8E3"
FT                   /protein_id="CAC99039.1"
FT                   /translation="MSKILKKPEVLAPAGNLEKLKIAIRYGADAVYIGGQAFGLRSRAG
FT                   NFSFEEMKEGIAFAHERNAKVYVAANMVAHAGDTEGAGEFFLTLRDIGIDAVIVSDPAL
FT                   ISICFQDAPGLPVHLSTQASATNYKTLEFWKKQGLERVVLAREVSMQEIQEIGEKTDVE
FT                   MEAFIHGAMCISYSGRCTLSNHMANRDANRGGCAQSCRWKYDLFEIDNGVSKNLVDTDE
FT                   EPFSMSAVDLSMIKYIPDMVDAGVDSLKIEGRMKSIHYVSTVASVYRRAVDAYCADPEN
FT                   YVFDPAWEEELWKVAQRELSTGFFYKEPTEDEQLFGKTRKIPQYAFAAQVLEYDEKTKI
FT                   ATLQQRNNFGVGEEIEFYGPGDTGFKQVVEVLWNEDGVEIDRAPNAMMTIKMPVDKPVK
FT                   PFYFMRKKK"
FT   regulatory      105195..105200
FT                   /gene="lemA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        105210..105767
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /product="Listeria epitope LemA"
FT                   /db_xref="GOA:Q8Y8E2"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8E2"
FT                   /protein_id="CAC99040.1"
FT                   /translation="MIGWIIAIAVVVILVLIYFGLYNSLVKYRNRVDETWAQIDVQLKR
FT                   RFDLIPNLVETVKGYAKHEKETLTKVIEARNKMMEVPADNRQGQIEADNMLSGALKSIF
FT                   ALGEAYPDLKANTSFIELQHELTTTENKVAYSRQLYNTTVMTYNTKVQSVPTNIVAKLH
FT                   NFTERDMLSIPEVERVAPKVEF"
FT   regulatory      105775..105780
FT                   /gene="lmo0963"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        105790..106704
FT                   /transl_table=11
FT                   /gene="lmo0963"
FT                   /note="similar to putative heat shock protein HtpX,Listeria
FT                   epitope LemB"
FT                   /db_xref="GOA:Q8Y8E1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8E1"
FT                   /protein_id="CAC99041.1"
FT                   /translation="MLFEQIAANKRKTIFIILGFFIFVLMVGAAIGIIVWNNYLNGLVL
FT                   AAVIGAFYILIMVMSSSSVVMAMNHAKEVTSKEQAPVLWDTVESMAMVAGIPMPKVYIV
FT                   EDPSPNAFATGISPEKGAVAVTRGLLNKLERYELEGVIAHEISHIRNYDIRLSTIAIAL
FT                   VAVIAILSDIAMRMIFWGSLTGGRNNRKSDNNNSGGAQAIIYIVALIFVILAPIIATAI
FT                   QFALSRNREYLADASAVELTRNPDGLIQALQKISGDSKKMEEVSASSESIYFSSPLKSK
FT                   KNKPGLFDSHPPISSRIERLENM"
FT   regulatory      complement(106699..106734)
FT                   /gene="lmo0964"
FT                   /regulatory_class="terminator"
FT   regulatory      106710..106745
FT                   /gene="lmo0963"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(106739..107557)
FT                   /transl_table=11
FT                   /gene="lmo0964"
FT                   /note="similar to B. subtilis YjbH protein"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8E0"
FT                   /protein_id="CAC99042.1"
FT                   /translation="MINQNLYYQSVANSKPIEIYLFFDPACDDCWNIEANMLRLQMEYG
FT                   NYFKLRYVLHNNLQTFVCKQKRAGNSNLSLKEQQIGAHLSYISCLAVKAAELQGKKQGI
FT                   TFLRKIQAAYFLENKDIASDEVLYDIAVSTGLDLSEFKKDLASTVAKRAYIGDQKVAQE
FT                   MEIHENPTVVFFNKNIEDAGLKLSGLHRYEVYVHVLSELLNDAPQPEERPQMEEYLAKV
FT                   KVTSSASMADFYGVSEQQIERQMKKWRLQQKVELIDAPAGQSHWKYIGNL"
FT   regulatory      complement(107564..107569)
FT                   /gene="lmo0964"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(107795..108379)
FT                   /transl_table=11
FT                   /gene="lmo0965"
FT                   /note="similar to B. subtilis YjbK protein"
FT                   /db_xref="InterPro:IPR009195"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8D9"
FT                   /protein_id="CAC99043.1"
FT                   /translation="MVKELEIEFRNLLTKEEYDTLIENFRVKEDDFFEQTNYYLDTTNF
FT                   GLKERHSALRIRQLETQYQLTLKTPEARGLMETTQILGEDQASAIISGANIPVGPVRDT
FT                   LKELGINHEDLQVFGSLKTIRAEKDYKKGLLVFDKNFYGSISDFDLEYEVSDYDKGKEV
FT                   FDKLLKEYQITNQPAENKVARFYHHVYENNK"
FT   regulatory      complement(108390..108395)
FT                   /gene="lmo0965"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(108396..108863)
FT                   /transl_table=11
FT                   /gene="lmo0966"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8D8"
FT                   /protein_id="CAC99044.1"
FT                   /translation="MILTLLQNGDYETARTQALTELKNNSDNAELHYYAAWAHDALGKE
FT                   DAAIPFYEKALQLGLPADSRKEAYIGLGSTYRITGQPEKSIRLFETALQEFPDNNALRT
FT                   FSVMAKYNQGLEKEALEEALMLLTQTTSDEDILSYKKAIQFYAQDLDATFH"
FT   regulatory      complement(108870..108875)
FT                   /gene="lmo0966"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      109010..109015
FT                   /gene="lmo0967"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        109022..109690
FT                   /transl_table=11
FT                   /gene="lmo0967"
FT                   /note="similar to B. subtilis YjbM protein"
FT                   /db_xref="GOA:Q92D54"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D54"
FT                   /protein_id="CAC99045.1"
FT                   /translation="MNHWEDFLAPYKQAVEELKIKLKGMRSQFELENNHSPIEFVTGRV
FT                   KPVASILDKANQKHIALDHLVEEMQDIAGLRMMCQFVDDIEVVVRLLRQRNDFRIVEER
FT                   DYITNKKPSGYRSYHVVIEYPVETIQGEKKILAEIQIRTLAMNFWATIEHSVNYKYQGE
FT                   FPEAINKRLKRAAEAAFQLDEEMSQIREEIQEAQVYFSQNKDVSKDKKAVHQVMPKKNK
FT                   "
FT   regulatory      109705..109710
FT                   /gene="lmo0968"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        109722..110516
FT                   /transl_table=11
FT                   /gene="lmo0968"
FT                   /note="similar to conserved hypothetical proteins like to
FT                   B. subtilis YjbN protein"
FT                   /db_xref="GOA:Q8Y8D7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="PDB:2I1W"
FT                   /db_xref="PDB:2I29"
FT                   /db_xref="PDB:2I2A"
FT                   /db_xref="PDB:2I2B"
FT                   /db_xref="PDB:2I2C"
FT                   /db_xref="PDB:2I2D"
FT                   /db_xref="PDB:2I2F"
FT                   /db_xref="PDB:2Q5F"
FT                   /db_xref="PDB:3V7U"
FT                   /db_xref="PDB:3V7W"
FT                   /db_xref="PDB:3V7Y"
FT                   /db_xref="PDB:3V80"
FT                   /db_xref="PDB:3V8M"
FT                   /db_xref="PDB:3V8N"
FT                   /db_xref="PDB:3V8P"
FT                   /db_xref="PDB:3V8Q"
FT                   /db_xref="PDB:3V8R"
FT                   /db_xref="PDB:4DY6"
FT                   /db_xref="PDB:5DHP"
FT                   /db_xref="PDB:5DHQ"
FT                   /db_xref="PDB:5DHR"
FT                   /db_xref="PDB:5DHS"
FT                   /db_xref="PDB:5DHT"
FT                   /db_xref="PDB:5DHU"
FT                   /db_xref="PDB:5EJF"
FT                   /db_xref="PDB:5EJG"
FT                   /db_xref="PDB:5EJH"
FT                   /db_xref="PDB:5EJI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8D7"
FT                   /protein_id="CAC99046.1"
FT                   /translation="MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGD
FT                   GTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLK
FT                   TTVKYGIGKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAY
FT                   NKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVD
FT                   HLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED"
FT   regulatory      110523..110528
FT                   /gene="lmo0969"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        110535..111425
FT                   /transl_table=11
FT                   /gene="lmo0969"
FT                   /note="similar to ribosomal large subunit pseudouridine
FT                   synthetase"
FT                   /db_xref="GOA:Q8Y8D6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8D6"
FT                   /protein_id="CAC99047.1"
FT                   /translation="MFLEWKVETEEDGLLLRTFLKSKHISKQLLTAVKFGADGKIEVNN
FT                   EEQNVLYHVKVGDKVRLTFPTEQQNERLLAEYTNLDIVFEDDFLLIINKPAGMASIPSQ
FT                   YHPNGSVANFVKGHYEAQGLTNAIHIVTRLDRETSGLMLIAKNRFAHARLSTFLQKGLL
FT                   KRRYQAFISGVLVEQKGSIEAPIGRKEVSIMERFVTPEGKYAKTNYEVLARYRAFDHVA
FT                   IQLETGRTHQIRVHFSYIGHPLIGDDMYGGDTNLLKRQALHSCHLHLVHPLTEEYMAFD
FT                   LPLPADMEEIIQKSK"
FT   regulatory      111490..111495
FT                   /gene="lmo0970"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        111503..112291
FT                   /transl_table=11
FT                   /gene="lmo0970"
FT                   /note="similar to enoyl- acyl-carrier protein reductase"
FT                   /db_xref="GOA:Q8Y8D5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8D5"
FT                   /protein_id="CAC99048.1"
FT                   /translation="MNLSLEGKTYVVMGVANKRSIAWAIARSLNEAGAKLVFTYADDRA
FT                   KKSITELVPSLSEVNQNPLILACDVTSEEAITETFETIKDKAGKLSGLAHCIAFANKDF
FT                   LTGDYLEVDRKSFLQAHEISAYSFTAVARALKHLEMLTEDASLLTLTYLGGERVVENYN
FT                   IMGVAKASLDASVRYLAMDLGAIGVRVNAISAGPIRTVSARGVSGFSDSISLVEERAPL
FT                   KRATQAEEVGDTAYYLFSNLSRGVTGEVIHVDSGYHIIGF"
FT   regulatory      complement(112294..112334)
FT                   /gene="dltD"
FT                   /regulatory_class="terminator"
FT   regulatory      112301..112330
FT                   /gene="lmo0970"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(112319..113593)
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /product="DltD protein for D-alanine esterification of
FT                   lipoteichoic acid and wall teichoic acid"
FT                   /db_xref="GOA:Q7AP78"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="InterPro:IPR023896"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP78"
FT                   /protein_id="CAC99049.1"
FT                   /translation="MKKKLWMTFGPLLVAFAVFLFVLFGPSSLFSKVSSDTVEKSATSM
FT                   NESVIQGLDIQKKALQEGNYLPIYGSSELSRVDPFHPSVVSKKYNQGYTPFLLGRPGTQ
FT                   SLSHFLDVNALGDDLKGKKVAVVLSPQWFQPKGVSDPSFGANFSPLHAYKFALEDTKNT
FT                   PERRYAAKRLLSFQVVQSDSTLKKLLENIVAKGPKKPHDPKLLNITGNVELKILERKDD
FT                   LESKYIIGSKQDRVSKGLKELPETLDYQQLDELAKETGERSTGNNPFQVKEHYYQKKIK
FT                   PIEGKLKNSRKDLRYDQSPEFADLQLLMDAFKKAGADVIFINPPINGKWIDYIGMDKQG
FT                   LDDYYAKTKEQIESQGFRYYSLEEYQNDAFFLEDPIHLSWRGWVKIDQVLADFVKEPIQ
FT                   TNYKPTPKEYYFKEHPENGPKKDRK"
FT   CDS_pept        complement(113593..113829)
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /product="D-alanyl carrier protein"
FT                   /db_xref="GOA:Q9S389"
FT                   /db_xref="InterPro:IPR003230"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9S389"
FT                   /protein_id="CAC99050.1"
FT                   /translation="MAFRENVLEILEEITETDEVVQNTNIKLFDEGLLDSMATVQLLIE
FT                   IEEKLDITVPVSEFDRDEWATPEMIITQLEALK"
FT   regulatory      complement(113604..113609)
FT                   /gene="dltD"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(113839..113844)
FT                   /gene="dltC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(113855..115039)
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /product="DltB protein for D-alanine esterification of
FT                   lipoteichoic acid and wall teichoic acid"
FT                   /db_xref="GOA:Q7AP77"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024024"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP77"
FT                   /protein_id="CAC99051.1"
FT                   /translation="MSLPYGTILYFGVLVLFLIPIIVAGLLGKRLPIYNAFVTLVFLYF
FT                   MFSASPVQGATFIFFVFWQLALVRLYFHYRQEKKRNHGGVFVIAVILSILPLVISKVVP
FT                   ILGDHVTMVGFLGISYLTFKATQMIIEIRDNLIKQYNAWDFVNFLLFFPTISSGPIDRF
FT                   RRFKKDVDNPPSKEAYLALLNRGIFLIFLGFLYKFIIAYLVNKHFVVPLDIAITHNVDT
FT                   TKSLIGYMYAYSMYLFFDFAGYSAFAVGVSYLLGVQTPMNFNKPFAARNIKEFWNRWHM
FT                   TLSFWFRDYVFMRFVFWVTKKKWFKSKFTIAYLAYFVNFFIMGVWHGLHWYYIVYGLYQ
FT                   ATLIVGFDLFERFNKKHKFYPKNKITYVIGVIITFQFVCFGFLIFSGILDKINF"
FT   CDS_pept        complement(115036..116568)
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /product="D-alanine-activating enzyme
FT                   (dae),D-alanine-D-alanyl carrier protein ligase (dcl)"
FT                   /db_xref="GOA:Q8Y8D4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010072"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8D4"
FT                   /protein_id="CAC99052.1"
FT                   /translation="MTTSIIERIDAWAEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFL
FT                   LKNLITDKEKPIIVYGHMSPLMLVAFLGSIKSGRAYVPVDVSMPVERIEQIKKAADPSM
FT                   FICTEELPNNLTITGCPVLTQDQLMDALEKHFGEVPDKEACVNNDDNYYIIYTSGSTGN
FT                   PKGVQISQNNLVSFSNWILQDFSLSQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLD
FT                   KTITANMKDLYREIPAQNLDVWVSTPSFADLCLLDENFNQENNPRLTRFLFCGEVLAKK
FT                   TASELLDRFPDAVIYNTYGPTEATVAVTQVKVTREIIDAYPSLPLGVIKPDMRLHIVDQ
FT                   ETGEVLPEGEKGEIVLIGASVSKGYLNEPEKTDQVFFDYKGYQAYRTGDSGIIKDGYLF
FT                   FQGRLDFQIKLHGYRIELEDIENNLKKVSYIQNCAIIPKMKDEKVDMLVAQVIPTTHDF
FT                   EKEYQLSAAIKKELKEFMPAYMIPRKWIYKTDFPLTMNGKIDRKSLNSEVNK"
FT   regulatory      complement(115047..115052)
FT                   /gene="dltB"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(116577..116581)
FT                   /gene="dltA"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      116946..116951
FT                   /gene="lmo0975"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        116959..117633
FT                   /transl_table=11
FT                   /gene="lmo0975"
FT                   /note="similar to ribose 5-phosphate isomerase"
FT                   /db_xref="GOA:Q8Y8D3"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8D3"
FT                   /protein_id="CAC99053.1"
FT                   /translation="MINQKKIAGEKACEWIKDGMVVGLGTGSTVYYTIEKLGEMVNNGL
FT                   HITGVATSEETNKQAQNLGIPLKSLNDVTEIDITIDGADEIDTDFQGIKGGGGALLREK
FT                   MVASASLKNIWVVSEEKLVRNLGKFPLPLEVIPFGWKQVERKLEKEHIQTNLRKQSSGE
FT                   VYVTNNGNYILDIVNQTFTDAEMWQEKLAQIPGIVEHGLFLHYVDIIICAKANGEIELI
FT                   KK"
FT   regulatory      117624..117667
FT                   /gene="lmo0975"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(117631..117662)
FT                   /gene="lmo0976"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(117669..118112)
FT                   /transl_table=11
FT                   /gene="lmo0976"
FT                   /note="similar to B. subtilis YjcF protein"
FT                   /db_xref="GOA:Q8Y8D2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8D2"
FT                   /protein_id="CAC99054.1"
FT                   /translation="MTVKKVTDDIGKQAALKIRNDVFVVEQRVDPALEWDEFDEIDSVV
FT                   MFVDYAEDGTPLATGRFREKDGYGKVERICTQKVARGTGSGRRIMEAIESEAKSRGLTT
FT                   LKLGAQVTAIPFYEKLGYETCSGLFLDAGIEHKDMKKTLTYEI"
FT   regulatory      complement(118121..118126)
FT                   /gene="lmo0976"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(118130..118879)
FT                   /transl_table=11
FT                   /gene="lmo0977"
FT                   /note="similar to B. subtilis YjcH protein"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8D1"
FT                   /protein_id="CAC99055.1"
FT                   /translation="MTANKMLDEKFYSKSLGEELDLIICLPPDFSPLYKYPLFIVQDGK
FT                   DYFQFGKLARHSEELALNEQIQKAIFIGIPYKTVMDRREKYHPDGKQNDAYIKFLAFEL
FT                   VPYLEERFPSFQMPTSRFLMGDSLGASVSLKAALLFPFTFGNVILHSPYVDDTILTLAE
FT                   KVDPSKVKIFHIIGDQETAVETTGNEVLDFLSPNKSLEQILTTRGFDYYFHVFNGDHRW
FT                   KYWQPFIKDSLQYMLPVNTFDLESMRA"
FT   regulatory      complement(118888..118893)
FT                   /gene="lmo0977"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      119086..119091
FT                   /gene="lmo0978"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        119098..120117
FT                   /transl_table=11
FT                   /gene="lmo0978"
FT                   /note="similar to branched-chain amino acid
FT                   aminotransferase"
FT                   /db_xref="GOA:Q8Y8D0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8D0"
FT                   /protein_id="CAC99056.1"
FT                   /translation="MSKDIDWSNLGFSYIKTDKRYISYWKDGEWDEGALTEDNTLHISE
FT                   GSTALHYGQQCFEGLKAYRCKDGSINLFRPDRNAARIQKSCERLLMPHIPTEKFIDAVM
FT                   QVVRANEEFVPPYGTGATLYLRPFVIGVGDNIGVHAAPEYIFSVFCSPVGPYFKGGMAP
FT                   TNFIVSDFDRAAPNGTGAAKVGGNYAASLLPGQAAKERNFGDCIYLDPATHTKIEEVGS
FT                   ANFFGITKDDKFVTPYSPSILPSITKYSLLYLAEHRLGLEAVEGDVYIDKLDEFKEAGA
FT                   CGTAAVITPIGGIQTKDDFHVFHSETEVGPVTKRLFDELCGIQFGDVEAPEGWIYKVK"
FT   regulatory      120125..120143
FT                   /gene="lmo0978"
FT                   /regulatory_class="terminator"
FT   regulatory      120297..120302
FT                   /gene="lmo0979"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        120313..121077
FT                   /transl_table=11
FT                   /gene="lmo0979"
FT                   /note="similar to daunorubicin resistance ATP-binding
FT                   proteins"
FT                   /db_xref="GOA:Q8Y8C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8C9"
FT                   /protein_id="CAC99057.1"
FT                   /translation="MKEVMIKATGLEKSFKKTEVLKGVDFEVKHGEIFALLGSNGAGKT
FT                   TTIQILATLLKADNGNAHISGFDVKTEPEKVRKHISLTGQFAAVDGLLTGRENILLIAK
FT                   LRGEKNPAQTADDLLARFGLEKAADRRADTYSGGMTRRLDIAMSLVGSPDVIFLDEPTT
FT                   GLDPEGRMEVWKTIKTLSDGGTTILLTTQYLDEAEQLADRIAILHGGTIIANGTLDELK
FT                   KLFPPAEVEYIEKQPSLEEIFLAIINGKEEVK"
FT   regulatory      121061..121066
FT                   /gene="lmo0980"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        121074..121826
FT                   /transl_table=11
FT                   /gene="lmo0980"
FT                   /note="similar to ABC transporter transmembrane component"
FT                   /db_xref="GOA:Q8Y8C8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8C8"
FT                   /protein_id="CAC99058.1"
FT                   /translation="MKAVRDTSILFGRSMRHIMRSPDTIITVAIIPIMIMLMFVYVLGG
FT                   AIQTGTDNYVDYLLPGIILMAIASGIAYTAVRLFTDVQKGLFQRFHSMPISRSSVLWGH
FT                   VLTSLVSNAISIVLIILVALLIGFRSSAGIVEWLAVAGILLLFTLALTWVAVIPGLTAK
FT                   SVDGASAFSYPLIFLPFISSAFVPTDTMPTAIRVFAENQPVTAIVNTIRALLYSEPIGN
FT                   DIWIALAWCVGITVVAYVFAVTIYKKMV"
FT   regulatory      complement(121825..121857)
FT                   /gene="lmo0981"
FT                   /regulatory_class="terminator"
FT   regulatory      121836..121868
FT                   /gene="lmo0980"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(121860..123335)
FT                   /transl_table=11
FT                   /gene="lmo0981"
FT                   /note="similar to efflux transporter"
FT                   /db_xref="GOA:Q8Y8C7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8C7"
FT                   /protein_id="CAC99059.1"
FT                   /translation="MEQTKVKAVTIAVFVATFMAAIEGTIVSTAMPTIVSQLDGIELMN
FT                   WIFSVYLLTSAVTVPIYGKLSDLYGRKNIFVIATIIFIIGSSLCGFAQNMEQLIIFRAI
FT                   QGIGAGGILPSTMTIIADVYPFEKRAKVLGFMGSAWGIAGVFGPLVGGFLVDQLSWHWI
FT                   FFINVPIGILTILLILLYLREKVEHVKLPIDYLGASLFTVALLGLLFALQRAGESLNWT
FT                   EPLVVILFAVSIVLFIAFYFVEKRAKDPIMPFVLFKNPVVLIGNLIGFLISAFLIGINV
FT                   YIPMWAQGMLGHGATIAGFMLAPLSVTWIIGSFIGGKLLMTLGNRHTVGIGVLITAASG
FT                   LILALFPASTNDIFFYLNSAFMGFGFGIIFTTTTVTVQDAVPRFQTGIATASNTLFRTV
FT                   GQTIGVAVFGTIFNSVLTSEFRAAAGSEVNRSNLNQLISPQTSGNVSTDLVDPLRDILY
FT                   SGLHTVFWVMFACCIVSYFIHFILPKKHISGEK"
FT   regulatory      complement(123343..123348)
FT                   /gene="lmo0981"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      123462..123467
FT                   /gene="lmo0982"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        123475..124527
FT                   /transl_table=11
FT                   /gene="lmo0982"
FT                   /note="similar to glucanase and peptidase"
FT                   /db_xref="GOA:Q8Y8C6"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8C6"
FT                   /protein_id="CAC99060.1"
FT                   /translation="MSYEPNTKETMQKIKELTSIPSPTGNTGKIIEKLAKDLDASKIPY
FT                   RLNNKGGLIVTLPGKDETKHRMLTAHVDTLGAMVKEIKADGRLLLTLIGGYRFNAIEGE
FT                   YCTIETSAGDLYSGTILMHQTSVHVYKDAGTAERNDKNMEVRLDVKALDADKVRALGIE
FT                   VGDFVSFDPRVQIINDEYIKSRHLDDKASVAILLQLINHIHENNLELPHTTHFLISNNE
FT                   EIGYGGNSNIPAETVEYLAVDMGALGDGQTSDEYTVSICAKDGSGPYHLGLRKHLVELA
FT                   KKNNIDYKVDIYPFYASDASAAINAGNDIIHGLIGPGIDASHAYERTHRDSLYHTEKLV
FT                   YAYLFSNILK"
FT   regulatory      124526..124531
FT                   /gene="lmo0983"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        124540..125019
FT                   /transl_table=11
FT                   /gene="lmo0983"
FT                   /note="similar to glutathione peroxidase"
FT                   /db_xref="GOA:Q8Y8C5"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8C5"
FT                   /protein_id="CAC99061.1"
FT                   /translation="MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLE
FT                   AMYKKLGGDNFEILGFPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASP
FT                   LYKYLTEQTGGKKVEWNFAKFLIDENGEVIERFPSKMKPEDFEDKVEALVAKVNN"
FT   regulatory      125026..125065
FT                   /gene="lmo0983"
FT                   /regulatory_class="terminator"
FT   regulatory      125140..125145
FT                   /gene="lmo0984"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        125153..125608
FT                   /transl_table=11
FT                   /gene="lmo0984"
FT                   /note="weakly similar to two-component response regulator"
FT                   /db_xref="GOA:Q8Y8C4"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8C4"
FT                   /protein_id="CAC99062.1"
FT                   /translation="MKFHVKQNNNLAVGEVDVYCHPDNLEEVTNIVMGIDEPTEKISVK
FT                   KDGATYLLEPKAILYFEAVESKIFVYTEKEIYEIHWKLYELEEKFKDSSFFRCSKSMIL
FT                   NIEWIEKIAPGFHGKFEAKLFNREKVIISRQYAKVLKQKLNMGGKRK"
FT   regulatory      125590..125595
FT                   /gene="lmo0985"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        125605..126033
FT                   /transl_table=11
FT                   /gene="lmo0985"
FT                   /db_xref="GOA:Q8Y8C3"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8C3"
FT                   /protein_id="CAC99063.1"
FT                   /translation="MSTKLIQFIQSACIIFSASIITMICSYIATGESETVAIRDIFIML
FT                   GFSIVTTFIQQLFFNNSVKTKLAFYSRLIAFFLFIGAAILGLGWLLDWYHNIAGFMIIF
FT                   GFICVTFLVMHIFFSFRDVKFSNEINQKLAEMRERETK"
FT   regulatory      126019..126024
FT                   /gene="lmo0986"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        126030..126941
FT                   /transl_table=11
FT                   /gene="lmo0986"
FT                   /note="similar to antibiotic ABC transporter, ATP-binding
FT                   protein,"
FT                   /db_xref="GOA:Q8Y8C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8C2"
FT                   /protein_id="CAC99064.1"
FT                   /translation="MIKLTNVVKKFGKIEAVKGINLEVEKGSLFAFLGENGAGKSTTLS
FT                   MICTESEPTSGEIYIDDEKLTFKNRKLFRQKLGVVFQENVLDDLLTVRENLYNRASLYG
FT                   KTKAEITERLALVSSIMGIEDILNRRFEKLSGGQKRRAEIARAIMHDPEILLLDEPTTG
FT                   LDPKTRVSVWKIIDYLREELGMTVFLTTHYLEEAKDADQLAVIHKGKIIAQGTPTNIRS
FT                   RFSVDKIFFYDAKVAELQKIMKKANLPFKVSKATMRVDVITQDVEILAILNQAAGLYGS
FT                   FEVIKGNLDDAFISMIKEESDD"
FT   regulatory      126922..126927
FT                   /gene="lmo0987"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        126934..127788
FT                   /transl_table=11
FT                   /gene="lmo0987"
FT                   /note="similar to Streptococcus agalactiae CylB protein"
FT                   /db_xref="GOA:Q8Y8C1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8C1"
FT                   /protein_id="CAC99065.1"
FT                   /translation="MISRNLKIYFRDRTAVFMSLLTVLIIIGLYAIFLGNNMEEMFKQA
FT                   SGKTVGIQELVNTWVIAGILSITPVTVSLAVFSLKVHDEELSIARSFAITSASRWRIVI
FT                   SYIVSGLVASFLLSVITLFVGEMYIWLTGGEFLPFESWIRLIGIILINVLCCSSIMFFI
FT                   ASLVKKASAFSSVSTIVGTVIGFIAGIYLPIGSLPAAVQTAMKCFPFTYGASTIREIMT
FT                   KEPLKEVFAGNTGAMDATKEMIGITIYWGDKTVTTGLSLLILSAFAVVFGVLSVILMKR
FT                   QTK"
FT   regulatory      127855..127860
FT                   /gene="lmo0988"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        127870..129438
FT                   /transl_table=11
FT                   /gene="lmo0988"
FT                   /note="similar to peptide chain release factor 3 (RF-3)"
FT                   /db_xref="GOA:Q8Y8C0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8C0"
FT                   /protein_id="CAC99066.1"
FT                   /translation="MSQDLQKEVASRKTFAIISHPDAGKTTITEQLLLFGGVIRSAGTV
FT                   KGKKSGKFATSDWMEIEKQRGISVTSSVMQFDYNGSRINILDTPGHSDFSEDTYRTLMA
FT                   VDSAVMVIDAAKGIEAQTLKLFKVCRMRGIPIFTFINKMDRQGKMPLELLAELEEVLGI
FT                   ESYPMNWPIGMGKELAGLYDRYHRVIEQYRSEEDERFLPLGEDGDLKEAHAIQKSLYYD
FT                   QALEEIMLLDEAGNDFSRERIIAGEQTPVFFGSALTNFGVETFLRTFVDFAPAPSSHES
FT                   NEGVIEADNPKFSGFIFKIQANMNPAHRDRIAFIRICSGEFERGMNVTLTRTGKSLKLA
FT                   NSTQFMADDRETVNRAVAGDIIGLYDTGNYQIGDTITNGSKKLEFEKLPQFTPELFMRV
FT                   YAKNVMKQKHFHKGVEQLVQEGAIQLFKTWRTEEYIIGAVGQLQFEVFEHRMRGEYNSE
FT                   IRMEPIGKKIARWVKEEDADEKLSTARSMLVKDRFDQPLFLFENEFAINWFNDKNPDIE
FT                   LTSLL"
FT   regulatory      129445..129485
FT                   /gene="lmo0988"
FT                   /regulatory_class="terminator"
FT   regulatory      129532..129537
FT                   /gene="lmo0989"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        129545..129970
FT                   /transl_table=11
FT                   /gene="lmo0989"
FT                   /note="similar to regulatory proteins (MarR family)"
FT                   /db_xref="GOA:Q8Y8B9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8B9"
FT                   /protein_id="CAC99067.1"
FT                   /translation="MRREKTMDTLIRSIMIKSKRKMDAKVAQFGLTTQQARVLGFLNDN
FT                   AANEIIQKDLQRIFQTRGASITSLIQGLEKKQLISRKPSIRDGREKVVTLTEEGKRIVD
FT                   EFNESFPREDDKAKKILSADEYKIFIDLLSKIDDNTE"
FT   regulatory      130009..130014
FT                   /gene="lmo0990"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        130022..131383
FT                   /transl_table=11
FT                   /gene="lmo0990"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8Y8B8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8B8"
FT                   /protein_id="CAC99068.1"
FT                   /translation="MKHSDNYYLTKASIPKAIAHLSIPMMLGMSVGVIYNIVNAFFIGL
FT                   LHDTSMLTAVTLGLPMFTILMAIGNMFGVGGGTYISRLLGKEEGTKAKQVSAFVLYGSL
FT                   VLGILCAILLGFLINPVTHFLGADATSFLHTKNYTLALLICSPFIIANFALEQVVRAEG
FT                   ASRVSMNGMLIGTVVNLVFDPLLILYFDFNVVGAAVSVGLASLFSLIYYAWYLEKKSDY
FT                   LSIRFKWFQASKEIVQNVFKIGVSELLLSLFLIVTTLVLNHYSMIYGEGVVAGFGVALR
FT                   VVQLPEFICMGLYMGIIPLLAYNYGSGNIARFEKAIRFTAISIGLIVLLLSSLVFIFRF
FT                   QVMHLFSDSQSVITLGVHIMVAMLISSLFSGFTGLFTSTFQAIGKAIPATIMSVSQGII
FT                   FIPVIILGQHYFGLMGVIWSLTATEILTCIIGVTLFTIHNIKIASSAKTKDLAV"
FT   regulatory      131649..131654
FT                   /gene="lmo0991"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        131665..132432
FT                   /transl_table=11
FT                   /gene="lmo0991"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8Y8B7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR013055"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8B7"
FT                   /protein_id="CAC99069.1"
FT                   /translation="MDTAMILEYGWVLLVLIGLEGILAADNAVVMAVMVKHLPDKQQKK
FT                   ALFYGLMGAFVFRFGALFLISFLANVWQVQALGAAYLLYIAISHIWKHAKGKDGEKEKK
FT                   EKAGSGFWMTVLKVEIADIAFAIDSMLAAVALAITLPETGWGHIGGIDTGQFAIMFLGG
FT                   LVGLIIIRFAATQFVKLLKSYPSLETAAFLIVGWVGVKLVIYTLAHPSLGVIPHSFPES
FT                   TLWKLIFWGVMILIIVWGWFVSYRSKKKTETTK"
FT   regulatory      132518..132523
FT                   /gene="lmo0992"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        132535..133302
FT                   /transl_table=11
FT                   /gene="lmo0992"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8Y8B6"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8B6"
FT                   /protein_id="CAC99070.1"
FT                   /translation="MDVSIWGEYALVFLVLVVLEGILSADNAVVMAVIVKGLPHDKQRK
FT                   ALFYGLVGAFVFRFVALFLISFLVKIWEIQAIGAVYLLYLAIKHMWRLKKGKQEEVKEA
FT                   SEAKSTSFWGVVARVELTDIAFALDSMLAAAALVVTLPDLGNFDIGGMNGGQFIVMFLG
FT                   GIAGLVVIRFAATQVVKLLERYPTLETAAFLIVGWVGVKMAVLTLAHPSVAIIPGDFPD
FT                   SAVWKLTFWSVMIIIGLGGYIIARKKEKKTKRV"
FT   CDS_pept        133346..134680
FT                   /transl_table=11
FT                   /gene="lmo0993"
FT                   /note="similar to Na+-transporting ATP synthase subunit J"
FT                   /db_xref="GOA:Q8Y8B5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8B5"
FT                   /protein_id="CAC99071.1"
FT                   /translation="MARMTPVQVIIAYYFLAVTISTIVLSLPFTLQKGVKVSFIDTLFT
FT                   AASSVSVTGLTTVDVSQTYSTAGIWVLMAIFQIGGLGVMMISTFFYLILKRRIGLKQRQ
FT                   LIMTDTNQFTMSGMVRMLREILVLIFGIELIGALILGIYFIPLYPNFWDAMFQGLYNSV
FT                   SLVTNAGVDITGKSLMPFANDYFVQFISILLIIAGAIGFPVLLETRRFLFEKNTLIPFR
FT                   FSLFVKVTTLTYFVLLIVGGLLIWLFEYHHFFSGKSWDFGFFNSMFLSATSRSAGLQTI
FT                   DSGALSISTLLLVSFLMFIGASPSSVGGGIRTTTFAITILFIYSVIRGRKHVYIFGREL
FT                   HQEDVRKSLAVTLVAGFLSISAIVVLMQTETASLIAVIFEVFSAFGTTGLSVGLTPDLS
FT                   TPGKIIIIALMFIGRVGIMYSMLSLRNKNQPKNAIRLPKEKIITG"
FT   regulatory      134689..134721
FT                   /gene="lmo0993"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(134719..134754)
FT                   /gene="lmo0994"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(134761..135129)
FT                   /transl_table=11
FT                   /gene="lmo0994"
FT                   /db_xref="GOA:Q8Y8B4"
FT                   /db_xref="InterPro:IPR025273"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8B4"
FT                   /protein_id="CAC99072.1"
FT                   /translation="MGSRKPEIIIGLIGSIIGILVGFWIINYGDSVTDYIQTFTYLPGE
FT                   LGNELANLGWITLIASVVALIASLLIKSAPRGWGVILVIIGIVLFFVIGTAWIISGILI
FT                   TLTGLMGIFRRPVPKSKY"
FT   regulatory      complement(135137..135142)
FT                   /gene="lmo0994"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(135159..136190)
FT                   /transl_table=11
FT                   /gene="lmo0995"
FT                   /note="similar to B. subtilis YkrP protein"
FT                   /db_xref="GOA:Q8Y8B3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8B3"
FT                   /protein_id="CAC99073.1"
FT                   /translation="MTQSALKRESYFDNAKFILIFLVVFGHFLQTFIADYAGVRVLYIY
FT                   IYTFHMPAFVLISGFFAKSFGKPGYLKKTMKKLILPYVFFQLIYSIFYYFLLSKDNLSI
FT                   QLLDPEWSLWFLLSLFFWNIMLFIFAKIKPWKSICIALFVGLVAGYFDIIGGYLSLSRT
FT                   LVFFPFFLVGYFLKKEHFYYLKTHFVMILGGIFIVLLLSFITLHPNLNDKWFLGSKPYA
FT                   NFVEVKSLGLFIRALVYLISFGSIAAFFSFIPRKRLFFTKWGKNTLYVYLLHGFFIKFF
FT                   REGSQTDFQYSPSTFLLLFVVTFVLTVLLSSRLVKIFVQPVIELRVSMLRDVFSRLTKR
FT                   ESY"
FT   regulatory      complement(136202..136207)
FT                   /gene="lmo0995"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      136361..136366
FT                   /gene="lmo0996"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        136376..136855
FT                   /transl_table=11
FT                   /gene="lmo0996"
FT                   /note="similar to methylated-DNA-protein-cystein
FT                   methyltransferase"
FT                   /db_xref="GOA:Q8Y8B2"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8B2"
FT                   /protein_id="CAC99074.1"
FT                   /translation="MLKRQKASPVGELFITIEDGCIMNISYDKPRNWELLDGNIIEKEL
FT                   FQELMIQLASYFEGERENFDLPMLLKGTDFQKKVWQALSEIPYGAVVSYKDIAISAGSP
FT                   KAVQAVGQANRANPIPIIIPCHRCVKSNGELGGYNGTDVDKKQYLLALEKGLSLS"
FT   regulatory      complement(136827..136863)
FT                   /gene="clpE"
FT                   /regulatory_class="terminator"
FT   regulatory      136833..136869
FT                   /gene="lmo0996"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(136871..139045)
FT                   /transl_table=11
FT                   /gene="clpE"
FT                   /product="ATP-dependent protease"
FT                   /db_xref="GOA:Q8Y8B1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8B1"
FT                   /protein_id="CAC99075.1"
FT                   /translation="MNCEKCNQNPATIQLYMNINGKRVEMPLCASCYAEVRNQANFGSN
FT                   EFPGASGSPFDDIFRQLSGAANQANREQRSQANAQVQTQTAGGGNGILDEFGTNLTDMA
FT                   KNEQLDPVIGRDKEIKRVIEILNRRNKNNPVLIGEPGVGKTAVVEGLANAIVAGDVPSK
FT                   LMNKEVILLDVASLVSGTGIRGQFEERMKQLIKELQERKNTILFIDEVHTIVGAGSAEG
FT                   SMDAGNILKPALARGDLQMIGATTLKEYRTIEKDAALERRFQPVTVSEPSTKETLTILN
FT                   GLKPKYEDFHEVVYSPEALTAAVELSARYIQDRHLPDKAIDLMDEVGSKYNLSIEKLDE
FT                   NTVSERVARLEDEKNQALQMEDYEKAAKVRDEITRLEENKTSNSFSERPVIQASDIQAI
FT                   IEEKTGIPVGRLQEDEQSKMKNLERNLTGKVIGQEDAVKKVAKAIRRSRVGLKSKNRPI
FT                   GSFLFVGPTGVGKTELGRTLARELFGTSEAMIRLDMSEFMEKHSISKLIGSPPGYVGHE
FT                   EAGQLTEKVRRNPYSIILLDEIEKAHPDVQHMFLQILEDGRLTDSQGRTVSFKDTVIIM
FT                   TSNAGATDTEASVGFNTTTETKLEKGSDILAKLGAYFKPEFLNRLDSVIEFKSLEKDDL
FT                   VQIIDLMLVDLNEMLAQEGVTIDVSKEVKEHLIDLGYDPKFGARPLRRTIQEHLEDTIA
FT                   DSLIDQPEAKNLVATLNDNKEITITEQVTA"
FT   regulatory      complement(139055..139060)
FT                   /gene="clpE"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(139165..139193)
FT                   /gene="lmo0998"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(139208..139819)
FT                   /transl_table=11
FT                   /gene="lmo0998"
FT                   /note="similar to hypothetical protein"
FT                   /db_xref="GOA:Q8Y8B0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8B0"
FT                   /protein_id="CAC99076.1"
FT                   /translation="MKSIKIDYKLVLGLVLCALLVILTYQFPRVFWYLYGAGMLFLLSF
FT                   VIFNDDLKKEFSFVKGILPGIFSGIVLYIIFYIGAFIIKVMPGGLEHSVEAAFNKYSTH
FT                   SLIIWLLLIVAIIPGEEIFWRGFVLKRLNHYFNPWFSNVFAALLCMVMMFPSGNFAAII
FT                   GIFVASLVWNIMYSYRPSLLMLYLSHLTFAFLLLAALPIY"
FT   regulatory      complement(139831..139836)
FT                   /gene="lmo0998"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      139950..139955
FT                   /gene="lmo0999"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        139965..140756
FT                   /transl_table=11
FT                   /gene="lmo0999"
FT                   /db_xref="GOA:Q8Y8A9"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8A9"
FT                   /protein_id="CAC99077.1"
FT                   /translation="MLEKNYKFLLWIYIFWFLGSVLLVSLHIIPPELTAVQSLFLVFTG
FT                   VFAAVFFIMQYGKWLGSAITLLIFVVSTCIEWMQLSYTDEYIGSTLGGSVYGIPITMGF
FT                   IWVGMVAGTHIIAREITLKINIDWIRGGIYSFIAATMVMIFEVLIEPITMQSKQLYITQ
FT                   NGFTILQLSDFINWWLLGLILHLMIYFILSLTDSWERLKYPDLKSEIVIVYWIIIAFFV
FT                   FLSFYLDLWTSIAIIIVSNIIFTACYFFSLEKETQTKKKSE"
FT   regulatory      140741..140766
FT                   /gene="lmo0999"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(140744..140772)
FT                   /gene="lmo1000"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(140757..142229)
FT                   /transl_table=11
FT                   /gene="lmo1000"
FT                   /note="similar to phytoene dehydrogenase"
FT                   /db_xref="GOA:Q8Y8A8"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8A8"
FT                   /protein_id="CAC99078.1"
FT                   /translation="MNLDSKKKIAIIGAGPGGLAAGMLLSQLGYQVNIYEKNDRIGGRT
FT                   ALHRMGKYSFDVGPSALTMTHVLTSLFMDCNRNILDYVSLLPINPIHTLYFKDITFPLY
FT                   SDQSETKAVIQTYFPGEEDGFDRFMKENTKKMLYISPLNQFNYSSLFDFFRPTTLRAIP
FT                   SLTLGRSLMDDLSRYFNSKYLRLAFSLQMRYLGMSPWDIPAAYSIIPFSEYYYGTFHPI
FT                   GGQNKIVEAMQQVVTENKGKFFFNSEVTEFESNGKEITGAVLANGKTIEADYYFTNLDF
FT                   IYSLTNEHPDKLDTKEYSSSAFILYLGLKTVLPFSHQSIIFPENYREFAHNTMHKKILS
FT                   KDIAIHLTNPSATDNTMAPINHSSIRIMVPVPNNTSNIDWKKETPAFRQLVLETVKERL
FT                   EIPDLESQIEEEYIITPIDWEKKYHVKHGAIFGLQHLWRQHGYLHPSKKSPKFKNLFVI
FT                   GAGAMSGSSLPFIIENAQIATQKFLQKEKKSE"
FT   regulatory      complement(142241..142246)
FT                   /gene="lmo1000"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(142254..142310)
FT                   /gene="lmo1001"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(142333..142617)
FT                   /transl_table=11
FT                   /gene="lmo1001"
FT                   /note="similar to B. subtilis protein YkvS"
FT                   /db_xref="InterPro:IPR018690"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8A7"
FT                   /protein_id="CAC99079.1"
FT                   /translation="MHTFFFSKIEATPKIEGVITMAKAHVGDIIEFKDGLTGIVEKLNE
FT                   NSVIVDLTYMENFKDLGIEEKTVVNHKNYQIIHSVEEDDEVENAEETEE"
FT   regulatory      complement(142626..142631)
FT                   /gene="lmo1001"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      142909..142914
FT                   /gene="ptsH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        142924..143190
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /product="PTS phosphocarrier protein Hpr (histidine
FT                   containing protein)"
FT                   /db_xref="GOA:P0A438"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A438"
FT                   /protein_id="CAC99080.1"
FT                   /translation="MEQASFVVIDETGIHARPATLLVQAASKYSSDVQIEYTGKKVNLK
FT                   SIMGVMSLGIGKGADITIYTEGSDEKEAIEGLTEVLKKEGLAE"
FT   regulatory      143175..143180
FT                   /gene="lmo1003"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        143190..144908
FT                   /transl_table=11
FT                   /gene="lmo1003"
FT                   /product="phosphotransferase system enzyme I"
FT                   /db_xref="GOA:O31149"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31149"
FT                   /protein_id="CAC99081.1"
FT                   /translation="MAKELKGIAASDGIAIAKAYLLVEPDLSYEKTEVTDVESEVKRFE
FT                   SALEVSRTELSMIREKAAKDLGEDKAQIFDAHLLVLNDPELTGPIEESIKNSKTNAETA
FT                   LQETTDMFIGMFESMDNEYMRERAADIKDVRKRVLSHLLGVTIPNPALIDEEVVVVAAD
FT                   LTPSDTAQLNRNFVKGFVTDIGGRTSHSAIMARSLEIPAVVGTKEVTASVAKNDIVIID
FT                   GLEGNVIIHPTEEQIAHYEKIKSDFALQQAEWDKLKNEKTVSKDGVHVELAANIGTPND
FT                   LEGVISNGGEAVGLYRTEFLYMGRDNFPTEEEQFEAYKAVVSGMDGKSVVVRTLDIGGD
FT                   KTLPYLELPEEMNPFLGFRAIRLCFANEELFRTQLRALLRASVYGNLKIMFPMIATVNE
FT                   FRQARDILLDEKAKLKAAGTEVSDSIELGIMIEIPAAAVLADQFAKEVDFFSIGTNDLI
FT                   QYTMAADRMNERVSYLYQPYNPSILRLVKMVIDASHKEGKWTGMCGEMAGDQTAVPLLL
FT                   GLGLDEFSMSASSILKSRSLIKRLDQSEMVKLAEEALNKSTAEEVVELVEKYTAE"
FT   regulatory      144921..144947
FT                   /gene="lmo1003"
FT                   /regulatory_class="terminator"
FT   regulatory      145007..145012
FT                   /gene="lmo1004"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145021..146055
FT                   /transl_table=11
FT                   /gene="lmo1004"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8Y8A6"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8A6"
FT                   /protein_id="CAC99082.1"
FT                   /translation="MVIYLLAGFFLLLFIVLSFIDRRRISNGIILTMALFFSVLSVVYA
FT                   TFSKGNELLVSVMGTVLLLLVLLIPFFVVGIATMLIVNGRLMLKREGRKLANMLPLIIG
FT                   LGILALIITWFGSILKTGSPILGIVVVFIVALVGYFSFLFLSFLLSTFLYQFNFPRYNQ
FT                   DFLIVLGSGLIGGDRVPPLLASRLNRAIKFYDKQYAKKGKRATFIVSGGQGANETISEA
FT                   EAMRGYLIEQGIDENFIIMEDQSVNTLQNMKFSKAKMDAIMSNYNSLFSTNNFHLFRAG
FT                   IYARKAGLKSQGIGAKTALYYMPNALIREFIAITVMYKKVHMVLLGLLLLFFAFLAIIG
FT                   VTFR"
FT   regulatory      146054..146059
FT                   /gene="lmo1005"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        146068..146928
FT                   /transl_table=11
FT                   /gene="lmo1005"
FT                   /note="similar to 3-hydroxyisobutyrate dehydrogenase (B.
FT                   subtilis YkwC protein)"
FT                   /db_xref="GOA:Q8Y8A5"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8A5"
FT                   /protein_id="CAC99083.1"
FT                   /translation="MEKIGFVGTGVMGSSMAGHLLEAGYEVLVYTRTKTKAEDLLDKGA
FT                   LWVETPGELANKVDILISMVGYPKDVEELYLGENGFLENLAVGTVAIDMTTSSPALAKK
FT                   MAEFGREKGIGVLDAPVSGGDIGAKNGTLSIMVGGSEDVFLKVKPIFDILGSSVILQGD
FT                   AGAGQHTKMVNQIAIASNMIGVTEAIIYAEAAGLNPSRVLDSISGGAAGSWSLANLIPR
FT                   VLKDDFSPGFFIKHFIKDMGIAISEAKQMGLELPGLTLAEKMYQTLAEQGLSEEGTQAL
FT                   IKYYR"
FT   regulatory      146939..146974
FT                   /gene="lmo1005"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(146971..148116)
FT                   /transl_table=11
FT                   /gene="lmo1006"
FT                   /note="similar to aminotransferases (to B. subtilis PatA
FT                   protein)"
FT                   /db_xref="GOA:Q8Y8A4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8A4"
FT                   /protein_id="CAC99084.1"
FT                   /translation="MTKSIRPELRDIQVSGIRTFNTRVTGIPDMIRLTLGEPDFPTPDH
FT                   VKQAAISAIEENFTNYTPNAGMPELLEAASIYFHEKYDLSYSNKEIIVTVGATEAISVA
FT                   LQTILEPGDEVILPDPIYPGYEPLITLNKAHPVKVDTTETNFKLTPEQLKAHITPKTKA
FT                   LIIPYPSNPTGVTLSKDELSALAEVLKETGIFVIADEIYSELTYHEEHVSIAPMLRDQT
FT                   IVINGLSKSHAMIGWRIGFLLAPEILTQEMLKIHQYSVTCASSISQKAALEAITNGKDD
FT                   AFQMRTEYKTRANFTQDRLEKMGFTVIPPDGAFYFFVKLPDEIAENSFDWAVKLAEEAK
FT                   VAVVPGNAFSEKGDRYFRLSYATSFNNLAEALDRMAQFVEK"
FT   regulatory      complement(148123..148129)
FT                   /gene="lmo1006"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      148321..148326
FT                   /gene="lmo1007"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        148336..148557
FT                   /transl_table=11
FT                   /gene="lmo1007"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D15"
FT                   /protein_id="CAC99085.1"
FT                   /translation="MTKPGKYEALFFPTKDGLLKIHAYGFNPCGSWGEVFATIGDQTIC
FT                   VKGFNRHKTIVRATKMIISATANRKNEF"
FT   regulatory      148566..148608
FT                   /gene="lmo1007"
FT                   /regulatory_class="terminator"
FT   regulatory      148850..148855
FT                   /gene="lmo1008"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        148863..149096
FT                   /transl_table=11
FT                   /gene="lmo1008"
FT                   /note="similar to B. subtilis YkuJ protein"
FT                   /db_xref="InterPro:IPR014904"
FT                   /db_xref="InterPro:IPR038073"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D14"
FT                   /protein_id="CAC99086.1"
FT                   /translation="MSQLLGIIQRLHAMQEDESAETQARRFEKNGTPVCEVKFFQASNS
FT                   FEVEIYGDNSKYQFDDIDMTAIEIFETLQENE"
FT   regulatory      149135..149167
FT                   /gene="lmo1008"
FT                   /regulatory_class="terminator"
FT   regulatory      149284..149289
FT                   /gene="lmo1009"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        149297..149749
FT                   /transl_table=11
FT                   /gene="lmo1009"
FT                   /note="similar to B. subtilis YkuL protein"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8A3"
FT                   /protein_id="CAC99087.1"
FT                   /translation="MISNRFGQFIDNELADSMISAEKVAHVQLGNNLEHALLVLTKCGY
FT                   SVIPVLDFEFKLHGLISAAMITDAILGLERIEFERLEDLKVEDVMQTDFPVIKDFNNNE
FT                   RIVHLLVDHPFVCVVDSDHHFEGIVTRRVVLKQVNRYIHLQVEENR"
FT   regulatory      149733..149738
FT                   /gene="lmo1010"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        149746..150624
FT                   /transl_table=11
FT                   /gene="lmo1010"
FT                   /note="similar to transcription regulator (LysR family)."
FT                   /db_xref="GOA:Q8Y8A2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y8A2"
FT                   /protein_id="CAC99088.1"
FT                   /translation="MIVTEYELLVCLAEELNMRKSAEKLFLSQPALSQRLQTIESRWNT
FT                   KIFIRTQKGLLLTPEGEAIVRHASSVIEREHTIQEKLEAMEGVVRGTLRIACASVVAQM
FT                   WLPRVLKAFSRAYPNVQISLVTGWSSEVTQQLAAGNVHIGIVRGSSTWKSVQKPLFNDK
FT                   LILVDTEITKIEEVFQTNRPFIQFRSDSNYYQVIQDYWQRNFGKMPRQAMLMDQMETSR
FT                   QMALNGIGFAILPEVTMLGYTDKINKIPLTEKDGSILSRETNLLTYEQSLSLPQVKAFL
FT                   EITDKFLEQVK"
FT   regulatory      150657..150662
FT                   /gene="lmo1011"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        150672..151382
FT                   /transl_table=11
FT                   /gene="lmo1011"
FT                   /note="similar to tetrahydrodipicolinate succinylase"
FT                   /db_xref="GOA:Q8Y8A1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8A1"
FT                   /protein_id="CAC99089.1"
FT                   /translation="MEQMDAHQIISFIQNSKKATPVKVYLKGDLEKIDFPSDVKTFITG
FT                   NAGTVFGEWAVVEPLLEANKANIEDYVIENDRRNSAIPLLDMKNINARIEPGAVIRDQV
FT                   TIGDNAVIMMGASINIGSVIGDGTMIDMNVVLGGRATVGKNCHIGAGSVLAGVVEPPSA
FT                   QPVIVEDNVVVGANVVVLEGVRIGEGAVVAAGAIVTKDVAPGTVVAGIPARELKKLDAK
FT                   TASKTEIMQELRQL"
FT   regulatory      151432..151437
FT                   /gene="lmo1012"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        151446..152561
FT                   /transl_table=11
FT                   /gene="lmo1012"
FT                   /note="similar to N-acyl-L-amino acid amidohydrolases"
FT                   /db_xref="GOA:Q8Y8A0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR023905"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y8A0"
FT                   /protein_id="CAC99090.1"
FT                   /translation="MLNEFIAIRRELHQIPETGYKELKTQAYLLDYISKLPSGHLEVKK
FT                   WRTGILVLVKGTNPEKTIGYRTDIDALPITEETELPFASKHPGNMHACGHDLHMSIALG
FT                   VLTHFASKPAKDNLLFVFQPAEEGPGGAKPIMESTEFAEWRPDSIYGLHIAPEYKVGEI
FT                   AIKPGLLFANTSELFISFKGKGGHAAYPHLANDMVVAASAFVGQMQTIISRNIDPMDSA
FT                   VITIGRIHGGEIQNVIAETAYLDGTIRTLSPETMEIVWTRLKQLAKGWEEAYQCEVEFH
FT                   PGSDYYQVDNDPVETEEFIHFLEEQYPESYVPARSAMTGEDFGYFLSEIKGFMFWLGVD
FT                   SEYSLHHAKLNPKEEAIPFAIDVLIHFLESK"
FT   regulatory      complement(152554..152601)
FT                   /gene="lmo1013"
FT                   /regulatory_class="terminator"
FT   regulatory      152565..152612
FT                   /gene="lmo1012"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(152605..153450)
FT                   /transl_table=11
FT                   /gene="lmo1013"
FT                   /note="similar to conserved hypothetical proteins like to
FT                   B. subtilis YkuT protein"
FT                   /db_xref="GOA:Q8Y899"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y899"
FT                   /protein_id="CAC99091.1"
FT                   /translation="MNLLKKWFSSIDWDQFWNHIISVGIKIAILIALYFIFRVIGNKII
FT                   RSFFRKYRQQQAVSVGRADTLESLISNFYGYVLFFTFAILLLQNFMDVTAIIASAGVAS
FT                   LAIAFGAQGLVSDVVTGFFILLERQLDVGDTITIGLVNGTVEALGLRTTQVRDFDGTLH
FT                   FIPNRQIMVVSNHSRGNMRVMVDIQISPHEDPEKAIKIIGEVCDVAAKENKNIVEPPVV
FT                   LGVQNIDATNMIIRVVGKAVNGEQYSVQRDLLKDIREALAENKIELPLNFVSTFGPNNN
FT                   "
FT   regulatory      complement(153462..153467)
FT                   /gene="lmo1013"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      153807..153812
FT                   /gene="gbuA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        153821..155014
FT                   /transl_table=11
FT                   /gene="gbuA"
FT                   /note="highly similar to glycine betaine ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="GOA:Q7AP76"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP76"
FT                   /protein_id="CAC99092.1"
FT                   /translation="MSKIKVEELTKIFGKKASKASSLLSQGKSKTDILKETGATIGVNK
FT                   ASFSVEEGEIFVIMGLSGSGKSTLVRLLNRLIEPTSGKIWLDGKELSSLNKKELLEVRR
FT                   KSMSMVFQNFGLFPNRTINRNVEYGLEIQGMDKEEREKNAAESLALVGLAGYGDQYPSQ
FT                   LSGGMQQRVGLARALANNPDILLMDEAFSALDPLNRKDMQDQLLDLQDKMKKTIIFITH
FT                   DLDEALRIGDHIMIMRDGSVVQTGSPEEILAHPANEYVEKFIEDVDRSKVYTASNVMIR
FT                   PEIVNFEKDGPRVALKRMREAGTSSVFVVKRNRELVGIVHAAEVSKLVKENITSLETAL
FT                   HRDVPTTGLDTPLAEIMDTISTTTIPIAVTEDGKLKGIIIRGSVLAALSGNEVNVNA"
FT   regulatory      154992..154997
FT                   /gene="gbuB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        155007..155855
FT                   /transl_table=11
FT                   /gene="gbuB"
FT                   /note="highly similar to glycine betaine ABC transporters
FT                   (permease)"
FT                   /db_xref="GOA:Q7AP75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP75"
FT                   /protein_id="CAC99093.1"
FT                   /translation="MPNIPTIPLASWIDKLVDGLTQFEGFFNVITNIIGGIVDAFQWVF
FT                   DLVPPWLFIILLVFGTFWVNRKGKKWGLIIFEVVGLLLIWNLDFWRDMTQTLTLVLTSS
FT                   LIALVIGVPLGIWMAKSNIVESIFKPVLDFMQTMPAFVYLIPAVAFFGIGMVPGVVASV
FT                   IFAMPPTVRMTNLGIRQVSTELVEAADSFGSTPWQKLWKVQLPMAKSTMMAGINQSIML
FT                   ALSMVVIASMIGAMGLGTRVYFAVGRNDAGGGFVAGIAIVIVAIILDRLTQAFNKKAKS
FT                   E"
FT   regulatory      155855..155860
FT                   /gene="gbuC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        155869..156771
FT                   /transl_table=11
FT                   /gene="gbuC"
FT                   /note="highly similar to glycine betaine ABC transporters
FT                   (glycine betaine-binding protein)"
FT                   /db_xref="GOA:Q8Y898"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y898"
FT                   /protein_id="CAC99094.1"
FT                   /translation="MLKKLITTAVLAMLIFTLAACGTTLAPYDAKKDLGEQINYTITGI
FT                   DAGAGIMLATQNAIKDYHLDDDNWQLQTSSTAAMTSTLQKAMKDKRPIVVTGWTPHWMF
FT                   TKFDLKFLDDPKNVYGNAENIHTIVRKGLKEDKPSAYQVLDNFFWTAEDMSEVMLEVND
FT                   GVDPEEAAKKWIKNNPDKVAKWTDGVEKVDGDEIKLTYVAWDSEIASTNVVAEALKQVG
FT                   YKPTIQAMEIQPMWASVATDAADGMVAAWLPNTSGIYYKDYKGKFEDLGPNLKGAKIGL
FT                   AVPKYMTNINSIEDLKTSK"
FT   regulatory      156783..156836
FT                   /gene="gbuC"
FT                   /regulatory_class="terminator"
FT   regulatory      156873..156878
FT                   /gene="lmo1017"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        156886..157377
FT                   /transl_table=11
FT                   /gene="lmo1017"
FT                   /note="similar to phosphotransferase system
FT                   glucose-specific enzyme IIA"
FT                   /db_xref="GOA:Q8Y897"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y897"
FT                   /protein_id="CAC99095.1"
FT                   /translation="MFKKFLKKSKQEVLFAHVTGQVIALEDVPDPVFNQKMMGEGIAIK
FT                   PETGTIVAPIDGKIIQLAETKHAFGIRTDMGQEILVHIGLETVSLNGEGFNVLVSVGDK
FT                   VKVGDPIVEADFDFIEKNAASTVVPMVITNSSEGKYDFDFHAVPKAEAGKTEVITTNLK
FT                   "
FT   regulatory      157389..157429
FT                   /gene="lmo1017"
FT                   /regulatory_class="terminator"
FT   regulatory      157476..157481
FT                   /gene="lmo1018"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        157490..158185
FT                   /transl_table=11
FT                   /gene="lmo1018"
FT                   /note="similar to E. coli copper homeostasis protein CutC"
FT                   /db_xref="GOA:Q8Y896"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y896"
FT                   /protein_id="CAC99096.1"
FT                   /translation="MLEVIVQNPRDAYLAEKYGANRMEVVSAISEGGLTPSYGAIKEIV
FT                   RASKLPAMMMIRPHSFSFVYDEAAKIVMERDIELAKEVGVQGIVYGGITENGAIDQALL
FT                   EKVIEWKGDLNLTFHRALEATKDIEASYQVLRTYGKDINQLLTSGGTANALDSLPRLKR
FT                   WIQDSEAQPDSFQVLVGSGVKPENIATFQATLNHSDYHVGSAAREANDFSKDILKEKID
FT                   ILQQQINKD"
FT   regulatory      158253..158258
FT                   /gene="lmo1019"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        158266..159138
FT                   /transl_table=11
FT                   /gene="lmo1019"
FT                   /note="similar to B. subtilis YitL protein"
FT                   /db_xref="GOA:Q8Y895"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y895"
FT                   /protein_id="CAC99097.1"
FT                   /translation="MNNYIGKSQVMTVKEIKDTGWLLEKDGVTVFLSKSNTHETELAVG
FT                   AEVTVFIFVDYDREIAATTIIPKIQVGHYGWGTVTEVRKHLGVFVDIGIEKDVVVSLDD
FT                   LPALPHLWPKKEDRMMIALRVDEENRVWGVLAEEEQFRAIAVRAEQDLFNQNVEGTIYR
FT                   LLKVGSFVFTDDFHIGFIHESERTSEPRMGERVKARVIAVKPDGSLNLSLRGRAHEVLN
FT                   DDAEMILTYLRSVGGEMPFGDKSDPDAIRAKFGISKAQFKRAIGTLLKARRITQENGVV
FT                   TKITEETSD"
FT   regulatory      159258..159263
FT                   /gene="lmo1020"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        159273..159986
FT                   /transl_table=11
FT                   /gene="lmo1020"
FT                   /note="similar to B. subtilis YvqF protein"
FT                   /db_xref="GOA:Q8Y894"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y894"
FT                   /protein_id="CAC99098.1"
FT                   /translation="MKKMESSVVFVFLIAIIVGVGLEMLFQWELLILFALGIFFIFTSR
FT                   KASATKKSARNSLFIGIVFIIIAVLLTTTFKVGLVVAGIYAIIHYISRKRAPQLLMLKT
FT                   REPDSKIDRTDKFIRNQWFGNQRILDVVYEWDDINIQTGIGDTILDLGNTVLPTGESVI
FT                   MIRSVSGKIRILVPFDIGICIEHSAIFGNIQYDKESTSIQNNSIKVYSDNYESSARKVK
FT                   IMTSVIFGDLEVIRL"
FT   regulatory      159970..159975
FT                   /gene="lmo1021"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        159983..161041
FT                   /transl_table=11
FT                   /gene="lmo1021"
FT                   /note="similar to two-component sensor histidine kinase in
FT                   particular B. subtilis YvqE protein"
FT                   /db_xref="GOA:Q8Y893"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y893"
FT                   /protein_id="CAC99099.1"
FT                   /translation="MSFSKLMMAVCSGLLLVATAIGTVGYYFFSEGSWYKILIEQKIFY
FT                   IPFVVFVPLTAISIGLIIGGLIGYFVKQKFESIDFSIRLLGQGDLEKKITSEEDENFLE
FT                   VQQVYKQIDRLRDKMKAQTILTQKLASDRAESTGQTKEAILSEERHRIARELHDSVSQQ
FT                   LFAAMMLLSALNEQSEKSATPAMQKQLKMVESIVNESQSEMRALLLHLRPTQLEGKSLK
FT                   TGIEQLLKELTTKLPIEVEWQIEDISLQKGIEDHLFRIVQELLSNTLRHSKAKLLEVRL
FT                   VTMDNLAVMKVVDDGVGFDMDNVRQGSYGLQNMRERVAEFGGTIKIISFPGRGTSVEIK
FT                   IPLVAKKDVESE"
FT   regulatory      161022..161027
FT                   /gene="lmo1022"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        161038..161676
FT                   /transl_table=11
FT                   /gene="lmo1022"
FT                   /note="similar to two-component response regulator, in
FT                   particular B. subtilis YvqC protein"
FT                   /db_xref="GOA:Q8Y892"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y892"
FT                   /protein_id="CAC99100.1"
FT                   /translation="MIKVLLVDDHEMVRIGVSAYLSVQDDMEVVGEAENGREGADMALE
FT                   LRPDIILMDLVMDEMDGIEATKEIMQNWKEAKIIIVTSFIDDEKVYPALEAGASSYMLK
FT                   TSTASEIADAIRATYGGDSVLEPEVTGKMMQRLTAKPEKNLHDDLTNRENEILLLIAEG
FT                   KSNQEIADELFITLKTVKTHVSNILSKLDVQDRTQAAIYAFKHDLVEKK"
FT   regulatory      161679..161684
FT                   /gene="lmo1023"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        161695..162354
FT                   /transl_table=11
FT                   /gene="lmo1023"
FT                   /note="similar to a bacterial K(+)-uptake system"
FT                   /db_xref="GOA:Q92CZ9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ9"
FT                   /protein_id="CAC99101.1"
FT                   /translation="MKEGFAVIGLGRFGGSICRSLVEQGMEVLAIDSDEERVNEYMSIA
FT                   THAVIANSTDENALRQLGIRNFEHVIVAIGEDIQSSILTTLILKEMGVKYVTAKATNDK
FT                   HAKLLDKIGADRVVHPERDMGRRIAHYIVSKNMLDYLELSDEYSLVEISVSDPRFLGKS
FT                   LVDLDFRNSFGVNIVGIKKDKQMIITPEANDVLHEGDILIVIGSDDDIERLQEKIQ"
FT   regulatory      162495..162500
FT                   /gene="lmo1024"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        162509..163429
FT                   /transl_table=11
FT                   /gene="lmo1024"
FT                   /db_xref="GOA:Q8Y891"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y891"
FT                   /protein_id="CAC99102.1"
FT                   /translation="MKKFLLDKIGARGLIQMLQAFIYASICVVVHTVIFPDLAGVLPIV
FT                   VLIGIISMQPTYGITRKVIPQIALAFTLACVFVIISTYFFPINVYIYYVVMIVVILAVN
FT                   FLMPQKYMVMTLAIGTALYFLGTDDLPMPLYAMIIVALMDVFVFFLLVQLVVKYVHLPL
FT                   EKTVQTIMKQLVGLFDKEIESVFKNNGKFIAKPLYSIFVQSQMFIKEYSASKKANPRHV
FT                   ELYQALLPNYLQLFFHMQTMEDIGRVGLSEEAKQALAQINVKVSDEINVKEADPVASFH
FT                   VKKFVENFLAVKVGMNELVEGRGQK"
FT   regulatory      163414..163419
FT                   /gene="lmo1025"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        163426..164277
FT                   /transl_table=11
FT                   /gene="lmo1025"
FT                   /db_xref="GOA:Q8Y890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y890"
FT                   /protein_id="CAC99103.1"
FT                   /translation="MKKISMRERFALDPRVAKVLISITIAVILFPVMGDWIVYPTYVFN
FT                   AIYITAQMSKGDTYKSSIERIIGTIVGGLLAAFVYLLVPNHHYIMIPIGAALAVMLSYL
FT                   FTKKFTMVIVVITVMVLVGKGDGEPIVFLRDRLFDTMIGLVIGFVVYALYPRKKNKKLN
FT                   QVFISQEKAVLERIKEIDINSEDAKSLAPKIKGLWKQLIDLRKTREQIITDSSFVASLT
FT                   SDEPMLHFTHLVEQAINNIEILYHVTLEKESEPDYEVVFAYHQQACAKVITEMDALITK
FT                   HK"
FT   regulatory      complement(164271..164313)
FT                   /gene="lmo1026"
FT                   /regulatory_class="terminator"
FT   regulatory      164282..164324
FT                   /gene="lmo1025"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(164319..165284)
FT                   /transl_table=11
FT                   /gene="lmo1026"
FT                   /note="similar to B. subtilis LytR protein"
FT                   /db_xref="GOA:Q8Y889"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="PDB:3NRO"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y889"
FT                   /protein_id="CAC99104.1"
FT                   /translation="MTETRTEKKKKTTSTFTKVMKIASVALLGIIFFSITGLAAKYYIT
FT                   VQNTFSKINVPLESSNKTLSDLEKKKPFSVLLMGSDARAGEKNGRADTIILATANKQQN
FT                   AVEMVSIPRDTKVDYGNGDIGKINASYSNGGPSGTVSAVEKLMPGVPVDYFISINMEGF
FT                   KDLVDAVGGITVYNDIDLTEVNSKFVKGNITLNGTEALQYVRIRHEDPRGDFGRQDRQR
FT                   DVIIGIANKVISSSGVSNFESIMKAVGDNFQTNMTLTDITSMAANYSSVLKNVDSQELK
FT                   GEGEMIYSESYGFDLYYFAPDKTDLERIITMFKKSLDITE"
FT   regulatory      complement(165293..165298)
FT                   /gene="lmo1026"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(165345..165383)
FT                   /gene="lmo1027"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(165393..167060)
FT                   /transl_table=11
FT                   /gene="lmo1027"
FT                   /note="similar to conserved hypothetical proteins (in
FT                   particular B. subtilis YkqC)"
FT                   /db_xref="GOA:Q92CZ5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ5"
FT                   /protein_id="CAC99105.1"
FT                   /translation="MKFVKNNETAVFALGGLGEIGKNTYGVQFQDEIILIDAGIKFPED
FT                   ELLGIDYVIPDYSYLVKNKDKIKGLFITHGHEDHIGGVPYLLRDLNIPIYAGKLASALI
FT                   RNKLEEHGLLRQTKIYEYEEDDVFKFRKTSISFFRTTHSIPDTYGIVVKTPSGNIVHTG
FT                   DFKFDFTPVGEPANLTKMAEIGKEGVLCLLSDSTNAEVPNFTMSERVVGESIKNIFRDV
FT                   EGRIIFATFASNIYRLQQVVESSIETGRKIAVFGRSMESAMEIGKQLGYIQAPKDTFID
FT                   VHQLNKTPAGNVTILCTGSQGEPMAALSRIANGTHRQIQIQPGDTVVFSSSPIPGNTTS
FT                   VNRTINLLYQAGAEVIHGKVNNIHTSGHGGQQEQKLMLRLMKPKFFMPIHGEFRMQKIH
FT                   AESAEECGVPEENSFIMANGDVLALTSETAHVAGKIHAASVYIDGSGIGDIGNIVLRDR
FT                   RILSEEGLVIVVVSIDMKNSRVMAGPDIISRGFIYMRESGNLIGEAQGLLTRHLNKVME
FT                   QKTTQWSEIKNEITDTLQPFLYEKTKRRPMILPIIMEV"
FT   CDS_pept        complement(167067..167276)
FT                   /transl_table=11
FT                   /gene="lmo1028"
FT                   /note="similar to B. subtilis YkzG protein"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CZ4"
FT                   /protein_id="CAC99106.1"
FT                   /translation="MIFKVFYQETLTETPVREKTQSLYVEAESEVKVRQLLKDEPFHIE
FT                   FVEKISDAHLAYEKENPDFALWEK"
FT   regulatory      complement(167072..167077)
FT                   /gene="lmo1027"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(167284..167289)
FT                   /gene="lmo1028"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      167745..167750
FT                   /gene="lmo1029"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        167761..168531
FT                   /transl_table=11
FT                   /gene="lmo1029"
FT                   /note="similar to conserved hypothetical proteins"
FT                   /db_xref="GOA:Q8Y888"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y888"
FT                   /protein_id="CAC99107.1"
FT                   /translation="MSKIVFFDVDGTLVGETKEIPASAKQAIAKLKENGVYVAIATGRG
FT                   PFMLDEIRKELDINSYICYNGQYVIFEGKEIYAKPLPTESLERLITVASEHEHPIVFSG
FT                   KDSMRANLPDHDRVTIGMNSIKREYPKVDANYYKGRDIYQCLLFCDESYDAYYREEFKQ
FT                   YGFLRWHDVSVDVCPADGSKAEGIKQMIKKLGFSMKDTYAFGDGLNDIAMLQTVGTGVA
FT                   MGNGRDEVKAVADYVTSHVDDDGVYNALKQLKLI"
FT   regulatory      complement(168534..168571)
FT                   /gene="lmo1030"
FT                   /regulatory_class="terminator"
FT   regulatory      168545..168582
FT                   /gene="lmo1029"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(168580..169608)
FT                   /transl_table=11
FT                   /gene="lmo1030"
FT                   /note="similar to transcriptional regulator, LacI family"
FT                   /db_xref="GOA:Q8Y887"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y887"
FT                   /protein_id="CAC99108.1"
FT                   /translation="MKLEDIARLANVSKSAVSLALNGKAGVSEETRLHILQIVEENNYV
FT                   PLRNTNKKMKKKSTIRFIACKSPNLITEQYQNLPFFSELLSYLSAEIASYPYDLVISTF
FT                   DATTILEELAEAEKEQPTAGLILLGTNLNAEEINRIQQEYPKIVVLDTHHPHISANFVS
FT                   INNFLGGYKAADYLLQLSHTKIGYVMGLPRIKNFDERKSGFFARLEEADISVPEEHVFH
FT                   LSAMQIQEEASVKEAIAELQDLPSALFCENDYMAISMIKMLQSLSIKVPEQVSVLGFDN
FT                   INESKVITPELTTVHVKKRDIAEQTLALLSKQIKADTNFETRQIQVNTSLIERTSCVPF
FT                   QK"
FT   regulatory      complement(169617..169622)
FT                   /gene="lmo1030"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      169859..169864
FT                   /gene="lmo1031"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        169872..171275
FT                   /transl_table=11
FT                   /gene="lmo1031"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="GOA:Q8Y886"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y886"
FT                   /protein_id="CAC99109.1"
FT                   /translation="MEAIKIGFAPTRRSIFSAPDAIKYANLTRDKLNELNIEFVDITEF
FT                   NEDGLLYDDADVMKIAAKFKKAGIQGLFLPHTNFGTEYVCARLAKELDVPVLLWGPRDE
FT                   RPDENGIRLRDTQCGLFATGKILRRFQVPFTYMTNCRLSDPEFERGIRDFIAVCNTVKT
FT                   FQNMRILQIGPRPFDFWTTMCNEGELLEKFNVQLAPIPLPELMKEIRSVSSEQIEEVDG
FT                   TVEYCHGCAIVKIKEVDLRMVAALKVAMKNLATKYGCSAIAIQCWTALQDEIGIMPCAA
FT                   NAMLIDEGIPVVCETDIHGAISCLLIEAANLGRNKSFFADWTVRHPDNENGELLQHCGL
FT                   FPFSVAKDKPAIGYPLAFDSPGAVEAEAKGGELTLCRFDGDNGEYSLLLGKARGIEGPY
FT                   TKGTYLWIEVDNLKRLEEKIVSGPYIHHVSGIHADVVPILYETCKYIGIKPDLYDPIEE
FT                   DIKAYLRGE"
FT   regulatory      171280..171285
FT                   /gene="lmo1032"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        171291..172115
FT                   /transl_table=11
FT                   /gene="lmo1032"
FT                   /note="similar to transketolase"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y885"
FT                   /protein_id="CAC99110.1"
FT                   /translation="MSELKLKSFEIRKDVLKMIYDAKTGHTGSDLSCADILVALCYGVL
FT                   NVNPENPEALDRDRYVQSKGHAVEVLWAVLADKGFFAKEELADFSAFGSRIIGHPNNKV
FT                   AGIEMNTGSLGHGLSVSVGMALAAKMDGKSYHTYTLMGDGELAEGSVWEGAMAAANYKL
FT                   DNLTAIIDRNSLQISGRTEDVMSVEPLADKWRAFGWDVIEADGNNPDKLQAIFKTVNET
FT                   GKPRLIIAKTIKGYGVKMAENVAKWHHYVPSSEEYEIAMKDLEERMEACRHE"
FT   regulatory      172093..172098
FT                   /gene="lmo1033"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        172108..173064
FT                   /transl_table=11
FT                   /gene="lmo1033"
FT                   /note="similar to transketolase"
FT                   /db_xref="GOA:Q8Y884"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y884"
FT                   /protein_id="CAC99111.1"
FT                   /translation="MNKIANRQVMCEVLMKEATRNDSNLVVLTSDSRGSASLGAFAEKF
FT                   PERLIETGIAEQNIVGIAAGLAHSGKRAFVASPACFLSMRSIEQVKVDVAYSDTNVKLI
FT                   GISGGVSYGALGMSHHSLQDIAVTRAIPNLEVILPADRLETEAIFDYLLQSNRPAYVRL
FT                   GRNAVEDCYAEKPVFQIGKAGTLREGNDVSILATGEMVRVALDASEELKLKGISARVLN
FT                   FSTIKPFDQEVVKAALTETKLLISIEEHSIYGGLGAAVSEVVSSSPTSIRHLILGIPDE
FT                   PAIAGTSQEIFDYYGLSATGIVATIMKNLPIIGDERR"
FT   regulatory      173046..173051
FT                   /gene="lmo1034"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        173061..174524
FT                   /transl_table=11
FT                   /gene="lmo1034"
FT                   /note="similar to glycerol kinase"
FT                   /db_xref="GOA:Q8Y883"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y883"
FT                   /protein_id="CAC99112.1"
FT                   /translation="MKKHYQIAIDQSTSGTKVLLFKEGKLVDRLDKKHRQLYPKKGWVE
FT                   HNPIEICQNVRTLIADILTKHDLITADIERLALTNQRETIVAWDKQTGKPLYNAIVWQC
FT                   NRTKEICETLKEAGYEKRIKQLTGLKIDSYFSASKMMWLLENISAVRDAASRNQLAFGT
FT                   MDAWLLFSLTDDSNYFTDRTNASRTLLYDIEKNDWSDELLELFGVKRAYLPEVKQSAGS
FT                   FGSYQEIPIHSVMADSEAALYGQGCDTFGAVKATLGTGCSVMMQIGENRLPENDAILTT
FT                   LAWDVAGVNQFALEGIIRSCGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQ
FT                   LGLGAPYWNTDIRAEILGLTREHTKWHIIRAGFTSIAFQIKAVIDQMELMIGQNIKRLQ
FT                   VDGGLTKQHELMQYLADVLKAEVAVSPAEELSAIGAIEIADNNLQNKRTIAKLYQPSIT
FT                   HTHALEDFQEWEKQVKSSILKIQKVRNFK"
FT   regulatory      174507..174512
FT                   /gene="lmo1035"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        174521..176377
FT                   /transl_table=11
FT                   /gene="lmo1035"
FT                   /note="similar to phosphotransferase system (PTS)
FT                   beta-glucoside-specific enzyme IIABC"
FT                   /db_xref="GOA:Q8Y882"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y882"
FT                   /protein_id="CAC99113.1"
FT                   /translation="MNNSDLAKEVVKLVGGKENILSVIHCVTRLRFKLRDENLAETEKI
FT                   KALKGVMTVVKSGGQYQVVIGDHVSYVYDEVIRVLGIKPDDALQDNPEQEHKSIFNKFV
FT                   ELISGIFMPVLGLLAASGILKGFLTAAVTMGLINTSAGVYEVLYAASDALFYFMPIILG
FT                   FSAGKVFKTNQYLSAAVGAALVYPTLVDMYSSGAHLTFLHIPVILMNYTMSVIPVILAI
FT                   YFMSKLEKVLVKFIPKSLQLIFVPLLLLLIVVPVSLIIIGPVSTYASQLLAKGALGLYS
FT                   LSPMIAGFFLAGVWQVAVMFGLHWAFIPIFINNISVLGYDPINAMLYCTVFAQTGAVMA
FT                   VMLKTRNQELRSLSITATISGFLGITEPAIYGVNLPYKKPFIMACVGSAFGGAIAGMSA
FT                   AKMFGGFASGGIFGIPMFINPDGIGWDFWGFLISLVVAFSVALILTYFFGFKDKVEEVV
FT                   IQTGEKATLDETIYSPLQGELIALNDVKDEVFSAGIMGAGVAILPASGEIRAPFDGTVL
FT                   SVFQTKHAIGLISKQGVELLIHVGLDTVNLNGQFFDIEVSESEEIKKGDLLGTFELDTI
FT                   KKAGYDITTPIIVTNSATLADVITVNLGKHVDNNQKILEAKA"
FT   regulatory      176385..176390
FT                   /gene="lmo1036"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176397..177662
FT                   /transl_table=11
FT                   /gene="lmo1036"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025277"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y881"
FT                   /protein_id="CAC99114.1"
FT                   /translation="MLKQSADKRRIEKNDKPFFYLADTVWSAFTNIDLTDWAYYLKVRK
FT                   EQGFNVLQINILPQWDRSVLKKIQEPFGINEGFFDLKAKNEAYFKHAEKMLEMAVNQGF
FT                   TPALVLLWCNYIPETWGAKFGTSPLFRKEDIKPYTEMMLEHFEQFEPIYIISGDTDFPT
FT                   ETVTDYYLEALETVSKKAPHALKVLHICGRLKDIPENLQTHPALDLYFYQSGHNSEHQS
FT                   MAYTLAEHFSQLEPIKPVINSEPCYELMGYSRQKYGRFSREDVRKAAWQSVLSGAIAGI
FT                   SYGAHGIWSWHEEGSTFGSALGEGFVSPFNWRQALHFEGATDYAFLKSFILANDLTTLA
FT                   PINLVLNQTPEIRAAETEKVVIIYVPSNVPIYLKGQFVSLDDYAIDLEQGKKVSLAKIL
FT                   HEEKTEIQMTPFLKDSLYVIHK"
FT   regulatory      complement(177704..177745)
FT                   /gene="lmo1037"
FT                   /regulatory_class="terminator"
FT   regulatory      177711..177746
FT                   /gene="lmo1036"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(177723..178526)
FT                   /transl_table=11
FT                   /gene="lmo1037"
FT                   /note="highly similar to B. subtilis YoaT protein"
FT                   /db_xref="GOA:Q8Y880"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y880"
FT                   /protein_id="CAC99115.1"
FT                   /translation="MQFFRLLWVFTWKQALCCIFPGIIFISLALTKLIDIPFIARYDLL
FT                   LIICLATQVLLIKFGLETWDELKVIMVFHIIGLGLEIYKVHMGSWSYPEPGLMKLFGVP
FT                   LYSGFMYSSVASYICQAWKRFDLKMTNWPNIWLVSSLCIAIYANFFTHHFIMDFRWILI
FT                   VLVLVLFRKTYVYFKVSSTQLKMPLSFSFLCIAFFIYLAENIASFYGAWSYPDQLVAWR
FT                   PVHVSKITSWYLLVIISIIIVAQLKFVKQKLEQTSVKAKSEATLK"
FT   regulatory      complement(178534..178539)
FT                   /gene="lmo1037"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(178534..178582)
FT                   /gene="lmo1038"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(178594..179175)
FT                   /transl_table=11
FT                   /gene="lmo1038"
FT                   /note="weakly similar to molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /db_xref="GOA:Q8Y879"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y879"
FT                   /protein_id="CAC99116.1"
FT                   /translation="MKNEKVNVGIVLAGGRSSRFGEPKAFFQDEATGKTWVELTVSKLL
FT                   PLCDMVFVSANHENHSKLVALFDAEPSIEIIPDQTAFSEFGPLGGIYAVMVEANAYQKA
FT                   NFLVLPVDMPFLTPKEIGRLADYPNHFAKTAQANHYLVANIPYSREVLHHLLQDEQHRV
FT                   RALLEKLHTKPLAFEEDAPFRNINHQNELF"
FT   CDS_pept        complement(179156..179818)
FT                   /transl_table=11
FT                   /gene="lmo1039"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q8Y878"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y878"
FT                   /protein_id="CAC99117.1"
FT                   /translation="MLRLQFHKKLPFHDLNIDYTFEKPVTAMMGASGSGKSTLFQCVSG
FT                   LKSIDGGIIEFDGTPWDDSNISLHLPVTERKVGYLFQNLALFPNMNVYENIAFGLKVKK
FT                   KKKKEQAEIQQQVRKMSDYLQISHLLYSSVQKLSGGEKQRVAMARAMITEPKLLLLDEP
FT                   FNGLDEETRLICMKLVGQMAKDFHIPVIFVTHYASEAEMMTEEILVMREGRLEKRKS"
FT   regulatory      complement(179182..179187)
FT                   /gene="lmo1038"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(179821..180492)
FT                   /transl_table=11
FT                   /gene="lmo1040"
FT                   /note="similar to molybdenum ABC transporters (permease)"
FT                   /db_xref="GOA:Q8Y877"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y877"
FT                   /protein_id="CAC99118.1"
FT                   /translation="MFTSVWHTLLVATISTFLAFMTMLPLSYYFAGRKSRFQLPVEILI
FT                   LLPLVLPPTVVGLVLLNILGRNDFIGGVLWDTFDFSFIFSLSGAIVATTIIILPIMYQG
FT                   LKSAFLSIDHELVWAAETLSANKKQIFTKIILPNCWQPILAGVLLSFCRAMGEFGASLM
FT                   VAGYIEGKTDTIASSIYFMVQQGDMRTAIYLGLINVIIGVFALLVIHVLTIRQSNLTRG
FT                   M"
FT   regulatory      complement(179827..179832)
FT                   /gene="lmo1039"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(180499..180504)
FT                   /gene="lmo1040"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      180584..180589
FT                   /gene="lmo1041"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        180597..181367
FT                   /transl_table=11
FT                   /gene="lmo1041"
FT                   /note="similar to molybdate ABC transporter binding
FT                   protein"
FT                   /db_xref="GOA:Q8Y876"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR041879"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y876"
FT                   /protein_id="CAC99119.1"
FT                   /translation="MKKIVLIICCGLLLLLGACEDTPEKVQTTTIHISAAASLKDSIDD
FT                   VKPLFEKANPTIKLSFDFGGSGQIRERVESGAPIDGVLLASKKDADTLIKQNLAEKTKE
FT                   FAGNELVLIEPKNVDQKTEANLEQLLNDASKIAIGDPESVPAGAYAKQTLENLNLYNAE
FT                   KAKLVLATDVRQVLSYVEAGNADAGFVYQTDALLSKKVQVKAKIDEKLHDPIAYYSAQV
FT                   SDSDKKEETATFLDFMNKSEAQKILEKYGFKAAN"
FT   regulatory      181447..181452
FT                   /gene="lmo1042"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        181462..182685
FT                   /transl_table=11
FT                   /gene="lmo1042"
FT                   /note="similar to molybdopterin biosynthesis protein moeA"
FT                   /db_xref="GOA:Q8Y875"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y875"
FT                   /protein_id="CAC99120.1"
FT                   /translation="MIEKRNTIRMEQAREVLCNQITHLPVEKKHVTEALNQVLQEPIFA
FT                   PFPAPYFRRSGYDGFAITEVDDGNYPITLRVVAEVPCGETYDKPLKPGETVRIMTGAKV
FT                   PDNASKIIMLEQSREADNENEIILINTQKSSNITEIGTEFAKGDLLLDRGHILNAGSIS
FT                   LLSSFGIQEVQVIRKPKVAILSTGSELVPAGNPLPDGKIFNSNQPLLENLLKVHHAEIC
FT                   AAEQLPDNYEDTKNRLLELTKIADLIVTTGGVSVGDFDYMADIAKQEAELLFNKIQMRP
FT                   GSPTTGMWLDKTLIIALSGNPGACFTGFYLLVEPVLTTLMGKDTTETTQVRAKMASDYT
FT                   KNNGYDRFLRGTYRLSDEGEYLVELVGSDMSSALGNLHLTTCLFKIPRGQVGKLKGEEV
FT                   EAWLLYSK"
FT   regulatory      182651..182656
FT                   /gene="lmo1043"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        182664..183149
FT                   /transl_table=11
FT                   /gene="lmo1043"
FT                   /note="similar to molybdopterin-guanine dinucleotide
FT                   biosynthesis MobB"
FT                   /db_xref="GOA:Q8Y874"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y874"
FT                   /protein_id="CAC99121.1"
FT                   /translation="MAAILQIIGFKNSGKTTLLNALIRASRKENYTVSAIKHDAHDFSV
FT                   DHAGTDSYSFQESGAEAVVIANSRQYAVMEQTGIDLKTAIQKLPESDIVLIEGYKEGPF
FT                   PKIILVREQAEIELLKNSKAVHKIATHNPALKKEAIFIGEENALNLFAETLIKEFLK"
FT   regulatory      183133..183138
FT                   /gene="lmo1044"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        183146..183568
FT                   /transl_table=11
FT                   /gene="lmo1044"
FT                   /note="similar to molybdopterin converting factor, subunit
FT                   2"
FT                   /db_xref="GOA:Q8Y873"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y873"
FT                   /protein_id="CAC99122.1"
FT                   /translation="MRYVALQHEKIEIGPLSEKLINKNHGGTNLFVGTIREWTGDIQTE
FT                   EIRYTSYEEMALKELNKLATEVEAKWGADVVIVHRLGLLQITDIAVVIGVSTPHRAACY
FT                   EGSRYIIERLKERVPIWKEEKDVDKTRWGGINAHNS"
FT   regulatory      183540..183545
FT                   /gene="lmo1045"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        183552..183800
FT                   /transl_table=11
FT                   /gene="lmo1045"
FT                   /note="similar to molybdopterin converting factor (subunit
FT                   1)."
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y872"
FT                   /protein_id="CAC99123.1"
FT                   /translation="MLTTVKFFAFLAEKTHKTEVKLNLQQCQTVGEVREVISSEFPEIA
FT                   VDLATCMLAVNMEFQQDQDFLPEEITEIAVIPPVSGG"
FT   regulatory      183800..183805
FT                   /gene="lmo1046"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        183813..184295
FT                   /transl_table=11
FT                   /gene="lmo1046"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="GOA:Q8Y871"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y871"
FT                   /protein_id="CAC99124.1"
FT                   /translation="MEKDDLTHFNDEKRAKMVDVTSKSETKRRAIASATIHMNEETLAR
FT                   IHAGKIAKGDVLAVAQVAGIMAAKKTSELIPMCHPIMTTKADISFEDDGKTALTITSEV
FT                   VTVGKTGVEMEALTAVTIAALTIYDMCKAMDKGMRIEKTYLVEKTGGKSGTFKAEA"
FT   regulatory      184310..184315
FT                   /gene="lmo1047"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        184324..185325
FT                   /transl_table=11
FT                   /gene="lmo1047"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   A"
FT                   /db_xref="GOA:Q8Y870"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y870"
FT                   /protein_id="CAC99125.1"
FT                   /translation="MQLLKDKFGRVHDYIRISVTDRCNLRCVYCMPEEGLTFLPHEKVL
FT                   SKDEIVSFMELMVKFGIKKVRITGGEPLLRTDIVEIVRGLGAIPEIEDISITTNAMYLA
FT                   KKAEALKEAGLTRVNISLDSLHADRFKAITRGGRLQKVLDGIQKAEEVGLFPIKLNVVL
FT                   IKGQNDDEITDFLRFTKDKDINIRFIEYMPIGHAGTSWKEKYLPLDTIFEACNEAGYEY
FT                   EPVDSIRGNGPSENFRIKGAKGTFGVIHPVSAHFCDSCNRLRLTADGYIKACLYWDEEM
FT                   NIRPFIQDPVKLMQLVQKAIDNKPENHEMALKLQDEVQSNKPTWRRMSQIGG"
FT   regulatory      complement(185332..185357)
FT                   /gene="lmo1048"
FT                   /regulatory_class="terminator"
FT   regulatory      185334..185355
FT                   /gene="lmo1047"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(185360..185848)
FT                   /transl_table=11
FT                   /gene="lmo1048"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   B"
FT                   /db_xref="GOA:Q8Y869"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y869"
FT                   /protein_id="CAC99126.1"
FT                   /translation="MEQKTFIKVTCSILTISDTRNLDTDTSGQLIQSALETAGHEVISR
FT                   VVVPDDVTLIKQKINELAANGSFCLITNGGTGIARRDVTYEALFATIQQEIPGFGEIFR
FT                   MLSYEEVGSRAMVSRAFAGFSESGLLLFALPGSSNACQLAVQKLIIPELPHLIAERQK"
FT   regulatory      complement(185854..185859)
FT                   /gene="lmo1048"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(185860..186858)
FT                   /transl_table=11
FT                   /gene="lmo1049"
FT                   /note="similar to molybdopterin biosynthesis protein MoeB"
FT                   /db_xref="GOA:Q8Y868"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y868"
FT                   /protein_id="CAC99127.1"
FT                   /translation="MERYDRQMRVKNIGKDGQEKLLTKTILIVGVGAIGSYAAEICARM
FT                   GFGKLILIDRDYVELSNLQRQSLFTEQDALDKQAKSYAASKALQLINSDITIEYIVDDA
FT                   NVTSLTPYVGTIDYILDCTDNFMTRDFLNQFCFSHQIPWIFTSCAGNYANLMPIIPPDS
FT                   ACLHCLLGDIPQTNAASCDIIGVDGALIPIVAGMQVSLLTQMIINPDFKANTYYQLDNW
FT                   HFSFQTIEVKKRPDCSSCAPGKMVSEVPFSGQTVTLCGRDTVQFRLPNKSNYREIKLLL
FT                   TEQKIIYNENPALLSFQYEKFQFVIFKNGRVLLHGSENIAEAKKIYHLFFN"
FT   regulatory      complement(186864..186870)
FT                   /gene="lmo1049"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      186975..186980
FT                   /gene="lmo1050"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        186989..187543
FT                   /transl_table=11
FT                   /gene="lmo1050"
FT                   /note="similar to B. subtilis YdfE protein"
FT                   /db_xref="GOA:Q8Y867"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y867"
FT                   /protein_id="CAC99128.1"
FT                   /translation="MKQRVETEKFYPAYPVFVLTYLNEIGEPQMSTGSSSYTLGDSIVI
FT                   GVSAESNAGKHLHAGQKFAVNFPNTEQLGLIEQGGFSSGKRNDKIKVHQIELTKSDSGG
FT                   VAYIDVCPIVLECTVIQTVSDMDYHTIFAKIDSRLFEKNLVDSEGHFIHEELDLVLFSG
FT                   DANERKFRQLDAKIETIGGHS"
FT   regulatory      complement(187553..187581)
FT                   /gene="lmo1051"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(187592..188143)
FT                   /transl_table=11
FT                   /gene="lmo1051"
FT                   /note="similar to formylmethionine deformylase and to B.
FT                   subtilis YkrB protein"
FT                   /db_xref="GOA:Q8Y866"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y866"
FT                   /protein_id="CAC99129.1"
FT                   /translation="MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGRDMLEFLINSQ
FT                   DEDLAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACL
FT                   SGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVIQHEIDHLNGIMF
FT                   YDHINKENPSYLPPDVDVFG"
FT   regulatory      complement(188154..188159)
FT                   /gene="lmo1051"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      188963..188968
FT                   /gene="pdhA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        188977..190092
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /note="highly similar to pyruvate dehydrogenase (E1 alpha
FT                   subunit)"
FT                   /db_xref="GOA:Q8Y865"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y865"
FT                   /protein_id="CAC99130.1"
FT                   /translation="MASKTKKAIIDVKKQFEAVHKQFELVQILNEKGEIVNPDLMPDLT
FT                   DDQLVELMTRMVWTRVLDQRSISLNRQGRLGFYAPTAGQEASQLASHYALEKHDYILPG
FT                   YRDVPQLIWHGLPLTKAFLFSRGHFVGNQFPEDLNVLSPQIIIGAQIVQAAGVALGLKK
FT                   RKKDAVVITYTGDGGSSQGDFYEGMNFAGAYHAPAIFVVQNNKFAISTPREKQSAAETL
FT                   AQKAVAAGIPGVQVDGMDPLAVYAVTKFARERAVAGEGPTLIETMTYRYGPHTLSGDDP
FT                   TRYRTKELDGEWELKDPIVRFRTFLEGKGLWNEEKENAVIDQAKEEIKVAIKEADATPK
FT                   QTVTDLLKNMYETPTAPIKEQLAIYEAKESK"
FT   regulatory      190079..190084
FT                   /gene="PdhB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        190095..191072
FT                   /transl_table=11
FT                   /gene="PdhB"
FT                   /note="highly similar to pyruvate dehydrogenase (E1 beta
FT                   subunit)"
FT                   /db_xref="GOA:Q8Y864"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y864"
FT                   /protein_id="CAC99131.1"
FT                   /translation="MAQKTMIQAITDALAVELEKDENVLVFGEDVGKNGGVFRATEGLQ
FT                   EKFGEDRVFDTPLAESGIGGLAIGLALEGFRPVPEIQFFGFVFEVMDSVAGQMARMRYR
FT                   TGGTRNAPITIRAPFGGGVHTPEMHADNLEGLMAQSPGLKVVIPSTPYDAKGLLISAIR
FT                   DNDPVIFLEHMKLYRSFREEVPEGEYTVEIGKAAVRREGTDVSIITYGAMVQESMKAAE
FT                   ALEKDGVSVEVIDLRTISPIDVETIIASVKKTNRAVVVQEAQKQAGIAANIVAEINDHA
FT                   ILSLEAPVMRVAAPDSVFPFSQAETVWLPNHNDIIERVKEVIAF"
FT   regulatory      191168..191173
FT                   /gene="pdhC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        191183..192817
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /note="highly similar to pyruvate dehydrogenase
FT                   (dihydrolipoamide acetyltransferase E2 subunit)"
FT                   /db_xref="GOA:Q8Y863"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y863"
FT                   /protein_id="CAC99132.1"
FT                   /translation="MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSV
FT                   EEITSPVSGTIKEIKVAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAP
FT                   AQASGKGIFEFKLPDIGEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVD
FT                   GTVKDILVSEGTVATVGQVLVTFEGDFEGEASHESTPESPAEDAALANNDATSAPATGG
FT                   NGTPSSKKDPNGLVIAMPSVRKYAREKGVNIAEVAGSGKNNRVVKADIDAFLNGEQPAA
FT                   ATTTAQTEEKAAAPKAEKAAGKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHV
FT                   TLMDEIEVTALMAHRKRFKEVAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEE
FT                   LVYKHYFNVGIAADTDHGLYVPVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHG
FT                   SATISNIGSAGGQWFTPVINYPEVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRV
FT                   IDGATAQKAMNNIKRLLNDPELLLMEV"
FT   regulatory      192807..192812
FT                   /gene="PdhD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        192822..194225
FT                   /transl_table=11
FT                   /gene="PdhD"
FT                   /note="highly similar to dihydrolipoamide dehydrogenase, E3
FT                   subunit of pyruvate dehydrogenase complex"
FT                   /db_xref="GOA:Q8Y862"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y862"
FT                   /protein_id="CAC99133.1"
FT                   /translation="MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGG
FT                   VCLNVGCIPSKALITIGHRFKEAGHSDNMGITADNVNLDFTKAQEWKGGVVNKLTSGVK
FT                   GLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYGKRV
FT                   LSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSL
FT                   VKRNLKSKNVEMVTKALAKSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEI
FT                   GLEQAGVKVTERGLVEVDKQGRSNVSNIFAIGDIVPGVPLAHKASYEAKIAAEAIAGEK
FT                   SENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVR
FT                   LVTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAE
FT                   LALGRPIHM"
FT   regulatory      194236..194276
FT                   /gene="PdhD"
FT                   /regulatory_class="terminator"
FT   CDS_pept        194413..194724
FT                   /transl_table=11
FT                   /gene="lmo1056"
FT                   /db_xref="GOA:Q8Y861"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y861"
FT                   /protein_id="CAC99134.1"
FT                   /translation="MEKQTATWKKALFWFAYVVAGICFVLTIVAFGVGFFHHMHDTGGW
FT                   RSVIQILETPITGFVKMTGGYIGKGILEVIILIIVSYVLPIFFCFATHYLKVKRREMT"
FT   regulatory      194839..194844
FT                   /gene="lmo1057"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        194853..195806
FT                   /transl_table=11
FT                   /gene="lmo1057"
FT                   /note="similar to L-lactate dehydrogenase"
FT                   /db_xref="GOA:Q8Y860"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y860"
FT                   /protein_id="CAC99135.1"
FT                   /translation="MPSKKKKIVVIGRSNLQNLYIHTVLLKKLPAEIYLIDDQAKTSVQ
FT                   DFDYASYYHADVTIHSGTFNECRNADIVVFFQEEMSNQIVSKEDNVALIIEKVKKMMAT
FT                   GFRGIVLVATAESNVVAALIKRFSGLSANQIITLGTMLATSYFQVEIAKLFKISPKNVH
FT                   GYIIGDNAEDVIPVWSRAFLGGKPILSYLAEDQKRISAEDLQNLTKMITKIPDFPFENK
FT                   DGCTFRFSTVTVLAELTEVILRDEARVITVGVEVKEAYGLENPVFISVPAVIGAEGVRE
FT                   LLELNLSDDEQKELKQIAAKTTEKLEELQLNKGGIS"
FT   regulatory      195791..195796
FT                   /gene="lmo1058"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        195806..196078
FT                   /transl_table=11
FT                   /gene="lmo1058"
FT                   /note="similar to B. subtilis YktA protein"
FT                   /db_xref="InterPro:IPR007920"
FT                   /db_xref="InterPro:IPR023324"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67356"
FT                   /protein_id="CAC99136.1"
FT                   /translation="MEYSYPLNPDWTTEEMTIVVQFLEAIERAYEKGIDTLELKEKYRA
FT                   FKQVVPAKGEEKRIGIDFEKASGYSAYKVMQLVKNATTSKIKMQP"
FT   regulatory      196084..196089
FT                   /gene="lmo1059"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        196100..196630
FT                   /transl_table=11
FT                   /gene="lmo1059"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y859"
FT                   /protein_id="CAC99137.1"
FT                   /translation="MDISQIKAEVVTPETGIHVGEKAAPVKVMSFVNLRCPFCREWNEK
FT                   SKDVLTEYIQAGKIELIIKPFDKEKESLQRGNVTHRYLDYSTPEKTRETINKIYSKQDE
FT                   WGSLSLDEVATYMESELGLTEQDNKAASEKIVAEANAANVVFVPTVIVGEHIFDEHISP
FT                   EELRSLLDDELAK"
FT   regulatory      196643..196703
FT                   /gene="lmo1059"
FT                   /regulatory_class="terminator"
FT   regulatory      196761..196766
FT                   /gene="lmo1060"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        196772..197434
FT                   /transl_table=11
FT                   /gene="lmo1060"
FT                   /note="similar to transcription response regulator"
FT                   /db_xref="GOA:Q8Y858"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y858"
FT                   /protein_id="CAC99138.1"
FT                   /translation="MEKILIAEDDSAILGVITAFLTEAGYQVMTAKNGIEAYHLFQKET
FT                   FDLIIMDIMMPSMDGYTLTELIRSTSTTPILMMTALSEEDDELKGFDLGADDYIQKPFS
FT                   YLVLLKRVQVLLRRVNQSETKKQILRCGNISVDTETFEVISAGETIELTKKEFDILVLL
FT                   IKNQKKVITREMILSQAWDFAAIVDTSIINTHMKNLRKKLHTEKIQTIRGAGYKMDE"
FT   regulatory      197404..197409
FT                   /gene="lmo1061"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        197409..198854
FT                   /transl_table=11
FT                   /gene="lmo1061"
FT                   /note="similar to two-component sensor histidine kinase"
FT                   /db_xref="GOA:Q8Y857"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y857"
FT                   /protein_id="CAC99139.1"
FT                   /translation="MLAIKWMNKVRTRISWKIFLIFVSIILLFTALVYAMLIFFLPQFY
FT                   YDYKIKQINDYANEVVKAGEADDIEGVEKALNDFMENTNILPILIDSNGNIVYIPNVNM
FT                   ASIKSATSTVVDGTKAEGGTTATDYSGGTETKNKPISINGQTYNLTYTINIQKINDIST
FT                   VLLQFAPYFILFAFILSLLTAYFFSRRMVRPLLRMNKVASKMANLNFTEVLPITSKDEI
FT                   GQLSGNLNEMAINLEKTMLELNEVNKKLQKEIEKERQLEEMRKSFVTAISHELKSPLAA
FT                   VMGQVEAMRYNVAPYDNHPKYLQESYQILEKMSQMIQEMLDVSKVDQTNYMIEKTSFSL
FT                   TEMVEKIIYSKKMVPHRLSQKVVFQVKEDVTVTANYAFIEKAIENIFENAFNYSKEETT
FT                   ILVEIQNREKGFYFSVHNKATSIPEEELNKLFEPFYRLEKSGNKKTGGNGLGLFIIAKF
FT                   LDIQRIHYKLINEKDGVTFQIWQ"
FT   regulatory      198871..198909
FT                   /gene="lmo1061"
FT                   /regulatory_class="terminator"
FT   regulatory      198928..198933
FT                   /gene="lmo1062"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        198941..200362
FT                   /transl_table=11
FT                   /gene="lmo1062"
FT                   /note="similar to ABC transporters (permease protein)"
FT                   /db_xref="GOA:Q8Y856"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y856"
FT                   /protein_id="CAC99140.1"
FT                   /translation="MDFIRRAFISINAKKGKSLVLFTLLLVIFSLVFTGFAIQESTKQS
FT                   AESARKQLGANVTLQMNQEEIMKKAQSGEEIKEEDLSIPTEDVNKIKKLPQVDNYTISS
FT                   EGSASKGDLTPIPAKKQEGGQGGMTQVAGTDTNGKKVETPSFSVKAVNQTATLNSFKDK
FT                   TDKIISGKPLTSDDKENTALIEKQLAKKNNLKVGDTFQLTNDKKKKVKFVVKGIYQSNQ
FT                   KIEPQLESFQMMLPGNKIYANIKGAKDFLWSGGIEKAEFNLKDPKEINSFISEAKKLTD
FT                   VDNGDMFQFDAQNSAYKKMIGPIERVASFSNIIVMITLLAGGLILALIVLLSIRERKFE
FT                   MGVLLSLGESKTKLMSQFLVEVLIIAALAFSFSCALANPIGQAISNQMLSTEVTKEANK
FT                   ENETSTQESMAIALGGEEKTKVDAEPIDKIDVVITSNIMGQVGGLGFILIFLATTIPCL
FT                   FIIRLQPKMLFTQKD"
FT   regulatory      200362..200367
FT                   /gene="lmo1063"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        200375..201043
FT                   /transl_table=11
FT                   /gene="lmo1063"
FT                   /note="similar to ABC transporter (ATP binding protein)"
FT                   /db_xref="GOA:Q8Y855"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y855"
FT                   /protein_id="CAC99141.1"
FT                   /translation="METNLELQDITYQYDSGNKAQIVLRNLSYTFSEGTFYTILGPSGA
FT                   GKTTLLSIAAGIDKPTSGKLIINKKVLNETMSLQSYRKSLSSIIFQTYNLIPYMTAVQN
FT                   VYTAMGIQHSQMKDKRKRAIELLKEVGLTDKQINSPVLKLSGGQQQRVTIARALSGNAP
FT                   FIFADEPTGNLDHETSEHIIDLFRDLAHKKNKCVVMVTHDNHVASRSDVILNLKGKTLI
FT                   "
FT   regulatory      complement(201047..201096)
FT                   /gene="lmo1064"
FT                   /regulatory_class="terminator"
FT   regulatory      201058..201107
FT                   /gene="lmo1063"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(201110..202054)
FT                   /transl_table=11
FT                   /gene="lmo1064"
FT                   /note="similar to membrane and transport proteins"
FT                   /db_xref="GOA:Q8Y854"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y854"
FT                   /protein_id="CAC99142.1"
FT                   /translation="MHQIFKSDENGKLIELEEVTRNCWINIVAPTSEEINKIADNYEIP
FT                   LEFLEDPLDKDESARIERDDDSDSVLIVCDFPVVDEDDIHYASFETIPMGIIITKDYFI
FT                   TICTIDSSIVQSFIRNRIKGFYTHMKTRFALQILYMISTTFLRHLKRLNRQTDEIEKEL
FT                   HESMKNKQLYDLMGIEKSLVYFVTALKSNKVVLDKMMRQNIVKMYEEDQDLLEDVIIEN
FT                   RQGIEMAEVHSNILSGMMDAYASIISNNMNIVMKFLTSFTIILTIPTMVFSFYGMNVKL
FT                   PFMNTPMAWMLTLGFAFGIAGALAIVFWRRKFF"
FT   regulatory      complement(202063..202068)
FT                   /gene="lmo1064"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(202255..202869)
FT                   /transl_table=11
FT                   /gene="lmo1065"
FT                   /note="similar to B. subtilis YktB protein"
FT                   /db_xref="InterPro:IPR009403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y853"
FT                   /protein_id="CAC99143.1"
FT                   /translation="MTFKGFSKKDFKTMQISGLEARMTGIQNDIQPKFRAVGEELTTYL
FT                   SAKLGDEMFLHIARHQRRSVNPPDSTWLAICHDKRGYKKHPHFQVGLFDKYLFIWLAFI
FT                   YENEESLKIANRFLKEKKLLADLPDNFAISPDHTEEKTYPVHDGQLEATLERFRDVKKG
FT                   EFLVGKIYLPDDNHLSPAKDFIKEAEMVLDELIPLYKAALQ"
FT   regulatory      complement(202877..202882)
FT                   /gene="lmo1065"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      202987..202992
FT                   /gene="lmo1066"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        203000..203773
FT                   /transl_table=11
FT                   /gene="lmo1066"
FT                   /note="similar to extragenic suppressor protein SuhB and to
FT                   myo-inositol-1(or 4)-monophosphatase"
FT                   /db_xref="GOA:Q8Y852"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y852"
FT                   /protein_id="CAC99144.1"
FT                   /translation="MDSEKIDYLARLWIMEAAAKIKQSFKETLDIDVKSGRNDLVTNMD
FT                   KETEAFFVQQIKDHFPDHCLFGEEGMASDVTDLDGVVWILDPIDGTLNFVEQQRDFAIS
FT                   LAVYEDGIGRLAYIYDVTRDELYFGEKGKGATVNGRTIPKLDPAIDLKDTLLIANLSVT
FT                   RKFPTMWEAVKVSRGLRLHGAASLEYMDVATGRAGAYLSANLAPWDIAAGKIIVEELGG
FT                   KVTRINGEKINMLEKGSSIVASPKIHQTLLDNYLP"
FT   regulatory      203951..203956
FT                   /gene="lmo1067"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        203965..205803
FT                   /transl_table=11
FT                   /gene="lmo1067"
FT                   /note="similar to GTP-binding elongation factor"
FT                   /db_xref="GOA:Q8Y851"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y851"
FT                   /protein_id="CAC99145.1"
FT                   /translation="MNLRNDIRNVAIIAHVDHGKTTLVDQLLRQSGTFRDNETVAERAM
FT                   DNNDLERERGITILAKNTAIKYEDTRVNIMDTPGHADFGGEVERIMKMVDGVLLVVDAY
FT                   EGTMPQTRFVLKKALEQNLTPIVVVNKIDRDFARPEEVVDEVLELFIELGANDDQLEFP
FT                   VVYASAINGTSSYDSDPAEQKETMKPLLDTIIEHIPAPVDNSDEPLQFQVSLLDYNDYV
FT                   GRIGIGRVFRGTMHVGQTVALIKLDGTVKQFRVTKMFGFFGLKRDEIKEAKAGDLVALA
FT                   GMEDIFVGETVTPFDHQEALPLLRIDEPTLQMTFVTNNSPFAGREGKHVTSRKIEERLL
FT                   AELQTDVSLRVEPTASPDAWVVSGRGELHLSILIETMRREGYELQVSKPEVIIREIDGV
FT                   KCEPVEDVQIDTPEEFMGSVIESISQRKGEMKNMINDGNGQVRLQFMVPARGLIGYTTD
FT                   FLSMTRGYGIINHTFDSYQPIQKGRVGGRSRGVLVSMETGKSTTYGTMQVEDRGTIFIE
FT                   PGTDIYEGMIVGENNREGDIAVNIVKAKQMTNIRSANKDQTNVIKKPRHLSLEESLEFL
FT                   NEDEYCEVTPESIRLRKKILNKNEREKAAKRSKTAE"
FT   regulatory      205817..205870
FT                   /gene="lmo1067"
FT                   /regulatory_class="terminator"
FT   regulatory      205961..205966
FT                   /gene="lmo1068"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        205975..206835
FT                   /transl_table=11
FT                   /gene="lmo1068"
FT                   /db_xref="InterPro:IPR031888"
FT                   /db_xref="PDB:4EAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y850"
FT                   /protein_id="CAC99146.1"
FT                   /translation="MKKWMVIISIISLVALLGACGNNDNEKDQEDKSTTDSTTKKAKSS
FT                   SNESNKAAETKENDTNDKAATTDKGSSNPTKEEKDTSTTTDTPKKETPKSPAKTEAFSF
FT                   SPSGFKVSTVESILGGDVTTTYLSSSKSFQKDFEALTLFINQYKVEHVINPTKEVSASN
FT                   PESYLANKNGYVITLDISIKNNSKKDKMYKADQISLLGASKSVGGSLDNFIPSGFHLIG
FT                   SSSDPYNFTAGKTARGLLTFTMDEATYNDLAKDSQIGVPDPSRFDSSSTKGSSQDNVVA
FT                   PFPIK"
FT   regulatory      206840..206880
FT                   /gene="lmo1068"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(206840..206869)
FT                   /gene="lmo1069"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(206874..207116)
FT                   /transl_table=11
FT                   /gene="lmo1069"
FT                   /note="similar to B. subtilis YlaI protein"
FT                   /db_xref="InterPro:IPR019241"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y849"
FT                   /protein_id="CAC99147.1"
FT                   /translation="MNAKCILCERVDELDNREFKTKQLRNKPIRMYLCPECEHRVAINT
FT                   ISRVNSGHFNFHKPVVISNSELKNMLEHNKETISE"
FT   regulatory      complement(207125..207130)
FT                   /gene="lmo1069"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      207309..207314
FT                   /gene="lmo1070"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        207322..207603
FT                   /transl_table=11
FT                   /gene="lmo1070"
FT                   /note="similar to B. subtilis YlaN protein"
FT                   /db_xref="InterPro:IPR009983"
FT                   /db_xref="InterPro:IPR036270"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y848"
FT                   /protein_id="CAC99148.1"
FT                   /translation="MANKKIDHREEAVELLKQDAKRILQLIKVQMDNLTLPQCPAYEEV
FT                   LDTQMYGLSREINFATRLGLIEPEEGKKLMSTLEKELSTLHELSMSKK"
FT   regulatory      207619..207652
FT                   /gene="lmo1070"
FT                   /regulatory_class="terminator"
FT   regulatory      207774..207779
FT                   /gene="lmo1071"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        207786..208988
FT                   /transl_table=11
FT                   /gene="lmo1071"
FT                   /note="similar to cell-division protein RodA and FtsW"
FT                   /db_xref="GOA:Q8Y847"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y847"
FT                   /protein_id="CAC99149.1"
FT                   /translation="MFKRILKSYDYAFIAVFIVLCLFGLIMIYSASWSLAIGKGLPADY
FT                   FYARQVKNFIISFIFFILFALLPFKFYQNNKVLMLIVFGSIGVLLLIFLVGKTVNNANS
FT                   WLVLGPRSLQPGEFAKLAVIIYMSAIYAKKQSYIDDFNRGVLPPIFFLAFVCFLIAIQP
FT                   DTGTAFIIFLVGCCIIITSGMRLRTIMKLIGIGMGIIIGLTLILFALPDSVRNEIVSPT
FT                   KVARITTFMNPFEYADKEGHQLINSFYAIGSGGVSGQGLGESVQKLGYLPEAHTDFIIA
FT                   VVAEELGVFGVMFIILALFFIIFKTITTGLRAKDPFASLMCYGIASLIAIQAFINLGGA
FT                   SGLIPLTGVTLPFISYGGSSLMVLSMMLGIVANISMFTKYQRVYKADGSTKELPKKQKR
FT                   R"
FT   regulatory      209003..209027
FT                   /gene="lmo1071"
FT                   /regulatory_class="terminator"
FT   regulatory      209254..209259
FT                   /gene="pycA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        209266..212706
FT                   /transl_table=11
FT                   /gene="pycA"
FT                   /note="highly similar to pyruvate carboxylase"
FT                   /db_xref="GOA:Q8Y846"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y846"
FT                   /protein_id="CAC99150.1"
FT                   /translation="MNRIKKVLVANRGEIAIRVMRACTELKIKTVAIYSQEDTGSFHRY
FT                   KSDEAYLVGAGKKPIDAYLDIENIIEIAKESGADAIHPGYGFLSENIEFARRCEQEGII
FT                   FVGPKSKHLDMFGDKIKAKEQALLADIPVIPGSNGPVAGIKEVEEFGEKNGYPLMIKAS
FT                   LGGGGRGMRVVESKEHVKESFERASSEAKAAFGNDEVYVEKCVMNPKHIEVQILGDTHG
FT                   NIVHLFERDCSIQRRHQKVVEVAPCNAITSELRNRICDAAVKLMKNVDYINAGTVEFLV
FT                   EGDDFYFIEVNPRVQVEHTITEMITGIDIVQSQLFIADGYALHDQLVAIPKQEDIHIHG
FT                   SAIQSRITTEDPLNNFMPDTGRVDTYRSTGGFGVRLDAGNGFQGTVVTPFYDSLLVKLC
FT                   TWGMTFEQATRKMRRNLIEFRIRGVKTNIPFLLNVVRHPDFASGNYNTSFIDTTPELFK
FT                   FPHIRDRGTKTLRYIGNVTVNGFPGIKHRDKPVYAEPRLPKIPYGSQISPGTKQILDAK
FT                   GPEGVVDWVKKQEEVLLTDTTLRDAHQSLLATRVRSKDIFQVADAMAHLLPNMFSFEMW
FT                   GGATFDVAYRFLNEDPWVRLETLRKQIPNVMFQMLLRGANAVGYKNYPDNVIREFVKQS
FT                   AQSGVDVFRVFDSLNWIKGMEVSIDAVREAGKVVEAAICYTGDIDDDTRTKYTIDYYKD
FT                   MAKELVAQGTHILGIKDMAGLLKPQAAYRLIGELKDTVDVPIHLHTHDTSGNGIYTYAA
FT                   AVSAGVDIVDVASSAMSGATSQPSMTGLYYGLVNGNRQTNLDAQNSQIINHYWEDVRHY
FT                   YKDFDNALNSPQTEVYIHEMPGGQYTNLQQQAIAVGLGDRWDEVKEMYTVVNQMFGDIV
FT                   KVTPSSKVVGDLALFMVQNELSEEDVYEKGDTIDFPDSVIEFFMGEIGQPYGGFPEKLQ
FT                   KLVLKGRTPLTDRPGALMEPVNFVDVKAELKEKMGYEPTEKDVISYILYPKVFLDYQDM
FT                   INKYGDVTVLDTPTFYKGMRLGETIEVELEKGKILLIKLNSIGEPIADGTRVIYFELNG
FT                   QPREINIQDMNVQSTVIARRKIDTTNPEHVGATMTGSVIQVVVKKGDSVKKGDPLLITE
FT                   AMKMETTIQAPFDGEVSSIYVSDGDTIESGDLLIEVNRI"
FT   regulatory      212844..212849
FT                   /gene="lmo1073"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        212858..213757
FT                   /transl_table=11
FT                   /gene="lmo1073"
FT                   /note="similar to metal binding protein (ABC transporter)"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y845"
FT                   /protein_id="CAC99151.1"
FT                   /translation="MKWFKGIAVVLLLAILTACGNTEVKETTKQTEEIKVKDATGETIT
FT                   LKKAPTKIVSLIPSNTEILFALGLGDEVKGVSAYDDYPKEAQKIEKVTSTSVDTEKIIA
FT                   LKPDLVLGHESMLATEKDAYKILTDAGINVFVVPDATNLKEVEKSIATIGDLTGTEKEA
FT                   TKVTDSMEKQKVAIEKKAKELKTSPKVWIEISPDLYTAGKGTFMNEMLELAGGTNIVTE
FT                   SGFIPYNEEKVVELQPDIILSVYPDAKSTIQKRAAWKDIPAIKNDKIYEMDANKLSRPG
FT                   PRLLEGAADIQAVLEKNN"
FT   regulatory      214032..214037
FT                   /gene="lmo1074"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        214048..214851
FT                   /transl_table=11
FT                   /gene="lmo1074"
FT                   /note="highly similar to teichoic acid translocation
FT                   permease protein TagG"
FT                   /db_xref="GOA:Q8Y844"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y844"
FT                   /protein_id="CAC99152.1"
FT                   /translation="MKQIIEVLKEQFKYAPMIFRIARYEDKATYQSHYLGLAWQVLNPL
FT                   IQIAIYYFVFGFAFNSSSGSNASYIEWMLAGIIPWFFISGVILQGANSIYNKINMVSKM
FT                   NFPMSILPSINIASNLTSYFTMMVLLVGLFAVKGTPITIYWGQYLYYFVAMIAFLYSFT
FT                   LLNATISVLVRDYYIMLQSLIRVLFYMSGVVWDLQTKLPEWAFNILKLNPIYYLINGFR
FT                   ETFLMEKMFWENPSYTVYFWLLTGVLLFVGASLHMKFRERFVDYL"
FT   regulatory      214850..214855
FT                   /gene="lmo1075"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        214863..215864
FT                   /transl_table=11
FT                   /gene="lmo1075"
FT                   /note="similar to teichoic acid translocation ATP-binding
FT                   protein TagH (ABC transporter)"
FT                   /db_xref="GOA:Q8Y843"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015860"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y843"
FT                   /protein_id="CAC99153.1"
FT                   /translation="MDKNIKVSFKHVSKEYDLYQNKSDKIKGLFLPKSKRVQSFWALRN
FT                   VCFDVYDGETVGLIGINGSGKSTISNIMSGVIPPTQGEVVINGETSLIAIAVGLKGPLS
FT                   GLENIRLKLLMHGLKGSQIDSLLPSIIEFADIGDFINQPIKNYSSGMRSRLGFAISVHT
FT                   DPDILVVDEALSVGDQTFYQKCVDKINEFKAQGKTIVFVSHSLGQVKSLCDKIIWMHHG
FT                   EVREIGDAAEVAEKYDEFVKWFNKQPNDFKKKYQKEQKEKQKLPQEKIYPTPNANKYKM
FT                   GLFDKCFLVVLLALLVLFGSLISTGKSFMGLFSATDNKVEQVTKVDKRTDWK"
FT   regulatory      215871..215903
FT                   /gene="lmo1075"
FT                   /regulatory_class="terminator"
FT   regulatory      216029..216034
FT                   /gene="lmo1076"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        216041..217759
FT                   /transl_table=11
FT                   /gene="lmo1076"
FT                   /note="similar to autolysin (EC 3.5.1.28)
FT                   (N-acetylmuramoyl-L-alanine amidase)"
FT                   /db_xref="GOA:Q8Y842"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR025987"
FT                   /db_xref="InterPro:IPR038200"
FT                   /db_xref="PDB:3FI7"
FT                   /db_xref="PDB:5JQC"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y842"
FT                   /protein_id="CAC99154.1"
FT                   /translation="MIKKVFHFILVLMLSVSIIPLFHAKAAETTNGVDSSEQEDNTEVA
FT                   REEMPPESEEPVFSLEQNRDDAMAALVVPQTRNSFLRAASTPTFQQTFINSISTQAMDL
FT                   CKKYNLYPSVMIAQAALESNWGRSELGKAPNYNLFGIKGSYNGKSVTMKTWEYSDSKGW
FT                   YQINANFAKYPSHKESLEDNAKKLRNGPSWDSSYYKGAWRENAKTYKDATAWLQGRYAT
FT                   DNTYASKLNTLISSYNLTQYDTLYDTIKQQKNVSEDAKVVKADGHGVYSGIYNTSAASA
FT                   KKLSTGAPYNNKDVKILKEGTTSRGTWVQFSLNNKVIGWMDKRAFVYYPKATNVKTLNL
FT                   TGKITAGSTNGLWSEVPGTVNAKKLATTAGAYQNKDAKIIKQGQISGRTYYQFQVGGKT
FT                   IGWLDARAFHVYDKIQSQSNVNWNRTILNADKHGVYSGVYNTSSSSMNKLSTGAKYNNK
FT                   KVKVIKQAKTARGTWYQFQVNGKTVGWMDYRAFFDTITSQKTMNKTVTVGNATNHGVFD
FT                   GVYRTSPTVKRISLGKPYNNKKVKVLKEAVTDHATWVQFKYGNTTAWMDKKAFKY"
FT   regulatory      217767..217795
FT                   /gene="lmo1076"
FT                   /regulatory_class="terminator"
FT   regulatory      217960..217965
FT                   /gene="lmo1077"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        217975..219663
FT                   /transl_table=11
FT                   /gene="lmo1077"
FT                   /note="similar to teichoic acid biosynthesis protein B"
FT                   /db_xref="GOA:Q8Y841"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y841"
FT                   /protein_id="CAC99155.1"
FT                   /translation="MSNSKFIITELYWERIQLHVKGKIENISLENYTFSFRTLTDEFHF
FT                   SPTGIKLEGNTFDLRFNIAILNDGNYLPSGDYLLSLYNSETADEIVAQPAAELYKFPED
FT                   EDLLEELNEAKTENEKNNVLLAGLRKEFKRGGANLKYTYKVTPMISADVNEFVFSVSFT
FT                   IPVPKPTKWQVFKNKIKEMYHTFSFNFRTGLFKSIFYTSQALVPKNGKRILFSSDSRAE
FT                   IGGNFEFVLNKMKEMGIDKDYKIKMTFKPNIRLRRAFIEKFRFPFLLGSSDIIFIDDYH
FT                   PMIYTIDFSEKTQVIQLWHACGAFKTVGFSRSGKQGGPFFDDRAHRNYTRAIVASDTDI
FT                   PFYAEAFGIKESSILPTGVPRTDIFFDPEYKRNIVTTMEQLFPETQGKQVILFAPTFRG
FT                   NGANQAHYPYFKINLAKFAEYCRKNNSVVIFKMHPFIKNEFIIPEQYADVFIDASSYRE
FT                   VNDILFITDILITDYSSVIFEFSTLQRKMLFYAFDLEDYVSTRDFYEEYEGFVPGKIVY
FT                   DFEALIKALEMNDFEQEKVKPFLDKHFKYQDTNSAKRIVEEIFKK"
FT   regulatory      219669..219699
FT                   /gene="lmo1077"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(219669..219699)
FT                   /gene="lmo1078"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(219705..220577)
FT                   /transl_table=11
FT                   /gene="lmo1078"
FT                   /note="similar to putative UDP-glucose pyrophosphorylases"
FT                   /db_xref="GOA:Q8Y840"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y840"
FT                   /protein_id="CAC99156.1"
FT                   /translation="MKVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQFIVEEAV
FT                   ASGIEDILIVTGKGKRAIEDHFDSVPELENNLREKNKLDLLHLVEETTNINLHFIRQSK
FT                   PKGLGDAILQAKGFIGNEPFVVMLGDDIVQSKTPCAKQLIDQYEKTHSSVIGVQNVPRE
FT                   ETYRYGIIDPDKEVSDRLYNVTGFVEKPNVEDAPSNLAILGRYLLTPEIFKYLETQEAG
FT                   SGGEIQLTDAINRLNEIQPVFAYDFEGERFDVGDKFGFIETTLKFALKHPEIKDDVRDL
FT                   IIRLGDELK"
FT   regulatory      complement(220584..220589)
FT                   /gene="lmo1078"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      220757..220762
FT                   /gene="lmo1079"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        220769..223627
FT                   /transl_table=11
FT                   /gene="lmo1079"
FT                   /note="similar to B. subtilis YfhO protein"
FT                   /db_xref="GOA:Q8Y839"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y839"
FT                   /protein_id="CAC99157.1"
FT                   /translation="MEDVRKKWKKVQWDNEITYKTFLTYSVLFVLVTISIYLLFWLRGY
FT                   SFIWSHDGFNQHYPILKEFRNMLVDFLKHPTQVPELWSWQIGMGGDVVGSFGYYVLGDI
FT                   FAYLVVLFPADQMELAYTTLILLRLFCVGIAFLALAKNFKINHIAAVTGSLVYVFSGYL
FT                   FVSATRHPFFITPMILLPLLCLCVERVLQKKSPVPLILVICWTLVSNFYFAYMLAIMVC
FT                   IYTVIRYFTHYKKQGIPLLSTIGKLAVYAITGFLMACILFLPNLIAFLGSSRANGEFAN
FT                   GLWFYDLSYYLSLGKMYITTESAGYWANLGFAAIAVFVLPFIWQYRKKYPVVFISLVLG
FT                   LGMMLFPFFGALFNGLSSPSNRWMFAVALPVSIGVSFLLTDYKTLTKKDMRNFLITLII
FT                   FIVVSWWGPNFNIYQPILLVPLTLMLLTFFVFFLQFINLNYIKKKAYNGLFYFLIIMLV
FT                   CVNLAYMGNYMFSKNGANKVQGQLNSGVVERKITELYGGADKKIDKSSFYRTSLSSGYN
FT                   GFYDNSDANILLDVNTVNSFYSITNGAVADLASELNNSQFRMTLPLGQMDNRTIFTNIL
FT                   GTTYLFARDDQAGRIPYGFKKIDSAEIERVDKPGISHTDVYESENSVPLMYMNYHTEDR
FT                   ESYEKLSPLEKEEALSYNAIIDNKDTSKREYKSNIKELEFETSIPKVNGKAPAKLTKDK
FT                   IEVSNAENSIQFKLKNPEETKNAELYFYIDGLDFTPYTFKQRKDIAFAKDEYKTKNMRY
FT                   NYYRNNLTKRIKEDYTLTAKTSNRVVSASQVDKSELSGYFKRDNMLLNGGFSEKARKQV
FT                   SINLSGLGTYDYDNIKIYAVPFDDSYTKRMQELKKQAATDLKFDTNKVSAKVSAKQDGV
FT                   LVTTIPYTKGWKVKVDGKEVSTEKVNTGFIGFSLDKGLHTIEMNYETPMLKAGMVASGL
FT                   GVILFAGIIVVYHLRKRKNKTQ"
FT   regulatory      223639..223669
FT                   /gene="lmo1079"
FT                   /regulatory_class="terminator"
FT   regulatory      223748..223753
FT                   /gene="lmo1080"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        223759..225630
FT                   /transl_table=11
FT                   /gene="lmo1080"
FT                   /note="similar to B. subtilis minor teichoic acids
FT                   biosynthesis protein GgaB"
FT                   /db_xref="GOA:Q8Y838"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y838"
FT                   /protein_id="CAC99158.1"
FT                   /translation="MRNLKDRVLNSLKGNKKDIKISVVVPTYNTELEGLKNLMASIDKQ
FT                   TMNPDEYELVFVDDGSTTDTYERLQEFAETRPNMTVKQIENSGWGSRPRNIATKMAKGE
FT                   YILYLDHDDTVFPETFERVYNFGKENNLDVVSGKEVRTNGWSWGWKQFSENNPHAEEMG
FT                   IECLLPMTPHKFYKREFLLENDITFDDGARVLWEDVYFNSKAFIHGAKVGILADYPTYY
FT                   WIATGANNSSSFGRDPHEKWNQINKLFNFFKDNIKEQRDLDFMLTHWYRSRVLGILGQW
FT                   LLKNNNERIDIEFNYAKKLAEELIPAYISENLDKNNQVKDYLLRQGDLDSLKKLAQIDA
FT                   GITALSYVEDAYFKEDKLFFKTSTKMTYEDKEDFFIEKTADRMERILPEEIKSKLPKEF
FT                   FDYSDDLAEFTYEPSIKGRNSRATWKIDGSTSNVEVVNKKANLYKIEGEMSFSVQINDY
FT                   ILDAADKKQPWDIATRFTGLGYTSHRALTIGKILIKTALINNKTMIVYKNASGLISLDV
FT                   GSSVRSIVEDSGVKREQILIDKTSGKVTIPLNEIHVFGESLIEGNAELKPVGISDADPI
FT                   NVKAKLIGEANKARVEVLLGDEKLSGEYHLVTNIQGKKDKQQIKITL"
FT   regulatory      225634..225639
FT                   /gene="lmo1081"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        225647..226513
FT                   /transl_table=11
FT                   /gene="lmo1081"
FT                   /note="similar to glucose-1-phosphate thymidyl transferase"
FT                   /db_xref="GOA:Q8Y837"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y837"
FT                   /protein_id="CAC99159.1"
FT                   /translation="MKGIILAGGSGTRLYPLTKAISKQMLPIYDKPMIYYPLSILMLAG
FT                   IKDILIISTPEDTPRFEQLLADSDQLGINISYAVQEKPEGLAQAFIIAEDFIGDDSVSL
FT                   ILGDNIYYGQGLSKMLQRASAKKAGATVFGYHVNDPERFGVVEFDESMKAISIEEKPTE
FT                   PKSNYAVTGLYFYDNRVVEIAKSIKPSERGELEITDVNKRYLELGELDVELMGRGFAWL
FT                   DTGTHESLLEASTFIETIERRQNLKIACLEEIAYRMGYIDEAAVEKLAEPLKKNAYGQY
FT                   LMKLINK"
FT   regulatory      226519..226524
FT                   /gene="lmo1082"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        226532..227092
FT                   /transl_table=11
FT                   /gene="lmo1082"
FT                   /note="similar to dTDP-sugar epimerase"
FT                   /db_xref="GOA:Q8Y836"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y836"
FT                   /protein_id="CAC99160.1"
FT                   /translation="MEIVESKLAGVKLVKPKVFGDHRGFFMESYNEKAFHEAGIDMKFI
FT                   QDNHSLSVEAGVLRGMHYQTNPKAQTKLIRVATGAIYDVVVDMRKGSPTYGEWEGYILS
FT                   EANKHQLLVPQGFAHGFCTITENVNVLYKVDQLYSPENDAGIAYDDPDLNITWPTDKLI
FT                   LSDKDTKHPRLKDAENNFVWENK"
FT   regulatory      227079..227084
FT                   /gene="lmo1083"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        227093..228079
FT                   /transl_table=11
FT                   /gene="lmo1083"
FT                   /note="similar to dTDP-D-glucose 4,6-dehydratase"
FT                   /db_xref="GOA:Q8Y835"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y835"
FT                   /protein_id="CAC99161.1"
FT                   /translation="MNLLVTGGAGFIGSNFVHHILNKHDDYKVVNLDLLTYAGTMSNLE
FT                   DIKENPNHVFVEGNICDYDLVKKLVTDHKIDTIVNFAAESHVDRSIINPGIFIETNVQG
FT                   TLNLLNVAKELNVAKYLQVSTDEVYGSLGETGYFTEETPIAPNSPYSASKASADLLVRS
FT                   YFETYGLNVNITRCSNNYGPHHFPEKLIPLMITNGLDGENLPIYGDGKNIRDWLHVSDH
FT                   CAAIDLVIHNGKSGEVYNVGGHNERTNNEIVHIIVDDLNLSKDKIVYVEDRLGHDLRYA
FT                   IDPKKIETELGWEPKYTFDTGIKETIEWYVNNEAWWRPLKSRAKLGE"
FT   regulatory      228067..228074
FT                   /gene="lmo1084"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        228082..228912
FT                   /transl_table=11
FT                   /gene="lmo1084"
FT                   /note="similar to DTDP-L-rhamnose synthetase"
FT                   /db_xref="GOA:Q8Y834"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y834"
FT                   /protein_id="CAC99162.1"
FT                   /translation="MSILVTGANGQLGTELVQLLKEHNLTVTEWDKDSVDIVDKAAVKK
FT                   AMLDLKPEWIIHCAAFTNVEAAEDELKNVNWEVNVDGTENISEAAEIVGAKLVYISTDY
FT                   VFDGTKKEAYLPDDKTNPLNQYGIAKLAGEKVALEKNSQTYVIRTSWVFGKYGNNFVYS
FT                   MLKLAETHKELKVVNDQLGRPTYTYDLADFIRFVIEKNPAYGIYQFSNSGTATWFEFAT
FT                   EILKDKDVTVNPCTSDEFPQKAERPKTSIMSLEKVEKLGFNIPTWQDALVRFKK"
FT   regulatory      228922..228948
FT                   /gene="lmo1084"
FT                   /regulatory_class="terminator"
FT   CDS_pept        228932..231022
FT                   /transl_table=11
FT                   /gene="lmo1085"
FT                   /note="similar to teichoic acid biosynthesis protein B"
FT                   /db_xref="GOA:Q8Y833"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y833"
FT                   /protein_id="CAC99163.1"
FT                   /translation="MHSYNCFFISLWGLFVYNSNVYKLLYEQKEPDILNDSRDLHSICF
FT                   VSTEVEDKNNNVHFIAESADLLADCLVLLEKENKHYLTFMKENLNTIALAEKIEYAPDI
FT                   ICPNKVLKGSLYTNPECIDNSLAGSTFSKDLLKRVANEMKQEVFELTSFNYYCYHLAEK
FT                   IGHLGEEASYSLSLADLDDSVTRLLDIKDNHYRKDWTILYYVNKFLMMHLENLPKIFEE
FT                   SDEKFQINYLEKLTELIAKLPDEVIFELDALDYLVQNILNDSFEWIKYEAYPACLTLAE
FT                   IISHRAAPNKFTDTKWLCLEKCVRKGSVNPLRNKKNPTVLTPIKKKFVSFFSRKVVFTI
FT                   AKLLPVAKDNVLLVSNKISDLDATFMPIYQTIKQKHPEKSVRAYMKMRPEDNHAMYYLT
FT                   YFWNLGRAKYVFLDDYYYQLYSIRMRKEAEVIQLWHAAGAFKRFGHSSLGFKDSISLDF
FT                   ETRAHQNYTTSVISSSDLKPIYAEAFHMDETKIEAFGLPRLWKLFDQDYKEFRLDYFQK
FT                   MYPLLKGKKVITYAPTFRGNSEERKAFQLELNLRKMKEELGQEYVVVIKLHPLVSVETQ
FT                   VPEDLADFVLDFSGIEMNDVLIVTDILITDYSSVIYDYSILNRPIIFYAYDLEAYSLER
FT                   NFYHDYLEFVPGPVVATTEEAIKLIQTNQMITGKLQDFAEKAFEYHDGDAAARIIDYVM
FT                   QD"
FT   regulatory      231086..231091
FT                   /gene="lmo1086"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        231098..231808
FT                   /transl_table=11
FT                   /gene="lmo1086"
FT                   /note="similar to CDP-ribitol pyrophosphorylase"
FT                   /db_xref="GOA:Q8Y832"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR034709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y832"
FT                   /protein_id="CAC99164.1"
FT                   /translation="MIYAEILAGGKGTRMGNVNMPKQYLPLKGKPIIVHTIEKFILNDR
FT                   FEKIIIATPKDWINHTQDIIKKYIFDSRVIVIEGGTDRNETIMNGIRYVEKEFGLNEDD
FT                   IIVTHDAVRPFITHRIIEENIDMALEFGSVDTVIPAVDTIVESTNHDFITDIPVRGNIY
FT                   QGQTPQSFNMKTIQKHYNNLTDDEKQILTDACKICLLAGEKVKLVNGGISNIKITTPYD
FT                   LKVANAIVQERINS"
FT   regulatory      231791..231796
FT                   /gene="lmo1087"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        231805..232830
FT                   /transl_table=11
FT                   /gene="lmo1087"
FT                   /note="similar to glucitol dehydrogenase"
FT                   /db_xref="GOA:Q8Y831"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR034710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y831"
FT                   /protein_id="CAC99165.1"
FT                   /translation="MINQVYRLVSERQFEEANIEEALTEDVVVVRPTYLSICAADQRYY
FT                   TGSRGKEMLSKKLPMALIHEGVGQVTYDATGEFEIGTKVVMIPNTPTEDDPVIAENYRR
FT                   SSLFRSSGYDGLMQENVFMRRDRVVRLPENMDMEVAAYSELISVAFHAITRFKQKANAN
FT                   QSVFGVWGDGNLGFITCLLLKTIYPESKVIIFGKTQYKLDFFSFVDEAHLVDEIPEGLV
FT                   IDNAFECAGGKGSQYAVEQIIDLIKPEGTISLLGVSENPIEFNSRMVLEKGLTVFGSSR
FT                   SGKEDFQNTVNFLSENERAVEYLSSLIGQRKVVRNLQDIIEAFETDLRNPFGKTVMEWK
FT                   V"
FT   regulatory      232908..232913
FT                   /gene="tagB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        232918..234078
FT                   /transl_table=11
FT                   /gene="tagB"
FT                   /note="similar to teichoic acid biosynthesis protein B
FT                   precursor"
FT                   /db_xref="GOA:Q8Y830"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y830"
FT                   /protein_id="CAC99166.1"
FT                   /translation="MIVKNIAISMYMFLLSLFSFFSRFFGVKKRVLIMASFPENTTAIL
FT                   NQMKKMGYTPNTICFHTERVQFNTKELDFVRFSPNNLANKWKLMFYLNTSKVILVDNYY
FT                   PELAAVSFKDGVECIQLWHANGALKQFGWEDNSISERSDADKKRFKAVYEHFLKVVVGS
FT                   DEMGEIFKRSFLLNESHLLKIGVPRTDVYFEESLQQQKRIEWRNKFHAENKKVILYAPT
FT                   FRDNELAEAKLVMDFNAMERAFSEDYLLVLKLHPAVKIDVQSLNTDFIINVDKNVALEE
FT                   LLAAVDILITDYSSIPFEFALFERPIYFFSYDMEKYDKERGLIKNYQEIIPGPISQTTA
FT                   ELIEQIKTKATSETLALFSKKWNKYSDGHASERMVVYMKQLMEEAK"
FT   regulatory      234065..234070
FT                   /gene="tagD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        234079..234462
FT                   /transl_table=11
FT                   /gene="tagD"
FT                   /note="highly similar to glycerol-3-phosphate
FT                   cytidylyltransferase (gct), CDP-glycerol pyrophosphorylase
FT                   (teichoic acid biosynthesis protein D)"
FT                   /db_xref="GOA:Q8Y829"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y829"
FT                   /protein_id="CAC99167.1"
FT                   /translation="MKKVITYGTFDLLHWGHIHLLKRAKALGDYLIVAISSDEFNRIKH
FT                   KEAYHSYEHRKLIIEAIRYVDEVIPENNWEQKRDDIEKYGIDVFVMGDDWEGEFDFLKD
FT                   VCEVVYLPRTEGISTSQIKDELK"
FT   regulatory      234469..234474
FT                   /gene="lmo1090"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        234484..235467
FT                   /transl_table=11
FT                   /gene="lmo1090"
FT                   /note="similar to glycosyltransferases"
FT                   /db_xref="GOA:Q8Y828"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y828"
FT                   /protein_id="CAC99168.1"
FT                   /translation="MEPLVSVIIPVYNVEKYVKRCLDSVLEQTYHNLEVIVVNDGATDN
FT                   SAKVIKSISDNRIRYFEKENGGQATARNFGLDVATGDYIVMVDSDDYISKNLVETCLDT
FT                   VQKTNADLVLFTSYNVNQEGKMQYIKRDKGIKVLDAGPTPWNKFYQADLWKGSRFPVGY
FT                   WYEDLGIIPVVTLKAKNPVKIQDALYYYITDRADSQSNIQQVDHFLDVVIMLENVETEL
FT                   KKLGIYEESKDQLAYLYIEHLIYRLVLRKAIYITNKQERKKLIKKISTIIQEKFPNWGS
FT                   YPYQAGGKLTATLKKKALWLYLHHLYLLGDLVWKYPFSIRSKQTGF"
FT   regulatory      235468..235473
FT                   /gene="lmo1091"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        235482..236495
FT                   /transl_table=11
FT                   /gene="lmo1091"
FT                   /note="similar to glysosyltransferases"
FT                   /db_xref="GOA:Q8Y827"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y827"
FT                   /protein_id="CAC99169.1"
FT                   /translation="MHKLSVVIAVYNVSEYIEACLTSVLEQNYKNVELIIVNDGSTDDT
FT                   FQKVEKLVDGHTNVILIDQENQGVSAVRNNGVKAATGDYLGFVDGDDIIAKDMFQKMMD
FT                   SFEMSDADMVTIGVARLSGDKVYPSTLHERYMVEKKEATTIEETPALLYDTTSWNKVFK
FT                   KSFWDKHHLEFPEGQMYEDIALMIPAFLYAEKVNIIPDVGYYWRSREGGAKSITQRRND
FT                   IAMVNDRLLALKKVNQVLNEKNIQGDLRYQNERKNFEIDLFSMIEWAFLAPKDYYLALQ
FT                   PLIKNYVEQEMKTTALNDIPKEKKRLFKALLANNRPAFLLNSYIYFGKKAVKKITK"
FT   regulatory      236691..236696
FT                   /gene="lmo1092"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        236704..238194
FT                   /transl_table=11
FT                   /gene="lmo1092"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YueK protein"
FT                   /db_xref="GOA:Q8Y826"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y826"
FT                   /protein_id="CAC99170.1"
FT                   /translation="MTNLFQDDSLTLHTDLYQLNMMKAYFDDGLHERRSVFEVFFRDMP
FT                   FDSGFVVFAGLERIIHYMQNLRFTETDIAYLHDELGFDGPFLEYLRNFKFKGNILAAKE
FT                   GEFVFKTEPILQVEASLAEAQLIETALLNIVNFQTLIATKAARIRSVIDDETFAEFGTR
FT                   RAQEMDAAIWGTRAAYIGGCDSTSNVRAGKIFGIPVSGTMAHAMVQAYRDELEAFRSYA
FT                   KTHFDSIFLVDTYDTLKSGVPNAIKVAKEMGDKINFIGIRLDSGDMAFLSKKARQMLDE
FT                   AGFTEAKIFASSDLDEHTILSLKAQKAKIDSWGVGTKLITAYDQPALGAVYKMAAIADE
FT                   NDILQDSIKLSSNTEKVSTPGKKKVYRIITNEDGLKAEGDYIALADESLENVDKLTMFH
FT                   PVHTYIMKTVENFTARELLVPIFQNGELVYDMPSLDEIKAYKEENLALLWDEYKRTVRP
FT                   EQYPVDLSVKCWKNKMRNIEKVRKSVQLHSPVELDMPF"
FT   regulatory      238193..238198
FT                   /gene="lmo1093"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        238206..239030
FT                   /transl_table=11
FT                   /gene="lmo1093"
FT                   /note="similar to NH(3)-dependent NAD(+)
FT                   synthetases,nitrogen regulatory protein"
FT                   /db_xref="GOA:Q8Y825"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y825"
FT                   /protein_id="CAC99171.1"
FT                   /translation="MEIRERILADMQVAETIDAHEEIRKSVEFLKAYLKKNTFLKSFVL
FT                   GISGGQDSTLTGKLAQMAISEMRAETGDDEYRFFAVSLPYGTQLDESDRQDALNFMEPD
FT                   NRLTVNIKASVDASVAALAEAGVELSDFAKGNEKARERMKVQYAIAAMHKGVVVGTDHS
FT                   AEAVTGFYTKYGDGGTDINPLFRLNKRQGKALLKELGCPEHLYLKKPTADLEDNKPALP
FT                   DEVALGVTYDQIDDYLEGKEVPADAAAKIENWFIKTEHKRHMAITIFDDFWK"
FT   regulatory      239029..239034
FT                   /gene="lmo1094"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        239043..239351
FT                   /transl_table=11
FT                   /gene="lmo1094"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y824"
FT                   /protein_id="CAC99172.1"
FT                   /translation="MKVGYGLLTAFYTHPGERDHLVKILLEAAESLEEYNTCIQYIVSE
FT                   SENEADTVFVSEIWVDKGHHEASLDNPAVKATIERAKPLIKEVKRIQELDILGGKGV"
FT   regulatory      239367..239402
FT                   /gene="lmo1094"
FT                   /regulatory_class="terminator"
FT   regulatory      239398..239403
FT                   /gene="lmo1095"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        239412..239816
FT                   /transl_table=11
FT                   /gene="lmo1095"
FT                   /note="similar to PTS system, cellobiose-specific IIB
FT                   component (cel A)"
FT                   /db_xref="GOA:Q8Y823"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y823"
FT                   /protein_id="CAC99173.1"
FT                   /translation="MQTLMIVCAGGATSSLMAQNVVKSATSEGMDAVLLFPDDVKYKDS
FT                   FREKYSTRDLVVVMGPVGAITAGKFRDYKEQVDAVLVAPQVKYMYKTVEEVLGELNIPC
FT                   ANINSLDFGRMRGDKILTQGLALMNAKNSK"
FT   regulatory      239936..239941
FT                   /gene="guaA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        239945..241501
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /note="highly similar to GMP synthetase"
FT                   /db_xref="GOA:Q8Y822"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y822"
FT                   /protein_id="CAC99174.1"
FT                   /translation="MFKIMKDFTEQEKIIVLDFGSQYNQLITRRIREFGVYSELHPHTI
FT                   TVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKV
FT                   ERAKDREYGKADIHVEKPNRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTVTSKSCPIAG
FT                   IADEERSLYGVQFHPEVRHSVYGNELLKNFALNVCGCKGDWTMENFSEVEIAKIQEIVG
FT                   DKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMETLQGEFNMNI
FT                   IKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLDGVEFLAQGTLYTDIIES
FT                   GTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGP
FT                   GLGIRVLGEITEEKLEIVRDSDYILREEIKNAGLEREIWQYFTALPNIRSVGVMGDGRT
FT                   YDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEW
FT                   E"
FT   regulatory      241510..241557
FT                   /gene="guaA"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(241558..242760)
FT                   /transl_table=11
FT                   /gene="lmo1097"
FT                   /note="similar to integrases"
FT                   /db_xref="GOA:Q8Y821"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y821"
FT                   /protein_id="CAC99175.1"
FT                   /translation="MTNDQIKKAKNGTYYFRANLGYDVKGKKIQKYRSGFKTKKEAREE
FT                   YSRLLLMNPDDLNENKDKMMFEYYINEIFLPWYKTQVKLRTYENRIPTIQKHFPYFYKM
FT                   AVSDIEPINVQDWQLKMTKNLKPSYVRAVQGLFSVAMDRAIVLGITTTNPSKIIGNVKK
FT                   VKPKVEFWTKEEFEKVLSLIYKEDYYQNFLFISLWFLFMTGMRIGEATAIQWEDIDFET
FT                   GVVSITKTLYYKSQIDYKFVEPKTKASVRHIVLDKVTLSYLADWREVQQNVVKTNFVMS
FT                   YNGIPTQKHTIAHAIDRFSKMAGIHRIKIHALRHSHASLLISMGENPLIIKERLGHEDI
FT                   ETTLGTYGHLYPNSNFEVASKLNGIISFQPAEQNLDSSPKNQFTVNYRQNKQPNSAIKV
FT                   Q"
FT   regulatory      complement(242768..242773)
FT                   /gene="lmo1097"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(243466..243696)
FT                   /transl_table=11
FT                   /gene="lmo1098"
FT                   /note="highly similar to TN916 ORF8"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y820"
FT                   /protein_id="CAC99176.1"
FT                   /translation="MKSTKEVLPFVVILQAVNGDVNAINQILKHFEHYIIRLSQKTLFD
FT                   EYGNAYIHVEEEIKRMLETKLITAVLKFELS"
FT   CDS_pept        complement(243698..244117)
FT                   /transl_table=11
FT                   /gene="lmo1099"
FT                   /note="similar to a protein encoded by Tn916"
FT                   /db_xref="GOA:Q8Y819"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y819"
FT                   /protein_id="CAC99177.1"
FT                   /translation="MTTTSNYEKTIEHQFDSFCKTVVRNFARDIYDENKRRNERLISLE
FT                   ALSMAELSQLSIFDDYDSNYIIMASYDYDIRIEDVLIAQAIGKLTKRKQDIILLSFFLS
FT                   MTNADIATLMDLAESTVHYHKTNALKELKKLMEEH"
FT   regulatory      complement(243706..243711)
FT                   /gene="lmo1098"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(244127..244132)
FT                   /gene="lmo1099"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(244472..246595)
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /product="cadmium resistance protein"
FT                   /db_xref="GOA:P58414"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58414"
FT                   /protein_id="CAC99178.1"
FT                   /translation="MSKASKQTTYRVDGMSCTNCAGKFEKNVKNLEGVTDAKVNFGAGK
FT                   ISVYGETSISQIEKAGAFENLRVTDEKDYSSKPAKKESFLKKNWHLVVSIIFIILAFIS
FT                   QNISGEDSTTTIILYVIAIVVGGFNLFKEGFANLIKLDFTMESLMTIAIIGASIIGEWA
FT                   EGSIVVILFAFSEVLERYSMDKARQSIRSLMDIAPKEALIRRDDVEQMIAVSDIQIGDI
FT                   MIIKPGQKIAMDGVVIKGYSAINQSAITGESIPVEKKVDDEVFAGTLNEEGLLEVKVTK
FT                   HVEDTTISKIIHLVEEAQGERAPAQAFVDKFAKYYTPTIMLIALLVVVVPPLFFGGDWD
FT                   TWVYQGLSLLVVGCPCSLVISTPVSIVSAIGNSAKNGVLVKGGIYLEEIGGLQAIAFDK
FT                   TGTLTKGKPVVTDFIPYSEHMDEQNSLSIITALETMSQHPLASAIISKAMIDNVDYKSI
FT                   EIDNFSSITGKGVKGEVNGITYYIGSSKLFESSLEKSQSISQTYQSLQKQGKTAMLFGT
FT                   ESNILAIIAVADEVRESSKEVIAQLHKLGIAHTIMLTGDNNDTAQFIGKEIGVSDIKAE
FT                   LMPEDKLTYIKELKQTYGKVAMIGDGVNDAPALAASTVGIAMGGAGTDTALETADVALM
FT                   GDDLKKLPFIVNLSRKTLKIIKQNITFSLGIKLLALLLVLPGWLTLWIAIVADMGATLL
FT                   VTLNGLRLMKVKK"
FT   regulatory      complement(246602..246607)
FT                   /gene="cadA"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      246888..246894
FT                   /gene="lmo1101"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        246900..247400
FT                   /transl_table=11
FT                   /gene="lmo1101"
FT                   /note="similar to lipoprotein signal peptidase"
FT                   /db_xref="GOA:Q8Y818"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y818"
FT                   /protein_id="CAC99179.1"
FT                   /translation="MKNKTIISKQNLVLIVIMVGATLTDQLSKIWITSNLQLGESIEII
FT                   PSFFKITYAQNTGAAWSILEGQMTFFYVITLVALILLGWYFYRLKDYQIIQKIGVALMV
FT                   SGTLGNFIDRLLFQYVRDSLDFHILGYNFPIFNVADVLLICGVLFIIIDEVLKSFGVSY
FT                   KKM"
FT   CDS_pept        complement(247533..247868)
FT                   /transl_table=11
FT                   /gene="lmo1102"
FT                   /note="similar to cadmium efflux system accessory proteins"
FT                   /db_xref="GOA:Q8Y817"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y817"
FT                   /protein_id="CAC99180.1"
FT                   /translation="MNDICEITCFDEEKVQKIQTSLEDKKISDISQIFKALSEETRLTI
FT                   AYALTLEKELCVCDISIIVKSTVATTSHHLKILSKAGVVQNKKIGKMVYYSLNNSLVET
FT                   LIKDIVL"
FT   regulatory      complement(247879..247884)
FT                   /gene="lmo1102"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(247997..248914)
FT                   /transl_table=11
FT                   /gene="lmo1103"
FT                   /note="highly similar to TN916 ORF13"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="InterPro:IPR035628"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y816"
FT                   /protein_id="CAC99181.1"
FT                   /translation="MKIKIERKEKPDKPKKQKKIPTIKVGTHKKLTIALWVLLIGSMSF
FT                   GIYKNFTAIDMHTVHEKEIIEKQVVDTNSIESFVESFSKEYFSWQQSQDSQSNRIERLK
FT                   NYLTENLQQLNTEMVRSDIPTSSIVNSFQVWSVEQSSDTEYDVLFSVGQQITESENKKN
FT                   ITSTYSVTVYVDEASNMVIIKNPTIDSKPQKASYEPVLSDSDGTVDANTTEEINSFLDT
FT                   FFKLYPTATEKELSYYVSNQALDVINKDYVFVELVNPVYTQADNQVTAIVTVKYLDKET
FT                   KVTQLSQFKIILQKNENWIIIKNN"
FT   regulatory      complement(248922..248927)
FT                   /gene="lmo1103"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(248930..249940)
FT                   /transl_table=11
FT                   /gene="lmo1104"
FT                   /note="highly similar to TN916 ORF14 and to L.
FT                   monocytogenes P60 protein"
FT                   /db_xref="GOA:Q8Y815"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y815"
FT                   /protein_id="CAC99182.1"
FT                   /translation="MKLVKYFAIFGVVFSMFFSLLLFVTIVFAEEDDTRSSREEMIQQG
FT                   GLNVSAEVLAHRPMVEKYCKEFGIEEYVNYILAIMQVESGGTAEDVMQSSESLGLPPNS
FT                   LSTEESIKQGCKYFSELLASAESNGCDINTVIQSYNYGGGFINYVASNGKKYSYELAES
FT                   FSKDKAGGVKVDYPNPIAIPVNGGWRYNYGNQFYVLLVSQYLTPVQFDDETVQAIMNEA
FT                   LKYEGYPYVFGGSSPSTSFDCSGLTQWSYAVAGIQLPRVAQAQYDATQHIPLSEAKAGD
FT                   LVFFHSTYDAGSYVTHVGIYVGNNQMYHAGDPIGYTNLTDSYWQAHLIGAGRIIK"
FT   CDS_pept        complement(249940..252099)
FT                   /transl_table=11
FT                   /gene="lmo1105"
FT                   /note="highly similar to TN916 ORF15"
FT                   /db_xref="GOA:Q8Y814"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y814"
FT                   /protein_id="CAC99183.1"
FT                   /translation="MRTKEERKARKIEKKQRIKQLPIYKKIIRYVLIAIIFFVILIIML
FT                   ASVGTVAHAAGLVDETINTSNEYSKYGLGNYQLDFYVNNDWGWLPWNWSDGIGKSVSYG
FT                   LYAITNFVWTISLYLSNATGYLVQEAYSLDFISKTVDSIGKNIQTIAGVTKNGFSTSGF
FT                   YVGFLLILIFILGIYVTYTGLIKRETTKAVRAVLNFIVVFILSASFIAYAPDYIGNIND
FT                   FSKDISTSALDVGTKIVMPDTDSKGKDSVDMIRDSLFSVQVKQPWLLLQYGTTDVDSLG
FT                   ADRVESLLSTSPDTNNGEDREDIVITEIETFNNANLSISKTVSRLGTVFFLFIFNIGIS
FT                   VFVFLLTGMMIFSQVLFIIFAMFLPISFLLSMIPSFDGMGKKAIMKLFNVIMTRAGLTL
FT                   VITVAFSISTMLYSLAGSSPFFMIMFLQIVTFAGIYFKLGDIMNMFSLQSNDSQSMGRQ
FT                   MFRKPRMFLNRQSRRLQRNVSRAIGKNSRSGKEKEAPTPTKTTKANHERQNENGNESTA
FT                   NRPTSTKQNRSAGTRAGEKMGDLMEAKNRMVDKAGDMKDTIKNAPTNAKYAVHKGKRDL
FT                   VRNVSEFSQSFADTRNLQQQERATKRNEKKATVAQRRQEMDKAKAEKSNLEPYASMQKR
FT                   QRDYEERKQPVPRTAPTPAPQASTPKATPERTASTNQQHERPLQKQKNTTKEQVKANKR
FT                   ENTSTTSKNSKTENKITKTTTKRRK"
FT   regulatory      complement(249949..249954)
FT                   /gene="lmo1104"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(252099..254549)
FT                   /transl_table=11
FT                   /gene="lmo1106"
FT                   /note="highly similar to TN916 ORF16"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y813"
FT                   /protein_id="CAC99184.1"
FT                   /translation="MAYPIKYIENNLVFNNDGECFAYYELIPYNYSFLSPDEKYQVHDN
FT                   FRQLVAQSRDGKIHALQLATESSIRATQERSKLEVKGRLKEVAHRKIDEQTEALVSMIG
FT                   DNQVDYRFFIGFKLLLNEQELSIQSVSQEIKKAVQEFLNGVNHKLMGDFVSMSNAEIDR
FT                   FSKMENLLESKISRRFKIRKLDKNDFGYIIEHIYGQTGTPYEEYEYHLPKKYQDKEVLV
FT                   KKYDILKPTRCLIDESQRYLKIIHEDETTYVAYFTINSIVGELDFPSSEIFYYQQQQFT
FT                   FPIDTSMNVEIVANKKALTTVRNKKKELKDLDSHAWESDNETSNNVIDALDSVNELETT
FT                   LDQSKESMYKLSYVVRVSAKDLDELKRRCDEVKDFYDDLSIKLVRPFGDMLGLHGEFIP
FT                   ASKRYINDYIQYVTSDFLAGLGFGATQTLGEHEGIYVGYNLDTGKNVYLKPALASQGVK
FT                   GSVTNALASAFIGSLGGGKSFSNNMLVYYAVLFGGQAVIVDPKAERGKWKETLPEIAHE
FT                   INIVNLTSDDENKGLLDPYVILSRKKDSESLAIDILTFLTGISSRDSDKFPVLRKAIRN
FT                   VTQSEQRGLLLVIDELRKEDTSISNSIADHIESFVDYDFAHLLFSDGNVTQSISLEKQL
FT                   NIIQVADLVLPDADTSFEEYTTMELLSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWS
FT                   FLQVAQGKTLSMKLVRAGRAMNAGVYFVTQNADDLLDEKMKNNIGLKFAFRSTDLVEIK
FT                   KTLTFFGVDPEDENNQKRLRELENGQCLISDLYGRVGVMQFHPIFEELLQAFDTRPPIR
FT                   NEVE"
FT   regulatory      complement(252107..252112)
FT                   /gene="lmo1105"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(254533..254928)
FT                   /transl_table=11
FT                   /gene="lmo1107"
FT                   /note="highly similar to TN916 ORF17"
FT                   /db_xref="GOA:Q8Y812"
FT                   /db_xref="InterPro:IPR025608"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y812"
FT                   /protein_id="CAC99185.1"
FT                   /translation="MKKIRSYTSIWNVEKVIYAINDLQLPFPITFTQMTWFIVSLLVIV
FT                   MFGSLPPLSLIDGALLKYIGIPVGLAWFMSQKTFDGKKPYGFLKSILTYFIRAKTTYAG
FT                   KAVKLQKQQFNEAITTVRSELYYGISN"
FT   regulatory      complement(254560..254565)
FT                   /gene="lmo1106"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(254936..254941)
FT                   /gene="lmo1107"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(255211..255711)
FT                   /transl_table=11
FT                   /gene="lmo1108"
FT                   /note="highly similar to TN916 ORF18"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="InterPro:IPR041893"
FT                   /db_xref="InterPro:IPR041895"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y811"
FT                   /protein_id="CAC99186.1"
FT                   /translation="MEEMRIYVANLGKYNEGELVGAWFTPPIDYEEMEEKIGLNGEYEE
FT                   YAIHDYELPFDIDEYTPISEINRLCEMIMELDGSPIYDELKDIQGMWFSSLEELLESKD
FT                   DIICYSDCDSMEDIAYYYVEDGLMGEIPERLQMYLNYQAIGRDLEINGNFLVTSHGVFE
FT                   YCN"
FT   regulatory      complement(255719..255724)
FT                   /gene="lmo1108"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(255723..255944)
FT                   /transl_table=11
FT                   /gene="lmo1109"
FT                   /note="highly similar to TN916 ORF19"
FT                   /db_xref="GOA:Q8Y810"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y810"
FT                   /protein_id="CAC99187.1"
FT                   /translation="MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLII
FT                   ALIAVGLVFNAGGVKDVLLNLFNRIIGA"
FT   CDS_pept        complement(255941..256231)
FT                   /transl_table=11
FT                   /gene="lmo1110"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y809"
FT                   /protein_id="CAC99188.1"
FT                   /translation="MSGLTAELYELGFNCGIELEIYIQDTGIYTSLIIEGFRKGVDEPY
FT                   QYDFYKQTFYPHYPNKVTVYGEHLRPSQLIERVERYFINRKKYMSERRNNT"
FT   regulatory      complement(255953..255958)
FT                   /gene="lmo1109"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(256228..257412)
FT                   /transl_table=11
FT                   /gene="lmo1111"
FT                   /note="highly similar to TN916 ORF20"
FT                   /db_xref="GOA:Q8Y808"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR040819"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y808"
FT                   /protein_id="CAC99189.1"
FT                   /translation="MNNKTSWIEELKEKRMAYGLSQNKLAVASGITRQYLSDIENEKVI
FT                   PTEQVKTALLDSLERFNPDNPLEMLFDYVRIRFPTDNVEKIIEEILHLNIDYMIHEDFG
FT                   YYSYPEHYRFGDIMVMVSYDITKGVLLELKGKGCRQYENFLLAQHRSWYDFFTDCLEVN
FT                   GVFKRLDLAINDKVGILDIPELARKSEQEECISIFRTFKNYRSGELVHRDEKSDMGNTL
FT                   YIGSLKSEVYFCIYEKDYEQFIKNDIPLEDPEVKNRFEIRLKNDRATHAIQDLLAYRNA
FT                   EKTAFEIINRYIRFADKDTTKRRSQWQTSERWEWFIGKNRGELRLTTKPEPYSYERTLN
FT                   WLRHQVAPTLKVASILDVLNETDIIPAMIRDANLTEKHEKLIEQQNLAVEDVIV"
FT   regulatory      complement(256237..256244)
FT                   /gene="lmo1110"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(257420..257425)
FT                   /gene="lmo1111"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(257603..259003)
FT                   /transl_table=11
FT                   /gene="lmo1112"
FT                   /note="highly similar to TN916 ORF21"
FT                   /db_xref="GOA:Q8Y807"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y807"
FT                   /protein_id="CAC99190.1"
FT                   /translation="MRKLFQYRGKKIKQSDKHLLSNFFTVSMVTLFSLVMIPFHLKAIM
FT                   AVDWETVTLDDFIKQLQTPYFLGSVITALFVCLIVGFLYYYYKIDNIKQLEHRQKLAKM
FT                   VLQNGWYEAEQIQSEGFFKDLPSSKTKERISHFPKMYYYLKDGLIHINVEITMGKYQDQ
FT                   LLQLENKLETGLYCELVDKELKDSYIEYTLLYDTIASRIQIDEATAHDGRLKLMDSVYW
FT                   EYDKLPHMLIAGGTGGGKSYFILTIIEALLHTNANLYILDPKNSDLADLATVMDNVYFR
FT                   KDDMLQCINQFYEDMIARSEAMKQHPNYKTGENYAYLGLPANFLIFDEYVAFMDMLGRD
FT                   SAEVISKLKQIVMLGRQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRLSELGYGMM
FT                   FGNDTQKQFFLKPIKGRGYVDTGTSVISEFYTPKVPKGYDFLKQIGKLANKSLADPVAD
FT                   EVKATGSD"
FT   CDS_pept        complement(259011..259385)
FT                   /transl_table=11
FT                   /gene="lmo1113"
FT                   /note="highly similar to TN916 ORF22"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y806"
FT                   /protein_id="CAC99191.1"
FT                   /translation="MRLAEGIVIEKEKTFGTLKFSALRREVKIVDDEGNVTEQVKERTF
FT                   DLKCKEQGRMIQVSIPASAGVKNFDYNAEVEIINPIADTVATATFQGADVDWYIKAEDI
FT                   VLKRPAQNQQADQKQNHDKK"
FT   regulatory      complement(259391..259397)
FT                   /gene="lmo1113"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(259406..259720)
FT                   /transl_table=11
FT                   /gene="lmo1114"
FT                   /note="highly similar to TN916 ORF23"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y805"
FT                   /protein_id="CAC99192.1"
FT                   /translation="MELKHVIPNMEKTFGQLEFAGEGKVEQRRINGKPTILSRSYNLYS
FT                   NIQRADDIVVILPAEAGEKHFEIEQKVKLVNPRITAEGYKIGTRGFTNYVMYADDIVKV
FT                   "
FT   regulatory      complement(259729..259734)
FT                   /gene="lmo1114"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(259887..262475)
FT                   /transl_table=11
FT                   /gene="lmo1115"
FT                   /note="similar to fibrinogen-binding protein (LPXTG motif)"
FT                   /db_xref="GOA:Q8Y804"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y804"
FT                   /protein_id="CAC99193.1"
FT                   /translation="MTTYIMVLVTICGTFFTSSTSVHASDLVLNEPTAYSYTGVSPHLG
FT                   YAITHNPIYVMKMDGKKVFCVESGIFTTTGGGYIPESYISPKKDILSKIAYYGYTNTGQ
FT                   SHYDYVVTQVMIWEELGDQYVSSTIPNYQQRKAEIMAMVNRHDTLPSWHNQEVKVTVGE
FT                   SITLADSHGVLSGMSLESNNTNATLQQDGNNITITPNANSNDGSITYRKVPQNEVGTSI
FT                   VYTKPQHQTLVEFHLESAKQATVKVDVIKLGNVQITKVDEETGRPLPDTTMKFEYNGTS
FT                   TELVTDSNGIALIKDIPEGTKITITEVKAPNGYVNKGVSQVVTIEPNKTIELTFDNKEQ
FT                   LGIATLTKAGEEAKEIEVTESEYGDVHTFKYNANVVAGVTYRIEATQDIHSVDGTLKAK
FT                   KGDTVATVTTDEKGQWHSPNLYLGEYQAVEVSAPAGYILDTRPIPFSLTYAGQEVELAS
FT                   TAIKATNEFQTLDLRLFKDEESILSWNNNQPEIEVIQGQEKVFGVFTREAQALTDEVHV
FT                   PANALLGYQTVSDGVASFELKLPQGKYYLKELEAGTSHVLNDTEYDFKFTAENNNATYP
FT                   IYIYQDTVAVGNETMLKIARTPIINKLHFNEFIIKKLNEQAIFDKESGVEFNYDGLGTG
FT                   AIFTLENEDNEVIQEVTIDKDGQGNFKNIPVGTFYLKEKSASSTHYLMSEKVIRIESTK
FT                   DGIKAFDEDDKLLGETSSTDEEPTILLEIENDLKKGTAELTKKDVSTGELLPNTGIRIL
FT                   DEEKNTIAEGRTDDKGIYTFEKLPAGKYYFQEYDAPTGYQLDDTPMLFEITENGEVVKC
FT                   EMTNNKIPEKITSLPQTGDTTNITIFALGMLLSVSTLGVLYFRRKKAKIE"
FT   regulatory      262997..263002
FT                   /gene="lmo1116"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        263010..263783
FT                   /transl_table=11
FT                   /gene="lmo1116"
FT                   /note="similar to regulatory proteins"
FT                   /db_xref="GOA:Q8Y803"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y803"
FT                   /protein_id="CAC99194.1"
FT                   /translation="MKTKMPEMLSFISEEAVSRKMTSEEIAAHFGYDKHHFSRKFKEIN
FT                   GFSVVEFLSSLKVEKAIIELDEEVRILDLQEHSGFESSGSFTNTFKKYTGSSPRKYKTE
FT                   MNDIFYDMKRFENDNKDKSIAHFQENNDSFCNVTIDVPDEFEKGIIFIGLFRTLIPNHM
FT                   PISGLATKNLIGNQLKNIPSGDYYLLACAISQSNNILSYFNLSNSLRGKEDEKLSFPKC
FT                   SGNHYAIKLRKPIPEDPPILANVGKILISCLKNTI"
FT   regulatory      263834..263839
FT                   /gene="lmo1117"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        263848..264204
FT                   /transl_table=11
FT                   /gene="lmo1117"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y802"
FT                   /protein_id="CAC99195.1"
FT                   /translation="MALNAKSITIGLPVSDLEKSASWYEKLFMSDEKLTPVEGVIEYQI
FT                   GSVWIQLFEEKINVSENVLRLGVEDLDVEFERLKTLGVITDEVIEDVPGIIRYFVFSDP
FT                   DGNKLSFYWLYEEE"
FT   regulatory      264243..264274
FT                   /gene="lmo1117"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(264864..266381)
FT                   /transl_table=11
FT                   /gene="lmo1118"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y801"
FT                   /protein_id="CAC99196.1"
FT                   /translation="MGVKYVEIEKIDNYIENPRHEVGLNELDTLKKLFDVSGYQNMINL
FT                   AQDIYTNGLVNASLVTIVKLNNADRYTVYEGNRRVACIKLILHPEKFSFLPKNQIDRIK
FT                   KMKSDTPSKINLSQIECLITDEEDAFFIMRRIHSGEDKGRGLKSWNTKEQEIFKLRTNP
FT                   KNSTSIAKIISDKYEEFFKEDIQEEMAYTNIQRLFNNLEVRESLGIEKDNIDSFSCERL
FT                   YLIKGVIEKVNQIAKIENLSISRKFNKRKIIEQIVIPIIEELKSKQLESKAINSIHIEQ
FT                   KNKSNKLSNSKEQQTQNKEATSNNGISVREDTGLKTEYKSIESISSTLKPKLPPKIGSG
FT                   KLLSSTMPFTNLYHSNVRINTLVIEINQIRYKDFRLATQFLLRSLMEVYGHEYIDYFAN
FT                   LDYQDVQKMKAIAKDRIKRNQTVNEIYSEFISNHITKHFPKYAEQAELINISLSKNNNS
FT                   SLMKILNFMVHSQNHIPDSIELIEAWYKVKSIVEAIDNILHEVKHNY"
FT   CDS_pept        complement(266384..267241)
FT                   /transl_table=11
FT                   /gene="lmo1119"
FT                   /note="similar to methylases"
FT                   /db_xref="GOA:Q8Y800"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y800"
FT                   /protein_id="CAC99197.1"
FT                   /translation="MNPSPLRYPGGKHKMYKYIKKLVAVNDIDTYIEPFCGGSGLALEL
FT                   LLSKDVNRIIINDYDYSIYCFWKSVLDYTDELIDMINSSEVTIEEWFRQKEIRKDIYDH
FT                   SVVEVGFSTLFLNRTNRSGIIDKAGPIGGYQQTGNYLIDCRFNKEKLIEKILKIAQVKD
FT                   KIEIYNLEALDFIDDVIKVEKNGFTFFDPPYYQKGQGLYTNFYSTGDHQTLSQKIINEL
FT                   KNKKWIVTYDLAPEISRMYNKIDSICFTLSYTLQEKKRGAEFLFFSKKTRRIKDSEYLH
FT                   FLEV"
FT   regulatory      complement(266389..266394)
FT                   /gene="lmo1118"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(267249..267254)
FT                   /gene="lmo1119"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      267578..267583
FT                   /gene="lmo1120"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        267592..268008
FT                   /transl_table=11
FT                   /gene="lmo1120"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y7Z9"
FT                   /protein_id="CAC99198.1"
FT                   /translation="MTIWTLINISLSGIKLKTSPWETTTVLGTYVSDTQNVLTELGNIK
FT                   SLDFGMKKNRFNLLNAPDELYINPKQFWEEFNQPFLDKAIQRGDDVAMATKPTVENLYI
FT                   AGTKQLTGFGREYKYLLQHGYAYDVKTSTMKLKK"
FT   regulatory      268005..268010
FT                   /gene="lmo1121"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        268020..268388
FT                   /transl_table=11
FT                   /gene="lmo1121"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y7Z8"
FT                   /protein_id="CAC99199.1"
FT                   /translation="MKLDDNAKEIILKKSEFLLHNNFKLIEITDATITFSNKKIAFVIG
FT                   YERYDNVSNINIKFLEENEMFNLGWIAFVRRNQTPLPQNKLDNILELLDYAEKNYAKVI
FT                   NLQFCQESRGMIEDFLKE"
FT   CDS_pept        268425..268844
FT                   /transl_table=11
FT                   /gene="lmo1122"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y7Z7"
FT                   /protein_id="CAC99200.1"
FT                   /translation="MDFHKEVEKTFKGYEQKYQLMLTKIDNNEVAFIGENYALGIGWST
FT                   DGIDWHYFKLDNSMLCKFSLDNLLNAKLTHIERDGLFPSKTICEKIINELIICERVFNN
FT                   HFQELLRGETLSDYGNKEFVSNLEKSIIERELLTR"
FT   regulatory      268917..268922
FT                   /gene="lmo1123"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        268930..269403
FT                   /transl_table=11
FT                   /gene="lmo1123"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y7Z6"
FT                   /protein_id="CAC99201.1"
FT                   /translation="MEFKHEVENNFANIIQEYRFNLIKVNEDEIMLLNPNYALTIWKSR
FT                   EGIDIYYLFLHSLEKVKITNFLFSNYEKDLLANITPANNLTDQISNSLLIHARGLSKYF
FT                   PELLSGQNDWVKEFKENKFYNEPRAINKDEYSAYQTIIKNINGKKIEGFQNEI"
FT   regulatory      269379..269384
FT                   /gene="lmo1124"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        269393..269830
FT                   /transl_table=11
FT                   /gene="lmo1124"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y7Z5"
FT                   /protein_id="CAC99202.1"
FT                   /translation="MRYEADFINRFQPLIEEYKLNYKVISEEELALFGSNFALVFSIHF
FT                   DEVSLNYVCRDKDNLLVSYDVWSYFLHVFDDKDRENLPKYNSVRERVDVSFLILARGLP
FT                   RHWNNVLNGDDKWLEAYKQYKLAGVPKKVIGHLKDSLSLNI"
XX
SQ   Sequence 270050 BP; 88313 A; 45474 C; 53809 G; 82454 T; 0 other;
     atgttaaagt aaggaaagag agaaaaataa aaagaatgaa aacaaatttt gaagatggag        60
     tgatgagatt ggataataat caaaaagact taaatcaagt aatccgtcag ctcaaagaaa       120
     aaggaattgt cgttgaaaaa acaaagtcac gaaaagatat ttggaaatcg gttagtagta       180
     aagcgatgcc gaatatgaca cttcgattgc agtaaatcga aaagtggagt ttttatatgg       240
     tattttgtga agctttgaag taactaaaat gactcaaagc agcatgattt acatataaaa       300
     taacttcact ttttttcttt gtcataaatt agtcattaag ttttgatgtt tctgttatcc       360
     tttttacgca aaaatgttgt atgatggagt ggaaggcttt tgtcatagaa gaaaatagaa       420
     atagagtgag gcatatacat gaaaaaagaa gcggttaacc aacaatctat ttatgtgcat       480
     attgatcatg ttattaataa tgtggcgaca agcggcattt ctttttgtga tttcttaaat       540
     ggcgtgggac agccccctga aaatattttg ttaattaagc ataatattga agatgcatcc       600
     tacaatgcgc acacagcttt tcactaccta gagccaggcg atttagcgaa tatttccaaa       660
     gagaatttta atccactatg ttggattgat tttgaagatg tggagctttt aaaccaacta       720
     actccacaag aagtagcgga gatgctttat cttgcacaca ctgggcgcca tttgcgttct       780
     ccattttatt ataaattaca aaataatttt gtttacttaa ctagggaaga cggtcgttac       840
     aataaagtat attaccggaa tcttaatcat ttttatatgt tactaagtta cgtcattgca       900
     cgtaaaacgg cagaactagt taatgagaag ggtatttttt cgtttggtaa gaaaaaatat       960
     gttgcggagc cgccagtcga acttttgaaa aaaatggcag atcattttaa agacggtgct      1020
     tgtattgcgc ttgatgatgt cgtgagaacg cgcacgcaaa ttgaagtacc aattgggcac      1080
     gggctaacag aagaaatgac cgaattagag atttcttcca aaatttatta tgaagaagag      1140
     gtcgccaaat tagtctatga tttaaaacaa aatgaatgga aatatatcga aaaataaaaa      1200
     atcaaacttt ttcctttacg tttggttttt tatttgctag aatttaacta atgaacgtta      1260
     gttaggaggt tgctttatga cgaagaaact gattaaagaa gtcgcgttaa ccctttttgc      1320
     ggaaaaaggc tacgatggga cggcgctttc ggaaatcgcg aaagctgttg ggattaagac      1380
     accatcgcta tatgcccatt ttgcatcaaa agaggccctt tttttggaag tttatcaaga      1440
     tagcatccag atggaattaa cagaactcgg acgagtagcg gagcgagagg atttagttgg      1500
     ggaagagaag ctacaatcaa ttttctttgt ggcaacagat ttttctagca atcccgatga      1560
     gaagaaattt ttccagcgcg ccgtctttta tccacctaag tcactttttc aagaattaaa      1620
     agaagaaaca aagacatatg aacaactgac gaatcgaata ttgcgcgaaa cgttagaaaa      1680
     aatagtatcc gaagaagcac ttgtaagatg gatgcacgtt ttttatgcac ttcttgatgg      1740
     actgagtgtg gaacacggca tttatgatga aacggaattt gagttgcgaa gaaaatctgc      1800
     ttgggcagtt cttgcaagtt tactcaaatg aattggaggt aaggaaattg gcttggtttt      1860
     atttgattat ggcagggtta tcagaaattg tttgggcttt tggattaaaa gaatcacatg      1920
     gtttcacgat gttaggttgg agccttttga cgatagcatt tttgattgtt agttttggtt      1980
     tgttttcgat ttccatgaag tcaattccga ttgggacggc atatgcggtt tttacaggaa      2040
     ttggggctgc agggacagct attattggga tgattttcct ttcagaaggt gtttcttttt      2100
     ggaagattgt ttcgcttatc gttttattga cagggattat tggtctgaaa ttagtggatg      2160
     gcaatgagtc tgaaaaggag gctaaataac gatggattgg atatttttac tagtagcagg      2220
     tttatgcgaa atggtcttcg ttgtcatgct gaaattatca gatggcttta aaaaggttgg      2280
     atatgcgata ctgacgatta tttttatgtc tgcaagtttc tttttactat ccctcgcact      2340
     gaagacgatt ccaatcggta caggttatgc aatttggaca ggaattggcg ccgttggtag      2400
     tgtgacactt ggaatgattg tatttaaaga acgcaagagt gttggtaaat tgctctttat      2460
     tacgatgatt attgccggtg tggtcggatt gaaattaaca tctggcgttt aacaagctag      2520
     gttgaaaaag tcctttttgg aataagcgtg ttcgtttctt atttaaaaaa gaagtttttt      2580
     tcaacctatt ttttagttat accttttcat cctgtcaaaa catggtaaaa tagataaagc      2640
     gaataatgac ggaggggtat tatgaaaact aaattaattt tattatacgg tggaaaatct      2700
     gccgaacatg aagtttcatt acaaacagca ttttcagtta tcaatgcttt ggatttagaa      2760
     aaattcgaag ctgcgccaat atatattacg aatgaaggtg agtggattca aggaccactt      2820
     ctttctggga agttagattt tgtcgaacaa ttacgttttt cggctacaga tacaataaaa      2880
     cttgctacaa ctgaatcaga aaaatcagaa ggggaagcaa ttagcccggc cgttttagaa      2940
     gcagacggac aagagacagt cgtattccca cttttacatg gtccaaacgg agaagatggc      3000
     actgttcaag gattgttcga agtattaaac attccatatg ttggcaacgg ggtcttggca      3060
     tcttctgctg caatggacaa aatcgtgatg aagaaaattt ttgcagatgc tggaatcccg      3120
     caagttccag cagttgctgt tcgtttaatt gattggaaaa attatcaaga ggaaatggtt      3180
     gctgagatgg aagaagtcct tacatatcct gtcttcgtaa aaccagcaaa ccttggttcg      3240
     agtgttggta ttagtaaggc aacaaacaaa aaagaattag tggacgcaat gacagaagcg      3300
     tttttatatg accgtcgtgt tgttgttgaa caaggtgtcg ttgctcgtga aatcgaaatg      3360
     ggtgtacttg gaaatgatac gccagtttgc tctgtacctg gcgaaatttt gccagaaggt      3420
     gcagttgcca cattctacga ttacaaagct aaatatcaag ataacaatac tgcgttaatt      3480
     attccgactg aagtagatcc agaaatcttg gaacaaatga aagaatatgc gatccaagcg      3540
     tttttaggtc tggacgcaag cggactagtg cgagcggact ttttcttaac ggaagataat      3600
     cagttattct taaatgaagt gaatacaatg ccaggtttca caccgtacag catgtatcct      3660
     cttctttggc aggaaacggg cttaccgtac ggagcgttaa ttgaacgatt agtcgattta      3720
     gcgaaagaac gccacgcagc caaaaatgca cttaaatata aattagaaga ctaaaataaa      3780
     caagaaagca gttttcatat gcggaagctg cttttttatg gaagagagcg atttaatttg      3840
     aaaaaaacag taggcgaagt agtagcaatg ttagatagtt ccatccatgt agatgcattt      3900
     cgcgatgtcg tcattactgg cgtttgtttt gacacaaggc aaataaagtc aggtgattta      3960
     tttgttccgt ttgtagggaa tgtgcgcgat ggacatgaat ttgtggggca agcacgagaa      4020
     atgggtgctg tagctacttt ctggcaaaaa aatgtaccaa atccaccgac ggatttcccg      4080
     gttattttag tagaagatac tttgctcgcg cttcaagaac tagcggcgaa atatatccaa      4140
     caagtaaaac caaaagtcat tgcgattacc ggaagcaatg gtaaaacgac gacaaaagat      4200
     attatggcag cgattgtaga aacaacgtac aaagtgcatt atactggtgg gaactttaat      4260
     aaccatatcg gcttaccata tacgatttta acgatgccag aagatacgga agttgctgta      4320
     cttgaaatgg gcatgaatca tcgtcatgaa atcgaagtgc tttccaaaat tgccaaaccc      4380
     gatatcgcga ttattacgaa tatcggcgag gcgcatattg aatatcttgg ttcgcgtgaa      4440
     gaaattgcca aagcaaaact ggaaattact gccgggctta atccaagcgg gattttaatt      4500
     tatccacatg aagaaacttt gctgctagga aatattaatg gcgatttcag acagctcact      4560
     tttggcaagt cggaagctgc ggaaatttat ccgttagaaa ttcgtgcgga agcggaaggc      4620
     acttctttta taactaattg ggagccggag ctagaaattt ttgtccctat tattggtgaa      4680
     cataatgttt tcaacacaat ggcggcgatg cttgcggcaa gagaaattgg aattgaaggc      4740
     gaaaaaattc aatctgcgct gaaaaatatg gaacgttcta aaagtcgttt agaatggatt      4800
     acaacgaaaa gtggcgcgcg tattttgaat gatgcctata actctagtcc gacagcgctc      4860
     aaaacggttt taaaaacatt catgcatatg gattcgagcg gcaaacctaa atatttggtc      4920
     cttgctgata tgctggaact tggcgatttg tcgacaaaac tacaccaaga atcagctgag      4980
     gtgttagaaa atgatacgat tcagaaagtt ttcttatatg gtgatgcgat gaaagcattt      5040
     ggagaagtag cggaatcgaa aattggtcag ggaaaagttc atcattttga cacgaaagaa      5100
     tcgcttgaga cggcgcttct ttctgaaata aaaggaaatg aatggatact ggtcaaaggt      5160
     tcttacggaa tgggcttgaa agatgtggta gaaaatctta ttattaagta acgactaaaa      5220
     ttggacagaa catattacca cttaaatggt aataatttgg acaggaggaa aggcataatg      5280
     gttgcttgtt tgtgtattca tggttttact ggttcgccgt ccgaggtgaa gccgctcgct      5340
     gactatttgc gagagcatac agattgggat gttttagcac ccacattacc tggccatgat      5400
     cacctgcgcc acttaaaaaa tgtgacgtat aaagattgga ttgtttttgt agatagtatt      5460
     ttaagccaaa tgctaaaaga agacgatgaa gtatatatta ttggtttttc tatgggtgga      5520
     ctgctcgcag gctggcttgc gagacattat ccggaagtga aaaaactagt acttctaagc      5580
     acagccgtaa atgcaatgga atggccacaa cttgtcgaaa attccaagca agtattaacg      5640
     gaagcgaaag aagtaactct caaaaacagc ccgatgttca aacggtacca aaagaaagta      5700
     acggaaacgc cttggacttc cacgctacaa ttcaaaaaaa tggtagcttt agcaaagcca      5760
     gtttttgaac atattgaaat tccaactttt atagcacaag gcagtgccga ccaagtagtt      5820
     cctgctgaaa aaagtgttaa tttcttaatg gaaagtattc ctggtccaaa agaattattt      5880
     attttagaag gttcgaaaca cgtgatttgt caagatgaac aagcggacaa attatttgca      5940
     gctgttttaa catttttgca aaaagatgtc gctgttttaa ataccaaata aagaaaaccg      6000
     attcagctct cgctcgctga atcggttttt ttattttcgc caacagaatc tcgggctatt      6060
     aaattagttg caagcgccag atgaacaaaa ccttcatctg gttttcttat gcgattatac      6120
     ataagttcga cagctttctc gcccataaaa ctaaggttag tacacatcgt tgtcagctgc      6180
     ggattactta gtacagtaaa ctcggtatta tcaaagcaaa taatagataa gtctttcgga      6240
     atattatagc ctttcgattg taagtaagtg ttgagaataa atccaagacc tgagttgacg      6300
     caaaaccaag cagtagggag ttcgtctagt tcgtctaaag ttctatacaa tgtagtttgt      6360
     tcttctttga tgcgagtgat agcatatttt ttgttaaaag gaatgtgata gtactgcaaa      6420
     gcttttttgt atccttctag tcgttcttca taacttggag aaaaagttac atcaccaaga      6480
     aaaccgattt tttggtgctt attttgaatt aaaaattcca cagccataaa agcaccgtct      6540
     ttgttttgac taataactgc atcggctttt aaatgcggat catgatgatc tatcagcact      6600
     actggcatgc cgaggtcgat cactttttta ctataatcgg tgttaatatg cgacagcaag      6660
     aaaataccag tccagttctc acttgtaagc tgctccggca attgatttgt tgccgcttcc      6720
     tcatccgtaa ctggaaaaat gataagttcg gcctggtggg cgataatgct ttgtttcata      6780
     ttatcgataa tttcaccaaa aaaactgcgc tgcgaaaggg cgaaagaagt tgctaaaagc      6840
     gcaaattttt ctttgacaac ctcacgtgcg atttctcttt tatatttata acctaattca      6900
     tctgccattt taaaaacagc tagtttagtt tgttcgctaa ccccattttt attgcctaaa      6960
     gcttgcgaga ctgaattttt ggttatattt agcctgtcag caatatcctg catcgtaact      7020
     ttcttcatgg ttcccctccg ttttcctcta tttattctat tatagaagta aattcacaaa      7080
     atagcaaaaa ttttataatt aaaaagtaat gtataaagta attcttttta tttttggcag      7140
     taatgcgtat aaagcttaat gatattaggc ctattaaaag taattattga cattacaaaa      7200
     gtgtaatgtg ataatgtaat cgtaatcaag cgcttacaat tacaaaaaag tggaattagg      7260
     aggattattg atatgaagat tagaaaaatt gctattgcag ctcttagtgt tgtggttgct      7320
     gggtcattac tcactgcttg tggtggtggg aacagcaaaa gcgacgataa tggtaaaaca      7380
     aaagtaacgt tttgggcagc tccaaatcca actcaagtaa aatattggga tgaaatggcg      7440
     aaagcttacg aaaaagaaaa tccagatgtc acgattgaag tttcccaaat gaaagaaagt      7500
     ccatcatcgg aagcaactat ccaatcagct attgcctcta aaacggcgcc aacaatgtct      7560
     gaaaatatca atcgtagttt cgctgcgcaa ttagctgaca gtaaagcgat tgttcctttg      7620
     aatgatgtaa agggacttga tgatgttgtc aaagaacgaa acatgagcga aacaatggat      7680
     tcttggaaat tctctgatgg caatcaatat gtgctacctg tatactccaa tccaattctt      7740
     tttgcttggc gtttagatac actcaaagaa cttggctatg atgcaccgcc aaaaacatat      7800
     agtgaagcgc tcgaagttgg taaaaaacta aaagcgaaat atccagataa agtgctttgg      7860
     gcaaaagggg atttatctga tccaactgct tggatgcgct ggtttgattt cttcccactt      7920
     tatgatgcag cttctaaagg aaatgcattt gtagaagatg gcaaattagt agcagacgat      7980
     aaagcaggaa cagagttatt aacatttatg tctgaattgc aaaaaaataa attacttctt      8040
     gcaagcaaag caacagatcc atttgaaact ggaacaagta tcatggcaga taatggccct      8100
     tggactttcc cgaactggga cgaaaaattc ccagaactta aatataacga aaactatgca      8160
     ataacagcac cactagtacc agatagcatg gtgaatgaag aaaatgttgc tacatacgct      8220
     gattcgaaag gcgttgtaat gtatgcacaa gcgacagata aagaaaaaga agcggcaatg      8280
     gatttcttga aattcgtgta caatgatgac aaaaatgact tgaaattctt agaaacaact      8340
     aacttaattc ctgcgcgtga tgatgcaaca gaaaacgaaa ctttcacagc tttctttaaa      8400
     gaaaatccag aactcgaagt ttatgcagct aatgtaccat atagcattcc tgcgatggat      8460
     gacgcgaaat ataatgatat tcaacaaatc attggtgaag aagcatggaa tccgattgtt      8520
     cgtggggaga aaaaacctac taaagcttgg tcagatatga agaaagctga ggacggggtg      8580
     cttcaagaat gaagcggcga aacaacaaat tgggctggtc atttaccagc ccgtatctca      8640
     tattcacagc gatatttttc ttagtaccgc ttgtttggtc aatttggtta tctgtgactg      8700
     attggaacat gatgagtccg gaaatcaatt ttgttggctt tgataatttt attaaagcgt      8760
     tcactagtcc agcagttcaa gcagcctttt ttgttactta taaatttttg attgtttttg      8820
     ttcctatggc gttaattatt tcgatgattg tcgcggtatt agtgaatgga ctaccgaagt      8880
     ttaaaggact ttatttggtt gcgtttttcc taccgtattt gtcttcagga gttgtaactt      8940
     cgctaattgt acaagggttg ctttcataca atagtgcgct gaatgtgttt ttacgcgggc      9000
     attttggttg ggatatcgat tggctcggaa caccaatgtc ggcgctcgtt attatttcac      9060
     taatgatagc ttggaaaatg tctggttatt atgcgctcat tttaatttct ggacttgcta      9120
     gtattaatca tgaaatttat gaagctgcag caatggatgg ttctggtaga tttagaacat      9180
     tttggaaagt cactgttccg atgctatatc cagctttatt tactgtgatt gttttagcgg      9240
     tgggtgttag ctttggtatt ttcaccgaag tttaccaatt gactggtggt ggaccgaatt      9300
     ttgcaacaaa tacatggcaa atggaaattt ttaaccaagc attcgttaac ttgaattctg      9360
     gttatgcttc agcgatttct ctaatggctg ctactgtaac atttgcatcg attggtgtta      9420
     ttaagaaaat gcttgagaaa tggggtcaaa gaaatggttg gacataatag taaagcgggt      9480
     aaaattgttc gctatatact gacaacatta ctcatgctga tcatgattta tccgtttatt      9540
     tatttggttt taaactcatt tgctgcttgg gatcaggtag ataaaaagtt gattccgaca      9600
     gaattcacga ctcgttcgtg ggattggtta tttggtaatt cagtcgttgc agcaccggcg      9660
     ccttggattc atgcctttat taatacaatt attgtttcca ccattgcgac aggcttgatg      9720
     ttgcttttcg gcctaatggt aggctacgca ctagcaaagg tggattttaa gggcaaaaaa      9780
     attgttaata atgcgatttt atttcaaatg tttttcccgg caatcatctt gctgattcca      9840
     cagtttttaa tgattacgga cttcggttta ttggatacat acgcgggaat gattatcccg      9900
     acaatgctta gtttatgggc cgtatttatg tataccaact ttttcaaagc gattccagat      9960
     acattgattg aagctgccaa actggacggg gcgagtgatt tgaagatttt gtttcgggtt     10020
     gtgctgccaa tgtctaaatc aattacgacc gtcattttct tattcctttt cacagacaga     10080
     tggacgaatt tactttggga tatgcttgta acgaagagtg atggaacggt cacgttgaat     10140
     gtgctaatct cgcaaatgtt tggaccgtat gcaacctatc caggtccaat gtacgcggct     10200
     tcggtgctgc taacacttcc gctaattatt ctattcttat tcttctcgaa gaagttccaa     10260
     gaaggaatgc aatttacttt gaaataaaag gagcgactaa acttggagtt ttggcgtcgt     10320
     agtgtgtttt atgaaattta tatgaaatca tttcaagata gtaatggtga tggtttgggt     10380
     gattttaaag gtttaacgag cagattagat tatctggtgg atttgggaat tgatggtatt     10440
     tggctgactc cattttatcc ttcaccgcaa gtggataatg gttatgatgt gtctgattac     10500
     tgcgatatta acccggatta cggcgatatg actgattttc gagcgtttat gaaagcggca     10560
     gatgcacgag gaataaaagt tattatcgac ttagtattaa atcattcgtc aacagagcat     10620
     acttggttta aggagtcgcg tagtagtaag acgaatccta aacgagatta ttatatttgg     10680
     cgagaaaaac caaataattg ggaatcgttt tttggtggtt ctgcttggga aaaggatgaa     10740
     cttactggcg agtattacta tcatagtttt gcaaaagaac aggctgactt aaactgggcg     10800
     aatgaagctg ttcgcgcaga aatggagcaa gttttagcgt tttggttgaa tgagggagtg     10860
     gcgggattca ggttagatgt tattaataat ttaacgctcg tacttgaatt tccggataat     10920
     ccagtcgcat ctggtgaaat ggagcatgtg tatgaccgta atcagagtgg attagaacaa     10980
     gcgttagagg atatcgcttc cttttgtcga aaagagcgcg acgtgttttt agtaggcgaa     11040
     attagctcgg ataaattacc tgaaattgcg cgatatagct cgaaaaaaat gctagatgtc     11100
     acgtttaatt ttaattttgg cagtgttgat cagttagatg caaaatctgt atttacgaca     11160
     ttgaatgaga tggaaacggc attaaacgaa gggcagtggc cgacgctttt ctttggaagt     11220
     catgatatga gcaggttcag aagtcgcctc gcatctggag acatagtaaa gacccagttg     11280
     ctcgcatttt taatgttaac tgcgaaaggc gtgccgttta tatactacgg agaagaggtg     11340
     ggtatgcctg atttaacgtt ttcttccgta aaagagatgc gcgatattca aggaacagcc     11400
     gcgtactatc aagctttaca aactggtaca gatgaaaaac aagcactcga aatcgctatt     11460
     gaaaaaacgc gtgacaaagc acgtgggccg atgattttcc cagatggaaa gccatttact     11520
     cttggtgaac catggattaa aatggctact ttgccggaag aagaagcacg gatgatgtgg     11580
     gatttttatc aagcattact cgcatttcgt aaagaaaatg attttaaaga gatggaatat     11640
     acttttttga agttggatgg agaagtactc agttatcagc gaggtgaatt tatcttttta     11700
     cttcattttg gtgaggaaga gataacttat ccgcttcagg ggaactatca gcttgttttt     11760
     ggagaagcga tgatggtaga aaatggtatt agaatgggcg cgcatactgg aattgcgctt     11820
     agagtggagg aataaaatga atacaatcga aaatttgttg caagtttacc gggaaaatag     11880
     tgctgcgttt gggacacgta tcacgttaaa tggtgctggc gacaaagatg tatacaatat     11940
     tacggcacca tttcattggc taggacaaga atatattgca ggtcgagtgg agtcgcgtga     12000
     tagcgagttt tcggaagtac gcttttttga aaaaacagag acggacaaat atcaattggt     12060
     tgaaaatacg actgttttag cgctacaaga tccatttgtt acatttgttc agggtgagct     12120
     gattattggc ggggtagaag ttttcccgaa agaaacggac ccgactatgt tagattggcg     12180
     tactaattta tatcgggcaa cctcgcttac taattttaag caaattcttg ccggaccaat     12240
     tgggatgaaa gatttgcgca tcaaagaatt agcagacgga cgcattttag tattaacaag     12300
     accacaaggt gaaaaaggcg gtcgcgggaa aatcggcgca atcgttatgg attcactaac     12360
     agaattaact atagagaaaa ttgaagctgc gccacttttg aaacggaatt tttcaggaga     12420
     ggaatggggt ggcggaaatg agcttcattt gttagaagat gagagaattg gcgtgcttgg     12480
     tcacatcgct tgttttgatg aagcaggtaa tcgtcattat tatgcgtgtt cttttcaatt     12540
     gaatgaagat ttttctcaaa tcgagcaaga aaaaataatc gccgaacgtg ctaattttgc     12600
     acctagtgag cctaaaagac ctgatttagc agacgttgta tttagcggtg gtttaatcag     12660
     gaatccggac gggactgcga cactttatgc agggattggc gattctgatg cacaaaaatt     12720
     agcaattcct gatccattta aaaataacta atagtaggag ttttgagtag aaatgaacat     12780
     ttatcgttat gaagaaaacc cattaattac acctttagac gtaaaaccaa tccatgaagg     12840
     ttttgaagtg attggcgctt tcaacgctgg tgttgccgaa tataacggcg aagtgctttt     12900
     acttcttcgt gtggcagaaa aaccagtcag tgagaatcca gaagtagtcc ttgcgccagt     12960
     ttataatgcg acaagtaatg aattagaatt acaaccattc cgattagatg atgaaaatta     13020
     tgattttgaa gatccgcgaa tgattcgcag taaagcaaaa ctagaaggtt tttcgtattt     13080
     aacatcgcta tcgtatattc gaattgctcg tagtaaagat ggtcatcagt ttacattgga     13140
     tgaaaaaccg tttttatatc cgtttaatga gtatcagaca tttggaattg aagatgctcg     13200
     tgtgacgcaa attggcgata catatcacgt gaattttagt gcggtatctg agtttggtgt     13260
     agcggatgca ttagtgacca caaaagactt cgaaaatttg gagtatcaag gaaatatctt     13320
     tgctcctgaa aataaagatg tactaatttt cccagaaaaa attaacggaa aatattatgc     13380
     cttacatcgt ccaagtttga aaagtattgg taatttagat atttggattg cttcttctcc     13440
     agatttgcgc agttttggcg atcatcgtca tttgcttgga attcgtcctg gtgaatatga     13500
     tagtggccga gttggtggcg gatgtgtgcc gattaaaaca gaagaaggtt ggctgatttt     13560
     gtatcacggt gcaacagaag aaaaccgtta cgtaatgggt gcggcacttc ttgatttaaa     13620
     tgacccaacg attgtattaa aaagaacgaa aacacctatt ttagaaccag ttgccgatta     13680
     tgagaagaac ggtttcttcg gtgatgttgt tttcgcttgt ggggccattc aagaaggcga     13740
     tacactgcac atgtattacg gtgtagcgga tacttccatg gcgggttgtg atatgaaaat     13800
     aagcgaaatt ttacatcagt tagaagtgga aaacaaatga cttggaaaca ctatttgagt     13860
     gcttggcaaa atgccgattt atcaaatgag tggcgccgtg aattacaacg agtggaagaa     13920
     gagcaggaac gttttgatgg ttacttaaca tttggaactg gcgggatgcg cggtaaaatg     13980
     ggtattggaa caaagcgcat caatcttttt accattagac gagtagcgaa aggtttggga     14040
     gattatgttg tcgcaaacga aggagccgaa atgggcgttg caattgcgtt tgactctaga     14100
     catcattcgg gtgcttttgc gcaggaaacg gcaaaggtcc tagcggcgca gggtatcaac     14160
     gtttatttat ccgattcgat tcgaccaaca ccagctttat cattttgcgt tcgagaaaag     14220
     ggggcattcg cgggcgtggt gattaccgca agccataatc cttctatcta taatggtttc     14280
     aaagtatatg ataaaaatgg ctgtcaaatc acattgggtg tagcgcagga aattgctggc     14340
     tatttagaaa aaataacgga tatctttact ataccagtgc gcgaattacc caatccactc     14400
     gtgacacctc taggaaaaga aatggatgat gcttatttaa acgctttaac agcagtcgtt     14460
     tctcgccctg acttgcttgc tgactacggg aatgaactac ggatttgtta cacgccgctt     14520
     catggtgccg gaaaagaact cgttatgcgt ggacttttgg aaaatggatt ttcggaaacg     14580
     accattattg cagaacaaag cgaaccggat ggggattttc cgacagtgat ttcgcctaat     14640
     ccggaagaag aaaatagttt cgacctagcc aaaaagctgg caaaagaaat acaagccgat     14700
     attattttgg caacagatcc tgatgctgat agactgggag tggctgtttt aaacaagcaa     14760
     gctacatacc aaattttaac agggaatcag ctaggagcgt tacttttaaa ttatatttta     14820
     gaagcaaaaa caccggtaac tggggcggat acgatgatca acacgatagt tactggggat     14880
     ttaggtggga aaatcgcgta tgactttgga attaaccata tccaaacgct cactggtttt     14940
     aaattcatcg gtgagaaaat agctgaaatg gaaggcacgg aaaaaaattt cctatttgga     15000
     tatgaggaaa gttatggtta tttaatcgca ccctttgttc gcgataaaga tgcagtgcag     15060
     gcagcattac ttacagcaga aatggcgctt ttctataaaa aagaaggaac aacacttctt     15120
     ggaaagctaa ccaatttatt tgaaaaattt ggctaccata aagaatattt gcacacgata     15180
     acattagacg atagcgatgg aataactaaa atgattcaag tgatagacgc tttgcgcaaa     15240
     gagccaattt tcatgccgga aattactgtg gtagaagact ttcttactag taaacggacc     15300
     aactttgtga caatggaagt aaccaatata gagctcccaa aagaaaacgt tttaaaattc     15360
     tacttaatgg atagctcatg gtttgcaata cgtccttctg gaacggaacc gaaatgcaaa     15420
     atctattttc aaacaagcgg tgaaacggaa gaaattgcga caaaagccat gaatgagttg     15480
     agaaaacgcg tattagctgt atgggactaa taaaaagctg gaaatcattt ttggatgatt     15540
     ttcagctttt ttaaaattta aaataactaa aaacagctga taaacgtaca ttggaagtga     15600
     attaactttt tttattcgat aatagcaagg aaagataagc ttttgacgtt gaaaagaaat     15660
     aattagtgtg ttatgatgat agatggaagt ttattaggtt tatatttagc ctagtgatta     15720
     atgagggctt ttttatttga tgcgttagaa ctgctataat ggcagagaaa atttctgatg     15780
     ccgtgaatca ttttgcttgg tgcgcccagg cttttctatt gcagaaaaat gaaaatgaaa     15840
     gatagcagtt ttcataaaaa caactgcaaa tgaacagaca aacaatcgta ataagcgtat     15900
     tgtgatgaat tataaaagta gctctcctac caaactttaa acaggtaaag gagaaatgac     15960
     attgacaaaa ttttcggagt tcggactgga cgaaaaaatt gtaaaatcag taaatcggat     16020
     ggggtttgaa gaagcaacac caatccaaga aaagacaatt ccactaggat tagaaggtaa     16080
     agacttaatc gggcaagcac aaacaggtac tggtaaaaca gccgcttttg gtcttccaat     16140
     gattcacaaa attgaccaaa agagtaacaa cgtacaagct ttaattattg ctccaacacg     16200
     tgaacttgca atccaagttt cagaagagct ttataaactt agctatgata aacatgtacg     16260
     tgtgctagcg gtttacggtg gtagtgatat cagccgtcaa atccgttcac ttaagaaaaa     16320
     cccacaaatc gtagttggta cgccaggacg tattttggat catattaacc gtcgcacact     16380
     gaaactagat cacgtggaaa cacttgtact agatgaagca gacgaaatgc taaacatggg     16440
     cttcattgat gatatcgaaa ctattctaaa agaagtacca gcagaacgtc aaactttact     16500
     attttctgca acaatgcctg atccaattcg ccgtatcggt gaacgtttca tgcatagccc     16560
     agaacttatt cgtattaaag caaaagaaat gactgcacta ttaatcgaac aattcttcgt     16620
     aaaagtgcat gaaaaagaaa aatttgacgt attatctcgt ttattagatg ttcaagcacc     16680
     agaattagca attgtttttg gtcgtacaaa acgtcgtgta gacgaactat ctcgcgcgct     16740
     tgatatgcgt ggttacgtgg ctgaaggtat ccacggtgac ttaacgcaag caaaacgtat     16800
     gagcgtacta cgcaaattta aagaaggaaa aattgatgtt ctagttgcaa cagacgtagc     16860
     agcacgtgga cttgatattt ccggtgtaac acatgtatat aactatgata ttccacaaga     16920
     tccagaaagc tatgttcacc gtattggtcg tactggtcgt gctggtaaag aaggtatggc     16980
     gattacattc gtacaacctc gtgaaatggg ttatttacgt attgtggaag aaactacgaa     17040
     aaaacgtatg caaccacttc aagctcctac atgggacgaa gcatttgcag gccaattacg     17100
     cgtagcaact gaaaaaattc aagaagcaat tacagaagaa aacttagctg actacaaaac     17160
     gtttgctaac gaacttcttg aaaaatacga tgcaactgac atcgcagcag caatgcttaa     17220
     aatgttagcg aaagaaccag ataaaactcc tgtccatatt actgaagagc gtccattacc     17280
     atcccgtggt ggcggtggct acaaaggtaa aaatggtaaa ggcggcaaag gtggcggcta     17340
     tcgcggcgga agcggcaaag gcggaagcta ccgtgatcgt aacaacagcg gtaaaggtcg     17400
     tcgtagcggc ggcggttccg gtggtggaag cggctctggc ggtggcggca atcgtgatcg     17460
     tcgtggcggc ggagaacaac gcagcggcgg caacaaaggc aactactcac aaaaatctaa     17520
     ataagattat tagacaaata gttaccatat agatagactg tagataaaga agattttaac     17580
     tttatctaca gtctattttt tataaatgct agtgattaaa cgatttcatt gatacgggag     17640
     tgtggtgcta gttatgaaga taaataaaat tatcgaatat attgtagtag caatcatcgt     17700
     tttggggtgg acttacttca ttgtcattaa agaaattctc cctaaaaata taggatttat     17760
     ttcattagta attctatcaa tagttcttta ttttgtaggt aaatggttga atggaaaaca     17820
     tagcacataa aaaaacggcc atactctaag tagccgtttt tttatgtgca ataagtcatt     17880
     tacattaact tccaaatatg agaaaatagc atgttggcaa aattgccaca cgtggttcat     17940
     tcataccatc ccacgtaaaa aaactaggag gaaaaataat gaaaatgaaa attttgacgg     18000
     tgaatgcaat tatcgctgca ctgtatgtag tgctcggaat gattgtcgcg cccattgggt     18060
     ttatggcatt acaatttaga ataccagaaa tctttaacca cctaatcgtt tttaataaaa     18120
     aatacttttg gggtattatc gtaggcgttt ttattacgaa tttgttcttt tccggattag     18180
     gttggattga tttagttttt ggcgtagcac aatcggctat ctcgctttta ctaatgattg     18240
     gcatttctaa atacgttaaa ggaattattc cgcggatgat tattaatacg attctcttct     18300
     ctgtaacgat ggcaattatc gcatgggagc tagtaatcgt ttttgactta cctttcctaa     18360
     ttacttgggc aacaacagct gcaagtgaat tcattgtgat gggcgtcggg attccgctaa     18420
     tgtatctatt aaataaacgg ttgaatttcc gtaaaatgat tgattaaatg agagcgtcta     18480
     agggaactta ggctcttttt atttttgtaa aaagcgagct gcctcctgta tcaattcaac     18540
     taattgacca ttcgtatagt ctttattcga ttgctgaatt tctgccgcta aacttaaaat     18600
     cattctagca aaacaattag gaataaagtt actatctgaa aaggaaattt cttttaacaa     18660
     actaattcga agtatttctc cagataccac atctaaaaaa atattttcag cgcggctcca     18720
     aaaaattgct tgaaataaaa gcgggttttt ttggatggag cggaggatta agcgttggat     18780
     attttctttt gttaaaataa tttggtcgaa ttccaaagag aagtattgca tggttcgtaa     18840
     aatctggact tcaataattt gaataatctc ttcatgatga cggtaaaaag tggctcgtga     18900
     tatttgggct tgttcacata aatcttttat tgatattgat tcaaaagttc taccttccag     18960
     ataaaacctc tccaaaaccg tatatagttt ggtttgtgtt ttttgtgtac gtagatcaac     19020
     attcaacggt tgatgaactt ttatatagtt attcataaaa actctccttt ttatgataca     19080
     taattgttat tagtgtatcg aaatgtggct attttagcaa ctcaaaaagg ggtattgttt     19140
     acttaaggag gaatgaacat gaaaattata acaatagaag aacattttga atccgaagta     19200
     attacgaatg aaatcaataa agtcactgga aatttagtaa gtggacaggt taatccggaa     19260
     atgtttcagt atatgcaaaa ggaacttcca tcagcggcgg aaatgcaaga tacggaaaaa     19320
     cgattaggct ttatggacca acatggtatt gatatgcaag tactctctta tggaaatagt     19380
     tctccgcaaa acttagatcc aaaaatttcg gtatctctgt gtaagcgagc aaatgatgaa     19440
     ctagcgaagg tgattcaaca aaatcctacg cgattttccg gttttgctgt cttaccagta     19500
     ggctcaccag aagatgctgc tattgaatta aaaagagccg tagaagaact aggtttcaaa     19560
     ggcgcacttg tgaaagggca gtttgaaaat aaatattttg ataatagctt ttattatccg     19620
     attttcgaaa tggcagaaaa actagatgta ccgatttcgt tccatccatc gtttatccca     19680
     gaaactatta cagaacaata ttttgccagt gatgcttggt ctgatgtagt cacgggggta     19740
     ttttcatctg ctggttttgg ctggcatatg gatgtgggta ttcaagtcgt gcggatgatt     19800
     ctttcgggta tttttgataa attaccaaat ttaaaaatca ttacagggca tttaggtgaa     19860
     atggtgccaa tgtttttaga aagaatggac gatacactcg gtcactggac aacgcttgaa     19920
     cacaaaattt ctgattatta ccggacaaat gtgtacatta caccaagtgg tttattatat     19980
     cgaaacgaat ggaaattttt attaaatgaa ttagatgaaa atcatctcat ttatgcgcta     20040
     gattatcctt ttgtaaaacc agaaaatgct ggaactttcc tagatatgct tgatttaacg     20100
     gatgaagtga aagcaaaaat tgctcataaa aacgcagaga aattattaca tttataaaag     20160
     gtggaattca aaatgacttt atcaaaagaa caaatcaaag caacgaaaag tgaatttgcg     20220
     gagaatttgg cgcttgcgga tttaacgatt gtcgaagtag caaaagaact aaatacaagc     20280
     caagtaaaaa tagaacggat ttttaatcta aagcaacgtt ctttaaatga tggttggatt     20340
     ttgcggaatt acttacttag aaaggttacg gaagtaggga agacaccagt tccgtttaca     20400
     gcgctcagtg gggattatca tggatattgg tttttagatg gagaagaaat tgattcaggg     20460
     atattaagta aaggaaatca ttaaaaatag ccacccaaga ggtggttatt tttctattaa     20520
     tctcgtttca acaaaacaat atcctcattc ttcgtcagca ataaatctac atgattctcg     20580
     ccccataagc aaagtttgtt caaaatctcc gacaacgatt cgccgtattc gctcaaagaa     20640
     tactccactt ttggtggaat ttgctcgtaa actttacgga taataacgcc ggatttttcg     20700
     agctcgcgca attgttgtgt gagcattttt tgtgtgatgt tggggatgag tcgttttaat     20760
     tcgccagttc gttttttgcc ttcgcgtaaa tggcaaagga tgactggttt ccatttgccg     20820
     ccaataactt ctagtgtagc ttcgacgccg atattatata ctttagtcat caaaatcctc     20880
     ctataggcac tttttagtat ctatatgact tttaagtacc ttcttgttat tctgtacggt     20940
     atataagata ctgtataaca gaacgaaaca atttgcaatt ttttaggggg aaacaatgtg     21000
     gatatgaaaa aagtgaatcc taatttgaca cttttagcgc tagcaattag tgcgtttggg     21060
     attggttcaa cagaatttat tagtgtgggg ctacttccac tgatttcttc tagtatgggt     21120
     gtgtcgatta gcacggctgg tttgacagta tcgatttatg cgcttggtgt aatggtcgga     21180
     gcgccggttt taacaaccgt gacggcgaag atgaatcgta aaaatctgtt attattagta     21240
     atgctcgtgt ttctaatagg taatcttgtc tctgcatttg ctgtaagttt tggaatgctc     21300
     cttactgggc gcgtagttgc ggcgtttgcg cacggggtgt ttatgtcgat tgcttctgtt     21360
     atcgcagccg atgtggttca tccgagtaaa cgggctagtg caattgcggt gatgtttaca     21420
     gggctgactg tggcgactgt gacaggggta ccacttggga cgtttatcgg tcaactattt     21480
     ggctggcgga tgtcattcct gtttattgtt gcgattggtg tgatagcaat tattgctaat     21540
     tttttccttg tgccgaaaaa cttatctaat ggaaaaagta tttcgtttaa atcgattggg     21600
     caattgttag ttaataaaaa aatcgtgatg gtgttactca tgacggcgtt tggttatggt     21660
     ggtacttttg tggtttatac gtatttatcg ccgatgttta gcggaatggg ctattcgaca     21720
     agtatgatag ttattttact gattgtttat ggtgtgatgg ttgcgattgg gaatacgatt     21780
     ggtgggcatt ttgcgaatga gcgtcctgcc aaagcacttt tcattatgtt tagcttacaa     21840
     ggtgtgacgt tgttgttgct tcaattcact tcaggaaatg ccattttagg tttaatgact     21900
     attatgctaa tgggattttt cgcgtttatg aatgtgtctg gtttgcaact ttatgtggtg     21960
     caattagcag aacggtattt gccagaaacg gttagcatgg cttctgcgct taatatttct     22020
     gcgtttaata ttggaatcgc actcggagca tttatcggtg gattagtagc agaatatatt     22080
     ggtttaagtt atacaccaat tgttggattt ttgatggttt tcatcgcaat tattttaact     22140
     ttctatatga aaaaagataa atagttcaaa taataggcct tttacagtga atgtagaagg     22200
     cttttttggt gctttcagta gctccgacct attccggcaa ggtttttttc cagttatagt     22260
     aaaatggata gtttttttgt ccctacgtat ctgacaaaaa tagctatata gcttattgta     22320
     agccctatca tgaaaatgat aaattgaatt tagaaagagg agtgatacct gatgaaacta     22380
     aatcagcagt gtattcaaat tttagatttt cttatggagc aggaagattt taaaaatatt     22440
     ggttatattt ctaacgcgct tggttgttcg gagcgaagtg ttcgttatag tttggaaaaa     22500
     atcgatattt ttctccatga gcaaacatta ccagctctta tcagacatac aaggaaaggg     22560
     gtgctacttc cggaaaagaa tatcgtaaac ccggttgtgc gtaaattcaa gcaacaaatc     22620
     acaccgaaaa aataccgtta cagccaagaa gaagtacaac aatttttact gctaaaactg     22680
     cttttaagtg aagaagtgct cccggttact tattttgaag aagtcctgtt tatttcaaga     22740
     tcctctgtgc taaatcatct acgtgcgatt gaaggagaac tttttttaaa taatttagat     22800
     ttatctcacc aaccgaggca tggttttcta gtgactggaa atttaattac gaaaacatca     22860
     ctttttgcta gaagtttctt gcgttttatt aatatccgcg aattttatca gtttttagat     22920
     tcggaaaata gcttatctaa aaagggcgag ttatttttct ataatctttt tgaattggag     22980
     attttgcagg aagtgaatcg tgaggcgcat tcggtggagg agaatatgac gcgtgcaatg     23040
     gatgagcaat tatatttaac gttaatcgcg attttactga aacagcatga ggcaaaagtg     23100
     gattttcagt ttacggcaga ttttgtggca gtcgatgagc tcgataaggc gctagaaata     23160
     attattgggt cactaaaaca gtatcaatat ggacgcgaag atgaggcggt tattgaagcg     23220
     tttgtaacag gtatttgcga aaaaatgggt gaaatttatc aagtggattt tgtgcatggg     23280
     gatacggatt tttatacaca aatcaaagcg catattaaat taatgattcg gcgcgttcgg     23340
     gctggagtca ttatcgaaaa tcctattttt aatgaattta tgcgagataa tcgggaaatt     23400
     tttatgcgtg tgaaggaaag cttggaagcg ttaaagccgc tactcccaat ttcagttagc     23460
     tctcaggaaa tttcattttt agcgatatac tttgcttccg aggtacaacg caataaacaa     23520
     accgttgaaa tgaaaccaaa tttactaatt atttgcccag aaggtgtcgc ggtttcaaaa     23580
     atgattgcaa ttcagttaaa gcgaatgttt gagtttgagt cgattcaaac gattgggctt     23640
     agaaagttca aacgcgcgat gatgaatgat tttgattttg tgattagcac agtggatttg     23700
     cctgatatgc aagacacgaa agtactccga attcacagct atttgcaaaa agaggatatg     23760
     gaattactgc aaaaacattt acggatgaaa ctcgtcaaaa gtgataaaca gattattaat     23820
     aagtttagca agattttagc gattattggc gaaaatacgc aaattactaa tttaagtaaa     23880
     ttagaattcg atttattgga agcgcttata tcggatgaag gagaaacacc aaaaaggctt     23940
     attccaacat ttgaatttac agaagaagct attgttatgg aagaaacatg tcctacttgg     24000
     cgccaagcaa ttaaacttgg gaccaaacgt atggagcagt taaaagtcat tgaaccaagt     24060
     taccacgaaa aaattatcca caatttaaaa gtatatgggc cgtatatggt cattgcacca     24120
     ggcgtggtaa tagcgcatgc aggggcaagt gatggagttt tgatggatgg tattggagtg     24180
     acgatcattg aggatggcat catgtttttc gataggtacg aggagccggt tcatgtcatt     24240
     ttcacattag ctttaaaaac aaaagaagcg catttaatcg tggaacaatt aatgaaatta     24300
     gcgctgaatg aagaaaaaat gcaaaaaatt aaaatggcta gctcaaagcg tgatatttat     24360
     cattacgtta agtcagctat ctttgaatga aagagggttt cataatggac atagaaaaaa     24420
     tatcgttttc attaatttca ctggcggggg attcgttttc taaattaatt gaagcactac     24480
     aggctgcaaa agaatcagat tcagaactag ttgaacaact tttaaaagaa gcagatgact     24540
     taatgattga agcacacaag gtacaaacgg aaatgctgat tcaagaaaca agaggggaac     24600
     aagcaaattt ttccgtctta ctcgtgcatg cgcaagatac tctaatgaat accatcttag     24660
     catcaacttt aattcgcgaa atgattgaaa tgcatcaaga gattaaaaca ttaagaaaag     24720
     aggaggaaaa gtaaatggaa atcaatcaat tacatgtact tttagtttgt aacttaggcg     24780
     catctacagg ggtaatggtt acaaaaatga aggaaattgc ccaaaatagt gaaaaattaa     24840
     caaacaccga tgtaaaaatc gaagcgcatc cagcaggaga attacgcgag catattgaag     24900
     actttgacgt tattttagtc ggtcctcaaa tcaaacatca actcaaacat ttaagtgaaa     24960
     ttgcggcgga atataataaa ccaatccaag tcatcgatac gaaagattac ggcactgtta     25020
     atggcgcaaa cattttaaaa gacgcaatta ttcttaaact gaacaaataa aaaagtggag     25080
     ggaaacaaca tgtcgagtaa aaacaaacaa tcttttatga accgttttat tgcttttatg     25140
     gagaaatatt ttgagcctgt cgcagctaga attgaaaaac aacgccatat ttcctcaata     25200
     aaaaatggga tgattgcttt gatctcggtt ttaattattg gatcattttc gctgattatt     25260
     tcagcaatcg ggaatatgtt tccagcaggt tctgttgtca aagaattctt tgttcaaaac     25320
     gcagcagcac ttaacttacc gtttcaattt acgtttggat tactatcgat ttatgcagct     25380
     ataacgattt cctacagcca cgcaaaacaa atgaaagtgc ctgtgttaca tagcgtgatg     25440
     gctgctgtta tggtgacact catcctcaat acgaaaatgg ttgacggggt tcttaataca     25500
     gaatttctgg attcaagagg actatttatc gccatttttg cagcactgat ttctgtagaa     25560
     cttatcggct tatttattag aaaaaatatt acgattcgaa ttaaagggtt accagcgggg     25620
     attgcgacta cttttgaagc aatcattcca ttagtagtac tgctgttcag tgctgttgga     25680
     ctcagtattt taatgcaaag tgtcactagc ggtcaaatca ttccggaagc ctttacgacg     25740
     atgctagctc cggcgattaa tagtatcgat acgccttatg cggttttcct tatttgtttc     25800
     cttgaaatgc tattctggtt tatcggtctg aatggttatg cgattttgat tggttttgta     25860
     cttccattta tgacgcaata tttaggagcg aacgcggctg catatgcggc aggagaacca     25920
     atcccgcatg tatttgcgcc aaacttctgg gattacttca tgggcttctc tggttctggt     25980
     attacaggtg cattagttat ccttgcgcta tttagtaaat caagagaatt gaaggcggtc     26040
     ggaaaagtgt ccgttgttcc agcaattttc acaatttctg aaccagttgt atttggttta     26100
     ccgatctgtt ttaatccgta tttatttatt ccattcgtac ttggcacgcc aattttggca     26160
     gtagggcaat ggtttgtgtt ccactttggt tgggttcgtc cgccgattgc gaatgttggg     26220
     gggacaccga ttcctctcgc gcagtatttg gcgacaatgg attggcgcgc gattatttta     26280
     atcatcttcg ttcttgcggc agccgtttgt atgtactacc cgttctttaa aatgtatgag     26340
     aagagtttga ttaaagaaga agaagttgta tcagaacgtc aagctgccca cgacgcgcta     26400
     gacttggatt tctaataaga aaggtggatt taaaaatgaa actaattatt aacgaaaatg     26460
     aacaactcgt ggcggaaaca gtgagccgaa gaatcattga attggtaaaa gaaaaaccag     26520
     caagcttaat ttgtatcgct ggtggagata cacctttatt aaccatagaa gcacttatta     26580
     aagcaaatca agcgggcgaa gtagacttta gtaacacgca atttgttggt ttggatgaat     26640
     gggttggcct tggacgcgaa acaaaaggta gctgtatcca aacactctat gatgcatttt     26700
     tcgaccgttt gaaaaatgtt tctagtgaac aaatttgctt tttcgatggg aaagcaacaa     26760
     gtttaacgga tgaatgcgct cgtgtagaca agtttatcga cgatcgtggc ggaatggatt     26820
     ttattttgct ggggattgga ctaaatgggc atattggctt caacgagcca tttgtgccag     26880
     tagatgtgaa ttgccatgtc gtggagctgg acgatgtaac gaaacgtgtc atgagtaaat     26940
     attttgatac agatttgcca ctaacacacg gaatttctct tggtatgcaa caaattttag     27000
     cggctaaaga aatattttta gtagcaactg gcgagaaaaa aatcgatatc gtgaaacaag     27060
     tagtggaaaa agaaccgaca gtagcgattc ctgcaactct cgtaaaagat tcaaatacaa     27120
     tgcttgtagt cgataaaatt gccgcgagtg gggtggaagc ataatggaaa agattatcgt     27180
     taacggtaga aaaaatggac aaaaaatcga gatagcttgt tctaatttag tgatgggtgc     27240
     aggagatttc ttacgtgcag ataatatgga ttttgcgggt ccagtactag atcaatattt     27300
     cgaaatgggt ggaaatattt ttgatacggc gcgccattat cgccatagtg aaaaagcgat     27360
     tggcgcttgg atgaatatgc gaggaaatcg ggatagtgtc attatccaaa cgaaaggtgg     27420
     acatccagtc cgggaagcaa gcgacgtgcc gcgtgttact ccggaagcaa ttcacgaaga     27480
     tatttcggtt agtttagata cgttacaaac agatcatgtt gaattattcg cacttcatcg     27540
     cgacaatcca gacgtagaag tgggttctat tatggaggcg atgcataaag aagtggaagc     27600
     tggacgcgtt tacgctattg ggctctcaaa ctgggagctc tcgcgcatta tcgaagcgaa     27660
     tgaatatgca gtgaaccatg gattgacacc actaagcttt aacagcccta attttagttt     27720
     agcaaaagtg aatcgaccac gctgggaaaa ttgtgtttcg gcgaatgaag agatgattcg     27780
     ctggcatgag gcgacgaatt tgccactatt ttcttggtca tcacaagcag gcggattttt     27840
     ctctggtaga ttttctgagg aagacacgag cgatacggaa atggtcgaag tttattatag     27900
     tgaggcaaac tgggaaagat acagtcgtgc caagcaacta gctaaccaaa aaggttgcac     27960
     accaattcaa atttcgcttg cctatgtatt aacgcaatca ttcccgacag ccgctgtcat     28020
     cggtccagaa aatactactg aacttcaatc ttccgttgca gcagcaggga ttaaattaac     28080
     agcgtctgag gttgattggc tggatttaaa ggcataagga aaggcggaga aacaatgaat     28140
     ataaaagaaa aactagcagt ccaactttat tctgtacgaa aagaaatgga gcgcgattta     28200
     gaaggtacgc tccggaaaat ccatgaaatc ggctttcatt acgtgcaact cgatggtatg     28260
     cgtggcaatg attctagaga ggtacgttgt ttactacaaa aatatgagtt aaaagtgatt     28320
     ggcatgcaca tcaagcatga tcgttttatg aacgatttgg atggcatcat tgaagaagct     28380
     tatttctttg attgtaaaac tatttttgac aaatatattg aagaagagga ccaaacgaca     28440
     gcgggctaca tggcaacaaa agcggcgtta attaatgcgg cggaaaagct acatccactc     28500
     ggttttcgca ttggtcttca caatccggag tatgatttca atgaatgcat tcatggtcgc     28560
     agagtgatgg attatattac cgacccagtt gacggcattt gtatttatgc agaacctgat     28620
     acttactgga ttcgtgcggc tggacatgat gaaacagaat atattaagcg ctacagcggc     28680
     cgcgcgccga ttgtgcatat gaaagatttt ttgagcggtt ttgagctaga agatatggat     28740
     aataatttag tcgaaatagg acaaggtgaa gtagattttc gcgctatcat tgaatggggc     28800
     gaagtaaacg gagtcgagta ctattgcatt gagcaagata gatccaaaag agatatgttc     28860
     gaaacattag aagcaagtta tcagtattta ttacagttgt aaatagaaaa acgtcaggct     28920
     tgttctggcg tttttttgtg cacaaaatct ttgtacggtt tttaacaagc aagttgtggg     28980
     aactataaag atagatgttt taagggggaa tgaaacaaaa tgaaaaaaag atggctggtt     29040
     tttgcaatta tatgtttaat tatcactgga tttttaagtc caaaagcaga agctgcaaca     29100
     gattacggga gcagtttttt tactaatgta tcattacaaa atcaaaacgg ggaacaagca     29160
     acgaatttta aagaaaatag taaagtgcga gtggcgtatg attttgttat tacacagcca     29220
     gttgcaagcg gggaaacaat gacgcttact attcctgatc agctaaaatt aattaattat     29280
     ggcggatttc ctctcatgga ttcgcaagga aacactatcg caaatgcaac tattgatcaa     29340
     gtaacgggaa cgattacatt aacttttacc gactacgtaa atacacatac agatttaagt     29400
     ggtagccttt tttataacgc aacttttaac agcaaaaata ttcaaacaga tcaagtaaat     29460
     ccaatcgcat ttccggtaaa aaatactact caaacagtaa ctccatatat tagtaaggtg     29520
     aattcgggcg gtggcacagg ctcaccaaca attgttttta aacaaggtcg aatggatgat     29580
     aaagacttaa gcattttaca ttggaccgtt actttaaata atgcgctgac acctattgat     29640
     aatgctgtct atacggatac gctaggttca gggcaaaatc tgcttggaag cgcaacaatc     29700
     aaataccgag atgccaataa aaaagtgata gcgactaata ttcaacctat tgcgctggat     29760
     gcggatcgca attttgaatt atctattggc gcgttaaata atcaatctgt cgtcattact     29820
     tatgatacga aaattacgac aaaacaaaaa agctatacaa ataaagcgac actatccggt     29880
     gataacctag atgctgtttc gagaaatgcg acagtcaatg attacggtag cggtggacaa     29940
     ggaacaggaa caccgccagc ccccccggtt aaagaagaac caccatttat tccggctgaa     30000
     aagcaaccga ttgaaaaaac agtcgaaaca gattttggtc cacttgaaat cgttaaagat     30060
     tccgaacaaa atggcaaaat taaagtcatt tataaagtga aagatggcga tacattacct     30120
     ggagtagcta ataagtttga tgtctccgtt gcagaaatta aagactggaa caatctcaca     30180
     tcggatactt tacaagccgg tcaaaaatta caattaacta ttgaaaaaac gctcttatca     30240
     aaaattaccg tgccacctgt gcaaaaagtg actagcacaa caagggtaga cggtgtcgta     30300
     aaagcaacag gggttttacc tcatactggg gattcgaacc catttatccc atttgtaaca     30360
     ggcctaagct taatagcgct tggttttaca tttggacgca aaagttaaag aaaaggaagc     30420
     actcatttta tttagagtgc ttcctttttt attataataa gtgacctttt tttcgatgcg     30480
     tcacttgttg gtttttagaa tgatcatgaa acgatttaga atctttcttt ggttcctctg     30540
     gaaggttaat cgtgatggtt ttgctttcgc tagtcccatc tgccattgtt gctgtgattg     30600
     tcactaaatt atttccaggt tgcaaattag ctaatgtaaa ttgatggttt tcggtgctac     30660
     cagcaattga ttgcgtttga ttatttgttt cggtggtaat cgatgcggct tcctctgtta     30720
     caaacattaa ctctgcacta tttttcgtcg tttcaatata aggattttga atgggataag     30780
     gtagaaacat gtccattaat tcgcttgtgg ttgcagttgt ataagtagtt gctgttgttt     30840
     ctttttgcgc gtgggcaatc tccggaagcc agtttaaagt tagcgacaaa agcgctatta     30900
     ttaatagaac ataacctttt ttcttcatca ttctcacctc ttcttgttat attataaaaa     30960
     agaaatatga acaaactatg aataaaacat gatagattta aaaaatcgct accaatttag     31020
     ctgtttttaa cgtaagataa aagaaaaaaa ggagtagagc aatggaactt gataatttag     31080
     aaaagaaatt accggagaaa attaaaacag tttggcggca aacggaggga attgctgttc     31140
     ttgtttttct actttgttcg gttgctgcgg cgattatttt gtattataca ggagcttcag     31200
     tgtggtggag tgcgatcggt tttggattaa cggtacttta tgctgccttt atttacttat     31260
     tcattattcc gtttcgtttt gcacgttgga gctaccagat taaaccagac gaaatggaaa     31320
     ttcagcacgg cattattttt agaagtcgtg tcttaattcc gatgattcgc attcaacacg     31380
     tggaaacgga gcaaggccca ctacttagaa gacaaaaact cgtttcctta tcgattacaa     31440
     ctgccgcaaa aacacataag attgaagcgg taaacgagtc tgaatcagat gaacttagac     31500
     atcatatcct tgaacttgtg aaggtggcga aagaagatgt ttgaagaaag acgcctccat     31560
     ccgattgccc tcattaaaga aattatcacg aacgtaaggc gcaatattgt tcctatcgtc     31620
     gtcggtttat tttccgtttt ccgcgccatt aatagtaacg gctatttgcc ggactgggct     31680
     gtatatttaa tcattgtcat cgttatactg cttattttga ctcccgcagt cttaaagtat     31740
     ataacctaca agtacaccct cgaagaccaa gggattcgca tcaaatacgg tttgattttc     31800
     cgaaaaaata catacatacc ttacgaacgc atccaaaccg ttcaaaagaa acaatggttt     31860
     ttctttatcc catttaatgt ctgccaaatt ttaatcgaaa cagctggtgg caacgggaaa     31920
     gcagaagccg atttagtcgc tgtcccagtt ggagtagtag acgaattaaa agatttacgc     31980
     gacggtaaaa agagagacat ccaagaagcc gtgccagaaa ccgaggaaac cacagtagaa     32040
     gtggcagaag caccagaaaa aacggtcatg ctacaaacaa aacagcttat tttaatggca     32100
     gtaacatccg gcggcgtttt tgggactctc cttatcgttc tagcgttcat gcaacaattc     32160
     cgagaagtca ttccgacaga ctggatggaa gcccaagcag aagagttatg gaaaatgggc     32220
     attatcgtgc taattgtatt aatcgtcttg attcttttag tattatgggg aatatccata     32280
     gtgacgacat tgttcaagta tttccagttc aaattgatga aataccccaa ttcacttgtc     32340
     gtcgaaaaag gacttttaga gcgaaatcat acaactatct cactttctcg tattcaagga     32400
     atcaccatca ttgaatcacc actacgacaa atgctcggct tggtagcagt aaaagttaca     32460
     actgccggga actcaggtga tgaaaaacta accggagaca ttttactttt gccaattatg     32520
     aaaaaagcgt tggccataaa aacgttaaaa gaaatgctac cagattattt atttgaaata     32580
     gaagaaatgg aatgcgctcc aaaggcaagt ttgcgtagat ttttgcagat ttacttaatc     32640
     tggacaatta tcccagccgc tgtagcaagt atcctatttt tcccgctcgg cttaattagt     32700
     attattttgc caattttagc agggataaaa gcgatagcca gctaccgcgc gaccggaatt     32760
     tttacagata agcacacgct ccttgttcag tcgaggccta ttttttccaa gttaacccat     32820
     attatccgca aagagcgaat tcaaggtttg agcttaagac aaagcatttg gatggaaaaa     32880
     ggtgggtcaa gacacttaaa tgtttggctg aaatcaggta gtacaagcgc cgaggcttat     32940
     gttcgttata tcaatcaaga cttggctatc aaggtttaca actggtacag cccatccaaa     33000
     actacgaatt aaaaaagaac atgccatttc caaaaatccg ctgaacatag cgagtgcatt     33060
     ttggaagatg gctgttcttt tattttttgt tcaattaccc ggaaatctgg taaaatagat     33120
     agaataaacg aaagagtaga tagagaggat tggttaagta gtgaaacata tagtcattat     33180
     cggaggcggc ttatcagggc tcgcagcagc gtatgaacta caaaaaacac atccgaatta     33240
     tacgtgggaa ttagtagaaa aagacgaaaa actaggcggg aaatttgaaa cggttaaacg     33300
     tgacgggttt ttaattgaaa aaggtccaga ttccttctta gctagaaaac ctgctggtgt     33360
     gggcttagta aaagatttag gactcgaaga taaactgatt gcgaacgcga caggaagatc     33420
     ttacatttac caccaaaaag cgcttcatcc gattccagaa ggctctgtga tgggaattcc     33480
     gacagataaa gaagcactgc tagctagtac acttgtatcc gaaattggga aagctcgcgc     33540
     acttcaagaa ccaacaatgg aacgaaataa tcaagaacga gatcaagcac ttggcgattt     33600
     ctttgaagcg cgattcggta aagaattagt caaaacaatt atcgaaccac ttttatcagg     33660
     aatttatgcc ggggatatat acaaaatgag tttacgcgcc acttttccac aattcgaaca     33720
     aacagttaaa aaatatggga atttgatgga tggtttaaaa gaaagtagca tgcaaacgac     33780
     agggacaaaa gccactattg gtgcttttag aacattagaa ggtgggctag atgctttgcc     33840
     aaaagctatt gccgccgcac ttccaaaaga aaatttgcat acagcaaaac aagcaacaga     33900
     aattgtgaag aaaaataacg cttacgaaat ttcttttgca gatggcgata aaatggaggc     33960
     agatggcgtc attatcgctg ccacacatga tgcgttaatt catttattag cagaaacaac     34020
     gacagaacca ttcgcgggac aaccgcttac gacccttgcg accgtttcgt tagcatataa     34080
     tgaacaagac gtaccgattt tacctgatgg aacaggctat ctagttgcca gaaccgcacc     34140
     atataaaacc actgcttgta catgggtgca gaaaaaatgg ccgcatatgg taccaaagaa     34200
     caaaatgtta ctacgaggct ttgttgggaa agcaggagaa acttggttag agcaagcaag     34260
     cgatgaagca atcgtctcag ctgttttgag agattatgcg gaaattatgg accttcacgc     34320
     cgcgccactt ttttatgaag taagccgaat gaaatccgcg atgcctcaat acttagttaa     34380
     tcaccaggac cgactaaaac aattgaaaaa gaacatcaaa acagattacc caggtgtttt     34440
     ttttgcagga atgagctacg aaggtgtggg tattcctgat tgcatcgcag gggctcaaac     34500
     agccgctaag gaattagtag attacttgga agaggtgtaa catgattaaa ggaattggtc     34560
     tagatatgat tgatttagaa cgtgtaaaac aagtcgtgga aaagaatccg cgctttatcg     34620
     aacgtgtttt aacagaaaaa gaaattaagc aatttgaaaa atacgaaggt aatcgcaaaa     34680
     tcgaattttt agctgggcgt tttgcagcaa aagaagcata tgctaaggcg aatggaactg     34740
     gttttggcaa acatttaagt tttacggatg tcgaaatttt gcaagtagaa gatggtcgcc     34800
     cccatgttac tttaccagtc aaatcaggcg aaaacgtttt tgttagcatc acccacacag     34860
     ctagatcagc cgcagctcaa gtgataattg aaatttagaa aggaacgtga acaatcatgg     34920
     tgacaggctg gcatcgtcct acatggattg aaatagaccg cgcagcaatt cgcgaaaata     34980
     taaaaaatga acaaaataaa ctcccggaaa gtgtcgactt atgggcagta gtcaaagcta     35040
     atgcatatgg tcacggaatt atcgaagttg ctaggacggc gaaagaagct ggagcaaaag     35100
     gtttctgcgt agccatttta gatgaggctc tggctcttag agaagctgga tttcaagatg     35160
     actttattct tgtgcttggt gcaaccagaa aagaagatgc taatctggca gccaaaaacc     35220
     acatttcact tactgttttt agagaagatt ggctagagaa tctaacgcta gaagcaacac     35280
     ttcgaattca tttaaaagta gatagcggta tggggcgtct cggtattcgt acgactgaag     35340
     aagcacggcg aattgaagca accagtacta atgatcacca attacaactg gaaggtatct     35400
     acacgcattt tgcaacagcc gaccagcttg aaactagtta tttcgaacaa caactagcta     35460
     agttccaaac aattttaacg agtttaaaaa atcgtccaac gtatgttcat acagccaatt     35520
     cggctgcttc cttattacag ccacaaatcg ggtttgatgc gattcgcttt ggtatatcga     35580
     tgtatggatt gaccccttcc acagaaatca aaactagctt accatttgaa cttaagccag     35640
     cacttgcgct ctataccgaa atggttcatg tgaaagaact cgcaccaggg gatagtgtca     35700
     gctacggagc aacctacaca gcaacagaac gagaatgggt tgcaacgtta ccaattggct     35760
     atgcagacgg attgattcgt cattacagcg gttttcatgt tttagtaggc ggggaacttg     35820
     ccccaattat agggcgcgtt tgtatggatc aaaccatcat aaaactacca cgtgaatttc     35880
     aaactggttc aaaagtaacg ataattggca aagatcatgg taacacgata acagcagatg     35940
     atgccgctca atatttagat acaattaatt atgaggtaac ttgtttgtta aatgagcgca     36000
     tacctagaaa atacatccat tagaaggtaa tattcgtgct ttttttagaa gaagcgttta     36060
     taatctaaca tatgaaactt tatagctata tataggactt aagggagtat atcagctaga     36120
     actgtaatat tcttaacaat aaaatgcgaa ataactcttt tcttcaaggc gtgataatgg     36180
     tacgatatag ttgttactta caggtacgag gctttggggg tgtgacacgt gttagagaaa     36240
     gaaaatcgga tgataatatc cgtagaactg acacaggaaa tgatacaaga actcgacgta     36300
     gttgtagaaa aagaaaaaat ggggcggagt gaagttataa tggaagcaac gcaacagttt     36360
     ttacaagaga aaagggctcg cgaattaaga gacgagatgg aacgcggcta tgcagagatg     36420
     gcgacaatta attttgctat cgcatgcgag tgtacccatg tcgaagcaga agcagaagac     36480
     aggaatatta gtattttagg aggttaatgg ctgatggtga agcgtggtga cgtatactac     36540
     gcggaccttt cccccgtggt cggaagcgag caagggggaa tacggcctgt tctcatcatt     36600
     caaaatgata ttggtaatag attcagtcca actgtgatcg tggcagcaat aactgcaaaa     36660
     attcaaaaag caaaattgcc aacgcacgtg gaagctactc gtaaagatgg ctttgagaaa     36720
     gattctgtca ttcttttaga acagattaga acgattgata aacagcgcct gacagataaa     36780
     attacgcatt tggacgaaga tttaatggcc aaggtaaaca aggcacttga agtcagtcta     36840
     ggagtagtag aattttaatc catcctaaaa aaataacata aaatgatgaa tgcagggcaa     36900
     aagggtctga cgtaaaataa ttagtttaat acataatgaa atagttaact gctctgaaga     36960
     aacagtaagg acatcagaaa cctacaaaca acgcgtatca acatactcgc taaatttgtt     37020
     tctaatgtct tttttaaaag gcagttaagc aaaccgcaca ataagagaga aaattttgtt     37080
     aatagtggag aaaggttgga aaataactga tgtataaaga ttttgcaaac ttcatccgta     37140
     caaataaagc agacttactg aatgactgga tgaacgaaat ggagaaacaa tcagatcagc     37200
     taatcaatga cattgcaaaa gaagcaatgt acgaagaaac tagcaaagaa tttgtagatt     37260
     taattgtttc gaatgttaca gaaaacggtt ctaaattcaa cgaaaaacta gatgattttg     37320
     cagaaaaagt ggtccacctc ggttggccaa ttcattttgt taccacgggc ctacgtgttt     37380
     ttgggctttt agtatataca gcaatgagag atgaagatct attcttaaaa agagaagaaa     37440
     aacctgaaga tgatgcctat tatcgctttg aaacatggct ttcgtccatg tacaacaaag     37500
     tggtcactgc ctacgcggat acgtgggaaa agacagtttc tatccaaaaa agtgctttac     37560
     aggaattatc tgcaccactt ttaccaatat ttgaaaaaat ttctgtaatg ccgttaattg     37620
     gaacgattga cacagaaaga gccaagttaa tcatagaaaa cttactaata ggtgttgtaa     37680
     aaaatcggtc agaagtggtt ttgattgata ttacgggagt tcctgttgtt gatacaatgg     37740
     ttgcgcacca tattattcaa gcgtccgaag cagttagact tgtcggctgt caggcaatgc     37800
     ttgtaggtat tagaccagaa atcgcgcaaa caatcgttaa cttaggaatt gaattagatc     37860
     aaattatcac taccaacaca atgaaaaaag gcatggagcg tgcgctagcc ttgacgaaca     37920
     gagagatagt agaaaaagag gggtgaatac tgtggggata ccaatcttaa agttaggtga     37980
     atgtttatta atttctatcc agagtgaatt agatgatcat actgcggtag aattccagga     38040
     agatttgctt gcaaaaatcc atgaaacgtc ggccagagga gtagtcattg atataacttc     38100
     tatcgatttt attgattcat ttattgcaaa aattcttgga gatgtagtaa gtatgtctaa     38160
     actaatgggt gcaaaagtgg ttgtaactgg gatacagcca gcagttgcga ttacactaat     38220
     tgaactcgga attacgttta gcggagtact ttcggcgatg gaccttgaaa gtggtctgga     38280
     aaaacttaaa caggaattgg gggaatgaac atgacattcc aatcctgtgt aaagataatt     38340
     aatgaatggg atattgtagc tgcaaggcaa ctaggtagaa aaatatccaa agaaattggc     38400
     tttggaaccg ttgaccaagc aagaattaca actgccatca gtgaattagc tagaaatatt     38460
     ttcctttatg ctggacgagg agaaatctgt atcgaaaaag taagtgaatc tggcaaacaa     38520
     ggtatgatta ttgttgccaa agacaaaggt ccaggtattg tagacataag aaaagtaatg     38580
     caagatggtt atacaacatc aggtggtctt ggagcaggtc ttccaggagt caaacgttta     38640
     atggacagtt ttgatattga atccagtatt gaaggcgatt ctaaaggaac ggtaattaca     38700
     acaacgaaat gggttcggta aggagagcta gaaaaaaatg gaaaaagctt ttgagggaaa     38760
     ataccgtgat attcttattc aatatttaga acatcaagat gaagaaattc tttatacttg     38820
     cgaaaaatta tccagagaag ctatggaaga acgagtatca ccagaagaaa ttgtccattt     38880
     acatcgctcg gttcttgaac tatacggaaa agagttgccg gattttgtcc gattatcatt     38940
     tgatgtacta cttgaaataa tggtaggcta cggcttggct tatatggaac atcttagtct     39000
     aagaaccgag caaaaagaat tacgtagtga aattgctcaa gcggaagata tgcaaaaaac     39060
     gttaatgaaa acagaggtac cggaacacga tgaacttgat tttggggtta tcagtgtcgc     39120
     agccagacaa atgagcggtg attactatag ctttacagaa gaaggcgaca aacaaattgg     39180
     tatcgctctt gctgatgtta ttggtaaagg aattccagcc gcatttagta tttccatgat     39240
     aaaatacgca ctagctggaa tgacagggga cgacagaaaa ccatctattg tactcgaatc     39300
     attaaaccaa gtagcggaag aaaatattaa cgacaacatg tttatcacga tgttttacgg     39360
     gctctatcac gaagatacac atttgtttga atatggttca gcaggacatg agctgggctt     39420
     atattaccag cataaagaaa acagcttttc tgatttatac gccaaaggct taccactggg     39480
     tgtggataaa aatgctatct accgtcaatt tgataagaaa attgaagtgg gggatgctgt     39540
     atttattatg tcagatggtg taacagaaac aagaacagcc aatggcttta ttgaacgtga     39600
     agagttaaca gaaattatag cagcgcatat ttcattatct gctgaaaaaa tggttcatgc     39660
     aatttatgat caattagtta aaatgcaaaa ctttgagttg catgatgact ttacgcttat     39720
     ttgtattaag cgaactaaat aagaagaagt gaagacgtac ctcattcttt agagagcatt     39780
     tactggtgag taaacgtatt taaagagtgg agcgttttta tttttgaatg ttttaatttt     39840
     atttgttagg gtaaaatcga cagtatactt aaaattagat ggggtgaagt gatgaatatt     39900
     agtatagaaa taaaagaacg tgatactgac cacatagaca tatttgttgc tggggagatc     39960
     gatgcttata cagcgccaaa ggtaaaagaa gcattagaag tatatcaagt taaagagggt     40020
     attgtacttc ggatcgattt aacagaagtg agttacatgg atagcaccgg attaggcgta     40080
     tttgtaggag ctttcaaaag cttacgtcaa cgccaaagtg aacttgtctt gtttggttta     40140
     agcgaccgac ttttccgatt gtttgaaatc acaggattgt cagatatcat cgaaatcaaa     40200
     aatgtagagg gtgaaatgaa tggcaacaat gcatgacaaa attacattac aacttcctgc     40260
     caagcctgaa tatgtaagtt taggtagact ttcattatca ggaattgcaa gtcgcgcagg     40320
     attttcttat gaagcaattg aagatttgaa aatagctgta agtgaagcca tcactaattc     40380
     cgtaaagcat gcatttaaag gggaagaaga tggcgaaatc acagtcgaat atcttattta     40440
     tgaagataag ctagaagttc gtgtttccga taacggcaca agcttcgact tagaaacccg     40500
     taaacaagaa attggcccat atgatgtggg cgaggatgcg gagatgatgc gtatcggtgg     40560
     gctaggttta tttttaattg aaacattaat ggatgacgtg aaactttatt atgatgaagg     40620
     ggtttctgtc gtaatgacca aatatattaa tgaaaagcag gtggaggaga atgccaaaag     40680
     tatctcaacc tgataaagag gcgaaagaaa aagtctatat ttggattgcc gcttaccaag     40740
     aaaatggcga tcaagacgcc caatataatt tagttgttca ttacaaaaac ctagtagagt     40800
     ccatcgcccg aaaatattcc caaggtaaat cttttcatga agatttagtt caagttggga     40860
     atattggttt acttggagct attagaagat atgatgcaac gtttggaaaa agctttgaag     40920
     catttgctgt gccaacaatt gttggtgaaa tcaaacggtt tttacgtgat aaaacatgga     40980
     gtgtccatgt gccgcgccga atcaaagagt taggtccgaa aatcaaaaat gccgtagaag     41040
     agctaacgag agaacttcaa agctcgccgc aaattagcga cattgctgat tttattggtg     41100
     tcacggaaga agaagtttta gaagcaatgg aaatgggaaa aagctaccaa gcactttctg     41160
     tagatcattc gattgaagct gattcggatg gaagtacgat tacgttactt gatgttgttg     41220
     gtggtacgga tgatggattt gaacgtgtga atcaacgtat gctcttagag aaagttctcc     41280
     ctgttttaga tgagcgagaa cagaagattt tgcaatatac atttattgaa aatcgcagtc     41340
     aaaaagaaac gggtgaacta ctcgatatat cacaaatgca tgtgtctaga atccaacgtc     41400
     aagctattaa aaaacttcga gaggcgttgc agaatgagga agtggagtaa atgaacaagg     41460
     cagttgaatc aaataattta tttgtatttc aacgttctaa agcattacaa caatactgcg     41520
     gggatgttta ttatacccat gaagacgaaa atggttttct gtatgttctt tctgatggac     41580
     ttggaagtgg gctcgaagct aatagagcgg ccaaagcgac tgttgacgcc ataaaagaag     41640
     atattcatgc agatattact gatatgcttg aaaaagcgaa ccaggctgtt tcagggcttc     41700
     gtggtgctgc gatagctatt attaaaggtg actacttaac gaagacactt tattatactg     41760
     gtatgggtaa tattcgtttt tatatgattg ggattgaaga taagcttatt tttccgcttt     41820
     caggctctgg atttttgtcc ggtcgaaaac agaaatatcg gttgcaatcg tttaaatata     41880
     aaccagacag taagttttta atgcattcag atggacttgt tctttctcgc gttagaaaaa     41940
     gcctagaatc accactttgt gtagtgaaaa ccgggcattt aatcgagcgt aatatattag     42000
     atattccaac agatgatgta acttttatgg ttgggaaatt tccggaataa ccataacacc     42060
     ttttaaacta gcgatggttt gaaaggtgtt tttttcagat tgggtgtgag aacaggggct     42120
     atttatggta tattagaata gagcgctagt tttttatact taatcatgtg ataattgtca     42180
     cttagtaagc gtgaagccaa attgctttgc gtttttttcg cgcggattaa aatacaaata     42240
     agagagaagg agcaaattga agaaagtttt gttgaatagt gtaaaaggtt atacgtgggc     42300
     gaggtttagg aaagacttgc ttgcgggtat tatcgtgggc attattgctt taccactagc     42360
     gatgtcattt gcgattgcat caggtgtaag tccggaatat gggatttatt caagttttgt     42420
     agcgggaata attgtttcta tttttggtgg ttcgaaattt caaattgctg gaccgactgg     42480
     tgcatttatt ccagttttac taggaatcgt attaacttat ggttaccaag atttacttgt     42540
     tgccggaatg atggcagggg ttttactttg cctaatggga atttttaaaa ttggaacatt     42600
     aattaaattt ataccgcgtc cagtaactat cggattcaca gctgggattg ctgtcactat     42660
     ttttatgggg caagtgggta atttcctagg attaactgga atggagaaac atgaatcatt     42720
     tgtagcgaat atgaaagaga tctggttgca tcttgattca tggaatttct atagtgtgct     42780
     catttcatgt atttgtatgc ttgtcttatt tatttttcct aaaattttac cgagaattcc     42840
     agcaccactt attggacttg tggttacgac ggcgattgct atgctgtttt tcccggatgc     42900
     gcttccgaca attggatcag cttatggaaa tattccgagt acttttcctc catttgaatt     42960
     tccagatatg acttttgcga atatgagtaa attgattgga ccggcttttg ttatcgcgat     43020
     gcttggcgga attgaatcgc ttctttcggc ggtggtggca gatgggatga cgaatacaaa     43080
     acataatagt aatcgagagc taattgggca gggtatcgca aatattgtaa cgccaatgtt     43140
     cggtgggatt ccggcaacag gagctatcgc aagaacggca accaatatta ataatggcgc     43200
     gactagccgt gtctcaggtg ttatccacgg ggtttttgtt ttactcactt tactagtact     43260
     tgcaccagta gctgtcaata tcccaattgc agcaatggca ccgattttaa tgttagttgc     43320
     ttggaatatg agcgaacgaa aaaccttcca acacatcatt aagttgaaat cgggcgatac     43380
     tttagtgctg gttattactt ttttattaac ggtatttgca agcttaactg tggcagtcga     43440
     agttggttta ctgctggcag tggtgctttt cgctaaacaa atgggaagtt caatgcagat     43500
     tgaagaaatc gaaccagaag gcgccgaaat cgctcctcat ttacacgaaa aaattagtat     43560
     ttttacaatt cgtggtccgc ttttctttgg cgcagcacag atttttcaac aaaatattat     43620
     aaaagcaatt catgttaaac caaaatacct tatattgcgg atggggaaag tgccaattat     43680
     tgacgctaca gcagaaggct atttccacca aattgaaaaa gaattttcga agcaaggcgg     43740
     tcaaatttta attaccgggc taacggataa agcgaaagaa agtttgaaag gtagcggact     43800
     ttacgaccga attggcgaag aacacttctt ttcccatacc gaagatgcga ttcattatgc     43860
     ggaaaatgct ttaaataagt gaggcgggta gcttttgtca gttgaaacgt aattatgtta     43920
     cacttagtag ataatgaaat aaatggaggc tatcaagtat ggaacaaatg caagataaaa     43980
     taatgaaatt agtccaaaaa tcgctaacgt ataaaccagc gcaaattaat gctgttatca     44040
     aattaatgga agaaggtaac acggttccgt tcatcgcgcg ttaccgtaaa gaaatgactg     44100
     gtagcttaga tgaagtagaa atccgtgata ttgaagaaac atttgaatat gtaacgaaat     44160
     tagaaaaccg taaagaagaa atcattcgct taatagatga acaaggaaaa ttaacagatg     44220
     aactgagagc ggcaatcgtc aaagctgaaa aacaccaagc gcttgaagac ttatatcgtc     44280
     cgtataaaca aaagaaacgc acgaaagcaa caatcgccaa agaaaaaggc ttagaaccac     44340
     tggctgaatg gcttatgagc tttccaagca atgccgatcc actgacagaa gctgcaaact     44400
     acatttcaga agaaaaagaa gtggaatcag cagaagctgc attactcggc gcgcatgaaa     44460
     ttattgccga acaaatcagt gatgagccta gtttccgtga atggattcgt aactttacac     44520
     gcaaattcgg gatgattgaa tccagagcga aaaacgccga agcagacgaa aaaggcgtgt     44580
     acgaaatgta ttatgaattt aacgaaatga ttggaaaagt agctagtcac cgtattcttg     44640
     cttttaaccg cggggaaaaa gaagatattt tacgtgtaca agtccaagtg gatacaacaa     44700
     aaatcttcca atatttattt gaaaaagtta tccaaaatcg caattctgca actcgtcctt     44760
     atgtagaaga agctatttta gatgcctata aacgctttat tggtccagca attgaacgtg     44820
     aaattcgcgg cgaactaaca gacaaaggtg aagaacaagc catccacatt ttctccgaga     44880
     acttgcgcaa attgctatta caaccacctt taaaagggaa aatcatcctt ggggtcgatc     44940
     cggcttttag aacaggttgt aaattctctg tgttagatca aacggggaaa gtgcttgaaa     45000
     tcggtgttgt ttacccacat acggctaaag cacgtcgccc agaagcgaaa caaaaaattg     45060
     cagaaatttt atcaacatat caagtagaag ttatcgcgat tggtaacgga acggcatcac     45120
     gtgaaacaga gcaatttatt gtggaagtga ttcgtgaatc gaactccaat gcttattatt     45180
     gtattgtaaa tgaagctggt gcgagtgtgt attccgcgag tgaaacagct cgcgaggagt     45240
     tcccagatta tcaagtagaa gaacgtagcg cagtttcaat tggacgccgt ttgcaagatc     45300
     cactagcaga acttgtgaaa atcgatccga aatctgtcgg tgtaggacaa tatcaacatg     45360
     acgtagcaca aaaacgttta aatgaaacac taactttcgt cgttgaaacg gccgtcaacc     45420
     aagtcggtgt caacgtaaat acagcatccg cctctctttt acaatatgtt gctggtttga     45480
     ataaaacagt tgcaaataat atccgtaaat atcgcgagga aaatggttcg tttgcttctc     45540
     gtaaagagtt gaaaaaagtt cctcgtctag gcgcgaaatc atatgaacaa agtatcggct     45600
     tcttacgtat tttagaaggc gaaaacccgc ttgataaaac agcgattcac cctgaaagtt     45660
     ataaagcggc agaacaaatt gttaaagcag ctggttttgg cttaaaagat atcggcagcg     45720
     aagatttaaa agcggcatta caagcgctta gtatcccaga agaagcagag aaattaacca     45780
     ttggtaaaga aaccatgcgc gatatcattg ataacttaat tgctcctggt cgcgaccttc     45840
     gtgatgaact tccagcacca cttttaaaac aagatgttat ttcgatggaa gatttaaaac     45900
     aaggaatgga attacaagga acagttcgta atgtagttga ctttggcgct tttgttgaca     45960
     ttggtgtgaa acaagacggc cttgtgcata tttcaaaact aagtaattca tttgttaaaa     46020
     acccgatgga tgtcgtttca gtaggagacg ttgtaacggt ttgggtcgat gaagtggata     46080
     caaagaaaaa tcgtattgct ttaactatgc taaatcctaa tggaagtgtt aaataatgaa     46140
     tcaagcagaa ttgcagcgac acatggaaga agtgtcgctg caatttttcc aaaaagaatt     46200
     tcgccaccaa gccgtgttta atgcgcgctt acgaaccact gggggacgtt atttgctaaa     46260
     aagtcataat atcgaaatga accccaagta cctagaaaac tttggattag cgtactttat     46320
     cgggattatg aagcatgaac tatgtcatta tcaccttcat ttagagaaaa aaggctatca     46380
     gcaccgcgat caagatttcc gcgagttatt aaaaaaagta gacgcaccga gattttgtgc     46440
     aacgatacca cgtgaaatta ccatgcatga atatacatgc aaaagttgcg ggaagtcctt     46500
     tttaagacaa cgcagattca atgtgaaccg ttatcgctgt ggcagttgcg gtggaaaact     46560
     aattcaaact gactccaaga aaatttatac agaaaacccg tgaaaagtct tgcattttcg     46620
     cccgattctg cgtatactag tggaagtcag ataattccac agtagctcag ttggtagagc     46680
     aatcggctgt taaccgatcg gtcgcaggtt cgagtcctgc ctgtggagtt tggggaagta     46740
     ctcaagtggc tgaagaggtg cccctgctaa gggtataggt cgctcgcgcg gcgcgagggt     46800
     tcaaatccct ccttctccgt aataacttat aaagacattg tttaggaaac taagcagtgt     46860
     ctttttttgt ggaaaatcgc gatggatttg agtctatata tatgctaaag ttattttgaa     46920
     agataagctc aagttgcaaa aaacataatg aagtaaaact attttggaat gcacatttac     46980
     caattatgat gagtgttggt gggtgttatg agtattatgc tatcgcttta aatgacgaaa     47040
     atgttgttca tggttcagaa cctgaatttg aagaaagttt agttgtagcc gactcgttcg     47100
     cggatttttt actgaaaatc gtgactggag aaatggtgat aagttaaaat taattaggaa     47160
     atttgctata ataagaaaaa cgtttcagaa aggaaaggac tatggataat aaactagaat     47220
     ttacaacgat tgatgaatat attacccaag cgccaccgga aacaaaagaa gtgttgcaaa     47280
     aaataagaga aacgattaaa gctgctgcac cggaagcaac agagaaaatc agttatcaaa     47340
     tgccgacttt ttatttggaa ggaaacctgg tgcactttgc tgttgcgaaa aatcattacg     47400
     ggttttatcc agcttctagt ggcattgcgg cattcgaatc taagctcgga aattacaagc     47460
     attcaaaagg cgctgtgcaa ttcccaatca aagaagaagt tccttatgaa ttaattaaag     47520
     aaatgacact tttccgacta gcagaaaata aacaaaaagc agcagaaaag ctagcaaaga     47580
     agaagaaaaa ataagaagga gactttcatt gtgatgatga aagtcttttt tgttcggtct     47640
     tttattttaa aaagactaga catttaaaat taaatgagta taataataaa tagaaaacgt     47700
     tttcttttta gaaatatatc atgtttgggg gaagtaaagt gaataagttt atggagttac     47760
     ttggggaaaa gttaatgcct cttgctgcaa aactaggaga gaataggtac ttaaccactt     47820
     taagagatgc attcatgttg gcatttccgc taacaatgtt tggttcgatt gcggtggttt     47880
     taatgaatct accgttttgg agtgatgaaa cgaaggcagt tttacagttg tatcttggaa     47940
     atgcccaaag cgccacgatg agtattatga ctgtctttgt tgtttttgga attggatatt     48000
     cactatctaa atattataaa gttgaagcaa tttatggagg ggcagttgcc cttgctagct     48060
     tcttgatttt aacgccattt ttctttaata gtcctgatgg agagcttatt accggagcac     48120
     tttcgttaga tcgacttggg gcaaaaggaa tgtttatcgg aatgattact ggttttattg     48180
     ctgcagaatt atatcgattt tttgttcaac gggattggac aatcaaaatg cctgcaggag     48240
     tgccacctgc tgtagctaaa tcatttgcag cacttattcc agctatctta acattaagta     48300
     tttttttagc aattaatgtt atggtacaat tcttcttcca tacaaactta catgatgttg     48360
     tttatactgt tattcaaaag cctttagtgg ggcttggttc aggaattgtt ccaacactaa     48420
     tcgctttatt ttttgtccaa gtattatggt ttttcggcct gcatggtcaa atcattgtca     48480
     actcggtaat ggacccgatt tggaatacgt taatgcttga aaatttagat gcttataaag     48540
     ctggactccc attgccacat attattacga aaccatttat ggaagtattt actgttggta     48600
     tgggcggatc agggatgact ttagcagtcg ttattgcatt agcattctta atgaaaagta     48660
     agcaaagtaa agaaattggc cgattagctc ttgggcctgg aatttttaac gttaatgagc     48720
     cagtactttt tggtatgcca attgtattaa acgctacgat tttaattcca tggattattg     48780
     cacctttgat tgtaactact ttgaattatt tcgtaatggc agctggtatt gttcctgctc     48840
     caaccggggt tgctgttcct tggacggtgc caattgtaat caatggtatt ctcgcaacca     48900
     attcatggct aggcggggcg cttcaagtag tcgatttctt catcgtcctc attatctggt     48960
     atccgttctt aaaactagtc gatcggacaa atattgcgag agaatcagag gcagctatca     49020
     aataagttaa attttccttt tcgatatgct ataatttgac tagaaatggc tagacatttt     49080
     taattcaagc gaaggagcga tcgaattggt taagtatgaa ttgattgcag cagatatccg     49140
     cgaaaaaata aacaacggta cttacccacc agaatccatt cttcctgatc aagtgagctt     49200
     atgtaaagcc tatgattgta gcagaatgac tataaaaaaa gcctttgacg ttttagcgct     49260
     tgaaggactt gtttacagac aacggggtgc aggaactttt gtcatgaaaa atgccttagc     49320
     taataagcaa gacgcgagtt tgcgggatta tgatggtttg acaaaaatga tgggagacaa     49380
     ccgaatctcg agtaaaatta ttgcattcga tattgccttc ccagatgaaa aaacacaaga     49440
     acaactttta ataaaagcag atcaaccggt ttacaaattg attcgtttac ggctcttgga     49500
     cggcgcacca tatgtattag agcatacaac tatgccggca gatttagttc ctggtttaac     49560
     aagagaaatt ttacatcatt cgatttatgc atacttacaa gactcactgg gactcgtgct     49620
     aagcggtgcc tttcggaaaa ttaatgccga taagccatct gaatatgatc aagaatattt     49680
     agcgtgcggg gaacacgacc cagtgttaga agtggagcaa gtagtgtatt taaaagatgg     49740
     tagaccagtg gaatattcta ggtcaagaca tcgctatgat acaagaagtt ttattatggt     49800
     tgaccaccga gaaaagtaaa ataaagtcag catgcccgta aagcatagct gactttgttt     49860
     tatggaggta aaaatgtata aaaaacttcc gatgaaaaaa atgtaaataa aattagaaaa     49920
     agccgttgac agtcactcag attatgttat aataaaaaag ctggtgtaag agaaatgaat     49980
     tcaattgaat atatattcat ttttcgtttt ttatctggcc cgttggtcaa gcggttaaga     50040
     caccgccctt tcacggcggt aacacgggtt cgaatcccgt acgggtcact ttttttattc     50100
     attttttata catatggttc cgtggtgtag gggttaacat gcctgcctgt cacgcaggag     50160
     atcgcgggtt caaatcccgt cgggaccgct caaaaagaat ccaagttttg cttggattct     50220
     ttttttcata caggaaattg gacacagctt tttatttgag ctataatctt attattcata     50280
     taagaattgt aagaattaaa ttggaggaat gaatcatgga tttagtgaaa aatgggaaag     50340
     tattggaact tgtacatcca aatggaaact ggacattaat taaagaagaa ggtttttctc     50400
     cagttcaaat aactgttgcg gcggttgctg cttgtagcgg atatgtctat caaacattac     50460
     ttgagaaaaa acgaattgat ataaatgatt taagcattca taccgattat gagcaagatc     50520
     aagaaagtgc tgtgcatgtg ttaacgaaaa ttaatgttac tttcacagtt gatttagtgg     50580
     ataaaagtaa ccaagcgaaa gccgaaaaaa cagtgcattt agtgaaagat gcctgcccgg     50640
     ttgcgaaaag tttagacccg tcgattgaaa ttaatgagat tgttgttttt aaataaaatg     50700
     atttatagac caagccgtgg tgcttggttt tttttcatct agtttggctt gattacttaa     50760
     agggaaggct atatactgaa accaaacaat acaaacgagg tgctggaata tggcagagaa     50820
     aacaatagta gaaaaattac aactggctaa atataaagaa gcagtcatcc taaatcaacc     50880
     agatggagcg gattatttcc aaaatctagc aaattacgaa gaaaaactag cagacaaaca     50940
     atacgattta attttcgatt ttgttgaaac gctagaagaa ttaattacgt tcgtgcaaaa     51000
     agttattgct gaaaataaac tttccgtgga tggatattta ttcttcgctt accctaaaaa     51060
     aggcaataaa aagttcgcta catatgtaca ccgcgatgaa ttaatgccag cgcttaaaac     51120
     cgatgaagaa ggttacgtcg atggcagcac actcaaattc acgcgaatgg ttgcactcga     51180
     tgaaacgtac acggttgttg ggctaaaaga agcaacaaaa ctaaaagcaa aaggcgttaa     51240
     gaaaaataat ccttccgcag atgaatacgc cgaccatgta cctctagtcg cagaatttct     51300
     agcagacaaa ggcgatttac aagtcttcta taacaatcta gctacaggat accagcgtgt     51360
     atgggcgcgc tatatttact ctgccaaaca accagcgaca caagaaaaaa gacgtttaga     51420
     aatggtcgat attttgagtc aaggttataa aacaaaagat ctttaccgac aagggaaaaa     51480
     gtaaccaaat aattttattt ggttattttt gtgtttgaaa ctgcttcttt atgtaaaaat     51540
     gtctaggcgt gatagaatag aagaggaata agacgaagga aaatcttgtt gcactggaaa     51600
     aggggacatg caggatggcg aattatatta acaaagaaag gcgccaaatt gattttgatc     51660
     catttgattt acggataatt gccgtaccag aagtagtagc ggtgcagttt aagccgcgct     51720
     cagagcatac tttacttatt cgtattgcgg atgtcggcgc aacctatcag ccactcaaac     51780
     acgaatcact ttttgaagct attttgcccg ttcactttaa tgatattaac gaagaagatg     51840
     attactgggg gcttagtgac aaagagcaag cggagatgaa actatttaac gaggtacatc     51900
     gcgatttgat ttataatttt gtggatgagc acccagattt tacgcagatt gttgtccatt     51960
     gtcacgctgg ggtcagccga agtagcgcgg ttgctatggc gattgcggaa catttaggcg     52020
     acacggacac atacgaaaaa cttcaagtga taaaacgata cttaccaaat ccgcgggttc     52080
     ttgcgattat gcggggcgaa gcgtatttat aaaaacgaaa acgaagaaat gttaggagag     52140
     attttgtatg gaaaagcatt atgattatat tgcgattggt ggcggtagtg gcgggattgc     52200
     ttcgattaat cgcgcagcca tgcacggagc aaagtgtgca ttaattgagc cgaaattttt     52260
     aggtggaact tgtgtaaatg ttggttgtgt tccgaaaaaa gtcatgtggt acggcgcaca     52320
     aattaaagaa gcgatggatt tatacgcaga tgcttatggt taccaagtgg acgcgagctt     52380
     caacttccaa aaactagtcg aaaatcgaga agcgtacatt gaacggattc gaggttcata     52440
     caaaaatgga cttgataata ataatgtaga ttggataaaa ggttatgccg aatttgtcga     52500
     tgaaaaaaca ttgcgcgtaa acggcgaact agtgacagcg gatcatattt taattgcaac     52560
     gggcggcgaa ccagcgcttc cttctattcc aggtgcagaa ttcggcatca catcagatgg     52620
     cttttttgca ttaaaagaac ttccgaaaaa agtggcggtt gttggcgcgg gctacattgc     52680
     agttgagcta gctggtgtat tacaacaact tggctcagaa acgcatttgt ttgtacggaa     52740
     acatgcacca ctccgaaatt tcgatccact tttaacagat acactaaccg aaattatcga     52800
     gcaatcggat atgacgttgc ataaacacgc cattccgcaa aaagtcgaaa aaaatccaga     52860
     tggcagtttg acgttgagct tagaggatgg ccgcacagaa accgtcgata cgcttatttg     52920
     ggcgattgga cgtaaaccag ttatcaaagg tcttcaaatc gaaaaatcgg gagtagaact     52980
     tctagaaagt ggtcatatcg ccgtagataa attccaaaac accaatgtag cggggattta     53040
     tgcagttggc gatgtaacag gtcattatga attaactcct gtcgcgattg cagcgggccg     53100
     ccgtttatca gaacgccttt tcaataacaa aaaagatgca catttaaact atgaaaatat     53160
     cccaaccgtc gtatttagcc atccagctat cggaacagtt ggtctaacag aaccagaagc     53220
     aatcgaaaaa tatggcaaag aaaatattaa agtgtacact tcaagcttta cctcaatgta     53280
     tacagccatc acagaccacc gcgaaccttg tcgaatgaaa ttaatttgcg aagggaagac     53340
     agagcgcgtc attggcttgc acgggattgg ttacggtgtg gacgaaatga ttcaaggatt     53400
     cgctgttgct attaatatgg gcgcaacaaa agccgatttc gacaatacag tcgctatcca     53460
     cccaacagga tccgaagaat ttgttacaat gaaatagaaa acaacgatgg aggaggaagt     53520
     acgtaatggg aaaaaaatta tcactttatt ttgtaagaca tggtcaaacc tacttaaaca     53580
     aaaatttgcg catgcaaggc tgggctgata cgccactgac accagaagga attgaaatag     53640
     taaaagaaag cggtcgaggt cttgctgaaa cagagttcgt cgcagcatat tcaagtgact     53700
     tacaccgtac aatcgcgaca gctggccact tgcttaaaga aaataaacac gcattcggct     53760
     taacgcttga gccattaagt gaatttcggg aaactttctt cggctcctac gaaggtgaaa     53820
     aaggcgatgt tgcctggaac gaaattgcac atcatatggg atacgcgaat caagaagagc     53880
     tattccaaaa agccgatgtg cgcgaaacaa tgaacggtac aaaagcggct gatccaaccg     53940
     gagatgcgga agatttcatg acattttgga cgcgcgtaga acaaggtttc ttacacgtta     54000
     tcaatcgtca tagagaaact ggcggaaacg tccttatcgt cgctcacgga aacactattc     54060
     gtaacatcgt ccacgaacta gaaccatcca tggacgaagc ggttatcctc gacaatgcaa     54120
     gtgttactgt actagcttac gaaaacggct tattcaaatt agaacgttta aatgacacct     54180
     ctcattttaa aaaagcatag aaaaaacgag ctttaggaag tagtttccca aagctcgttt     54240
     ttttattttt tcggtgtatc tggattagga agattattat caatcgccag ctgacctcgc     54300
     cgcaatttaa ttaaacgatt aacgttaacg ataattgttt tcactaccgc ataaagtgga     54360
     acacctaaaa tcattccgaa gattcctgct aagtttccgg caacaatcaa gataatgata     54420
     atagttagtg ggtgaatcga tagagattta cccataatat atggagaaag taagttagag     54480
     tcaatttgtt gcacaatcgt tacgacaaca ataacgagca gtgcttggac tggagaagta     54540
     aatagcgcca cgataactgc tggagctgct ccaatgaatg gtccaagata aggaataata     54600
     ttcgttgcac ctgcaataaa accaaacaga agcgcatacg gttgaccgat aattaaatac     54660
     ccaataaaag taaataaacc aacaaacata caatcaattg cttgcgaact gatgtaagta     54720
     gagattgttt tgttcatttc tttaataatt tgttttgctt cagaacgaat acctgccggg     54780
     aaaaattttc cagaggactc aacaaactta tgaccatctt taaacatata aaagacgata     54840
     aatggtacag ttacaagaat catgacaaaa ctagagacaa aggagacaat ggctccaaaa     54900
     ctagaagcta ccccatcaac gaccacagac atgatttttg gtaaggaaat gttgagcttc     54960
     tcaagttctt gtttcatatc tatatctttt aatgcagaat tattcgagag accttgcagc     55020
     catttttcaa aatcttgcca gtaacctggt attgcttttg caagttcagc tacttggtca     55080
     gcaagcgttg gaccgagttg cattactgca agaacaacaa gcgtgataaa agcgataaaa     55140
     attacaataa cactcaaaag tcgaggtact tttctttttt ctaaaaataa tacaagtggg     55200
     ttaaataaat agaataggaa ccctgctact aaaatcggca taaataatgt agaaactatg     55260
     atgccgattg gtgaaaatat gtacttcatt tgtaatagaa cgaacaaaat agctacaacc     55320
     gctaaaattt caattgtcca aaaaaataat ttactatctc gaaatcgtga aaacttcaaa     55380
     ttctcccctt ctttctaaaa ccttattgat aaattttata gtaccattaa ctgctttaaa     55440
     tagccactga attactgcta ttgacgtaga agtatatgtg ttatacaata tatataacag     55500
     ttgaaggaga ggtgtttcta tgttacttgc aattgatctt caatcagacg agccaattta     55560
     tacacaaata tgcaatcaaa tcatcgaagg catggcgaaa cgggaacttt taccaggaga     55620
     caaattacct tctgttcgga gtcttggtgc agatatcgga attaattttc atactgtaaa     55680
     caaggcctac caaattttaa aacaagaagg atttattcaa atacatcgtc aaaaaggagt     55740
     ggttattcat ccggatgggg tagctaaggc agatgagcta ttttttacta aattacaaac     55800
     gaagctaaaa ccactcatcg cggaatcggt tgtgcgcggt gtcaccgaag agaagtggct     55860
     cgaagtaagt aaagcaattt ttgacgaaat gcatggacgg agagtggagt agaaatggaa     55920
     attatcattt atatttttgt cagtattgct atcatttcac tgcaagcaat aacccctttt     55980
     gtaataagaa aatcagaatg tttcggagta aatgttggcg aacgtgctaa ccggaatgca     56040
     gaattaacac agttaaaaaa acaatatgtt gggcaagtga ttttgtggac ctctttcgtt     56100
     gctattatcg gaatcgcgtt aattcaaggc tttcattcga gtgaaaatac gcaagctggt     56160
     atttttattg cttcgatgtt tagtcaatta atcgtttctt ttattattta ttatcgcttt     56220
     caccacacaa ctttacagtg gaaaagagac aaaatagaag ctggagaaat ttcgactaat     56280
     tctattataa tggtagacac tagttttcat cgcagaaaaa tggttatttc gtatacatgg     56340
     tttatcgtgc cactgcttat tttcattatt acacttgcga ttacagtcgt attttattca     56400
     acagcccccg ttgattttcc tatccatttt gatatgagcg gaaccgtgac agatacagtc     56460
     gccaaatcac ctagagtcgt attgttacta ccaatgatgc agctaggaat gattgcattg     56520
     tttatcttta ttaattttgt tattgcacgg agcaaacaaa cggtagagaa cgaaaaccct     56580
     actgattcat taaaacgaaa tatgttattt agacagattt ctagtaaagc tatgttaatt     56640
     atgtgtacga taatggtgat tgattttctt atcatgcaag tagtcacatt acttgcactt     56700
     ccagctgaat ggatgatggt aacgatgatt atttctgttg tcttaatttt gtttgggact     56760
     gtcctccttg ctgtaaaagt aggacaaggc ggtagcagac tcaaatttgc tgaccaacct     56820
     gatggtgtca ataaaccaat tcgggatgat gattcctttt ggaaagcagg ggttatttat     56880
     tttaaccgaa atgatccagc cttatttgta gaaaaacgtt ttgggattgg ttggacgatt     56940
     aatacagctc gcccggttgc ttggctatct tttgtaatta ttatcgctgt cataattctt     57000
     attagcatct tgttttaact tgccctcagg cgggtattta ttatatggta tgcggataaa     57060
     ttagtttgtg tgagatgctt ttgtaaagga gtagattatt atggcgatta gattgaagcg     57120
     actggaggaa tgggaaggat ttactggtat tgcactcgtt cgagaaggtc ttaaagcaga     57180
     agcacttcac acagaaataa aaactgcctt caaagaaata ctccaacttg cgcgagaact     57240
     agatgacttt tccaagcaaa aaatttttta tgggatttct gtccataata tagaagacgg     57300
     aataacgcat tattcggcaa taccggtcga acaaaaatat tctaatttaa aagaaccgct     57360
     tgagtggatt gaagtgccag cgcatacgta ttttgtagca gagcatattc aggataccga     57420
     tataggtgaa agctatgaag agattgccag agccattcaa gaaaaaaatt ataaacctta     57480
     tattacggcg aataatcctg tttttgatcc actaccattt aaactggaag tgtatacgaa     57540
     acaaggaagc gacgaaacaa atattgaaat tagaattcct gtcgtgaaag aattgcatac     57600
     gtaagaaata gcctgggact tttgttctgg gcttttttat actagcaagc tgtttttgag     57660
     tgtgctataa taaaaacgct attttgtgat tattttaaca agaaggaagg gattcatgtg     57720
     ggatattaca gcccgcagga agtaacagag attacgattg aaaaaggaac ccaaaaagca     57780
     aattcaagta cattaacact tgtgttgtta ggctttttag gtggagcttt tatatctctt     57840
     ggttacttat tatacatacg tgcagtagga acaatgcctc acgaatgggg aagctttgca     57900
     acgctcattg gcgccagtct ttttccggtt ggcctcgttt gtattttgct aggtggagga     57960
     gaattaatta ccggcaacat gatggctgtt gcaattgctt ggtacgacaa aaagatttcc     58020
     ttccaacaat tacttagaaa ctgggcgatt gtgtccgtca tgaacttagt gggcgcattt     58080
     tttgtcgctt acttcttcgg acatttcgtt ggcttaacag aaggcgattt cttacccaaa     58140
     acgttagcta cagctggcgc aaaaattaac gatcctttct gggttgcctt tgtttcagga     58200
     attggttgta actggtttgt tgggattgct gtttggcttt gttacgcggc caaagatttc     58260
     gcagggaaaa tccttggtat ttggttcccg gttatggcat ttgttgctat cggatttcag     58320
     cacgttgttg ccaatatgtt tattattcca gctgctattt ttgctggtta ctattcatgg     58380
     gcagatttta tttggaacgt catcccggtt tacctaggga atgtagtcgg cggagcagtt     58440
     tttgttagcc tattctactt ccttgcttat aagaaaaacg cgcctaaaaa ggtaaaagaa     58500
     gaaatacacc aaccaattga agaaaattaa gataaaaaag ctagttacat tcgatgtagc     58560
     tagctttttt ttgaaaaaaa taaaaaattt ttaaggctat tacgattccc gccatgttgg     58620
     gatagaatga ctttttccaa aagttatttt gctagttgaa aagaaaaatc ctgattaaat     58680
     ttttcgattt gtggaaaaca ctattataag ctacgagagc acgtgcagaa aaattttttg     58740
     aggagtggta tttttgagta ttaaagaaac agcattacca aaagttcaaa caaaattatt     58800
     tattaatgga aaatggacgg atggagataa taaagaaaca aaagatattg taaatccagc     58860
     aaacggagat gttattgcaa aaatcgctca agctggacca agtgaaacaa aaaaagctat     58920
     taaagcggca aaagatgcat ttcctgattg ggcaaaaatg gaactagctg accgtgtcaa     58980
     attattacac aaaattgccg atttaatgga agaaaaagca gatacgttag caaaaattat     59040
     gacgcttgaa caaggtaaac cgctaaaaga atcaaaagga gaagtcttaa ctggcgtaga     59100
     aaacttccga ttcgctgcgg aagaagcaag aagattatat ggtgaaacaa tccctgctcc     59160
     aaacaatcat gcgtttatcg tgaaaaaaca accaattggc gtagttgctg ctattactcc     59220
     ttggaatttc ccaggtggta tggtgacgcg gaaacttgca ccggcgctgg caactgggaa     59280
     tacaattgta ttaaaacctt ctggagatac gccgctttcg gctctagcta tttttgaaat     59340
     ttttgaagaa gctggcttgc caaaaggcgt tgcaaatatc gttatgggta gctccaaaga     59400
     aatcggtgaa acgttaactg atagtgatga tgttcgtaaa ctaactttca ctggttccac     59460
     gaaagttggt caaacactct ttaaacaatc agccgataca ctgaaaaaaa tctcactcga     59520
     acttggtggt catgcgccat ttatcgtatt tgatgatgcg aatcttgatg ccgctgtaaa     59580
     tgatttagtt gctgcaaaat tccgcaacaa cggtcaagta tgcgtgtcac caaaccgaat     59640
     tttcgttgcc aaagaaatca aagaaaaatt cactaaagcg ttagttgcta aagtagaaca     59700
     attaaaagtt ggtaacggtt tagatgacgt gaatgttggt ccgcttatcc gcgaagatgc     59760
     gatagataaa attgataaac aacttaaaaa cgccacagaa aaaggtgcta aagtcttaac     59820
     tggtggcggt cgtctaacag gctctgacta tgataaagga aacttttata aacccactgt     59880
     cttagataat gttacccgta aaatggacat tttttatgaa gaaacatttg gtccagtaat     59940
     cccgctcatc acatttgaaa cggaagacga agcaatcgaa atggcgaatg acagtgaatt     60000
     cggtcttgct tcttacttct acactaaaga cttagcacgc gtagaaaaag tgggagcagc     60060
     actagaatac ggaatggtcg gagcaaatga aattgccatc tctaacccag aaactccatt     60120
     tggtggagta aaacattctg gtttcggtcg cgaaaacggt cattatggaa tggaagaata     60180
     catccaagtg aaattcatca acttaaaata tcgtgattaa aataagcaat ataacaaact     60240
     ccttcgcttc aagcggagga gttcttttta tgcagtttcc taccagtagg aaaaaaacat     60300
     atttgtaagc ggattcagcg gtttatataa taaaagtaag ttaaggaaag ggaggataca     60360
     aaatgaaaaa cattttactc atttgcggat caggagcttc tagtgggttt atggcagcag     60420
     cgattagaaa agcagcaaaa aaacgtggag aacaagtgac agtgaaagcg gccagtgagt     60480
     cacaaattga tgaaagaata aatgaaattg attacttatt aataggcccg cacttggctt     60540
     atatgctgga tgacttaaaa caaaaagtag ctgataaaga tgttttagta tcaattattc     60600
     cgcaagcaac ttatggcaca cttaacggcg aaaaagcact cgatctcatt ttaaatatgg     60660
     agggataaca ggatgaacaa caaagtgatg gattttatga caaataaatt tgctcccaaa     60720
     gtaaataaag ttgttaaaaa tccttgggta tcagcaattc aagatgcaat tatgtctgcg     60780
     cttccgctcg tttttgtcgg ttctttagtc accatcgttt cattacttaa aaatttattc     60840
     cctggtatgc ctgacttttc gatgataagt aatttttcct ttgggatgtt cggattagtt     60900
     gtagcatttc taattcccta ctatctgatg gagaaaaaag ggaatagcag tcaaaagttg     60960
     atttctggcg caactggact tgtactattt ttaatgctac tatttccaac tatttcagct     61020
     gacggggatg cagttttcat tttatctcga tttggcgcga ccgggatgtt cttatcaatc     61080
     acaactggat tatttgttgg ttgtgtgatg aactttgctg cgaagcgatc atttttcagt     61140
     gaagatacgc caattccgga ttttgttgtc gggtggttca atagtttact accaattaca     61200
     tttattttaa ttgttggttg gttaattacg gttcaattta acattgactt ctttgaagta     61260
     attgttgcag tgtttagccc actcgcgtca attgtacaat cttatccagg ctttgtgctt     61320
     tcggttttca ttccagcatt tctttataca ttcgggattt ctgggtgggt tatgatgccc     61380
     gcgatttacc cggtttatat ggcaggactc gcagaaaact cacaagctgt agcaaatgga     61440
     gcgagcgcat caaatatcgc aacacaagaa acagtttatg ctttaatttc aataggcggg     61500
     gtgggtacaa ccttatcact ctcgattatg atgctgattt taagtaaatc tttacagcta     61560
     aaagcaatcg gaaaagcagt catcgtccca tcaattttta acatcaacga accattattc     61620
     ttcggggcac caattgcctt caacccatac ttaatgattc caacgtggat taatgctttt     61680
     ctagtaccga gtattgctta ctttgtgatg tcaatgaatc tagtaagtat tcccgcgcaa     61740
     tcattcttac tttggtatat gccttaccca gtaacatctt acttagcaac acaagacttc     61800
     cgtggggtta ttgcttgttt agcaattatc gtcatcacat ggctcgtcta cttgccgttc     61860
     tttaaagcat acgacaactc attactcaaa caagaaaaat tagatgcagt cgaaacagag     61920
     aaagaaatgg taacaaattg attggaggaa ataaaatgtc agagcaagac tatgttgaag     61980
     aaacagatag cttaaatgag ctatccatga atatattaat ccatgctgga aatgcaagaa     62040
     atgatttagt gaaaggtctt aatcatttag aggaactaga gtttaacgaa gccgaggaat     62100
     ttatcgcctc tgccaaaaga gaaattgtca tcgcgcatag tctgcaaaca gatacacttc     62160
     aactagaagc atcaggcaat caaatccgtt attccacgct gttctgtcat gcacaagata     62220
     cactcatgac ggccaaaagt gaaatattaa tcggcgagca tatgctacgt ttattcaaaa     62280
     aaatgaccga acttacgaaa aaataggagg tacgagcatg tttgaaaatt atcaatttcc     62340
     gaaagacttc ttatggggtg gggccatcgc agccaaccaa gcagaaggcg catttaaagt     62400
     agatggaaaa ggaattagtt tagcagattt gcacaaatat cataaaggta aaacaaatga     62460
     tgagattagc gaggaacagc ataaaggagt aagtttagct gatatcaaag caagtataga     62520
     ggataaaata aactattatc cgaaacgcca cggtatcgat ttttatcaca cgtatccaga     62580
     agacttggag ttgcttgctg aaatgggttt taaaacattc cgaacttcac tggactggac     62640
     acggattttt ccaactggcg aagaaactga accaaatgaa gcgggattaa aatattatga     62700
     ccaattaatc gataaaatta tcgaacttgg catggagcca attattacga ttttacatta     62760
     cgaaactccc gtggaaattg ttttaaatca tggcgggtgg cacaatcgta aagtcattga     62820
     tttatttgag aagtacggca aaacagtact tgatcgctac aataaaaaag taaaatattg     62880
     gattgtcatt aaccaaatta atttaattca attcgaacca tttaactcta ctgcgattcc     62940
     atacgatgca gttgatgatt atttatccgc aacatatcaa gcagttcaca atcaatttgt     63000
     cgcaagtgca aaaatttatg aatacggaaa ggcactgaac cctgatttaa tgattggtac     63060
     aatgctagct gattgtacgg cctatccatt ctcatgcgat ccggatgata tcgtcctcgc     63120
     aatgaaacgt aatcgtatgg aatatttctt cgcagatgtg cagttccaag gcgaatatcc     63180
     acaatatgcg cttaactact tcgaagaaaa taatattcat attgaaatta cagaagaaga     63240
     caaagctatt ttgcaaaaaa ataccatgga ttatctagcg ctttcctatt attattcaca     63300
     aatggtagat tccaaaagaa atgatttgga cccagcttcg attacaccaa acccgcatct     63360
     taaagctaat ccgtggggct gggcagtcga tccaaaaggg ctatataatg ctctgtcaca     63420
     atactgggat agataccata aaccaattat tattgctgaa aatggtttcg gcatgtatga     63480
     caaattggaa aatggcgaaa tccacgatga ttaccgaatc gattatttat ccgcccatct     63540
     aaaagaaatg aaacgtgcta tgtatggtgg cgtagaaata atcgcatatt gcgcttgggg     63600
     accgattgat atcgtcagct gttcttccgc acaaatggaa aaaagatacg gtttcattta     63660
     cgttgattta gataacgaag gaaacggcac aggcaaaaga attaaaaaag acagcttttc     63720
     atggtataaa aaagtaatag agtctaatgg ggaagactta gaagcttaat gtaacagagc     63780
     gccagttgtg gtagttgata gctaatacaa ctggctttcg gtatataggg ggtaacaaaa     63840
     aatggatact caaaaagaaa tactagctta tttacacaaa caggaaaata agtgggttac     63900
     ctcaaatgag ttagcagctt tttgcgagtg tacgacacga accattcgca acaacatata     63960
     caaaattaac gaagtaacac cgaatttaat taattccaca aagcaaggct atcaaatcaa     64020
     tctgaatatt ccatttgaat ttcaatcgga aagtgatgta acagaacgaa agtcaaagct     64080
     cttacttgaa ttaattaaaa actccactaa aggcgttgac ctttttgagc tcgctgacat     64140
     tttatacatt tcagaagtga ccttaaaaaa agacattcaa caactaaaaa atgagttaaa     64200
     agaggctgat gtcaaaatcg tcatcagtaa agatcgcatc aaattaatcg gaaaagaacg     64260
     cgccaaacga aaatatatga tttccttact atacgaagaa ggaggatatc gtgaaagtat     64320
     caaaagtcgc attcaagaaa tgatagaatt tgtctctatc gacaaactgc aaaacatcgt     64380
     aaaagaagtt ttagcgcaag aatctattac aaccaatcaa tattcgatga tgaacattgt     64440
     cttacattac gccattagca tcgttcgaat ccaacaaggg aatacactca tcgaaacgca     64500
     aaaaacactc atccgaaaac actccaaaga atacgaaata tcgaaaaaaa ttgctaaaat     64560
     tctttcggaa gaataccaaa tccatttttc agaggcagaa acaaaacaac tcggactttt     64620
     atacgttggt cttcaaaatg aacaatctgc taacgccaat catggcgaac tggaccaatt     64680
     tgtagacaaa aaaatcatcg acgcacttaa aatcgtgctc gctaatgtgg aagaaactta     64740
     tctcattgac ctccaaaacg agcaactttt catcaaatta gctattcacg tccaaagtct     64800
     atactatcgc tcacgctaca aagcttatac aagaaattta agcctacttg atattaaaac     64860
     ttcctaccca gtaacttttg acattgccgt ttacatttct tctttgctac aagaaaaact     64920
     agcgattgac tttaacgaag atgaaatttc ctttatcgcg ctccatattg gctcttttct     64980
     agaaagtgaa aaccgtgatt atattcgctt ggaaatcggc cttcttgtcg acgattatca     65040
     tgatttaaga acaaatatgc tgaaaaaact gcgcgcacga tttgataatg aagctaccat     65100
     cgaactgata gaaaacgagg attacgaaga aaattttgat atcattttaa cgacaaaccg     65160
     agatgttgcc cttgaaaagg caggttcaat ttttatacat cctttactga cgaccaaaga     65220
     tatcaaaaaa atcactagcc gaatccaaac aaagaaaaaa atcttggaaa ataatataag     65280
     aggccagcaa attgatcgct atatcgttcg ttccctctac tcgaaccaaa ttgacccttc     65340
     agaacttaca cctgcaaaaa ttagagagca aatgatttct aaaatggaaa aacaaacctt     65400
     cgtcactcca gagtttaaag aaaaagttga aaaaagggaa caaatggcgc caacaagctt     65460
     tccgtccggt attgctatac cacattctat caagaatgat gccctccaaa gtggtgtatc     65520
     cataatgact ttgcaagaac caatttattg gaatgatgtc aaagtaaaaa taatcaccct     65580
     cgtcgccatc agcaaaaaag atgcaacaga gttcaacgat ttctttgaaa aatttgtaga     65640
     aattgtctcc gaaccaatca acaccaaacg tttatcaatg gtggaaagct tcgaggagtt     65700
     catccggaaa ctaaaaatga tgatggaaga aagtgaataa attcccacaa tgtaagccgt     65760
     gtatttcaaa cgacacggct tataaaggtt gaagtaacaa taaaattgcg ctataatata     65820
     accatcaaat gaaaaggagt gttatcttaa gccaatgaaa ttctaatcct gtattatatg     65880
     aaaaaatgaa gaaagctatc cacttctcgg atagaaacta ttttttcgga cgggattcgt     65940
     atgttcattt cgcatgataa ctcttgctat aggccttttt ggcgtagccc cgcggattcc     66000
     tctctgaaaa tattcaggag gttatttttt atgtctacaa tcgaaataaa tcaattaaaa     66060
     atagaagtag cagatagagt tttagtagaa attcctcatc tgctagttag taaaaaagca     66120
     agaatcggca tcatcggtca aaatggtcta ggaaaaacaa cactaatgga agtgattgct     66180
     ggcgctaaag aagcgacatc tggcacggtg actacacaag gaaaacttgc ttacatcaaa     66240
     caactttcca cggatacaag tacgaaaagc ggtggtgaaa aaacaagaaa agctactcaa     66300
     cacgcgatgc gccaaaatcc aagtgttctc ctagcagacg aaccaacaag caatcttgat     66360
     gtcgaaagcg tcaaacattt agaacgtcag tggagcgatt tccacggtgc gctcataatt     66420
     atctcgcatg accgcgcttt tttagatgca ctttgtacag aaatatggga aatcaaaaac     66480
     caaaaaattc acgtgtacaa aggaaactac cacgcgtatt tagaacaaaa acaacaacaa     66540
     gaaaaccaag cagaacttgc atacaaagaa tttaaaaaca aaaagaaaca attgcaagca     66600
     tctcaaacac atcacgaaat cgaagcaggt cgtatcgtta aacccgggaa acgcttaaac     66660
     aacaaagaag ccagcgcatt taaagctgga aaaggaacac aacaaaagaa acaacatagt     66720
     acaatcaaag ctttagaaaa acgaattgaa cggcttggta atgtcgaaaa accacataca     66780
     actaaaccaa tcaaaattat caccccagac aatcgcgtta taaaaaaagg caacacgata     66840
     ctaagtgcca aagaaacagc ttacgaaatt gccggacgaa aactatttga aacaaaagct     66900
     ttttctatta aagcagggga taaagtggcg ctgatcggtg aaaatgcaag tgggaaaact     66960
     acatttttaa aagaaataat ccaagaaaat cctaatctct tatgtaatcc ccaagcgaaa     67020
     attgcttatt tcgaccaaga attgaatgga ttaaaccaaa cgaaatccct attagaaaac     67080
     atctcggaaa ttagcgttca aaccaagcaa gtaaacagag aagtactagg tagtatgcat     67140
     tttaaagaaa gcgatttgca taaggaagtg cgcatgctct ctggcgggga acgagtgaag     67200
     ttgctgctca gtatgctcct tcttagtgac gccaatttct tgattcttga tgaaccaacc     67260
     aactatttgg atatctacgc aatggaagcg ctggaaacgt taatcaaaca atttgcgggg     67320
     acggtactct tcgtttctca tgatagaact tttgttaatc atgtggcaga acagttactt     67380
     gttatcgaaa ataatgaaat gaatttccac cggatgactt ttgcagaata tgaagaaagt     67440
     aaagcaccaa gccggattac agaagaagat aagttgattt tagaaatgcg tatgtcagaa     67500
     attgcggcaa aactcatgca acccaattta aagcccacag aaaaagccat actcgaacaa     67560
     gattatcaag aaattatcac aaaaagacag caatttagtt aaattgttgt ctttttattc     67620
     aagctaaata aaaaatatag tcatttatct tttacttgat ttctgcaaaa gataggctta     67680
     gaatcaaata gttattaaaa agagtaaaga aagaaggaat cccatgttta gtcatcttcc     67740
     ggattcattc ctacaaatga ataccatttt tatttctatt ttgattgagg cactgccgtt     67800
     tgtattaatt ggtgttttta ttgctggctt tattcaaatg tttatatctg aacaatttat     67860
     tgcccatgtt atcccaaaaa ataaatttct agcagtcatt gttggctcgc ttattggtgt     67920
     atttttccct tcctgtgaat gcggcattgt tcctatcgtt cgtaatttgc tggcgaaagg     67980
     tgtaccgctt catgccggaa tcgccttcat gctcacagcg ccgattatta atcctgtagt     68040
     attattttcg acctatgttg cgtttggaag cacctgggaa gttccgctgt tacgcgttgc     68100
     cggaagtctt gtagtggccc tcgttgtcgg aaatattatc gcttatttat ataaaggaac     68160
     tggactcaaa gatcgctttt taaagtatga agcagccagt gaaaaagtag ccgttccagc     68220
     cgcaaatata gcgcttgctg gcggccctgt agaaagtgcg acaactaatt ttcaagtatt     68280
     aacaactgaa gcggttcccg cagaagtagc gcatacaaac catgcgcacc atcatcacgg     68340
     cgaagagcac acgcatacaa aaatgacatt aagtcaaaaa atatggcata ccgtacagca     68400
     cgctgtcgat gaattctttt ctgtaggtaa ataccttgtg tttggggctt taattgccgc     68460
     agcgatgcaa acgtacatta aaacatccac gctcgtgtca attggacatg ggccgatttt     68520
     atcaatctta cttatgatgg ttcttgcttt tgtattatca ctgtgctctg aagcagatgc     68580
     ctttattggc gcttctttcc gtagtgtttt ctctacacaa tccatcgttg catttttagt     68640
     gtttggcccg atgcttgata ttaaaaattt aatgatgatg ttaggagcat ttaaagcaaa     68700
     atttgtttta ttaattgtta ctagtgtaac gattgttgtc tttttatacg ccctagttat     68760
     ttaaccgaaa gtaggtgagc agatgtttcg cgtttttatt ttatttggat ttggttttta     68820
     tttgatgcag ctacatattt ctggtgacat cagtaaatat attaatatga agtacgctta     68880
     tttatctttt tccgcgatga ttgccgcatt tttacttgcg attattcagc tcattatggt     68940
     ttttcgtgat gaagatattg gtgcaaaaac agaacatatg gggcatacac atgatggcga     69000
     gaatactatt ttaaaaaaaa tcatggtgta tggtttactt tcttacgctt taatcgctgg     69060
     tttccttttc ccagtagcaa cgcttgattc aacgatagtt tctgctaaag gttttcattt     69120
     tccgaaaaac aatgcagctg gcgacgaccc atacgctcaa aatcagtttt taagaccaga     69180
     cacgagtggc tattttggag aaacggatta tgaaaaaatg atggcgaaag aaaaagccga     69240
     aatcatcgat caaaatccaa tcaaagtcaa tgatagtaat tacttaatga cgatggaaat     69300
     tctttataat tatccagggg agtttactgg caaacaaatc gagtttactg gttttgttta     69360
     taatgatgaa gtgaccaaag ataataactt attcttgttc cgttttggaa ttattcactg     69420
     tgttgccgat tcaggtgtgt tcggaatgct cgttcaaatg ccggaaaaga ccaatttaaa     69480
     aaacgataca tggcttacag taaaaggaac catcacccaa gaatattatt ctccgttcaa     69540
     aatgaacatc ccgtctgtac aagtagaaag ctataaagaa gtagcaaaac caaaatcagt     69600
     ttatgtctat cgtaaatatt aaatcgctac ttgcggattt atgcagcttg cgttatcctt     69660
     aaataaagct gtttacgttt tcacgaatga attaaaggat ggaacattga atgaatgatt     69720
     acaaccacta ctttcatttc ccacgagaag aatggcgcaa gctggaagtg agtaaggacc     69780
     aaattttaac tgcagaggaa ctggaagaaa tacgtggttt aaatgaccga atttctttac     69840
     aagacatctc tgaaatctat ttaccactaa taaaactaat tgcgattcaa taccatgaag     69900
     cgatttttat tcatggcgaa aaaatggaat acttgaagaa aaaagaatcg cgtgcaccat     69960
     ttattattgc attagctgga agtgtggctg ttgggaaaag tacgacagca cgtgttttca     70020
     aattaatgct tgatcgctgg ttctccaaaa ctagacaagt agagcttgta acgacagacg     70080
     gctttcttta ccctaacaaa gttctagaag agcgcggtat catggacaaa aaaggcttcc     70140
     ctgaaagcta cgaccgcgac cgttttgcta agtttttaac cgacttaaaa gcaaataaag     70200
     aagatgtcga aattccactt tattcgcatt tcacttatga tgttttagac gaaactcgcg     70260
     tgattcataa tccagatatc gttattattg aaggaatcaa tgttcttcaa gctgatcaac     70320
     atgagagcct gtttccaagt gacttttttg atttctcggt ttacatggat gccaatgaag     70380
     cggatattaa gaaatggtat ttagagcgtt tcttcatgct tcgcgaaaca gctttccaag     70440
     atgaaagttc ttatttccac ccatatacta aaattagcaa acaagaagca gaaacatttg     70500
     cactcggggt ttgggataca atcaacggcg tcaacttaaa agaaaacatt gagaaaacaa     70560
     aatatcgagc cgacttagtt cttcaaaaag gcacagatca tctcatttca gacatttatt     70620
     tacgcaaata accgaatgca aagagaagga aacttcttga tgcgttcggt tttttcttta     70680
     cattggagaa aatccgagta caataggaag tgagtaatca ctcattttga gaaagggagg     70740
     gaaagcaatg tcagaaatag cgattaaagt ttctaattta gatgtgaaaa ttggaaagaa     70800
     acaaatctta accgatatga ctctcgaaat agaaaagggc gagatatttg gcttaatagg     70860
     accatccggt gcggggaaaa caacgctcgt taaaaccatc attgggatgg aaaaagcaac     70920
     gattggcaca accgaagtgc taggaaaagt aatgcctaat ttacccgtca ttagtaaaat     70980
     tggatatatg gcccaatcag acgcacttta tactgattta acagccaaag aaaacttgga     71040
     ttttttcgct tcactatatt ccatcaaagg tgctgccaag aaagatcgaa tgaattatgc     71100
     agctactcta gttaatttac aacaagattt aaccaaaaag gtaaacaatt attcaggagg     71160
     aatgaagcgc aggctttcac ttgccatttc tgtacttgct gacccagatg tcctaatcta     71220
     gatgagccaa cagtcggcat tgatccagaa ctaagaaaaa caatttggga agagctagat     71280
     gatctaaaag cgaacggtaa atgcatcctt gtgacgacac acgtgatgga tgaagccgaa     71340
     aaatgcgata gacttgcaat gataagaaat ggggaaataa tcgctgtagg gaccccacaa     71400
     gagctctcaa gcaaaacgtc atctggtaag ctagaagatg cctttttaga gtttggaggg     71460
     aagcactaat gcgaatactt gcaatcgtca aacgcatcat taaccaattt cgccgcgaca     71520
     aacgtacgct tgccctaatg tttcttgcgc cactgttact tattacgcta ctcacttatt     71580
     tattcgaagg tgacacagtg aagccagttg ttggtgtaag cggactttct gattccatgg     71640
     taaaagaact gaaagcaaac gatttaacca tcaaaaccta ttcagaaaat accgatgtaa     71700
     ccgctaaaat aaaagatgcc aaccttgacg cttttttcaa acaaaacggt gaaaaactcg     71760
     aagtcaccta tgaaaatagt gaaccaagct tgagtaaaga aatcggatta aaattacaaa     71820
     aagcattgat gaccgagcaa caagcacaag caaagaacca agcaaaggca acaggagaag     71880
     ctttagctaa agctggaatt gatccaaaca gtattccaac acttaccgcc agtccggaga     71940
     aacttacact ctcaacagat tacgtttacg gcgataaaga tactagcttt ttcgacacaa     72000
     ttagcccgat tttcattggc tttttcgtat tcttcttcgt atttctgatt gccggtattt     72060
     ctttcttgag agaacgaaca acaggtacgc ttgaacgact catggcaacc ccaattaaac     72120
     gtatcgaact tgaattaggg tatttgatag gctttggtat ttttgcgtta ctacagtcta     72180
     tcttagtcgc agttttctcc atccaagtgc ttggcatgat gcaaaacggc tccttattct     72240
     atgtattact aattacatta acactcggca tggtttcttt agcgctagga attttacttt     72300
     ctacttttgc aaataatgaa tttcaaatcg ttcaatttat tcctatcgtt atcgtgccac     72360
     aagtgttatt ttgtgggatt ttcccgctcg atgggatggc agattggctc gtgtggattg     72420
     cccacataat gccgctttac tacggcgcaa atgcactaac atccatcatg gtaaaaggag     72480
     aaggattcgc ttcgtttgca actgatttct atattttact aggatttgtg ctcgtatttg     72540
     ttatattaaa tatttttgct ttgaaaaaat accgcaaagt ttaaatgaaa caggaggaga     72600
     taagacgtgg atgcagaagg agatattatc cgtcaaatgc ttgatttaac ggaaaaagaa     72660
     accaagatga gtgaaaagca gcgccgaatt gtcgctgctt ccatcgaact atttgctgaa     72720
     aaaggttatg ctgggacttc aacgaatgaa attgctaaaa aagcaggagt cgcagaagga     72780
     actattttta ggcactataa aacaaaaaaa gatttattaa tggctatcac gatgccaacg     72840
     ctcatcggtg gggtgatacc atttttagca caaagttttg tcaaagaagt atttgaaagt     72900
     gagtatccgg attttcagtc atttattcgg gaaatcatcg ttaatcgctt tgattttgcc     72960
     aaagaaaatg gtaaggtcat caaaatttac tttatggaac tgttttatca tgatgagtta     73020
     agaatacaat tttcagaaat ttttatgaca catgtcaaag ggcaatttga tcaaatgatt     73080
     gattattata aagagcgcgg agaaatagtt gatatgccga atagcacgat tatgcgcgcc     73140
     cttatcacga atattgtcgg ttttatgcta acaaggtttg tcgttatgcc tgatgtggag     73200
     tgggatgacg caaaagaaat tgacgatacg gttgcatata ttatgcgagg tttaggcaaa     73260
     taaaaaagag tccagatatt ctggactctt tttttattta tcggatgaat cagttgattt     73320
     tttcttattg taattgtatt tacttggatc cacttttttg aaaccatcag gagcatagaa     73380
     acgcaacaag tcaccttgta gtacagaatc tgaaagctct aattcttttg ctactttttc     73440
     tttggtttct ttcatttctt ttgtttccgt agcaatcggt tccccagttt gttgattata     73500
     catgttacca ccaatcattg aataggtagg agttatataa tcaccgtttc ggaatggaac     73560
     aagttgttta tggtctttag aaagtaaatc tgtaccaaat tgcaagtact ctttattatc     73620
     aacaccaagt aagtgaagta atgtaggaag taggtcaact tggccaccgt attgttcttg     73680
     aacgccacct tgaacaccgg gaacgtgaat cattaaagga acacgttgcg cttgggcatt     73740
     ttcaaaagtg ttgtaatctt taccaagaat ttttgtcatt gcttcttcat ggttgtcgga     73800
     aataccataa tggtcaccgt acatgataat gacagagtta tcgtaaagac cagatttctt     73860
     caagtaatca acaaagctct tcacagattc gtctaaataa cgagctgttt ggaaatacgt     73920
     atctacagat gaatcgcctg ttgttgccgg agcaatcgaa gcatctttct catcaattgg     73980
     ataagggaaa tggttcgtaa gcgtaataaa tttcgtgtag aacggttgtt gtaatgacga     74040
     tagatattct tcggactctt taaagaatgg tttatcttta agtccgtagt tagaaacatc     74100
     tgcttcgttc atatcatagt aactggcatc aaagaaattg tcgtaaccga attgtttata     74160
     aatttcatca cgattccaga agctcttata gttaccatgg aatacagcac ttgtatagcc     74220
     ttgttggcct aaaatagcag atgcagattc ataggtgttt tgccctttag tagtaaaggc     74280
     agaaccttga ggcaggccgt aaagcgagtt ctcaagtaac atttcggagt cagctgtttt     74340
     cccttgtcca gtttggtgga agaagtttgt aaagcttagt gtattttggt ctttaaagaa     74400
     agagttaata aacggcgtta cttcttctcc atttaatttg taattcacta ggaattgttg     74460
     gaaactctct aaatgaatat aaatgacgtt tttgcctttt gctttaccga aatattccgg     74520
     gtttggcgcg gcatatttgg atttagtata gtttaaaact tcagtaacat cactactatc     74580
     agcaagtgca cgctgggtag atgattcagt acttttcact gcgtcgtaga tttggtagtt     74640
     agtcatacct agatatttaa caatataatt tctatcaaat gttcttgtta aaagttgtgg     74700
     acgatcaatt tctgcaagtc ccaaattccc aaagaacatt gcgataccaa gcgttagaac     74760
     cccaactact tttctcgcac gaatacgggc tgttttgttt ggttttacaa agcggaaagc     74820
     aagtagtgca attaaaatga taatatccgc gaagtaaata atatcgtgcc agctgagtaa     74880
     cgctgtgata ctacttccca tgtcgcccat gttttgcatt tgttttgcgt ttagattcgg     74940
     aagcgtaatg aaatcactaa agaatctata atatacaata tttgcgtaaa gaataaaact     75000
     cattaaaaag tcaatgacga taatccaaat gaatgaacga cgtcccttgg caaagagcgc     75060
     aagacccata aagaaaatgg ccccacttaa tggattaatg aacagcaaaa tttgctgcat     75120
     cagattttct atgccaagtt taaattcaag ttgatatgcg atatacgttt ttagccaata     75180
     aagaatgacg gctagaacaa aaaatccata attcttgctt aaaaacgttt ggatttttat     75240
     tttccaatcc ttcatgaaac acctctccta cacactattt gctcgtttta tttgttattt     75300
     tgaaatgaaa aaaagaagct gtattatgta acaagaaaca attcatacag cacccacttt     75360
     aacataattc taacacaaga ttaataaaag gcaagctata acctatacgt ctgaagtagg     75420
     atttaagagg aaataggctg atataactag tcaaaaaaga accatttgga atggaagtct     75480
     gctagaataa aaagaaaaca ttgaggtatg aaatggaagc gatgattacg aaagaatttt     75540
     ttgaaagtaa gacgacaatc gaattagcga gagatattct gggtatgcgt ctcgtacatc     75600
     aaacgaatga gggacttcta tctggactaa tagtggaaac agaagcgtac ctcggggcta     75660
     cagacatggc ggcacatagt tttcaaaatt tacgaacgaa acgaacagaa gtaatgtttt     75720
     catccccagg aacaatctat atgtaccaaa tgcatcgcca agtgttgctt aattttataa     75780
     ccatgccaaa aggaattcca gaagccattc taatacgagc catcgaacct gacgaacaag     75840
     ccaaacagca aatgacacaa aatcgtcacg ggaaaactgg ttatgaactt accaatggcc     75900
     ccggaaaatt aacgcaagct ttaggattaa gtatgcaaga ttacgggaaa actctttttg     75960
     atagtaacat ttggttagaa gaggcaaaat tgccgcattt aatagaagca actaatcgaa     76020
     taggagtacc taataaagga attgcaaccc attatcctct taggtttact gtgaagggaa     76080
     gcccatatat ttctgggcaa cgaaaaaata gcattcggac tggtatttgg aaataacttt     76140
     acaattttgt cacaggtagg gaaaatagtt ttatcaagac actgattttc tttgcttcat     76200
     aagaagagct actatataat gaaatagtta caaggaggaa tcatatgtta aagaaaacaa     76260
     ttgcaataat aattttaatc atcgggctac tattaatttt ttccccattc atcaaaaacg     76320
     gcattgtgaa atacatgagt ggtcatgaaa caatcgagca atataaagca tcagatataa     76380
     agaaaaataa tgaaaaagac gctacatttg attttgaaag tgttcagcta ccttctatga     76440
     catctgttat taaaggagcg gcaaattacg acaaagatgc agtcgttggt tctatcgcag     76500
     ttccatctgt agacgttaac ctattagttt tcaagggaac aaatacagct aatttgctag     76560
     ctggagcaac aactatgcgt tctgatcaag taatgggtaa aggtaattat ccgctagcag     76620
     gtcaccatat gcgtgatgag tctatgttgt ttggcccaat aatgaaagtg aaaaaaggcg     76680
     acaagattta tctaacggat cttgaaaatt tatacgaata tacagttact gaaacaaaaa     76740
     caattgatga aacagaagta agcgttattg ataatacgaa agatgctaga ataacgctga     76800
     ttacttgtga taaaccaact gaaacaacga aacgttttgt cgcagttggt gagctagaaa     76860
     aaacggaaaa gctaacaaaa gaactagaga ataaatattt ccctagtaaa taatgaggaa     76920
     aaaaagacag cggattttct aagctgtctt ttttctggat aatttctcct tttattataa     76980
     atgttgtatc atataaatga ggtttacttt gagaaaggaa gtgcagtgat gaaactaacc     77040
     gtttttggac attggggtgg ctacccggta gcaaatgaag gcacatctag ttatttgctg     77100
     gaagaagctg gatttaagct gttaattgat gttggtgcaa gtgctgtttc tattatgcaa     77160
     aactatattg atcctgatga tattgatgcg gcaataattt ctcattacca tccagatcat     77220
     gtagcagacg taggaatttt gcagcacatt cgattgctct cccaaaaaaa agaaaaaccg     77280
     ccagtcttgc cgatttatgg gcataaagaa gatgaacgtg gctattctta tttagaaatg     77340
     gcgaatgtaa caaaggtaat cgaatataaa gcagacgata cactcgaaat agggccgttt     77400
     aaagtaactt tcttaaaaac gattcatccg gtaccttgct atgcaatgag aatagaagcg     77460
     gctggcaaag ttttcgtata cacagcagat agcgcttatc aagatagctt tattcctttt     77520
     gcagagagtg cggatttatt agtaacagac accaattttt tccatgacct agctggaaaa     77580
     acaaaagtgc atatggcaag tacagaagtt gcaaaaattg ccaaagaagc caatgtgaaa     77640
     tcattactcc ttagtcattt acccgaagtt ggcgatttag aagttctaaa acaagaagca     77700
     gcggctattt acaaaggaga aattgcgctc gcttccaaag gattcacgaa aacattttaa     77760
     tatagaagaa aaggggtagg agtatgtatt ttatagataa caataatgag aaagatccac     77820
     gtattaattt agcggtggag gaatttattt taacagaatt aaatctggat gagcctgtgc     77880
     tgttatttta tattaataag ccatcgatta tcattgggcg caaccaaaat acagtagaag     77940
     aaattgatac agagtatgtg gagaaaaatg atgtcatcgt tgtgcgcaga ctttctggtg     78000
     gcggcgcggt ttatcacgat gaaggaaact taaatttcag ttttatcacg gaagatgatg     78060
     gagagtcttt ccataatttt gcgaaattca cacaaccgat tgtggaagct ctgaaacgtt     78120
     taggcgtcaa tgcggaacta aaagggcgta atgatttatt gattgatggc ttcaaagttt     78180
     ccggtaatgc gcaatttgca acaaaaggga aaatgttctc acacggaaca ttaatgtatg     78240
     atttgaactt agataatgtt gctgcatcgc taaaaccacg taaagataaa atcgaatcaa     78300
     aaggaattaa gtctgttcgt agtcgtgtag cgaatatttc tgatttcatg gatcaagaaa     78360
     tgacaaccga ggagtttcga gatttactct tactttatat ttttggcgtg gaaaaagtag     78420
     aagacgtgaa agaatacaaa ctaactgccg cagattggga aaaaatccac gaaatctctg     78480
     ctaaacgtta tggtaactgg gactggaatt atgggaaatc gccaaaattt gacttaacac     78540
     gtacaaaacg tttcccagtt ggtgcagtag acgttcgctt gaatgtccaa aaaggtgtga     78600
     ttacagatat caagattttt ggtgacttct tcggcgttaa aaatgtggca gatatcgagg     78660
     agaaattagt taatactact tataaacgtg aagttttggc tgaggcttta gtagatatag     78720
     acgtaaaaga atactttggt aatattacta aagatgaatt tttagattta ctttattaaa     78780
     aaaatggaaa gcacgcggga tgcgtgcttt ccattttttt atttgagatt ttttcctgac     78840
     atccagtgtt ctaatcgttt tccaacaaac cataaaataa cgacagaaac agctaatata     78900
     gccagtttaa gcggttggtg aatcaagtct acgaaatcat agccaatata gctaatagcg     78960
     aatactttta ttaatttccc acctacaagc gctaatataa attgatacac tttaatttta     79020
     gagagacctg caacgatatt tacggcagaa gatggagtaa aaggcattac aagtaaaata     79080
     aaaatcggac taaaaccatg tctatcaatc cattccatta ctcgtttaat ttgtttatga     79140
     cctgaaataa agcgtaaaaa acgagtttgc ccaaattttc gtgctaacaa aaatacgcat     79200
     aaactaccag caatggctgc aataacagag attaaaaagc caatgagtag tccatatgca     79260
     tttacgttca ctacaacgaa aactataaat ggtaaaaatg gtaaaaacgc ttcaataaaa     79320
     ggtaagagaa aagctaaaag tggacctaga tttcggtact cacttagcca gtacattaaa     79380
     ttatcataag aaaagaaatt catcatatcc tgccaaaatg tcataagcaa gcctccagtg     79440
     gtctttaact acataattta ttttctcaca taaaaatgat aaagcgctaa taaaacagct     79500
     tgaatatagt taaaatccta gcattttaac caggatttta actaaatatt atttttggtc     79560
     agaaaaacca ttttcttctt ctataatata aagcggacga tcttttactt catcataaat     79620
     tcgaccaatg tattcaccaa ttaatcccag aatgaaaaga attgtccctc caaaaacaag     79680
     ttgtaaaata ataatagaag tccagcccgt taatgttgta tcagtaaaga atcgttggaa     79740
     gagcactata attaagtaaa taaagccaat aaatgctgtt aaaacgccaa gatagcttgc     79800
     aagttttaag ggccgataag aaaaagaggt gataccatct atagataatt taatcatttt     79860
     tttgagtgga tattttgttt ctccagccgc gcgttcatct cgttcataat gaagggctgt     79920
     ttgtttaaag ccaagccaac ttacttggcc acgaacaaag gggtttttct catgtaagcc     79980
     agcgagttcg cgacaaactt gcgcatccat aagccggaaa tcccctgtat caactggaat     80040
     attgatatct gttaatttag ttaaaatacg ataaaaaaga gaagcgcttt gttttttaaa     80100
     gaaagtctcg ccttttcgtt tgaggcgctg tgcatataca acttgatagc cttctttcca     80160
     tttctcaacc atttcaataa ttaattcagg aggatcttgt aaatctgcat caattacaat     80220
     aacagcttta ccgtgagcat aattggcacc ggcagtaata gcaatctgat gcccaaaatt     80280
     cctcgaaaaa tggattgctt ttacacaact atcttctgcg cttaactttt gcaacatact     80340
     cttcgtgaga tctcgactac catcatttac aaaaataatt tcgtagggac cgtcaagtgt     80400
     ttgcatgact tctgtaagcc gtttatatgt ttttagtaga acttcttctt cattaaaaac     80460
     agggactata caggagtatt caatactttt ttccatactt cacacatcct taattaagtt     80520
     gataaagtgt cccgccacta gtaccattta tccgttagca ttaaattcga tgttgtatga     80580
     agcactagaa gtagtaccat cgttatcaga agtaaaaaca tttttgtaaa agtcaacgat     80640
     cgctttacca tttcttctat ccattttacc acatctgagt cagaagcttt accattgaga     80700
     gaagataaat atattttata tcgtgattct tatttatttg agtaaaaaag ctttaaagaa     80760
     aacaaatatt tattttttat aaagaaattc cagaaaaagc cttgtcaaaa catacataga     80820
     atggtattat ataaaagttg ttaaaacact aagaactact tactatgcgg gtgtagttta     80880
     gtggtaaaac tacagccttc caagctgttg tcgtgggttc gattcccatc acccgcttta     80940
     tatttttata aatcctgtta tcaacgcagt gtttcgacct ttttaagcga agcattgcgt     81000
     ttattttatt gcctgaaaat aaggagagag gggatgatgg tagtgaagca gaaagctgat     81060
     tatgcagcgt taaaagaaga gctcattgct tatgcatatg aaattggtat tcaaaaaatt     81120
     ggtttcacga cagcggaccc ttttttattt ttaaaagaac gattattaga ggcggaagcg     81180
     ctggaccttt ttacgggatt tgaacatcca gtaattgaag agcgagttta tcctgaactt     81240
     atcttcaaag aacctcagtc gattatcgcc attgcacttg cttatccgtc taaattaaaa     81300
     gaagcacctg tgagtaaaaa aggagctagg cgaggtgtgt ttgccagagc ttcttgggga     81360
     attgattacc ataccgtttt gcgagaaaaa ttagcgctac tcgaaacttt tttaattgag     81420
     cgattacctg atgtacgaat gaaatcgatg gtggatacag gggaattatc ggatgtagct     81480
     gtagcagaac gagcgggaat aggctggcgg gggaaaaata ccttgctaat aacgcctgaa     81540
     tacggctcgt gggtttattt aggtgagatg ataaccaata ttccctttga accagatacc     81600
     cctgctagcg acttgtgtgg aagctgtaat caatgtgtta aagcctgtcc aacgggttcc     81660
     ttactagggg aagggaaaat gaatccgaaa atatgtttaa gttatttgac gcaaacaaaa     81720
     gactttctag atgaaaaata tcgcgaagtg ttgcataatc gtttgtatgg ttgtgatact     81780
     tgtcaggtag tctgtccgta taatcgtggg catgatttcc actttcatga agaaatggag     81840
     cctgatccag agcttgttcg accagaatta aaaccactat tacacatttc caatcgcgct     81900
     tttaaagaac agtttggcga tatggcgggt tcgtggcgtg ggaagaagcc cattcagcga     81960
     aatgccatca tcattctagc gcggtataaa gataaaacag ctgtaccaga cttaatcgac     82020
     tgtttgcaaa acgatccaag accagtcatc cgaggaactg ccggctgggc gctacgaaaa     82080
     attggtggaa gagatgccga agaagctgtc gagcgagcac ttcaaaccga acaagatgta     82140
     caagtattac aagaattaac agccatacca aattaataga aaccaggtga aaagaaatgc     82200
     caaaccatat cgtactatac caaccagaaa taccagcgaa taccggaaat atctccagaa     82260
     catgtgccgg gacagatact tacttacatt taatccgtcc acttggtttt tcaacagacg     82320
     ataaaatgtt aaaacgtgct ggacttgatt actgggataa cgtgaaactt tcctattacg     82380
     attctctaga tgaattcttc gagaaaaatg aaggcggaga attttattac attaccaaat     82440
     ttggtcgtca tgtttatagc gatatcgatt atagtgatac aaacaaagat tatttcttcg     82500
     tttttggaaa agaaacgact ggattgccag atgcgctttt acaagagaat gaagaaaatt     82560
     gtttgcgtat tccaatgact gaccatattc gttcattgaa tttatctaat acagcagcaa     82620
     ttttagctta tgaagcgtta cgtcagcaga attttggtgc acttttacaa gaaccgaatt     82680
     acgatcgaaa aatttttcaa gactaagggg gagttaggat gaatcaggcg atagatgcca     82740
     ttctgggaca ttactcagtg cgaaaatttg aagacaagga cttaacggaa gaagcgttga     82800
     ccttacttat caagagtgca caagccgcat ctacatccag ttttgttcaa gcatactcca     82860
     tcatcggaat aacagataaa gatattcggg aacaaatctc agccattgca ggaaatcaac     82920
     catatacagt acaaactgga caactattta ttttcgttgc tgatttagct cgtcatcacg     82980
     ccatcttaga agaacaccaa gtagacacag cggcactgga aacttcagaa aaatggcttg     83040
     tttccgtcat agatgcggca cttgctgcgc aaaatatggc tatcgcggca gaatcattag     83100
     gacttggtat ttgctttatt ggcggtattc gtaacgatgt cgaacaaatc gccgaaatac     83160
     tggatttacc accatatacg atgccgttat ttggtctaac aattggtcat ccagttgcta     83220
     acaaagaaaa agcgaaaccg agattacctc aagatttggt atatcacgaa aatagttaca     83280
     aaaaaatgaa tccagaaact ttagcagaat acgataaaca aataaaaact tactacaatg     83340
     aacgaacagc aggtaaacga gtagaaggct ggtccgaaca aattgcccgc ggacttggaa     83400
     gaccaagccg tttagattta aaagcatttt tagaaaaaca acatttaaat caaaaataaa     83460
     agaacggtac ggcgcattat cgtaatgcgc cgtaccgttc tttttcagtt atttacgttt     83520
     atttctagcc atttgaatta agttccaaat aacgagtatt aaaacgatta ctagcaagat     83580
     attaattaat ccacccgcaa tatggaaaat aattccaagt aaccaaactg ctaataaaac     83640
     aacgattatt ccccaaataa ttcctaacat atataaaaac ctctttctgc acttttgatt     83700
     gtactcttat atattcccgt gagatcagtc tttaaacata tttgggataa aaacagacta     83760
     tttttttgta atataggcta aaagagcttt cactccctca gttaccatgc gctcggtttc     83820
     atcaaaatca ccagtataat aagggtcggg gatatcttta tcttcttgac ctgagacaaa     83880
     agacatcagc gaacgaatga ttacatctgg attgttatta agggcattta aatcagctaa     83940
     attttgctga tccatcccga taataaaatc tgcttcttta aaatcagcat cagaaatttt     84000
     tcgagcacgc atcgcttggt aatcaacacc atgctttttc aacacttcct gcgtcccgcg     84060
     atgtggaggc ttacctaaat tccacgttcc agttgctgca gaatcaatct ttatttcatc     84120
     cgtcagccca gcattagcca cttcttttcg aaataacccc tcagccatgg gggaacgaca     84180
     aatatttcct aaacatacaa aaactacttt taccaattga attcctcctt agttccattc     84240
     tttatataat tcagccacag tcactttatt tattccatca cacgctttaa gtcggacgaa     84300
     aatttgctcc acaagctcag gtacgagttt tcttcggaaa taaagcaatt gattttcaaa     84360
     taaactacag acaactaaat tatacgggat ttcttgtttt tcaagtaatc ctaaaagtgt     84420
     ctctaaatac cactttttat ctggataatc ttctaatagt tccagtaact gttttgtttt     84480
     ttgaacatta ctagcagcaa gaatttgatt taattttttt atcggaaaat gttctgccaa     84540
     atcaatagga aaagggctaa agtacagttt ctctaaaaat gcagcaagat tttcagcaac     84600
     aacaagtgtt tgtaaagttt caaaatcaac ataaataata cttggttctg acgtattatc     84660
     catataagaa aaaccaagat agcgcgattc atcccggtga aagtaaactt gctttcctgc     84720
     gagctcaaca tctttttgtt ctggaatatc cgttaataat tcatccaaac ttcccaaata     84780
     atagatctcg ccaaaatcca gcccgtaaga agtaggttcc gaagtcggga aatgattttt     84840
     gcgaatcaaa ccaccatttt gcttcaatag caattgttta tagtcagttg gcaaaatcaa     84900
     gccaatctca gtttcttttt catgtatagt ttgttcagtt gcgcctttat tttcgttttc     84960
     cacccaaatc gtcatcttct tcaactcctc cctgtattat cctaaaaaaa gcgatatagc     85020
     gcaaacaaaa gaacatagct aggaataatt cctaactatg ttccaaaata tcacttcaaa     85080
     agatcttgat aataactatt ttcattccgc gcatcaaact tcgccgttaa agtttccgtc     85140
     atttccacca aatcagcttc tttttcccgg tcgaaaagag aataggctgc ttgtaggaat     85200
     aagagacgat ccattccgct ttctgcttga agaacaattt ccttatgcac atcaagaact     85260
     tcgcgtgctt tttctgtttg gtttgtcttc actagatatt taagcaaata gctgagtggt     85320
     tggattaagg cgatctgttt ttccacaagt ggataacctt tatcgaagca ttcttgcgcc     85380
     atctccgcat caccaagttc caaataaaca agcgccatat ctccataagt ataatgaggg     85440
     acttcggcac aggctaattt tccattaata atcggggtag ctgtttcctt ggctttttca     85500
     taatctttaa tgaagtaata ataactggct tgagcacatg tttcgcaagc acggcagtca     85560
     tttaaatgat cagcttctgt gttattccat ttaacaaaga attgtttagc tttttccact     85620
     tcacccatcc acatagcatc aagcgtacaa actttataat aagggcgcag tgagtaattt     85680
     tgctgctcga atttcagctt catatcctct aaaagcctgt taatttgtgt ttttggtatt     85740
     tcatcaaatg tagcaatctg ttcgctaatc catttataat tccaaaaaag atcgaaggtg     85800
     tctacagaag aatcgtcgtc ttcccatttt ttcactaacc aactaaatgc tttcagttgt     85860
     tttttaggaa agccagccgt taaacaagtt tctatcaata attccctggc ttcaacagcg     85920
     ctttcgacat cgttatacat atcggcactt gcaatagctt gttccaataa ttttactttt     85980
     tcagaagtat cgtccattcc ccaagcttct tctagtgcat tcaaataatc cattgtcatc     86040
     ctccaatagc attttgtaaa acttttagta agcttctaaa cgattttgat aataattatt     86100
     ttcattacga gcgtcaaact tcgccgttaa agcttccgtc atttccacca aatcagcttc     86160
     tttttcccga tcaaaaagag ggtaggctgc ttgtaagaaa ataagacggt ctaaaccagc     86220
     ctcggcttgg agaacgattt ccagattcgt atcaaggact tcacgcgctt tttccgtttg     86280
     gtttgtagat actaaatatc taagcaattg gccaagtggc ggaattaagg aaatttgttt     86340
     ttccacaagc ggataacctt tatcaaaaca ttcttgcgcc atttttgcat cgcccaagtc     86400
     taaataagca agtgccatat ttccgtaggt taaatgaggg acttcagcgc agcgctgttt     86460
     cccatcaata attggtttcg ctttttcctt ggctttttca taatcttgca caaaacaata     86520
     ataatttact tgatcatttc tttcacaagc agggcagtca tttaaataat ctgcttttgt     86580
     agtgctccat ttgttatata gttcttttgc tttttccaca tcacccatcc gcattgctgc     86640
     aagagtacat actttatagt aaggtcgtag cgaataattt tcttgttcga attttacttt     86700
     catatcattt aaaagcccat caatttgagc tttcgaaact tcatcaaacg ttggaacatg     86760
     ttcgctaatc catttatatt tccaaagaag atcttctgag tcaatataga catcgttatc     86820
     ttcgtcttcc catttgctaa ttaaccaact aaaagcttgt agctgttttt ttggaaagcc     86880
     gacagttaaa caagtttcaa ttagcatatc gcgagcctca atgccacttt ctacatcatt     86940
     atgcgcatct gcaccagtaa tgattcgttc taaaacttta attttttcag gtgtatcttc     87000
     catgccccaa actgtttgtg tatcatttaa gtaatccatc attttgcctc ctatagcatc     87060
     tctaagattc gtaacatatt ttggttcatt aataccattt ctttccgttt aagcggataa     87120
     tgccctaata gtaaggcttg gatataaagt acattcacaa tcacagacaa ttctttcact     87180
     gttttttcag aagtgaaaag tcgtttaatc agctcattat ctaaatttaa atacaagtga     87240
     gcgagcgggg caggttcttg ttctttttga atgctctcta aaatatcact gaatacggaa     87300
     gttgtttctt ctactgcgcg ttctagttcg cgtaactctt gtgttgccgt agaatggatg     87360
     aaaataattg gtaaatcttt tggctcaaaa tgtttgatta acacatcggt gtcaaactca     87420
     gccatcatac tattcatttc tgtcaaaata ggttggtacg cttgtttttc atccgctgtc     87480
     attggacgta atttatccgt catttcttcc ggctggatta aaacaaattc agttccttcc     87540
     acaaaataac ttaactgcgc taaaattggc gagtcgtagg aataaccacc attaataagt     87600
     gtcatgccgc ttgatctcgc aatatcctta atttgtctaa aatcatcgac cgagtaagtg     87660
     taatagatga cgtcattttt agcgataata tcacctaatt tttcttcgcc atttaaagtt     87720
     cgaactggaa gataaggata aattaatttt aaaaatggtg catcttcact cgcaagtgct     87780
     ttaaaaccaa gataatgtgt agctaataat ttcatcagcg cttcttccgg aagagtttca     87840
     attccttttt ttaaagcaac gccaagctca cttgcaacac tagttaaccg ctcattttta     87900
     taaaatgctt cacgggaagc aacgggttga agttcatccg tccaaatcac gcatttagca     87960
     aaaaatgacc aatctggtaa aatattattt gcttcactgg tgacaaacat cttatttaga     88020
     aataccgtat tttttcggat agcattcatt tgaacagcat gtggaatcat ataagcaata     88080
     ccaaacgttc ttcctgactc attttcaatt aagaaatagt cttggaaatg cgttccaagg     88140
     atatattcgc cgtactgaat aatttgttct ctcgaaagtg ttgacaaggt ttctttatca     88200
     gaaaactgtt tggtccaact attaatttct tcctctaaac cattcatttc tactattata     88260
     ttgctttcca aagaagcacc atattttttc agtgtattga ttaaatattc gacgtcctca     88320
     cattcaggat gatcttctaa accggcgcgt aaacgtaaat acacttgcgt accaggttcg     88380
     cgagtgtcag tttctatttt gcgaacggaa taagtaccat ccgcttttcc gcgccactcg     88440
     gttgtgccgc catctttttg agaggtagaa atcattacaa tttcatcact cacgataaaa     88500
     caagaaagta aaccaatccc aaaacgacca ataaagtcat tggaactttc tccatcaaag     88560
     tttttttcgc cttttgatga attagcaata gtagctagaa aagcgtgaac ctcatcttcc     88620
     gttaaaccaa tgccgttgtc ttctataatt aatgtttttt cattattatc tccagttaga     88680
     gatgcatgga ttttaccttc taaagttgaa tcaatttttt tcctagcacg aatggcatcg     88740
     gttgcatttt gcagcaattc gcgaatataa acatcttttt cgtcataaag gtggtttgag     88800
     agaatgtcaa tcataccagc caagttcacc tgaaagcggt gagaataatt ttccatagct     88860
     tgggcctcct agttgtctaa aactcttttt tattctatca taaaagagaa gataaataat     88920
     gagaaaatgg ttatagatgt ttaagaaatt ttatcagtgg taaatacttt gtgatggttt     88980
     ccacactgga cattgatgtg gaaatagatt atacttatta ttaagtgata atcattataa     89040
     aataggagga agataattat gaaaacaatc aactcagtag acacaaagga atttttgaat     89100
     caccaagtag cgaatttaaa cgtattcaca gtaaaaattc atcaaattca ttggtatatg     89160
     agaggccaca acttcttcac tttacatgaa aaaatggatg atttatatag cgaattcggc     89220
     gaacaaatgg atgaagtagc agaacgttta ctagcaatcg gcggaagccc attctcgact     89280
     ttaaaagagt ttttagaaaa tgcgagcgta gaagaagcgc cttatacaaa accaaaaaca     89340
     atggatcaat taatggaaga cttagttgga acattagaat tacttagaga cgaatatcaa     89400
     caaggtattg agcttactga caaagaaggc gacaatgtaa caaacgatat gctaattgct     89460
     ttcaaagcaa gcattgacaa acatatctgg atgttcaaag cattcttagg aaaagctcca     89520
     ttagagtaga gagtaataaa aactgtgcgg gattaatcgt ctcgtacagt ttttttgtct     89580
     ctaactgtta tagtacaata ttcttatttt ttagttgttt taacacaatg tggtttgaag     89640
     tttctttgaa agaggtatat tatcttcata acaaaaagca gaaaaagtga aattcaccaa     89700
     gaaatctgct attcttgaat aacaatcatt acgaaaaaat tggaaacgag gagtgaaaag     89760
     tatgaatatc gaggtaacgg accaagcaaa taaatggttt catgatgagt ttgatgtagc     89820
     taatggtaat ggaattcgac tttttgcgaa atacggtggt tctaacagtt ccttgcatcc     89880
     tggtttctct atcggtttaa ctgccgaaaa accgcaagaa gcagctgtag ctgagaagaa     89940
     agaagactta attttcttca ttgaagatca tgattattgg tatttcaaag accacgactg     90000
     gaaaatcgac tatgaaccaa aaacggaaga agtactcttt tcctttaaag aaaaagtgaa     90060
     atgaatccaa cataaatgac cgcgtgtaat caatttgatt ccaggcggtt tttgttttaa     90120
     aaactttact gtttcgcctt cctttgctat tctactaaga gagcaggagg agaaagatga     90180
     caaagaaatt agtaatctgt ataagtttaa tcgcgatatt tttaagcggt tgtagttttt     90240
     ccgaaccatc aacgagtaaa tcgaacatta ctgaaaaaac attgaacggt gcaactttta     90300
     cattttttga tgttggacaa ggtgatagca cacttatcca agcagaagat ggcacaacta     90360
     ttttgattga tacaggtcgc caagacgatg accgtatttt aacctattta aaagaagcga     90420
     atgtaaagaa aatagatttg ttgctattga cacacccgca cgcagaccat attggtaatg     90480
     ctgataaagt aatagctaca tacaacccaa aagaaatttg gatggatggt ttaacttttt     90540
     ctagtagtat ttatgagaaa gtaattgacg cggcattagc ttcagatgca aaatacaaag     90600
     aaccaagacg cggcgaaaaa gcgacttttg gtccatttaa tctagaggtt ttaagccctg     90660
     ataaactgga aaatgacgca aataatgatt ctatcgctgt aaaaatcacc tataaagata     90720
     tttccgctat ttttacaggt gacgcagaaa aaggccgaga aagagaaatg gtagatagcg     90780
     gtgccaattt agaagcggat attttagatt tagggcacca cggatcgtcc acatccaacc     90840
     agccattttt cctagataaa gtaaaaccgc aagtggctgt ttactctgct gaaatggcta     90900
     atagttacgg acatcctcat gtggaagtgc tggagtggtt aaaagagcgt gatataaaaa     90960
     catatggaac agatgtgaat ggtacggtta ttatcgaaac cgatggtgaa aaaatccatg     91020
     tgcaaactga aaaatcaggt acaccaaaac caggtagcag ttataataaa gaaaatagca     91080
     cacaaaaaac agaagatgca acatccgaag aattaccaga aagcattaat ttaaatacag     91140
     catctagtga agatttacaa ttattaccac taattgggcc agcgcttgca gaaaaaatca     91200
     ttgccgagcg accatatcag tccatagatg acttgaaaaa aattaacggc attggcgatg     91260
     gcattgtgcg ccaaataaaa gaacaaggca ttgccgtaac aaagtaggtg attaggatga     91320
     aaaaagcaat tttagatcgg atagaagatg gcaaagcagt ttttctatta gaaccagacc     91380
     aaacagaatg gcaaattgac aaagaaaagc tcgattcatc cataaaagaa ggggatatcg     91440
     tcactatttc agaaactaat gaaataatga aacatcccca agaaacggaa gaaatgaaaa     91500
     ataggattgc agaaaagcta gaaagattaa gagggagaaa ctgagaaaaa cttttttaaa     91560
     ctctcatgaa attatcatct ttctttcagc acattctttt ttagaaaagt tattatatgt     91620
     ataagctaac aacaagcaaa acattttcat ttctttccct ttttagaatg gaaatcccaa     91680
     actccctttt agctagtgcg gtttactccc tttttccgca ctagtttttt tatgcgcaaa     91740
     aatcactttt tctgagagaa gagaaattta ttgcgtccag catctaggcc gcagtatagc     91800
     ataagcatgg taataccgac taaaacatat aaggtcggtt gccaactacc aagcgcatcg     91860
     tgtagggtac caaataatat tggaccagag gcggcaaata agtaaccgat agattgtgcc     91920
     attccagata aatccgctga ttctgtcgcg cttgttgttc gcaaattaaa gaacatcatc     91980
     gacaaactaa acgacatccc cgagccaatt ccatagataa tgatagcgat ggataaaata     92040
     agtatgctac cagaagcaaa cataatgcca aaaatcccaa ttaaaaagaa taaaatagaa     92100
     attccaacaa gtaattgctg atttttcatt cgtccggcaa taataggaat aataaacgta     92160
     atcggcataa ccgcaaactg cattaaggaa agcattaaac cactagaagt actagataac     92220
     ccttggtctg ctaaaatatt tggtaaccag gcaatcgaaa tataaaaaat tgctgactgc     92280
     gaacccataa ataaagaaat tttccatgcg agcggagatt tccaaaccga agttgtaacc     92340
     aagtgagttg caattttttc cgtcgagcgt tgattatatt ttagttgtgg aagccaaatg     92400
     actaaagcaa cgattccaag aattgcccag aaaaccatac ttccatgcca gctaaagcga     92460
     ttgttcatag caattggaac cgttaagcca gctgcaattg ctgcacacaa attcatcgaa     92520
     atggaataaa ctccagtcat tagacccaat ttaaatggaa attctttttt tatcaaactt     92580
     ggcaaaatga catttccgac tgcgatagca aggccaatca taaacgttcc agcaaataaa     92640
     ttaagttcgc caccaaaagg tcgaagtaag ctaccaagta caagtgtcaa aagtgctaca     92700
     aaaattaata cttccatacc aagtgctcga cttagtttag aaacaaatgg ggatagtccc     92760
     gcaaatgcaa gtagcggaat cgttgttagt aatccagcca ttgtattggt taaatgtaaa     92820
     tctgattgaa tcattccaag taacggacct acagaggtaa taggtgtacg taagtttgcc     92880
     gcaattaaaa caattcctaa aacaagcatt accttactcg aacgtgtaag gattttttta     92940
     ttggttaaat ctgaattcat ttcttttctc cattcttagc agcaatccgt ttgaaaagag     93000
     taatatactc tgttacttca tgagctgctt gttctttatt tcgtttttca atcgctttga     93060
     caagcgcagc atgcccttta tgctgattag cttctgggct catttcggtt gtactcgtga     93120
     ttgaaaactg tatttcttct aaaatattga catacatatc taacaacaaa tcgttatgtg     93180
     ctgtctttac aattgttaaa tgaagggcag aatcagcttt cacaaaagcg cctacatcat     93240
     ttttttcagt cgctagttgg cattgttgtc tatatttttc tagtgtttct acatcttctt     93300
     ccgtacgtcg gtcgcaggcc agaataaccg cttctctgtc aagtgcatgc cgaatttcca     93360
     agatttcttg aaccgtggat tcgcggacac gcttctgcat gatagcattt agttcactat     93420
     tgttacgaac aaaagtcccg tcaccttgtt tggtttccag taaaccgata tgagctaggg     93480
     cgcgaatagc ttcacgtaac gtattacgac taatgccaaa ttcagccatt aaatccgctt     93540
     cttttggaat acgctcacca attttccacg taccattagt aatttctgct tttatttgat     93600
     cataaacttg ctctgcaagc gattttcgtt caattttttc taccatacta ttcactccat     93660
     ttctaaaggt aggatgattg gttctatttt acagaagaat tctttttttg taaaccttat     93720
     tttgttaaac tatgataaaa tgaagaaaga aaagggctgg tgaggatatg aattggttag     93780
     aaaaactaaa agaaaacgac actgcaagac gggtgctagt gtttgtcctt ctaggcgttg     93840
     ttttatattt actcagaagt atgattgatt tgattttact aacattcatt tttgcatttt     93900
     tagtaacacg actagagaat gttattttga aaagggtgcg cgtaccaaga aagctaattg     93960
     tcattgtact ttattcgcta gtagcagtat tcttatatgt cgctatagtg catttcttac     94020
     caattttaat taatcaaatt tctcaattag tagattctct tgtgaaactt tacaataatc     94080
     caagtgacaa cacgattgtg aagtggattg ttgggttttt aaaagaatct aacatacaaa     94140
     aatatttaca agctggggtc gattttatta tcgcttcact ttccggtatt ggatctgtcg     94200
     gattgtcttt cttcctagca ttaattctta gtttattttt ctctttggaa aaagaacgag     94260
     taacttcttt tactgggcag tttatgacaa gtaaggtagg cttcattttt aaagaggctg     94320
     cgttttttgg aaagaaattt gtttcgactt ttggagtagt tttagaggcg caattaatga     94380
     ttgctttagt aaacacattt attacgacaa tcgcgcttta tttaatggac tttccacagt     94440
     tgcttagttt atctattatg gttttcgtct taggattaat cccagttgca ggagtgatta     94500
     tttcctgtat tccactggtg cttatagctt attctgttgg aggatttcaa gatgtggtgt     94560
     acattttaat taccgttgtc attgtccatg cgattgagac gtacatttta aatccaaaac     94620
     taatgtcatc taaaacgaac ttaccggtat tttacacatt tattattttg attttctcgg     94680
     aaacattctt tggagtgtgg gggctaatcg taggaattcc agtttttgta ttcttattag     94740
     atattttaga agtgagaaat gcagaagact taaaaaaacg aacgttattt ggacgcaaga     94800
     aaaaagtaga ttaggcgata gcttaatcta ctttttctat tccccataaa aaatcagcta     94860
     cttcggcatc aacattggtg ttttcgtgga gtttactatg agctgcattt ttccctgtga     94920
     atgttttttc ttcgtaactt gctgcctggc cttcaaaaat aaatttgcca gataaggcgc     94980
     tcgcaacaga aacactacca tcgctttttg ttccgtttaa agtatcacct gcaatattta     95040
     atacgtgcaa attagtaggg attttttgtt tgtttttcat gaattcacta taacggtctg     95100
     aagatttttt tggccctgaa tctgtaaggt cgtaagctgt aacaccatca tcaccaatta     95160
     ctagtccatt aagcggagcg ccgattaaaa caagtttttc aagaacagga taagttttat     95220
     cattacctac tttttcaatg taactcgtta aactaacgcc acccatggaa tgaccaactg     95280
     cgtatacttt ttcgatatga taattatttt ttaattcttt catgacattt tgaatccatt     95340
     gtgtttgatt tgccgctgag cttttattat cttcaaaaat aacttgaata gtagggttat     95400
     gactaaactt atcatagtca cccttagagc ttacagtccc atcagccgca acattcataa     95460
     caagtgattt tgttacatcc ccgtcttcag caaggcgatt aatcataccg ccgaatgaat     95520
     ttgctgttcc agaataccca tgaacaaaca gggtagggat ggctatttct gaaacagaat     95580
     tttgttcttt tgttgttgtt ttatttgctg tcacggtagg ttctttagct tcttttttag     95640
     tcggctcaaa ttgaagaaaa attatccaga agcccgtaat gataacggct aatgcgataa     95700
     ttaaaataat aacttttttc attcgaaaca tcctttaatc gtttatttct cgccccataa     95760
     aaattgacca acatatttat ccactacagt agattcatgc atactactat gagtagcttg     95820
     tggtccttta atgacatgtg tcgtcacctt ttgatgtgca aataattttt caccatataa     95880
     aacactgtct aatttcactt caccatcact atttgaacca tcttccaaat taccaccaat     95940
     aatcataatt tctgtattgt tgggtaaaac tttggccatt ttctcagcga atttagcatg     96000
     tacattattg gcgtttttaa tatcaacctg ttgatcacca tttacatatt cttccggata     96060
     aaatggtact gcaagaaaca caattttatt tacttgtgga taggacttgt ttttttcgta     96120
     actagctaaa tacgaaaccc aagcgccacc ccccattgaa tgacctactg cattaaattt     96180
     tttaattgca taattttgtt gtaaataaga cattaccttt tttgtccaca tcgattgttg     96240
     gggaagcgtc gcccgattat cttcaaaaac aatgttgata agtggatttt tttccttttt     96300
     gttataagtt ccagtagtag aaatttctcc atctgggctt acatttacgg tcaatgactc     96360
     tgtaccccaa tcatactttt ggtcaaagcg acgtatcatt ccgtgaagcg agcggtctgt     96420
     cccacgataa ccatgtataa aaatggttgg aatggaatca ttggctgctt ttggataagt     96480
     cgtgttaatc gttagtaaaa taaaaattgc tccaactaaa caacctaatg gtaagataat     96540
     ggagaagaac acgcgcttta gcattatttt acgccccttt aaaatttgtt atgaacaaat     96600
     tatacatttt ttttatggaa aacgcacgat tggtctactt tttctactaa tttaatggtt     96660
     tcttctcatg aaaacatata gtatactgga aaaataagcg aagaaacgga ggcatattca     96720
     gatgattaaa cgaactggtg agatagtact cgctattatt ggtcttgttt taagtctact     96780
     cgcacaagca tttattgcta ttattggtct attaatgata agcggttcaa aaggaaagga     96840
     aggtttaaca actttctaca acaactacta caaaacaatg actgaatggg aaatcccgaa     96900
     aaaagaggtt cctgatcccg atcgtgtatt ggattttgtg caaacattat cttggacagc     96960
     attaacggga ggcttaatta cgctcgctct aggtatcttt gggatttact acatcttcaa     97020
     aaataaaaaa ccagtttttg caggatattt atttttagca gcaggcgttg tatcgttgct     97080
     ttctacagca ctaattagtt tcattcctgc gttactattc attgttgctg ctatactttg     97140
     ttttgtccgc aaaccgaaga gcactttttc tggattataa ttcgaaacga gtttgaattt     97200
     ttcaagctcg tttttgtttt acttctactt ttttagggaa taaaatagtg gatttcaaga     97260
     ggaggttgat agtgtgaaaa ataaagtagg aattattgcc ggagccgtgg gagctgtcgc     97320
     tggagtttta gcttgtgcag cggtatacgt ggtaaaaaag caacagccgc ccaccccttt     97380
     tgatgaggta aatgatattc ggacacgtta tgctgacaaa gaaatttccg aaacagagct     97440
     ggaagaaaac aacatgattt cagaaggtgg cgtttcatct cttcaatatg aagaaaagta     97500
     aaataatgag aatgcagttt gtatcttgtg ttacgcgaga acaagctgtt ttttttatgt     97560
     agaaaacact gcttattata gtagattatg ttatcctgta gttagacaat aggactcaag     97620
     ttgtaggtga atttccttct acagcgggtt attatacttg atagataggg ttatgatagg     97680
     tacagtaata aaagaaaata tatcagctac atttggaagt taggaggtag gtgtatgaga     97740
     gcaatattga ttggcgtatt aataatttta ctaattgcga tgatacttat agtcttattg     97800
     ccagcgatac tagcaatggt tggtgcagtg ctcggctttt ggtcacttaa gaaactactt     97860
     gaagcaaggt ccgtaggtga aaaagttatt tatggtgttc taattggcgt tggtgcctta     97920
     ataattctag ctaacttaaa aggaattctg gttgttgtaa ttatcggagc aatcatttac     97980
     ttcctaacta gaaataaaaa taaaccaaga aaaaatgatg acgtattcga ctacccatac     98040
     aataaataat tggaggagaa aaaaatggca aacctttttg aaaaaatgaa acaatggaat     98100
     aaagaagtta gtgaaaaaat cgagaaacgt gaagaaaaac gtcgcaattc agtaagttac     98160
     tatatggata aaacaaaaca agaaatgaaa gacgcagaac gcatggtaga aaaacaacgc     98220
     gaactgaaat ctcttttcta taaggaatat aaagaaatgg aagtttatgt tgaaaaacgt     98280
     cgtcaccaag cagaaattgc aaaagaagct ggtgaaacaa aactagctga tttcgcttta     98340
     gaagaagtgg ctcaatatga agaacaatta gaagctacaa aagcacatta cgatcaagcg     98400
     tccgaacaac ttgaaaaatt agaactacgc atgcacgaaa tgcgcttaaa atggaaaaat     98460
     cttaaaaccc aacatttagc ggaaatggct gaaaaaaatg caacagaaac ttccgaaaaa     98520
     atggacaaag ttatccatga catgagctgg ggtagtgtta gtgactatca tgaagcacaa     98580
     aaacaacgcg atttagctga agaagcagaa aagaaagcag atatgagcaa agaactttct     98640
     caatccttcg atgatctaat ggatgaatta gaaaagaaaa caaagaaaag taaagaaatc     98700
     atcaaagaca aagcgcaaaa ctttacaact atggtagatg aaattattga acgcgaaaaa     98760
     caaaatttca aaaaaccaga aaaagcttcg atggaagatc aattaaatga acttgaaaaa     98820
     gaagctgcaa aagaaaaacc aaaagaagaa aaagaggtct taattccaga attagagaaa     98880
     aaagaagaag aaaacgaaac agataaataa aagtaacgag cgcagaataa ttattctgcg     98940
     cttttttata actaaaagct acaggccatc taaatatgct cgtagctttt ttggttattt     99000
     tacttttttt cgggtaaata ggaaaagata agttgcattt taatagatac atgctataat     99060
     aattggtata gaccgattta acaaggaggc aatatgtaat ggctaataaa gtaattacta     99120
     acgctacaat ttatactggt aaaggtgttc tagaaaatgc tttcgtacgt tttgataaac     99180
     aaattttaga ggttggctcg atggctgatt ttcaagcgga caaagcagaa gaagtaatcg     99240
     atgcaaaagg acaaaaactt gttcctggtt tcattgatgt tcattcacac ggtggttata     99300
     gttttgacgc aatggatgca gatccagaag cacttagaaa acaagtgaac ggaatgttaa     99360
     atgaagggat tactacttac ttcccaacaa cgatgacgca atcacacgaa aatatcgaaa     99420
     aagcgctaaa agtgattaac gaagtcgcac aaacagaacc tgttattggt gggattcatc     99480
     tagaaggccc atttgtttcc aaagtcttta aaggagcgca accagaagaa tacatccaag     99540
     cgcctgattt ggaacttttc aaaaaatggt ttgatatttc tggtggctta attaaattag     99600
     taacatatgc accagagcat gatacttctg ctgattttga aaatttgtgt ttcgaactag     99660
     gggttgttcc aagtattggg cactctaatg atgtgcgtga acacttgaaa acaagtaaag     99720
     cgacacatgc gacacattta tataatgctt gtcaccgtat gacacaccgt gagccaggcg     99780
     ttccaggtca cgttttacta gaacgcggta ttaatgcaga actaatcgtt gatggtattc     99840
     acgttcatcc tgatatggtg aaattagctt atcaaatgaa agggccagaa catttatgca     99900
     ttatcactga ctccatgcga gcaaaaggta tgccagaagg aaaatccgaa cttggcggtc     99960
     aaactgttat cgtaaaagat aaacaagctc gtttagaaga tggaacttta gctggaagtg    100020
     tgctcactta tgacgacggc ttccgcaaca tgattaaatt tactggatgc tcggtagaag    100080
     aggcagttct tatgtcttct ggaaaccaag cacgcgaatt taatttaaca caaaaaggtg    100140
     caatcgaggc tggtaaagat gcagatttca acttactaga cgaagattta cacattacag    100200
     caacttattc attcggaaaa aaacattctt gagaggaaga taataaaatg caacttatca    100260
     caacagaaaa taaattagca ggatccaaaa aagcgttaga aatcattgaa aaaggcatta    100320
     catcaggcga agtaaacaca cttggcctag caacaggaag cacaccagaa acactttatg    100380
     ctgaacttgt aaaaagcgat gttgacacta aaaatgtaac aacaactaac ctagatgaat    100440
     atgtaggtct tgcggcaagc gacccaaaca gttatcatta ctatatgaac gacttgttat    100500
     tctctaaaaa agcatttaaa gaaagtttct taccaaacgg agaagcgaca gatgctgaag    100560
     cagaatgcgc acgttatgaa gaaattttat ctgagcaccc aattgatatt caagtgcttg    100620
     gaattggaac aaatggacac atcggtttta acgaaccagg aacttctttt gattcgataa    100680
     cacataaagt tgttttaaca gattccactc gtgaagctaa caaacgcttt ttcgaaagag    100740
     aagaagatgt tccaacacat gcttattcta tgggaattaa atccatcatg aatgcgaaga    100800
     aaattatcct actggctttt ggtgaaaaca aagcacaagc aatcaaagaa actattaaag    100860
     gacctgtaga tgtgaattgt cctgcttctg ttcttcaaaa tcatccagat gttactgtga    100920
     ttcttgacaa cgaggcggcg tcacttctat aagaagaggg cggggaaatg atcgataaac    100980
     aatcaggaat accgatttac attcagattc aaagtgaaat taaaaagaaa atggaagatg    101040
     gtgtctggaa agttggcact tctattccag ctgaacgtca gcttgcagaa atgttccacg    101100
     tcagccgaat gacggtaaga caagccattc aaggcctcgt tgatgataac attttgcaaa    101160
     ggcgtgttgg tgccgggact tttattgcgg aaaagaaact aaccgaacga cttgaagcgg    101220
     ttacgagttt tacgaatttg atgttacaag aggggaaagt tccttcgacg cgaatcgtat    101280
     cgtacggtat tcgtccggca agtacgcaag aacaagaggc gttgcaacta ccagaaaaca    101340
     gcaatgtaat gaaaattgag cggattcgtt atggcgaccg cgttccaatt ctttatgaag    101400
     ttgcggccat tccagaaaaa attgcttcac tgcttacaaa ggaagacatt atggattccc    101460
     tttataaagc gattgaatta aaacttggtc aaccaattgg agaagcggaa caaatcatgg    101520
     aagcttcttt agtatcagaa aaaattgcgc catatcttga tgtgaaactc ggatcaccgg    101580
     ttatgaaact taggcaaatt acaacgttag aagacggtcg accatttgaa tttacgcgtt    101640
     cccagtatgt aggtagtaga tttcaatttg tagctaggat taaacaataa ataaaagctt    101700
     gaggcggaat ctgtctgccc caagcttttt tgcataatga ttttcgttgt ctttttgcaa    101760
     ataaaaaagt ataatgagat gagtaaaaaa tttgcgggga ggactagcca tgagctggat    101820
     gattatattt atatgttttg gcgcgtccgt attacttaca ccgctaattc gaaaaatagc    101880
     tctatacttt gatattacag ataaaccaga ccaacgtcgt attaatatta aaccaattcc    101940
     gagtttaggt ggactagcaa tatttatcag ttttactatc ggaatgtttt tactcccaat    102000
     tgaaaacgaa ttcttatggc cgcttctgat tgcggcgttt gtcatggttt tgactgggct    102060
     attagatgat attatggaat ttaaagcaag atataaatta attggccaaa tcactgctgc    102120
     ctttattatt gtattttggg gtaacattag catcgacttt attaacttac catttggtgg    102180
     ggaaattcat tttgggatgt taagtattcc gcttacgatt atttggattg tagcaattac    102240
     gaatgctatt aatttgattg atggactaga tggccttgca gcaggtgttt caaccattgc    102300
     actacttacg attttaggaa tggcgtttat tatgggagat gcactagtaa ttatgatagc    102360
     aagcgtgtta attgctggaa ctcttggttt cttaccttat aatttcaatc ctgcaaaaat    102420
     tttcatgggt gacactggcg cgcttttctt aggttttatt atttccgtgt tatctgtgat    102480
     gggattcaaa aatgttacgt ttatctcttt aattgtaccg attttaattt taggagtacc    102540
     aatttctgat acgctttttg ctattatacg acgcatggta acgaaacaac ccattgcgat    102600
     ggcagacaag tcgcatttac atcattgttt attacgacta gggttcacac atcgtcaaac    102660
     tgttatttta atttatgcta tagctgcact attttcatta ttcgccttca ttttcacgat    102720
     gtcgacactt tggggttcga tgattttaat cggtgtgctg ctcgtcttaa ttgaggtatt    102780
     gattgagaca cttggattag tagggagctc ctatcgccca ttacttaatt tatttaaatt    102840
     aacaaaagaa gaaaaaatag attagagatt ggtcacttag actagtctct ttttttgtgc    102900
     caaaattctt attgagtaac aagtcttctt gtgatacatt tatcaagtaa cgtttttgta    102960
     gaaatgagga gaaaaacatg gaaatcattg cgacagcaga ttcaatgaaa caagctgaac    103020
     aattgcttcg cgcgggggta gacagactat atataggtaa tagccaattt ggtttaagac    103080
     tgccatattc gttttctgtc gaagaattac gtgaaatagt tcatttagcg catcaagaag    103140
     gaaagaaagt aacagtagca gtaaattcgt taatgcataa cgagcatatg gaaaagttac    103200
     caggattttt agagcaactt gctgatatgg aagtggatgc agtaacgtgc ggcgatccag    103260
     gtgcaattat gcttttgagt gaaatggctc aaccgattcc gtttatttat gatgcccaaa    103320
     catttgtaac tagcgcagaa caaatctcgt tttgggaaaa acaaggagcg attggcgcgg    103380
     tacttgctcg ggaactaaca gaaggcgaaa tcaaaaccat cgcgcatagc cttactatcc    103440
     cagtcgaagt tctagtttat ggaccaacat gcattcacca atccaaacgt aaactagtaa    103500
     cgaattatga gcgtattgtt gaaatggaag atgatacatc gaaggaacgc ggtctttatt    103560
     tacgcgaacc taatgatgaa acaagtcaat taccaatcta tgaagatgag tctggaacac    103620
     atatttttgc ttccgaagat gtttcgcttg ttccttattt ggcggactta tatgaggctg    103680
     ggttgaaaac atggaaacta gatggtgttc ttgcagaatc agaaaatttt gttcaaattg    103740
     catcactgtt agttgaagcg aaagaagcta ctctgaaagg tcaatttgtt gcagagtatt    103800
     ttgtgaataa attaacggag cttcagcctc aaacacgaaa actagacgca ggattttatt    103860
     tgaaaaatcc ggatgatgtg aaataggggg attagcataa tgagtaaaat attaaaaaaa    103920
     cctgaagtgc tagctccggc tggtaactta gaaaaattaa aaattgcgat tcgctacggt    103980
     gcggacgctg tatatattgg tggacaggct ttcggacttc ggtcacgggc aggtaatttt    104040
     agttttgaag aaatgaaaga aggtatcgct tttgcgcatg aacgaaatgc aaaagtgtat    104100
     gttgcagcaa atatggttgc gcacgctggt gatacagaag gtgctggtga atttttccta    104160
     acattacgcg atattggtat tgacgcagta atcgtttctg acccagcctt aattagcatt    104220
     tgtttccaag atgcaccagg tttaccagta cacttatcca cacaagcttc tgcaacaaac    104280
     tataaaactc tagaattttg gaagaaacaa ggactagagc gtgttgttct tgcacgggaa    104340
     gttagcatgc aagaaattca agaaattggc gaaaaaaccg atgttgaaat ggaagcattt    104400
     attcatgggg caatgtgtat ttcctactct ggtcgttgta cattatcgaa tcatatggct    104460
     aatcgtgatg cgaaccgcgg cggttgtgcg cagagttgtc gttggaaata tgacttattc    104520
     gagattgata atggcgtttc aaaaaattta gtggatacag atgaagagcc gttttcaatg    104580
     agtgcagttg atttatctat gattaaatac attccagata tggtagatgc tggtgtggat    104640
     agtttgaaaa tcgaaggacg aatgaaatct attcattatg tttcaaccgt tgcaagcgta    104700
     tatcgccgtg ccgtggatgc ttactgcgcg gacccagaaa attatgtgtt tgacccagct    104760
     tgggaagaag aattgtggaa agtcgcgcaa cgcgaactat ctacaggatt tttctacaaa    104820
     gaaccaaccg aggacgagca actatttggg aaaacgcgga aaattcctca atatgctttt    104880
     gcggcgcaag tactggaata tgacgagaaa acgaaaatcg ctactttaca acaacgaaat    104940
     aattttggtg taggggaaga aattgaattt tatggaccag gagatactgg ctttaagcaa    105000
     gtcgtagaag tactttggaa cgaagatggc gtagaaattg accgcgctcc aaatgcaatg    105060
     atgacgataa aaatgccggt agataaacct gtgaagccat tttactttat gcggaagaaa    105120
     aaataaaaat ctcatgctgc agtaggattg tcgtgtactc cctaagtaag gtataatggg    105180
     gtaagtacat atgaaggagg agattaatta tgataggatg gattattgct atcgctgttg    105240
     ttgtcatttt agtattgatt tatttcggtc tatacaacag ccttgtaaaa taccgtaacc    105300
     gtgtggatga aacttgggcg caaattgacg tgcaattaaa acgtagattt gatttaattc    105360
     ctaatctagt tgaaacagtt aaagggtatg caaaacacga aaaagagaca ttgacaaaag    105420
     taattgaagc tcgtaacaaa atgatggaag tccctgctga caatcgtcaa ggtcaaatcg    105480
     aagctgacaa tatgttaagt ggagcgctta aatccatttt tgcattagga gaagcttatc    105540
     cagatttaaa agcaaatact tctttcatcg aattgcaaca tgaattaact actacggaaa    105600
     acaaagtggc ttattctcgc caactttata atacaaccgt aatgacttac aacacaaaag    105660
     tacaatctgt accaacaaac atcgttgcaa aactgcataa ctttacagaa cgtgacatgc    105720
     tttctattcc tgaagtagaa cgcgttgcac caaaagtaga gttttaagcc atgaaggaga    105780
     gcgaaaatta tgctatttga acaaattgca gcaaataagc gaaaaacaat ttttattatt    105840
     cttggctttt tcattttcgt tcttatggtt ggcgctgcta taggtataat tgtttggaat    105900
     aactatctga atgggcttgt actcgcggct gttattggtg cattttatat tttgattatg    105960
     gtaatgagca gttcgtcggt cgttatggcg atgaatcatg cgaaggaagt cacatcaaaa    106020
     gaacaagcgc cagttttgtg ggataccgtt gaaagtatgg caatggttgc tggtattccg    106080
     atgccaaaag tatatatcgt tgaagatcca agtccgaacg cttttgcgac ggggatttct    106140
     cctgaaaaag gagccgtggc ggttactaga ggattgctta ataaattaga acgttatgaa    106200
     cttgagggcg ttattgcgca tgaaatttct catattcgta attatgatat tcggttatca    106260
     acgatcgcca ttgcgctagt ggctgttatt gcgattctta gtgatatagc aatgcgaatg    106320
     attttctggg gaagcctaac tggtggcaga aataaccgta aaagtgacaa taataacagt    106380
     ggcggggcac aagcgattat ctatatcgtt gcactcatat ttgttatttt ggcgcctatt    106440
     attgcaacag ctattcaatt tgcgttatct cgtaatagag agtatttagc tgatgctagt    106500
     gcggtagaat taaccagaaa tccagatgga cttatccaag ctttacaaaa aatcagtggt    106560
     gattcgaaaa aaatggaaga agtgagtgct tctagtgagt ccatttactt ttcgtcacct    106620
     ctaaagtcaa aaaaaaataa gccaggtctt tttgactcac atccgccaat tagttcgcgg    106680
     attgaacgct tagaaaatat gtaaaaaaag aagcaaccca ggaatgggtg cttctttttt    106740
     ataagtttcc gatgtatttc cagtgagact gtccagctgg agcatcgatt aattctactt    106800
     tttgttggag acgccatttc ttcatttggc gctcgatttg ttgttcggaa acaccataaa    106860
     aatctgccat agaagcagaa gaagtaactt ttacttttgc taagtattct tccatttgcg    106920
     ggcgttcttc tggttgcggg gcatcattta aaagctcgga taaaacatgt acataaactt    106980
     cgtaacgatg aagtccactt agttttaatc cggcatcttc tatattttta ttgaaaaaga    107040
     ctacagtagg gttttcatga atttccattt cttgagctac tttttgatcg ccgatataag    107100
     cacgtttggc aactgtagag gctagatctt ttttgaattc tgataaatct agaccagtgg    107160
     agacagcaat atcatagagt acttcatcac tagcgatatc tttattttca aggaagtagg    107220
     ctgcttgaat cttgcgcaag aatgtaattc cttgtttttt tccttggagt tcagcggctt    107280
     tgactgcaag acaagaaata taggaaaggt gcgcccctat ttgttgttct tttaagctta    107340
     ggttactatt tcctgcacgc ttttgtttac atacaaatgt ctgcaaattg ttatgcagaa    107400
     catagcgcaa tttgaaatag ttcccgtact ccatttgtaa ccggagcatg ttcgcttcga    107460
     tattccaaca gtcatcacaa gctggatcga agaatagata aatttcgatg ggcttggaat    107520
     ttgctactga ctgataatat aaattttggt taatcatttg ctatcacctg attttcaaat    107580
     tctaaatatc ttcaaacaga tactcatttc aatgtaccag tgtgaaaaga aataattcac    107640
     tgctcagtaa aagctgatac aaaatttggt tttgtaactt atatatctat tttatcagcg    107700
     taatgtaaat ttaacaaata attgtcattg gcttaacata tttattcgtt attttttaag    107760
     aatttgtgtc tttttgctat aaaagtatct atttttactt attattttca tatacgtgat    107820
     gataaaatcg tgctacttta ttttcggcag gttgattggt gatttgatat tctttaagta    107880
     gtttgtcaaa aacctctttt cctttgtcat aatcagacac ttcatactct aagtcgaaat    107940
     ctgatatgga gccataaaaa ttcttatcaa acacaagtaa gcctttttta taatcttttt    108000
     ctgcgcggat tgttttgagt gaaccgaaaa cttgtaagtc ttcatgattg attcctagtt    108060
     cttttaacgt gtcacgaaca ggtccaaccg gaatatttgc tccagagatg atcgcacttg    108120
     cttggtcctc gccaagaatt tgagtagttt ccattagtcc acgtgcttct ggggttttga    108180
     gtgttaattg gtactgtgtt tctaattggc gaattcgaag agcagaatga cgttctttta    108240
     acccgaaatt tgttgtgtct aaataataat ttgtttgctc aaagaaatcg tcttctttca    108300
     ctcgaaaatt ttctattaat gtatcgtatt cttctttggt taatagatta cggaattcga    108360
     tttctaattc tttgaccata aaaattcagc tccctttaat gaaatgtcgc atctaaatct    108420
     tgcgcataaa attgaattgc ttttttgtaa cttaaaatgt cttcatcact cgttgtctgt    108480
     gtcaagagca tcaaggcttc ctccaaagct tctttttcta aaccttgatt gtacttagcc    108540
     atcactgaaa aagtacgcaa ggcattatta tctggaaatt cttgtaaagc tgtttcgaaa    108600
     aggcggatag atttttcggg ctgacctgta atacggtaag tgctaccgag acctatatac    108660
     gcttctttgc gagaatcagc aggaagacca agctgaagag ctttctcgta aaaggggatt    108720
     gcagcatctt ctttaccgag tgcatcgtgc gcccatgctg cataataatg aagttctgcg    108780
     ttatcggagt tgttttttaa ttcagtaaga gcttgagtgc gcgcagtttc gtaatcgccg    108840
     ttttgaagta atgttagaat cattttcgtc ctccttttag ttgtcgtttg agtgcttcgg    108900
     ttttatttta ccacgggatt gaaaaaaagg ttactttaag caaggtggat taactgcttt    108960
     tgtgttaaaa taaaactgat gttgcataaa tttaatcatg aatatacttg aggtgagcga    109020
     tttgaatcat tgggaagact ttttagcgcc ttacaaacag gcagtggaag aacttaaaat    109080
     taaacttaaa ggaatgcgtt cacaatttga gcttgaaaat aatcattcgc caattgaatt    109140
     tgttacagga cgagtgaagc cggttgcgag catactagac aaggctaatc aaaaacatat    109200
     tgcgctagat catttagtag aagaaatgca ggatattgcg ggactccgca tgatgtgcca    109260
     atttgtagat gatattgaag tagtggtgcg ccttttaaga caacggaatg attttcgaat    109320
     tgtagaagaa cgcgattata ttacaaacaa gaaacctagt ggttaccgct cctatcacgt    109380
     tgttattgag tacccagtgg aaacaattca aggagaaaag aaaatcttag ctgaaatcca    109440
     aattaggaca cttgcaatga atttttgggc aacgattgag cattcggtaa actacaagta    109500
     tcaaggcgaa tttccagaag caatcaataa acgtttaaaa cgcgctgctg aagctgcttt    109560
     tcaattagat gaggaaatgt cgcaaattcg tgaagaaata caagaagcgc aagtttattt    109620
     ctctcaaaat aaagacgtat caaaggataa aaaagcagtg catcaagtga tgccaaagaa    109680
     aaataagtaa ttagttgtag gaataggggc gaatagaaat aatgaaatat atgattactt    109740
     ccaaaggaga cgaaaaatcc gatttgctgc gactaaatat gatcgcaggt tttggggaat    109800
     atgacatgga atatgatgat gttgagcccg aaattgttat ttctattggt ggagatggaa    109860
     catttctgtc tgcttttcat caatacgagg agcgcttgga tgaaattgcc tttatcggaa    109920
     ttcatacagg gcatcttggc ttttacgcgg attggagacc agctgaggct gataaattgg    109980
     ttaaactttt agcaaaagga gaatatcaga aagtttccta tccccttctc aaaacaaccg    110040
     tgaaatatgg gattggcaaa aaagaagcga catatttagc gcttaatgaa tcaactgtaa    110100
     aaagttcagg aggccctttt gtagttgatg ttgtgattaa cgatattcat tttgagcgat    110160
     ttcgtggaga tggcctttgt atgtcaacac ctagtgggac gacggcatac aataaatcgc    110220
     taggtggggc acttatgcat ccttctattg aagcaatgca gttaacagag atggcatcga    110280
     ttaataatcg tgtgtaccgg acaatcggta gcccactagt ttttccgaaa catcatgttg    110340
     ttagtttgca accggttaat gacaaggact ttcaaatttc tgtagaccat ttgagcattt    110400
     tgcatcggga tgtacaagaa attcggtatg aagtatctgc aaaaaaaatt cactttgcca    110460
     gatttaggtc atttccattt tggcgtcgtg tacacgattc gtttattgaa gattaagcta    110520
     gcaggaggaa gcatgtgttt ttagaatgga aagtcgaaac tgaagaagat gggctcttac    110580
     ttcgcacgtt tttaaagagt aagcatattt cgaaacaatt attaactgcc gtgaaatttg    110640
     gggcagatgg aaaaattgaa gtgaataacg aagaacaaaa tgttttgtat cacgtaaaag    110700
     taggcgataa agtgaggctt acttttccaa cagagcaaca aaatgaacga ttgcttgcgg    110760
     aatataccaa tttagatatt gtttttgaag atgatttttt attaattatc aataaaccgg    110820
     ccgggatggc ttccattcca tcacaatatc acccaaatgg atccgttgca aattttgtca    110880
     aagggcatta tgaagcgcaa ggactgacga acgctattca tattgtaaca agactcgatc    110940
     gtgagacgtc agggttaatg ctaatcgcca aaaatagatt tgctcatgct agattaagta    111000
     cgtttttgca aaaaggattg ctaaaacgac gctatcaagc ctttatatca ggagttttag    111060
     tagaacaaaa gggttcgatt gaagcgccaa taggacgcaa agaagtgagt ataatggaac    111120
     gttttgttac tcctgaaggt aaatatgcca aaacaaatta tgaggttctc gcgcgctata    111180
     gagcatttga ccatgtagct attcaacttg agacaggaag gacgcaccag attcgtgtgc    111240
     atttctctta tattggacat ccgcttattg gcgatgatat gtacggagga gatacgaatt    111300
     tgttgaaaag acaagcactg cactcatgcc atctgcattt agtccatcct ttgacagaag    111360
     aatatatggc gtttgatcta cctctaccag cagacatgga agagataatt caaaaatcga    111420
     agtaataagt gttttaaaaa gttatttggt catgtaaaat ggaagaagcg aacaaatcgc    111480
     atcaatttta ggaggaaaga acatgaattt atcattagag ggaaaaactt atgttgtaat    111540
     gggagtagct aataagcgta gtattgcttg ggcaattgcg cgttcactaa atgaagctgg    111600
     agcaaaactg gtatttacat atgcggacga tcgtgcgaaa aaaagcatta cagagctagt    111660
     accttcatta agcgaagtaa atcaaaatcc acttatctta gcttgtgatg taacaagtga    111720
     agaagctatt acagaaactt ttgaaacaat taaagataaa gctggcaaac ttagcggcct    111780
     agcacactgc attgcttttg caaacaaaga ctttttaact ggggactatt tagaagtaga    111840
     tcgtaaaagc ttcttacaag cacatgaaat tagtgcctat tcatttacag ctgtagctcg    111900
     tgcactaaaa cacttggaaa tgttaacaga agatgcaagt ttactaacgc taacttacct    111960
     tggtggggaa cgtgtagtag aaaactataa tattatgggt gtagcaaaag cttcccttga    112020
     tgcaagcgtt cgataccttg caatggatct aggcgcaatt ggggttcgtg tgaatgctat    112080
     ttcagcagga ccaatcagaa cagtatctgc tcgtggcgtt agcggtttct ctgattctat    112140
     ttcactagta gaagaaagag ctccactaaa acgtgcgaca caagcggaag aagttggcga    112200
     tacagcgtat tacttattca gtaatttatc tcgaggcgtt actggtgaag taattcatgt    112260
     agatagcggt tatcatatta ttggatttta aagaaaaaaa gaccgtaagt agtttttact    112320
     acttacggtc tttttttggt ccattttctg gatgttcttt aaagtaatat tcttttggtg    112380
     ttggtttata gtttgtttga attggttctt taacgaagtc tgctaatact tggtcgattt    112440
     ttacccaacc acgccagctt aaatgaatcg gatcttctaa gaaaaaagcg tcattttgat    112500
     attcttctag agagtagtaa cggaaacctt gactctcaat ttgttctttt gttttcgcat    112560
     aatagtcatc taaaccttgt ttgtccatac caatgtaatc aatccatttt ccattgatag    112620
     gcgggttaat gaaaatgaca tctgcaccag cctttttgaa agcatccatc agtagctgta    112680
     aatcagcaaa ctcaggagat tggtcataac gtaaatcttt gcggctattt tttaatttac    112740
     cttcaatggg tttgattttc ttttggtaat aatgttcttt gacttgaaaa ggattattac    112800
     cagtacttct ctcaccagtt tctttagcta attcatctag ttgttggtaa tctaaagttt    112860
     ctggaagttc ttttaggcct ttgcttacgc gatcttgttt ggaaccaatg atgtattttg    112920
     attctaaatc gtctttacgt tccaaaatct tcagttcgac attaccagta atgtttagaa    112980
     gctttggatc atgaggtttt ttaggtcctt ttgcgacaat gttttcgagt aattttttta    113040
     atgtagagtc actttgaact acttggaaag ataataaacg tttagctgca taacgacgtt    113100
     caggcgtgtt tttcgtatct tctaaagcaa atttatatgc atgaagaggg gaaaagttgg    113160
     caccaaatga tgggtcagaa acccctttag gttggaacca ttgtggagat aaaactaccg    113220
     ctactttttt tccttttaaa tcatcaccaa gtgcatttac gtctaagaaa tgacttaatg    113280
     attgtgtacc tgggcgacca agtaaaaatg gagtatagcc ctgattgtat ttttttgaga    113340
     ctacgctagg atgaaatggg tcgacgcggg aaagctctga agaaccataa attggtaaat    113400
     agtttccttc ttgtaaagct tttttctgga tgtctaagcc ttggatgacg gattcgttca    113460
     ttgatgtagc gcttttctct acggtatcag aagaaacttt agagaataag ctactaggtc    113520
     cgaatagaac gaaaaggaaa accgcgaatg cgaccaataa aggcccaaat gtcatccaca    113580
     gctttttttt cattatttta gcgcctcaag ttgtgtaata atcatttcag gagtagccca    113640
     ttcgtcgcgg tcaaattcgg aaacaggtac agtaatatct agtttttctt caatttcaat    113700
     taaaagttga accgtagcca tagaatcaag caagccttca tcaaataatt tgatgtttgt    113760
     attttgtact acttcatcag tttctgtaat ttcctctaat atttctaata cattttcacg    113820
     aaaagccatt ataaattacc acctttagtt agttttaaaa attaatttta tctaaaatac    113880
     ctgagaatat caggaatccg aaacaaacaa attggaatgt aatgataacg ccgattacat    113940
     aagtaatttt gttttttgga tagaatttgt gcttcttgtt aaagcgttcg aataggtcaa    114000
     atccaacgat aagtgttgct tgataaaggc cataaacgat gtaataccaa tgaagtccat    114060
     gccatactcc catgatgaaa aagttaacga aatatgctag gtaggcaata gtgaacttgc    114120
     ttttaaacca tttctttttt gtaacccaaa atacgaaacg catgaataca taatcgcgga    114180
     accagaaaga aagcgtcata tgccaacgat tccagaactc tttaatgttg cgagctgcga    114240
     aaggtttgtt aaagttcata ggtgtttgaa cgccgagcaa gtaactaacc ccaactgcaa    114300
     aggcactata acctgcaaag tcaaagaata aatacatact ataagcatac atataaccaa    114360
     ttaaactctt tgttgtatct acattatgtg taatcgcgat gtctagtgga acaacaaaat    114420
     gtttgtttac taagtaagcg ataatgaatt tgtagagaaa accaaggaag ataaggaata    114480
     ttcctcgatt taataaagct agataagctt ctttactagg cggattatca acgtcttttt    114540
     taaagcgacg gaatcggtca atcggtccgg acgaaatagt cgggaagaat agtaagaagt    114600
     taacaaaatc ccacgcgtta tactgtttaa ttaagttatc acgtatttca ataatcattt    114660
     gtgttgcttt aaatgttaag taggaaattc ctaggaaacc aaccattgtt acatgatcac    114720
     ctaaaattgg aacaacttta gagataacga gggggagaat ggacagaatc actgcgataa    114780
     caaaaacgcc gccgtgattc cgctttttct cttgcctata atggaagtaa agtcgtacaa    114840
     gggcaagttg ccagaagacg aagaagataa aagtagctcc ttggactgga cttgctgaga    114900
     acataaagta taaaaatacg agtgtcacaa aagcattata aatcggtaat ctcttcccta    114960
     acaaaccagc tactatgata ggaatcaaaa atagtacaag tactccaaaa taaagaattg    115020
     tgccgtatgg taaactcact tgttaacctc actattaagt gatttgcgat caattttgcc    115080
     attcatagtt aacgggaagt ccgttttata aatccatttt cgggggatca tgtatgctgg    115140
     cataaattct tttagttctt tttttattgc tgcacttagc tggtattctt tttcgaaatc    115200
     atgggtagtt gggatgacct gagcgactaa catatctacc ttttcatctt tcattttcgg    115260
     aataatagcg cagttttgaa tgtaacttac tttttttagg ttgttttcga tatcttctaa    115320
     ttcgatgcgg taaccatgaa gtttaatttg gaagtcaaga cgtccttgga agaacagata    115380
     accgtctttg ataataccag agtctcctgt gcgataggct tgataacctt tataatcgaa    115440
     gaatacttgg tctgtttttt caggttcatt taagtaacct ttagaaacgc tagcaccaat    115500
     taggacaatt tctccttttt cgccttctgg aagaacctca ccagtttctt ggtcaacgat    115560
     gtgtaaacgc atatctggtt taataacgcc aagtggtaag cttggataag catcgataat    115620
     ctctcgagtt actttcactt gggtaacagc cacggttgct tctgtaggtc cgtatgtatt    115680
     gtaaataact gcatctggga aacggtccag taattcgctt gctgttttct tggcaagtac    115740
     ttcaccacag aataagaaac gagttaagcg ggggttattt tcttggttaa agttctcgtc    115800
     tagtaagcac aaatctgcaa aagaaggagt agaaacccat acatccaagt tttgagcagg    115860
     tatttcacga tatagatctt tcatattcgc agtaattgtt ttatcaagag gtacaagcgt    115920
     cccacccgat agtaaacttg ggtataaatc cataacggat agatcgaagg agaagggcgc    115980
     ttggtttaag aaacgcaatc cttggcttaa agaaaagtct tgtaaaatcc agttactaaa    116040
     acttactagg ttgttttgac tgatttgaac gcctttagga tttcctgtac ttccagatgt    116100
     gtaaataata tagtagttat catcattgtt tacacatgct tctttgtctg gaacttctcc    116160
     gaaatgtttt tctaaagcgt ccattagctg atcttgtgtt agcaccggac aaccagtaat    116220
     agtaaggttg ttaggcagct cttctgtgca aataaacata gaaggatcag ctgctttttt    116280
     tatttgttct atacgttcaa ctggcataga aacatctact ggtacataag ctcgacctga    116340
     tttgatagag cctaagaatg caactaacat taggggagac atatggccgt aaacgataat    116400
     aggtttttct ttgtcagtaa ttaggttttt tagtagaaaa gagccgaatg catcagattg    116460
     ccgttttagt tctttatagg aaagacgtgt tccagcatat tcatagcaag ggaaatccgg    116520
     tgtcttctct gcccatgcat caattctttc tatgatactc gttgtcatta ttgatattcc    116580
     catttttaac agtcctttct tcttttagaa ttcgttgtaa atgaatttcg caccttcagg    116640
     gtttttgaaa ccataaaacc aaagcaatcc aagcaaaata gctaggtaga aaaaagtttt    116700
     cattgtaaaa atagttgctg gatgatgcaa aattagtttt attttattca taaatccacc    116760
     tcttcattgt ttcatttgtg ttacaaatat taaaaataaa cgtttaatac ttacttactg    116820
     taatacattt gtctttaaat gtctaattac atttttgtaa ggttagaaaa ataaacatat    116880
     tttgaacttg aaagtaggta cgagtataat gaaacaatag atatagcaat gttttaatgc    116940
     tagaaaagag gttggactat gattaatcaa aagaagattg caggagaaaa ggcttgtgaa    117000
     tggattaaag atggaatggt tgtgggtctt ggaacgggca gtacagttta ttacacgatt    117060
     gaaaagcttg gagaaatggt aaataacggt ttgcacatta caggggtagc gacttctgaa    117120
     gaaacaaaca aacaagcaca aaatttagga atacctttga aatcgctaaa tgacgttacg    117180
     gaaatagata ttactattga tggtgcagat gaaattgata cggattttca aggaataaag    117240
     ggtggaggag gagcactgtt acgcgaaaaa atggtagcaa gtgcgagttt gaaaaacatt    117300
     tgggttgtca gtgaggagaa gcttgtaaga aacttaggga agtttccttt acctttagaa    117360
     gtaatacctt ttggttggaa gcaggttgag agaaaacttg aaaaagagca tattcaaaca    117420
     aatttacgga aacaatcttc aggagaagtc tatgtgacaa ataacgggaa ctatattttg    117480
     gatatagtaa atcaaacttt tacggatgca gaaatgtggc aagaaaaatt agcgcaaatc    117540
     ccagggattg tggagcatgg attatttctt cattatgtgg atataattat ttgtgcgaag    117600
     gcgaatggcg aaattgaact aataaaaaaa tagttatttc ttctatataa aagaaataac    117660
     tatttttatt aaatttcata ggttaatgtt tttttcatgt ctttatgttc aattccagca    117720
     tcaaggaata atcccgagca agtttcgtat cccaattttt catagaaggg aatagctgtt    117780
     acctgcgcgc ctaattttaa ggtagttaag ccacgagact tagcttcgga ttcaatggct    117840
     tccatgattc tccggccgct cccagtaccg cgggctactt tctgggtgca gatgcgttcg    117900
     actttaccat aaccatcttt ttcgcggaat ctaccggttg caagtggtgt gccgtcttct    117960
     gcgtaatcaa caaacatcac aacagaatct atttcatcaa attcatccca ttctaatgct    118020
     ggatcaacac gctgctcaac gacaaaaaca tcatttctaa ttttaagtgc agcttgtttg    118080
     ccaatatcat ctgttacttt ctttacggtc aagttgtttc cgtcctttcc tatgcgcgca    118140
     tgctttctaa atcaaatgta ttcactggaa gcatatattg taaagaatct ttgataaatg    118200
     gctgccagta tttccagcga tgatcgccgt taaatacatg gaaataataa tcaaatccgc    118260
     gagtggttaa aatttgttct aaagatttat ttggtgatag gaaatcgagc acttcatttc    118320
     cggttgtttc gactgcagtt tcttggtcac caataatatg gaagattttc acttttgaag    118380
     ggtctacttt ttctgcaagt gtaaggattg tgtcatccac atagggggaa tgtaaaatca    118440
     cattaccaaa tgtaaaagga aaaagaagag ctgcctttaa agaaacagat gccccgagtg    118500
     agtctcccat caagaatcta ctagtaggca tttggaaaga aggaaagcgt tcttcaagat    118560
     aaggaacgag ttcaaatgct aagaatttga tatatgcatc gttttgttta ccatccggat    118620
     gatatttttc gcgacgatcc ataacagttt tgtaggggat accaatgaaa atggcttttt    118680
     gaatctgctc atttagcgct aattcttcgg agtggcgcgc aagtttgcca aactgaaaat    118740
     aatcttttcc atcttgtaca ataaaaagtg gatatttgta aagtggcgaa aaatcaggtg    118800
     gcaagcaaat aattaaatca agttcctctc caagcgattt actataaaat ttctcatcca    118860
     acattttgtt agctgtcatt ttcattctct cctttcttga aatcattcct tcattggtta    118920
     ttgttttttg aaaagttact ctattttagc atgaattacg ttaaaagaaa gaacattttg    118980
     cctatttatt tgaaaaaatt ttctttttca caggacatca ctgcaataat gctatttaat    119040
     atgctatact gaaacataca ataattctgt tttaatgata gaaagtgggg attttgaatg    119100
     agtaaagata ttgactggag taatttagga tttagttata ttaaaacgga caaacgttac    119160
     atttcttatt ggaaagacgg agaatgggac gaaggtgcgc taacagaaga caatacgcta    119220
     catattagcg aaggttcgac agcacttcat tacggacaac aatgttttga gggtttaaaa    119280
     gcatatcgtt gtaaggatgg ttcgattaat ctttttcgcc cagatcgaaa tgctgctcgt    119340
     attcaaaaaa gttgtgagcg tttattaatg cctcacatcc caactgaaaa atttattgat    119400
     gctgttatgc aagttgttcg tgccaatgaa gaatttgtgc cgccgtatgg tacaggtgca    119460
     acactttatt tacgtccatt tgttattggt gtaggcgata atattggtgt tcatgcagcc    119520
     ccagagtata ttttctctgt tttctgttca ccagttggtc cttacttcaa aggtggaatg    119580
     gcgccaacta actttatcgt ttccgatttt gaccgtgctg ctccaaatgg tacgggtgcc    119640
     gcaaaagttg gcggaaacta tgcagcaagt ttacttccag gtcaggctgc aaaagaacgc    119700
     aattttggtg attgtattta tttagatcca gctacacata caaaaataga agaagttggt    119760
     tctgctaatt tctttggtat tacaaaagat gataaatttg ttacaccgta ttctccttct    119820
     attttgccaa gtatcacgaa gtattcgtta ctttatttgg cagagcatcg tttaggctta    119880
     gaagcagtag aaggcgatgt atatattgat aaattagatg agtttaaaga agctggagca    119940
     tgtggaacgg cagcggttat tacaccaatt ggcggtattc aaaccaaaga tgatttccat    120000
     gtattccata gtgaaacaga agtggggcca gtaacgaaac gtttattcga tgaactttgt    120060
     ggtattcaat ttggagatgt agaagctcca gaaggttgga tttataaagt gaaataatat    120120
     caaaccgtcc gttcagcggg cggttttttt gtgaataaaa acaaaagtca tttcagatga    120180
     aaaaaagaaa tgactttttt attgacacat ccgcaactcg gtgttactat gtagtagtaa    120240
     taagtaatac agaataccgg tgttactgag tagtggggtt ttaataaaaa atggaaagaa    120300
     ggttgtattc aaatgaaaga agtgatgatt aaggccactg gtttggaaaa gtcatttaag    120360
     aaaacggaag tcttgaaggg tgtagatttt gaagtaaaac atggcgaaat ttttgcatta    120420
     ctaggctcaa acggtgcggg caagacgaca accatccaaa ttttagcgac tcttttaaaa    120480
     gcggataatg gaaatgcgca tatttcgggt tttgatgtga aaacggagcc ggaaaaagta    120540
     cggaaacata ttagccttac tggacaattt gcagcagtag atggactttt aacaggacga    120600
     gaaaatattt tactcattgc taaactacgt ggtgaaaaga acccggcaca aacggcagat    120660
     gacttattgg cacgttttgg actcgaaaaa gctgcggatc gacgtgcaga cacttattca    120720
     ggaggaatga caagacgact ggatattgct atgagtctcg ttggctcccc ggatgtgatt    120780
     tttcttgatg aaccaacaac tggacttgat ccggaagggc gaatggaagt ctggaaaacg    120840
     attaaaacac tttctgatgg aggaacaacc attttactaa caacacaata tttggatgaa    120900
     gcagaacaac ttgctgatag aattgctatc cttcatggcg gaacgattat cgcaaatgga    120960
     accttggatg aacttaaaaa attattccca cctgctgaag ttgaatatat cgaaaaacaa    121020
     ccatcactgg aagaaatttt cttagcaatt attaatggga aggaggaagt gaaatgaaag    121080
     ccgttcgtga tacaagtata ttatttggtc gctccatgcg tcatattatg cgtagtcctg    121140
     atacgattat tactgttgct attattccaa ttatgattat gttgatgttt gtgtatgtgc    121200
     ttggaggtgc aattcaaaca gggacagaca attacgtaga ttacttgttg ccgggtatta    121260
     ttttgatggc aattgcaagt ggaatagcct atacggcggt acgattattt acagatgtac    121320
     aaaaaggatt atttcaacga tttcattcta tgccaattag tcgatcttcg gtattatggg    121380
     gacatgtttt aacttcttta gtttctaatg ctatctctat tgtgctcatt attctagttg    121440
     ctcttcttat tggttttcgt tcatcggcgg gaatagtgga atggcttgcc gtagcgggta    121500
     tcttgctgtt attcacttta gcgctcacat gggtcgctgt gattcctggg ttgacagcta    121560
     aatcagttga tggagcgagt gccttttctt atccactcat atttttacca ttcattagtt    121620
     cagcttttgt tccaacggat acgatgccaa ccgcaatacg agtttttgca gaaaatcagc    121680
     ccgtgacagc tattgttaat acgatacgtg cattgctgta ttcagaacca atcgggaatg    121740
     atatctggat tgcacttgca tggtgtgtag gaattaccgt tgttgcctat gtttttgcag    121800
     taactattta taaaaaaatg gtataaaata aaaaaggttg gctccgcaga gccaaccttt    121860
     tatttttcgc cggaaatatg ttttttcggt aagataaaat gaataaaata actaacgata    121920
     cagcaagcaa acattaccca gaaaaccgta tgaagcccgc tatataaaat atctcgaagt    121980
     ggatcaacaa ggtctgtact aacgttaccc gaagtttgtg ggctaattaa ttggtttaaa    122040
     ttactgcgat tcacttcact gccagctgcg gcgcggaact cgcttgtaag aactgagttg    122100
     aagatagttc caaatacagc cacaccgatt gtttgaccaa ctgttctaaa aagtgtatta    122160
     gaagcagtag caataccagt ttggaatcgc ggtacagcat cttgaacagt gactgttgtc    122220
     gtggtaaaaa ttatcccaaa accaaatccc ataaatgcac tatttaaata gaagaagatg    122280
     tcatttgtgg aagcggggaa taaggctaaa attaatccac ttgccgccgt aattaaaacg    122340
     ccaatgccaa ccgtatgccg atttccaagc gtcattaaaa gtttgccgcc gataaatgaa    122400
     ccaattatcc atgtaaccga aagcggtgca agcataaatc cagcaatcgt agccccgtgc    122460
     ccaagcattc cttgtgccca cattggaata tacacgttaa tcccaattag gaaggcacta    122520
     atcaagaaac caattaagtt cccaattaac accactggat ttttaaataa tacaaatggc    122580
     ataatcggat cttttgcacg tttttcgaca aaataaaaag caataaataa cacaatcgaa    122640
     acggcaaaaa gaataacgac gagcggttct gtccagttga gcgattcccc ggctcgctgt    122700
     aacgcaaata ataaaccaag tagtgccacg gtaaagagcg aggcacctaa atagtcaatc    122760
     ggtaatttca catgttccac tttttcgcgt aaataaagca aaataagtag gattgtcaaa    122820
     atgccgattg ggacattgat aaagaaaatc caatgccatg aaagttggtc tactaaaaat    122880
     cctccaacaa gtggtccaaa tacaccagcg ataccccaag cggaacccat gaagccaagt    122940
     acttttgctc gtttttcaaa tggatacacg tctgcgataa tcgtcatagt agatggtaaa    123000
     atcccacctg ctccaatacc ttggatcgcg cgaaaaataa ttaattgttc catattttgt    123060
     gcaaatccac aaagtgatga accaataata aaaataattg tcgcaatcac aaaaatattt    123120
     tttcgtccat acaaatcaga cagttttccg taaatcggaa ccgtcactgc tgatgttagc    123180
     aaataaacag aaaaaatcca gttcattaac tctatgccgt ccaactgact tacaatcgtt    123240
     ggcatcgcag tactcacgat ggtaccctca atagctgcca taaatgttgc gacaaatacg    123300
     gcgatggtaa cggcttttac ttttgtttgt tccaaaaaat tccctccctt ttcgtctacc    123360
     gaattatagc atataaaagg actaatttgg gaaaaagtta atcctaagaa atgcgcacat    123420
     tcaagataag cgctataata taatagaaga aagcgaacta aaggaggaat ttttttgtca    123480
     tacgaaccaa atacaaaaga aaccatgcaa aaaattaaag aattaacatc tatcccaagc    123540
     ccaacaggca acacagggaa aatcatcgaa aaactggcaa aagatttaga tgcttcaaaa    123600
     atcccatacc gcttaaacaa taaaggcgga ttaattgtaa cgcttcctgg gaaagacgaa    123660
     acgaaacatc gtatgctaac cgcccatgtg gatacgcttg gagcaatggt taaagaaatt    123720
     aaagcagacg gacgattact tttaacgtta attggcggct atcgttttaa tgcaattgaa    123780
     ggcgaatatt gtaccattga gacaagcgct ggagatttgt atagtggaac tatcttgatg    123840
     caccaaactt ctgtccatgt gtataaagat gcagggactg ctgagcgtaa tgacaaaaat    123900
     atggaagttc gcttagatgt aaaagcatta gatgcagaca aagttcgtgc tcttggaata    123960
     gaagtaggcg atttcgtttc ctttgatccg cgcgtgcaaa ttattaatga tgaatatatt    124020
     aaatctcgac atttggatga taaagcaagt gtcgcgattt tattacaact aatcaatcat    124080
     attcacgaaa acaacctgga gcttcctcat acaacccatt tcctaatctc taataatgaa    124140
     gaaattggct atggtggtaa ttctaatatt ccggctgaaa cagtggaata tttagctgtc    124200
     gacatggggg cgcttggtga tggtcaaacg tctgatgaat acactgtttc tatttgtgca    124260
     aaagacggaa gtggcccata tcaccttggt ttgcgcaaac atttagtgga gcttgctaaa    124320
     aagaataata ttgattataa agtggatatt tatccgtttt atgcatctga tgcgagtgcg    124380
     gcgattaatg ctgggaacga tattatccac ggtttgattg gaccaggaat tgatgctagt    124440
     catgcatatg aacgcacaca ccgcgattca ctttatcata cagaaaaatt agtttatgca    124500
     tatttatttt cgaatatatt gaaataggag gaattccata tgaatgtcca tgatttttct    124560
     gaaaaagcaa tgaacggcaa agaaatagct ttaagtgatt ataaaggtaa agttttactc    124620
     atagtgaata ccgcgagtaa atgtggctta acacctcaat tagaaggtct tgaagcaatg    124680
     tataaaaaat tgggtggaga taattttgaa attctcggtt tcccatgtaa ccagttttta    124740
     cgtcaagacc ctggtagtga tgaggaaatt ttagaatttt gccaaatgaa ttatggtgtg    124800
     actttccaaa tgttttccaa aattaaagta aaaggcaaag atgccagccc actttataaa    124860
     tatttaaccg aacaaactgg tggtaaaaaa gtagaatgga actttgcgaa atttttaatt    124920
     gatgaaaatg gagaagttat tgaacgtttc ccatctaaaa tgaaacctga agattttgag    124980
     gataaagtgg aagcacttgt tgcgaaagta aataattaag ggagactcgg taatgtcatt    125040
     gcggcactac cgagtttttt tgcatcttag ttagttaaaa atgcatgtta ctgaaatcag    125100
     cttgtagttt ttgacgtgac gtttataata aaagaaaaag ggaggcaacc agatgaaatt    125160
     ccatgtgaag caaaataata atttagcagt tggtgaagtg gatgtgtatt gccatcccga    125220
     taatttagaa gaagtaacga acatcgtaat gggaatagat gagccaacag aaaaaatctc    125280
     tgtcaaaaag gacggcgcca cttatttact agaaccaaaa gccattttat attttgaggc    125340
     agtcgaaagt aagatttttg tttatacgga aaaagaaata tatgaaatcc attggaaatt    125400
     atatgaattg gaagaaaaat tcaaagatag ttcttttttc agatgttcga aatcaatgat    125460
     tttaaatatc gaatggattg aaaaaattgc tccgggtttt cacgggaaat ttgaagcgaa    125520
     actttttaat cgggaaaaag tgattatatc tcggcaatac gcgaaggtct taaagcaaaa    125580
     attaaacatg ggaggtaagc ggaaatgagt actaaactaa ttcaatttat acaatcagca    125640
     tgcattattt tttctgcctc tattatcacg atgatctgct cttacatcgc aactggagaa    125700
     tcagaaacgg tcgcaatccg ggatattttt attatgcttg gttttagcat tgtgacaacg    125760
     ttcattcaac aattattttt taataattca gtgaaaacga aacttgcttt ttatagtcgt    125820
     ttgattgctt tcttcctctt tattggcgca gcgattttag ggcttgggtg gttgctggat    125880
     tggtatcata acatagctgg gtttatgatt atttttggct ttatttgtgt gactttcctt    125940
     gtgatgcata ttttcttcag cttccgtgat gtgaaattca gtaatgaaat taatcaaaaa    126000
     ctagcagaaa tgcgagaaag ggagacaaaa tgataaaatt gaccaatgta gttaaaaaat    126060
     ttggcaaaat cgaggcagtc aaagggatta atttagaagt tgaaaaaggc tcgttatttg    126120
     cttttctagg cgagaatggt gctggtaaat cgactacgct tagcatgatt tgtacagaaa    126180
     gcgaacctac ttcaggagaa atttatattg atgatgaaaa attgacattt aaaaatcgta    126240
     aattatttag acaaaagcta ggcgtagttt tccaagaaaa tgtgttggat gacttactga    126300
     cggtgcgcga aaatttatat aatcgcgcta gtttatacgg gaaaacaaaa gcagaaatta    126360
     cggaacgatt agcgctagtt tcttctatta tggggattga ggatatttta aatcgtcgct    126420
     ttgaaaaatt gtctggtggt caaaagcgtc gcgcggaaat tgctagggca attatgcatg    126480
     atccagaaat tttgctgcta gatgagccaa cgaccgggct agatccaaaa acaagagtga    126540
     gtgtatggaa aattattgat tatttgcgag aagaattagg aatgacggtg tttttgacga    126600
     cacattattt agaagaagct aaagatgcgg atcagttagc tgtaatccat aaggggaaaa    126660
     tcatcgcgca aggtacacca acaaacatta gaagccgttt ttctgtagat aaaattttct    126720
     tttacgatgc gaaggtagca gaacttcaaa aaataatgaa aaaagcaaat ttaccattta    126780
     aagtttctaa agcaacgatg cgtgtggatg tgataactca agatgtcgaa atattggcta    126840
     ttttaaatca agcagcggga ctttatggtt cttttgaagt gattaaaggg aacttagatg    126900
     acgcttttat ttcgatgatt aaggaggagt ccgatgatta gtcgtaattt aaaaatctat    126960
     tttcgtgata gaactgctgt atttatgtca ttacttactg ttttaattat tattggactg    127020
     tatgcgattt ttttaggaaa taatatggaa gagatgttca aacaggcttc tggaaaaacg    127080
     gtaggcatac aagaattagt gaatacgtgg gtgatagcag ggattttatc cattacacct    127140
     gtaacggtat cgttggccgt tttttctttg aaagtgcatg atgaagaatt aagtattgcg    127200
     agaagctttg cgataacatc tgcttccaga tggcgtattg ttattagtta tattgttagt    127260
     ggactagttg cttctttctt gttgtctgtc ataacacttt ttgttgggga aatgtatatt    127320
     tggttgactg gcggagaatt tttaccgttt gagagctgga ttcgtttaat tgggattatt    127380
     ttaattaatg ttttatgttg tagcagtatt atgttcttta tcgccagttt ggtgaaaaaa    127440
     gcgagtgcct ttagttccgt ttcgacgatt gttgggactg ttattggttt tattgccggg    127500
     atttatttac caattggttc acttccggcc gcggtgcaaa cagcgatgaa atgttttcct    127560
     ttcacatacg gagcttctac tattcgagaa atcatgacaa aagagccttt gaaagaagtt    127620
     ttcgcgggga atacaggtgc gatggatgcg acaaaagaaa tgattggaat tacgatttat    127680
     tggggcgata aaacagttac aacagggctt agtttactta ttttaagtgc ctttgcagtc    127740
     gtgtttggtg tgttatctgt catcctcatg aaacgacaaa caaaataatt tttgaataaa    127800
     aaaacagccg aaattctcct agttatgcta tactaatgga atgtgaatga atctaggagg    127860
     aaaataacaa tgagtcaaga tttgcaaaaa gaagttgctt cacgcaaaac gtttgcgatt    127920
     atttctcacc cggatgctgg gaaaacgacg attactgagc aattattatt attcggtggc    127980
     gttatccgtt cagctgggac tgtaaaggga aagaaatctg gaaagtttgc gacaagtgac    128040
     tggatggaaa ttgaaaaaca acgtggtatc tcggtaacga gttctgtgat gcagtttgat    128100
     tataatggtt caagaattaa tattttggat acaccgggtc actcggattt cagtgaagac    128160
     acgtaccgga cattgatggc agtggatagc gcggtcatgg ttatcgatgc tgcgaaaggg    128220
     attgaagctc aaacactaaa actattcaaa gtttgtcgaa tgcgcggaat tcctattttt    128280
     acttttatta acaaaatgga ccgtcaaggg aaaatgccac tggaattgct tgctgaacta    128340
     gaagaagttc ttggcattga atcgtatcca atgaactggc cgattgggat gggtaaagag    128400
     cttgctgggc tttatgaccg ttaccaccgt gtgattgagc aatatcgttc tgaggaagat    128460
     gagcgtttct taccacttgg tgaagatggc gatttgaagg aagcgcacgc tattcaaaaa    128520
     tcactttatt acgatcaagc tctggaagaa attatgttac ttgatgaggc tgggaatgac    128580
     tttagtcgcg aacgtattat tgcgggtgaa caaacaccag tatttttcgg tagtgcctta    128640
     acaaactttg gtgtagaaac tttcttgcgc acatttgttg attttgcgcc tgctccttct    128700
     agccatgaat cgaatgaagg tgtgattgaa gcagataatc caaagttttc tggttttatt    128760
     ttcaaaatcc aagccaatat gaatcctgct catcgtgatc ggattgcctt tattcgaatc    128820
     tgttcaggtg aattcgaacg tggcatgaac gttacgttaa cacgaactgg aaaaagtttg    128880
     aaacttgcta actcgacaca gtttatggca gatgaccggg aaactgttaa tcgtgcggta    128940
     gctggtgata ttatcggttt gtacgacaca ggtaattacc aaattggcga tacgattact    129000
     aatggaagta aaaagctcga atttgaaaaa cttccgcagt ttacaccaga attatttatg    129060
     cgtgtttatg caaaaaatgt catgaaacaa aagcatttcc ataaaggcgt agagcaactc    129120
     gttcaagaag gtgcgattca attatttaaa acatggcgca cggaagaata catcattgga    129180
     gctgttggtc agttgcaatt tgaagtattc gaacacagaa tgcgcggcga atataattca    129240
     gaaatccgga tggaaccaat cggtaaaaaa atcgctcgtt gggtcaaaga agaagatgcg    129300
     gatgaaaaac tatccaccgc tcgaagcatg ctcgtaaaag accgtttcga ccaaccgtta    129360
     ttcttattcg aaaacgaatt cgcgattaat tggtttaatg ataaaaatcc agatattgag    129420
     ttaacttcat tactataata gctgcaacct atttgtattt tcgcaaatag gttgtttttt    129480
     tcttgacaat tttttgaaac gcgctataat tagttagaat tctaattaat aaggaggaat    129540
     actcgtgaga agagagaaga cgatggatac gttgattcgt tcgattatga ttaaatccaa    129600
     acgtaaaatg gatgcaaaag ttgctcaatt tgggctgaca acacaacaag ctagagttct    129660
     tggattttta aatgataatg cagcaaatga aattatccaa aaagatcttc agcgaatctt    129720
     ccaaacacgt ggtgcaagta tcactagcct cattcaagga ctcgagaaaa agcaattaat    129780
     ttcacgcaaa ccaagcattc gagatggcag agaaaaagtg gtcactttaa ctgaagaagg    129840
     taaacgaatc gtggacgaat ttaatgaatc cttcccgcgt gaagatgata aagcgaaaaa    129900
     aatcctttcc gctgacgagt ataaaatctt tattgatcta cttagtaaaa ttgatgacaa    129960
     tacggaataa aaaatttaac tatatagtta gaattctaac taattttaag ggggaaccaa    130020
     aatgaaacac tcagataatt attatttaac aaaagcgagc attcctaaag cgatagcgca    130080
     cttatcgatt ccaatgatgc tcggaatgtc ggttggggtg atttataata tcgtcaatgc    130140
     gttctttatt ggtttactgc atgatacgtc gatgttgact gctgtaacac tcggtttacc    130200
     aatgtttacg attttaatgg cgattgggaa tatgtttggt gttggcggtg ggacgtatat    130260
     ttctcgcttg cttgggaaag aggagggaac caaggcaaag caagtatcgg cctttgtttt    130320
     atatggaagt ttagtattag gcattctatg cgccatctta cttggctttt tgattaatcc    130380
     agttactcat tttcttgggg cggatgcaac gagcttttta cacacaaaaa attatacgtt    130440
     ggcgcttcta atttgtagtc cgtttattat tgcgaatttt gctttagaac aagtggttcg    130500
     ggccgaggga gcttcgcggg tgtctatgaa cgggatgctg attggtacgg ttgttaattt    130560
     agtatttgat ccattgctta ttttgtattt tgattttaat gtggtggggg ctgcagtttc    130620
     ggtaggatta gcaagcttat tttcgctgat ttactatgct tggtatttag agaagaaaag    130680
     tgattattta tccattcgtt ttaaatggtt tcaagcatcc aaagaaatcg ttcaaaacgt    130740
     gtttaaaatt ggtgtttcag agttgctctt atcgttattc ctcattgtga caacgctcgt    130800
     tttaaatcat tattcgatga tttacgggga aggggtggtt gctggttttg gcgtggcgct    130860
     tcgggtggtg cagctccctg aatttatttg tatgggactt tacatgggga ttattccgct    130920
     gttagcttat aattatggtt cgggtaatat tgcacggttt gaaaaagcaa tacggtttac    130980
     tgctattagt attgggctta ttgtgctctt gctttcgagt ctggtattta tcttccgttt    131040
     ccaagtgatg cacctattta gtgacagtca aagtgtgata acgcttggtg tgcatattat    131100
     ggttgctatg ctgatatctt ctcttttcag tggatttaca ggactgttta cgagtacttt    131160
     tcaagcaatt gggaaagcta ttccggctac aattatgtct gtttcacaag gcatcatctt    131220
     tattccagtc atcattttag gacaacatta cttcggactt atgggcgtga tttggtcctt    131280
     gacggcgact gaaattctta cgtgcataat cggtgtgaca ctattcacaa tccataatat    131340
     taaaatagct agtagcgcaa aaacgaaaga cttagccgtt taaaaagttt gtgagaaaaa    131400
     ttagttgacg agaagttcta tattatggta ttattctcta ggtaatcata tatcgttctt    131460
     tgacaaatgt cagaggggag tagcgctgat tagcttttta atcaggataa agtcgtcatt    131520
     acatgataga gatatcatcg gttttatcac atttaacttt aaatgttagc gagacctttg    131580
     cctttacggg caggtctcgc ttttttgttt cttcaaaata ggagatcttt gacattttaa    131640
     tagaacaaag gaggaaaaaa attagtggat acagcaatga ttttagagta cggttgggtg    131700
     ttacttgtcc taatcggtct tgaggggatt ttagcagcag ataatgcagt agttatggct    131760
     gttatggtca aacatctccc agataaacaa cagaaaaaag cgttatttta cggattaatg    131820
     ggtgcctttg ttttccgttt tggcgcatta ttcttaattt cctttttggc aaacgtttgg    131880
     caagttcaag cgcttggtgc cgcatattta ctatatatcg ctattagtca catttggaaa    131940
     catgcaaaag gaaaagacgg agaaaaagag aagaaggaaa aagctggctc tggtttttgg    132000
     atgaccgttc taaaagtaga gattgctgat attgcgtttg cgattgattc catgcttgcg    132060
     gcagtagccc ttgccattac tcttccagaa acaggatggg gacacattgg gggaattgat    132120
     accgggcaat ttgcgattat gttcttaggt ggacttgtcg gtctaattat tatccgtttt    132180
     gcagcaactc aatttgttaa attactaaaa agctatccaa gtctcgaaac agctgcattt    132240
     ttaattgttg gttgggtagg cgtgaagctt gttatttata cactagctca tccaagtctt    132300
     ggggtaattc cacacagctt ccctgagtca acgctttgga aattaatttt ctggggtgtg    132360
     atgattctta ttattgtatg gggatggttc gtttcctacc gtagtaagaa aaaaacagaa    132420
     acaactaaat aatttttaat agaccagaag tgcatatttg tacttctggt tttacataca    132480
     accagatgct gaaaacacaa ttttatgata gagtagaagg atggtgaatg aggaatggat    132540
     gtttctattt ggggcgaata tgcgttagtt tttcttgttt tagtagtact tgaaggaatt    132600
     ctttccgcag ataatgccgt agttatggca gtaattgtca aaggtttacc gcatgataag    132660
     caacgaaaag ccttatttta tgggttagtt ggcgcatttg ttttccgttt tgttgcacta    132720
     tttttaattt catttttagt aaaaatatgg gaaatacaag caatcggcgc ggtttattta    132780
     ttgtacttag caattaagca catgtggcgc cttaaaaaag gtaagcaaga agaagttaaa    132840
     gaagcatcag aagccaaatc aacttccttt tggggtgtag tagctcgtgt ggaattgacg    132900
     gatatagctt ttgcactgga ttccatgtta gctgcagcag cgttagttgt tactttacca    132960
     gatttaggga attttgatat tgggggaatg aacggtggac aatttatcgt gatgttcctt    133020
     ggtggtattg caggacttgt cgtaattcgt tttgcggcca cacaagtggt taaattatta    133080
     gagcgttacc ctacacttga aacagcagcg tttttaattg ttggttgggt aggtgtgaaa    133140
     atggcggttc taacgctagc acatccatct gtagcaatta ttccaggaga ttttccagat    133200
     tcagccgtct ggaagctgac attctggtcg gttatgataa taataggttt gggtggttat    133260
     atcattgcga gaaaaaaaga gaagaaaacc aaaagagttt gaatatgatc aagaagtaaa    133320
     actacgcaga agattaaagc ttgttttggc acgcatgacg cctgttcaag tgattattgc    133380
     gtattatttt ctggcagtga cgatttctac tatcgtatta agcttgccat ttacgttaca    133440
     aaaaggggta aaggtatcgt ttattgatac actttttacg gcggcgagtt cagtgagtgt    133500
     aacaggatta acgacagtag atgtaagtca gacatatagc acggccggca tttgggtatt    133560
     gatggcgatt ttccaaattg gtggactcgg tgttatgatg attagtacgt ttttctattt    133620
     aattttaaaa agacgaattg gattgaaaca acgccaatta attatgacag atactaacca    133680
     atttacaatg agcgggatgg ttcggatgct tcgtgagatt ctagtgctta ttttcggtat    133740
     tgagttaatc ggggccttga ttttagggat ttactttatt cctctgtatc cgaatttttg    133800
     ggatgctatg ttccaaggat tatataattc tgtttcactc gtaaccaatg caggcgttga    133860
     tatcaccggt aaatcgctaa tgccatttgc aaatgattat tttgttcaat ttatttcgat    133920
     tctgttgatt attgcaggtg cgattggttt cccagtgttg cttgaaacgc ggagattttt    133980
     atttgagaaa aatacgttaa ttccgtttcg cttttccctt ttcgtgaaag taacgacgct    134040
     aacttatttt gtgcttttaa ttgttggtgg tttacttatt tggctatttg aatatcatca    134100
     tttctttagt gggaaaagtt gggatttcgg tttctttaat tcgatgttct tatcagcgac    134160
     atcacgaagc gcggggttac aaacgattga tagtggggca ttatcgatat ctacgttgtt    134220
     acttgtctca ttcttaatgt ttattggagc atctccaagt tctgttggtg gtggtattcg    134280
     aacgacaaca tttgcgatta cgattttatt tatttattcg gttatccgag gtcggaagca    134340
     tgtgtacatt tttggtcgtg agcttcatca agaggacgtg cggaagtcgc ttgcggtaac    134400
     gttagtagca ggatttttga gtatttcggc tatagtggtt ttaatgcaga cagagactgc    134460
     ctcgttaatt gccgtcattt tcgaagtgtt ttcggcattt ggtactacag gactttctgt    134520
     agggttgaca cctgatttat ctacgccagg taaaattatt attattgcat taatgtttat    134580
     tgggcgcgtt ggtattatgt actcgatgct aagtttaaga aataaaaacc aacctaaaaa    134640
     tgcgattcgt ttaccaaaag agaaaattat tactggttaa atataaaagc cattctggtt    134700
     gcagaatggc ttttttgtcc atgaaaaaac ctcttgatca gagcgaccaa gaggtgattt    134760
     ttaatatttt gattttggaa cagggcgtct gaaaataccc attaaaccag ttaaagtgat    134820
     taaaattccg gagataatcc aagcagttcc gataacgaag aagagtacga taccgataat    134880
     tactaagata acaccccaac cacgtggagc tgatttgatt agaagggaag caattaatgc    134940
     aactacagat gcaattaatg taatccaccc tagatttgct aactcgttac ctaattcacc    135000
     aggtaaataa gtaaatgttt gtatataatc tgtgactgaa tctccataat taataatcca    135060
     aaagccaact agaatcccaa tgatagagcc aattaatccg ataataattt ctggttttct    135120
     tgaacccata atacaacctc ctttttctat ctatacgttt aataactttc ccgttttgtt    135180
     aagcggctaa acacatctcg cagcatagat accctaagtt cgattaccgg ttgaacgaat    135240
     atttttacca atcgactcga taataatacc gttaaaacaa aagtaacgac gaatagaagt    135300
     aaaaatgtcg acgggctata ttgaaagtca gtctggctac cttcacgaaa aaacttaata    135360
     aagaagccat gtaacaaata aacatataac gtatttttac cccatttagt gaaaaataac    135420
     ctctttctag gaataaaact gaaaaaagct gcaatcgaac caaagctaat caaatagaca    135480
     agcgcgcgaa tgaatagccc tagcgactta acttccacaa agtttgcata aggcttagaa    135540
     cctaaaaacc acttatcatt taagttagga tgaagcgtga taaaggataa aagtaaaaca    135600
     atgaaaatgc ccccaagaat catgacaaaa tgcgttttaa ggtagtaaaa atgctctttc    135660
     tttaaaaaat agccaactaa gaaaaacggg aaaaaaacaa gtgtccgaga taaactcaaa    135720
     taccccccaa taatatcaaa atagccagca accaatccaa cgaagagagc aatgcaaatc    135780
     gacttccaag gcttgatttt tgcaaaaata aataacatta tattccagaa aaacaaactt    135840
     agtaaaaacc aaagtgacca ttcaggatca agcaattgga tagaaagatt atctttactt    135900
     agaagaaaat aataaaaaat actataaatt agctgaaaaa atacataagg taaaataagc    135960
     tttttcatcg tcttttttaa ataaccaggc ttaccaaagc ttttagcaaa aaaaccggat    136020
     attagtacga aagccggcat atggaaggtg taaatgtaaa tataaagtac gcggacgcca    136080
     gcataatccg cgataaatgt ttgaagaaaa tggccgaaaa caactaagaa aatcaaaata    136140
     aacttggcat tatcgaaata actttcccgc tttaaggcgg attgtgtcat aaaaaaacag    136200
     tcctctctga tctaggttga catactattg tttattttac cctgaattct gtaacgctta    136260
     tccaacagtt aagtaacaaa aagtatcaaa tattaacaac ggatgacagc tatttgcgaa    136320
     tttaagaggg gcgtgctatc tttaggacaa taaatcaagc aggaggagcg atgatatgct    136380
     aaaacgtcag aaagcatcgc cagtcggaga attatttata actattgaag atggctgtat    136440
     tatgaatatt tcgtatgata agccaagaaa ttgggagctt ctggatggga atataatcga    136500
     aaaggagctt tttcaagaat taatgatcca actagcaagt tattttgaag gcgaaagaga    136560
     gaattttgat ttgccgatgc ttctaaaagg aaccgatttt caaaaaaagg tatggcaggc    136620
     attgagtgaa attccatatg gcgctgttgt cagctataaa gatattgcaa tttctgcggg    136680
     gagccctaaa gctgtacaag cggtaggaca ggcgaatcgt gctaatccaa ttcctatcat    136740
     tattccatgt cataggtgcg tgaaaagtaa tggggaactt ggtggctata acgggacaga    136800
     tgttgataaa aaacaatatt tacttgcatt agaaaaaggc ttgagtttaa gttaactcaa    136860
     gcccttttta ttacgctgtt acttgttctg ttatggtgat ttctttgtta tcgtttagag    136920
     ttgcaacgag atttttcgct tctggttgat caattaaact gtcagcaata gtatcttcca    136980
     ggtgctcttg gatagtccgg cgtagtggcc gtgctccaaa tttaggatca taaccaagat    137040
     caatcaaatg ttcttttact tccttggaaa catcgattgt cacgccttct tgagcgagca    137100
     tttcatttaa gtcaacgagc attaaatcaa taatttgtac taaatcgtct ttttctagtg    137160
     atttaaattc aatgacgcta tcaagacggt ttaagaattc tggtttgaag tatgcgccta    137220
     atttcgcaag gatgtcagag cctttttcaa gtttagtttc tgttgttgta ttaaagccga    137280
     cagaagcctc tgtatctgtc gcaccagcat tacttgtcat aataatgact gtatctttaa    137340
     agcttactgt acgtccttgt gaatcagtta gtcgaccatc ttctaaaatt tgtaggaaca    137400
     tatgttgaac gtctggatgt gctttttcga tttcgtctaa caaaatgatg ctatacggat    137460
     tgcgacgaac tttttctgtt aattgtccag cttcttcgtg accaacatag ccaggagggg    137520
     aaccgattaa tttagagatg ctgtgttttt ccataaattc gctcatgtct aaacgaatca    137580
     tcgcttcact agtaccaaac aattcacgag ctagcgtacg accaagttct gtttttccga    137640
     caccagttgg tccaacaaat aggaaggaac caattgggcg attttttgat ttgaggccaa    137700
     cacggctacg acgaattgct ttagctactt ttttcacggc atcttcttga ccaattactt    137760
     ttccagttaa gttacgttct aagtttttca ttttggattg ctcgtcttct tgtaagcgtc    137820
     ctacaggaat gcctgttttt tcttcaataa tcgcttgtat gtctgatgct tgaatgacag    137880
     ggcgttctga gaaggaattg cttgttttat tttcttctaa gcgagtaatt tcgtcacgaa    137940
     ctttggctgc cttttcgtag tcttccattt gaagagcttg atttttttca tcttctaaac    138000
     gggcaacacg ttcgcttacc gtattttcgt ctagtttttc aatggataga ttatattttg    138060
     agccaacttc atccattaaa tcaattgctt tgtctggcaa atgacgatct tggatataac    138120
     gagcgcttaa ttcaactgct gctgttaatg cttcaggtga ataaactact tcatggaaat    138180
     cttcatattt tggttttaaa ccatttaaaa tagttagcgt ttcttttgtg gatggttcgc    138240
     ttacagttac tggttggaag cgtcgttcaa gtgcggcatc tttttcgatt gtgcggtatt    138300
     cttttagcgt agtagcacca atcatttgca aatcgccgcg agctaaagct ggttttagaa    138360
     tgtttcctgc atccattgac ccttctgcgg aacctgcccc aacgatagta tgcacttcat    138420
     caatgaagag aatcgtgttt ttacgttctt gaagttcttt aattagttgt ttcatgcgtt    138480
     cttcaaattg accgcggata cctgttccgg aaacaagcga agcgacatca agtaagataa    138540
     cttctttgtt cattagtttg cttggaacgt ctcctgcgac aattgcattt gcaagtcctt    138600
     ctacgacggc agttttacca acacctggtt caccgattag gacgggatta tttttattac    138660
     ggcggttcaa tatttcaatg acacgcttaa tttctttatc acggccaatg acagggtcga    138720
     gttgctcgtt tttcgccata tctgttaagt tagtcccaaa ttcatctaat atgccattac    138780
     caccgccagc agtttgtgtt tgtacttgtg cattagcttg gcttctttgt tcacggtttg    138840
     cttggtttgc agcaccactc aattgacgaa aaatatcgtc aaacggggag ccacttgctc    138900
     ctgggaactc attcgaccca aagtttgctt gatttctaac ttctgcataa caagaggcac    138960
     aaagcggcat ttccacacgc ttgccattaa tattcatata tagttggatt gttgctggat    139020
     tttgattaca tttttcacag ttcatatata atttcctcct tttaaaaatg agaaatgaaa    139080
     ggtcttgact ttgactatct ttgaccttat gactttatta tatactgacc tattttgact    139140
     ttcaagtatt ttgcttactt tttttataaa aaaaacgccc ctataaagga acgtttttgt    139200
     gctattttta ataaattggt aaggctgcga gtaacaaaaa cgcaaaggtt aaatgcgata    139260
     aatatagcat aagtaggctt ggacgatagg agtacatgat attccatacg agcgaagcga    139320
     caaagatacc aataatcgct gcaaaattgc cactcgggaa catcattacc atacataata    139380
     acgctgcaaa aacattcgag aaccaaggat taaaataatg gtttaaacgt tttaatacga    139440
     agccgcgcca gaaaatttct tctcccggga tgatggcaac gataagtagt agccaaatta    139500
     tcaaagaatg cgtcgaatac ttattaaaag cagcttctac agaatgttct agaccgcctg    139560
     gcattacttt aataataaag gcgcctatgt aaaaaataat ataaaggaca attccggaaa    139620
     aaatacctgg caaaatacct ttaacgaacg aaaactcttt ttttaaatca tcattaaaaa    139680
     tcacaaaact aagtaaaaat aacatcccag ctccatataa ataccaaaaa acacgtggga    139740
     actgatatgt taatataacg agtagggcgc ataaaacaag gcccagtaca agtttataat    139800
     cgatcttgat gcttttcaaa atactttaca cctcttctta acaaatactt ctcatactac    139860
     tttaaaacaa atgaaatcgt ttggcaacaa ttaaacaaaa gataagataa aagttgtgca    139920
     atttaataaa tcctatataa ttaaaaaata ggagtggttc atagatgtta gaaaaaaact    139980
     acaaattttt actttggatt tatatattct ggtttttagg tagcgttttg ttagtatcct    140040
     tacacattat tccaccagag ctaaccgcag tccaatcgtt atttttagta tttactggtg    140100
     tttttgcggc tgttttcttt atcatgcagt atggaaagtg gctcggttca gcaattacgt    140160
     tacttatttt tgttgtaagt acttgtattg aatggatgca actaagttat acagatgaat    140220
     atattggttc gacattaggt gggagtgttt acgggattcc tattacgatg ggctttattt    140280
     gggtcggaat ggttgccggg acgcatatta tcgctcgaga aattacattg aaaattaata    140340
     ttgactggat tcgtggaggc atttactcgt ttatcgcagc aacaatggtg atgatttttg    140400
     aagttttaat cgaaccaatc acgatgcaat ccaaacagct ttacatcact cagaacggct    140460
     tcacgatttt gcagctgtct gattttatta attggtggct cttaggcctt attttacact    140520
     taatgattta ctttattttg agtttgacgg atagttggga gcgcctgaaa tatccggatt    140580
     taaaatcaga aattgtgatc gtttattgga ttattatcgc ctttttcgta tttttgtcct    140640
     tttaccttga tttatggacc tctattgcga ttattatcgt ttccaatatt attttcacgg    140700
     cttgttattt tttcagtttg gaaaaagaaa cgcaaactaa aaagaaatcc gaatgattac    140760
     tcggatttct tttctttttg taaaaatttc tgggttgcga tttgcgcatt ttcaataata    140820
     aatggaagag agctacccga cattgcgcct gcaccaatta caaataagtt tttgaattta    140880
     ggcgattttt tggaagggtg taagtagccg tgctggcgcc acaaatgctg taaaccaaag    140940
     atcgcaccgt gcttaacatg atatttcttt tcccagtcta tcggtgtgat aatatattct    141000
     tcttcaattt gcgattctaa atctggtatt tctaaacgtt ctttgactgt ttctagaact    141060
     aattgacgaa aagcaggtgt ttcttttttc caatcaatat tactcgtatt gttaggcaca    141120
     ggaaccataa ttcgaatact agaatgatta attggcgcca ttgtattatc agttgcagaa    141180
     ggattagtca aatgtatagc gatatcctta gagaggattt ttttatgcat tgtattatgc    141240
     gcaaattctc ggtaattttc agggaaaata attgattgat gcgaaaaagg taacactgtt    141300
     tttaaaccaa gataaaggat aaaggcagaa gaggagtatt ctttagtgtc caatttatct    141360
     ggatgctcat ttgttaaaga ataaatgaaa tctaaattgg tgaaataata atctgcttca    141420
     atagtttttc cgttggcaag aacagcgcca gttatttctt tgccgttcga ttcaaactct    141480
     gtcacttcgg aattgaagaa aaacttccct ttattttctg taactacttg ttgcatcgct    141540
     tcgacaattt tattttgccc gccaattgga tgaaaagttc cataataata ttcggaaaat    141600
     ggaataatac tataagcagc tggaatatcc cacggagaca tgcctaaata ccgcatctgt    141660
     aaggaaaaag cgaggcgaag gtacttacta ttaaaatatc ttgataaatc atccatcaac    141720
     gatcgtccaa gtgtcaaact aggaatagcg cgcaaagttg taggacggaa aaaatcaaat    141780
     aaagaactat aattaaattg attgagcggc gaaatatata gcattttttt cgtgttttct    141840
     ttcataaaac ggtcaaaacc atcttcttcg ccaggaaagt aagtttggat aaccgctttt    141900
     gtctcagatt gatcactata aagtggaaag gtgatatctt taaaataaag ggtatgaatt    141960
     ggattgattg gtaaaagcga aacataatcc aaaatattac gattacaatc cataaaaaga    142020
     gaagtcaaaa catgcgtcat tgtgagtgcg gaaggcccta catcaaatga gtatttaccc    142080
     attctgtgta acgccgttct tccaccaatc cgatcatttt tttcatagat gtttacttga    142140
     tagcctagtt gacttaatag cataccggcc gccaaaccac caggtccagc tccaataatg    142200
     gcaattttct ttttactatc caaattcaaa cgctcctttg ccccgtttat atacatataa    142260
     aaaacgcaaa aatatagagc attgtcactc ggaaatgctt tatttttgcg cacttaaaaa    142320
     ctattctgtt ttttattctt ctgtttcttc tgcattttca acttcatcgt cttcttctac    142380
     agaatgaata atttggtaat tcttgtggtt aaccactgtt ttttcttcaa tccctaaatc    142440
     tttaaaattt tccatataag ttaagtcgac aataacggaa ttttcattga gtttttcaac    142500
     gattcctgta aggccatcct taaattcaat aatgtctcca acatgtgctt ttgccattgt    142560
     tatcactcct tcaattttcg gtgttgcctc tatcttgctg aaaaagaatg tatgcatttt    142620
     tgaaccttcc ttaaattttg cactaaaaaa ctattaaaat caactataag ccattaaaaa    142680
     gtgctattta attcaaaaca gaaacaattt agtgataaat taaaaaaaac gctctatttt    142740
     ttctatttaa aaagagcgaa ataaggtgct ctacaaaaaa acattctaaa aaatttttaa    142800
     tcaaatagtt gtaacaatag gtaaaacatg gtactctttt taattgaggg atagtctttt    142860
     tggctgaaat tctttcggct taaaaggtta caacaaattt ctttacaaag gagaatgtaa    142920
     attatggaac aagcaagttt tgtagtaatc gatgaaacag gaattcacgc acgcccggca    142980
     actctattgg tgcaggctgc aagtaaatac agctctgacg ttcaaattga atacactggt    143040
     aaaaaagtaa accttaaatc aatcatgggc gttatgtctc ttggtattgg taaaggcgct    143100
     gacattacta tctacactga aggtagcgat gaaaaagaag caattgaagg actaactgaa    143160
     gttcttaaga aagaaggatt ggctgaataa tggctaaaga gttgaaaggt atcgcagcat    143220
     ctgatgggat tgccattgcg aaagcttatc tgctcgttga acctgatctt tcctatgaaa    143280
     aaacagaagt tacggatgtt gagagtgaag taaagcgttt tgaaagcgcg ttagaagttt    143340
     ctagaacaga actttcaatg attcgtgaga aagctgctaa agacttaggc gaagataagg    143400
     cacaaatttt tgacgcgcat cttctagtgt taaatgatcc tgaattaaca ggaccgattg    143460
     aagaaagtat caaaaattct aaaacgaatg cagaaacagc tttacaagaa acgacagaca    143520
     tgtttattgg tatgtttgaa tctatggaca acgaatacat gcgtgaacgt gcagcggata    143580
     ttaaagatgt gcgtaaacgt gttctttctc acttactagg tgtaactatt cctaatccag    143640
     ctttaattga tgaggaagta gttgttgttg cagctgattt aacgccttcc gataccgcac    143700
     aacttaaccg taactttgtt aaaggtttcg tgacggatat tggtggacgt acttctcact    143760
     ccgctattat ggcgcgctct cttgaaattc cagcagtagt tggaacgaaa gaagttactg    143820
     ctagcgtagc gaaaaacgat attgttatta ttgatggttt ggaaggtaat gttatcatcc    143880
     acccaacaga agaacaaatc gctcactatg aaaaaattaa atctgatttt gctttacaac    143940
     aagcagaatg ggataaactt aaaaatgaaa aaactgtttc taaagacggt gttcacgtgg    144000
     agcttgcagc aaacatcgga actccgaatg atttagaagg tgttatttct aacggcgggg    144060
     aagcagtagg actttatcgt acagaattct tgtacatggg tcgcgacaat ttcccaacgg    144120
     aagaagagca gtttgaagcg tataaagctg tagtatccgg aatggacgga aaatctgtgg    144180
     ttgttcgtac attagatatc ggtggcgaca aaacgttacc atacctagaa cttcctgaag    144240
     aaatgaaccc attcttagga ttccgtgcta ttcgtctttg ttttgcgaat gaagaattat    144300
     tccgtacaca acttcgcgcc ttacttcgtg caagtgtata tggtaactta aaaattatgt    144360
     tcccgatgat tgcaacagta aatgaattcc gtcaagcacg tgatatttta ctagacgaaa    144420
     aagcgaaatt aaaagctgct ggaacagaag tatccgattc catcgaactt ggaattatga    144480
     ttgaaattcc tgctgctgca gttttagctg atcaatttgc aaaagaagtt gatttcttct    144540
     ctatcggaac aaatgacttg attcagtata caatggctgc ggaccgtatg aacgaacgcg    144600
     tttcttacct ataccaacct tacaatccat ccatcttacg tttagtaaaa atggtaattg    144660
     atgcttctca taaagagggc aagtggactg gtatgtgtgg ggaaatggct ggagatcaaa    144720
     cggctgtacc acttctttta ggcttaggct tagatgaatt ttcaatgagt gcttcaagca    144780
     ttcttaaatc tcgttcgtta atcaaacgtt tagatcaatc tgaaatggtg aaattagcgg    144840
     aagaagcttt aaataaatct acagcagaag aagttgtaga attagttgaa aaatatactg    144900
     cagaataata tctgaataaa gacctagaca attttgttgt ctaggtcttt ttatgttgtg    144960
     aaatagcctc cgcacaagta taattggaaa tacagttagt tttaaaaggg ggcaacaaga    145020
     ttggttatct atctattagc agggtttttt ctgcttctgt tcattgtctt gtcgtttata    145080
     gatagacgac gtattagcaa tgggattatt ttgacaatgg cactattttt ttctgtgctt    145140
     tcggtggttt atgctacttt ttcaaaaggg aatgaactac tcgtctcggt tatggggacg    145200
     gtgttacttt tattagtttt acttattccg ttttttgttg tagggatagc aacgatgctc    145260
     attgtaaatg gacgattaat gttgaaacgt gaaggacgta aattagccaa tatgcttcct    145320
     ttaattattg gtttaggcat tttagcactt attattacat ggttcggtag tattttaaaa    145380
     acaggtagtc cgattcttgg gattgtggta gtttttattg tggcattagt tggttatttt    145440
     tcctttttat ttttatcgtt tcttttatcg acttttctct atcagtttaa tttcccaaga    145500
     tataatcaag attttctgat tgtattagga agtggtctga taggcggtga tagagtacct    145560
     ccattgcttg ctagtcggtt gaatcgcgct attaagttct acgacaagca atacgccaaa    145620
     aaaggcaaac gagctacttt tatcgtatct ggtggacaag gtgctaatga aactatttca    145680
     gaagcagaag cgatgcgagg ttatttaata gaacaaggca ttgatgaaaa ttttattatt    145740
     atggaagatc aatccgttaa tacactgcaa aatatgaaat tttcaaaggc aaaaatggat    145800
     gcaattatgt caaactataa tagtttattt tcaacgaata attttcattt atttagagca    145860
     ggtatttatg caagaaaagc gggtttgaag agtcaaggga ttggtgcaaa aacagcttta    145920
     tactatatgc ctaatgcatt aattcgagaa tttattgcca ttactgtaat gtataaaaaa    145980
     gtacatatgg tcttacttgg tttattacta ttgttttttg cgtttttagc gattataggt    146040
     gttactttta gatagggggt tagcctgatg gagaaaattg gatttgttgg tacaggcgta    146100
     atgggttcga gtatggcagg gcatttactg gaggctggtt atgaagtatt ggtgtatact    146160
     cgcacaaaaa caaaagcaga agatttactt gataaaggag cactctgggt agaaacacca    146220
     ggagaattgg ctaataaagt ggatatatta atttcaatgg ttggttatcc aaaagatgtg    146280
     gaagagcttt acttaggcga aaatggcttt ttagaaaatt tagcagttgg gacagtagca    146340
     atcgatatga caacttcctc accggcatta gctaaaaaaa tggctgaatt tggccgtgaa    146400
     aaaggtattg gtgtattgga tgctcctgtt tcaggtggcg acataggcgc gaaaaatggc    146460
     acgctatcaa ttatggtagg cggatctgaa gacgtttttt taaaagtgaa accaattttt    146520
     gacattcttg gtagcagtgt gattctgcaa ggtgatgcag gtgctgggca acataccaaa    146580
     atggtgaacc aaattgcgat tgcttccaac atgattggtg tgactgaagc aatcatttat    146640
     gcggaggcgg ctggacttaa tccatcacgt gttctcgatt caatttcagg tggtgcagct    146700
     ggtagttggt cacttgcaaa cttgattcca cgtgtactta aggatgattt ttctcctggt    146760
     ttctttatta aacatttcat caaagatatg ggaatcgcga tctcagaagc aaaacaaatg    146820
     ggcttagaac ttcctgggct aactttagct gaaaaaatgt atcaaacgct agctgaacaa    146880
     ggtttgagtg aagaaggaac tcaagcactc attaaatatt atcgttagac gaagaaatac    146940
     ccactaacta aggttagtgg gtatttcttt ttatttttct acaaattgtg ccattcgatc    147000
     taatgcttca gccaaattat taaaggaagt agcataagaa agacggaagt aacgatcgcc    147060
     tttttcggaa aaagcatttc cgggaacaac tgcaaccttg gcttcttcag caagttttac    147120
     agcccaatcg aaagagtttt cggctatttc atcaggaagt ttgacgaaga aataaaatgc    147180
     accatctggc ggaataacag taaagcccat tttttccagg cgatcttggg tgaagttagc    147240
     acgtgttttg tattcagttc gcatttggaa tgcgtcgtct ttaccgttag tgatggcttc    147300
     tagtgctgct ttttgggaaa ttgaacttgc gcaagtaacg gaatattgat gaattttcag    147360
     catttcttgt gtcaaaattt ctggggcaag taaaaaacca attctccaac caatcattgc    147420
     gtgggactta gataggccgt tgatgacaat tgtttgatct cttagcatag gggcaatact    147480
     cacatgctct tcgtgataag ttaattcact ataaatctca tcagcaatga caaaaatacc    147540
     tgtttctttt agtacttctg ctaaagcgga aagttcatct ttggaaagtg tgacgccggt    147600
     tgggttggat ggatagggaa tgataagtgc ttttgttttt ggtgtgatat gtgcctttaa    147660
     ttgttcaggt gttaatttga aattagtctc agtcgtatct actttaacgg gatgagcttt    147720
     atttaacgtg atcagaggct cgtaaccagg ataaattggg tcaggtaaga ttacttcatc    147780
     acctggctcc aaaatcgttt gtaacgcgac agaaatcgct tctgtagcac ctacagtaac    147840
     gatgatttct ttgttactat aggacagatc atatttttca tggaaataaa tagaagctgc    147900
     ttcgagtaat tctggcatcc ctgcattggg tgtatagttg gtgaagtttt cttctattgc    147960
     tgaaatggct gcttgtttaa catgatcggg tgttggaaag tcaggttctc cgagtgttaa    148020
     acggatcata tcaggtatac ctgtcactcg tgtattaaaa gttctgatac cacttacttg    148080
     aatatcgcgt aattctggtc gaatagattt tgtcattttc gtcacctttc tttataagaa    148140
     aatcccgtaa aaattaggtg ggagtaagct tcgtaatttc attccattat agcttaaaaa    148200
     gatagaaaag caaaatgtct gaaaatatta ctaaaaaacc ttgcactttt atttggaata    148260
     ctataagatg gttttaataa tgataatcat tttcagttag aaatgattac ttcaatgtgg    148320
     aaggggccac cggatatgac taaacctggt aaatacgaag ctctcttttt tccaacgaaa    148380
     gatggcttgc taaaaataca tgcttatggc tttaatccct gtggttcatg gggcgaagta    148440
     tttgcaacaa ttggtgatca aacaatatgc gttaaaggct tcaatcgcca taaaacaatc    148500
     gtgcgggcta caaaaatgat tataagcgct actgctaatc gaaaaaacga attttaatta    148560
     tcaaagactg tagaaaggtt cgttcctttt tatagtcttt tttttggata aaacaacgat    148620
     aaaatagaac aaatcgtgtc tattaggtta atttaaaata atttcttttt ctgaatattt    148680
     ccagaaccct tgcgttatac gtgcggtttg cgataaaatt tggtagtata gtgaaagaaa    148740
     taagatatgg cgaaaaaacc agatatgagg aaatatgtaa aaaagcattg ccacgcgcgt    148800
     ataacaagca aggtatgcca atttttgcac gtcagatggt ggatttgaga ggagagtgta    148860
     agatgtctca gttattggga attattcaac gtttacatgc aatgcaagaa gatgagtctg    148920
     ctgaaacaca agcaagacgt tttgaaaaaa atggtacacc tgtgtgcgaa gtgaagtttt    148980
     tccaagcttc taactcattt gaagtagaaa tctatggcga caatagtaaa tatcaattcg    149040
     atgatattga tatgactgct atcgaaattt ttgaaacgct acaagaaaac gaataacatg    149100
     gtaaaaatcg gataatctga taatttactt aggggctgtg aacttatatt cacagctttt    149160
     tttgttttca agcgctaaat gaaagaaatc agaccaaata gtatggtaga ataggagatg    149220
     gaaaagtttc gatttatttt aaaaagttga aagaaacttc gtagagcttg aaaataaagg    149280
     aagaggaaga ttctaaatga tctcaaatag atttggacaa tttattgaca atgaactagc    149340
     tgattcgatg atttccgctg aaaaggttgc tcatgtacag cttggtaata atttagaaca    149400
     tgcattactt gttttaacta aatgtggtta ttcagttatt cctgtactag actttgaatt    149460
     taaactccat ggattaataa gtgcagcaat gattacggat gccattctag gactcgaacg    149520
     tatcgaattt gaacgattag aagatttaaa ggtagaggat gtcatgcaaa cagatttccc    149580
     agtaatcaaa gattttaaca ataacgaacg aattgtgcac ttacttgtgg accatccttt    149640
     tgtttgtgtt gtagattctg accaccattt tgaagggata gtaacaagac gtgttgtttt    149700
     aaaacaagtc aatcgttata ttcatttgca ggtggaggaa aatagatgat tgtaacagag    149760
     tatgaattac ttgtttgttt agcagaagaa ctaaatatgc gtaaaagtgc tgaaaaactc    149820
     tttttaagtc aaccagcctt atcgcaacgc ttacaaacga ttgaaagtag atggaatacc    149880
     aaaattttta ttcgtacaca aaaagggctg ttgcttacac cagaaggaga agcaattgtt    149940
     cgtcatgcat ctagcgtcat tgaacgagag cacactattc aagaaaaatt agaagcgatg    150000
     gaaggcgttg tccggggaac attacggatt gcttgtgcaa gcgtagtggc gcaaatgtgg    150060
     cttcctcggg ttctaaaagc tttttcaaga gcgtacccta atgtgcaaat ttcacttgta    150120
     actgggtgga gcagtgaagt tacgcaacaa ctcgctgctg gaaatgtcca tatcggcatt    150180
     gtccgtggaa gttctacttg gaaaagcgtt caaaaaccgt tatttaatga caaattaatt    150240
     ttagtagata cagaaattac taaaattgaa gaagtttttc agaccaatcg accatttatc    150300
     caatttcgca gtgattcgaa ttattaccaa gttattcaag actactggca acgaaatttc    150360
     gggaaaatgc cacgccaagc aatgcttatg gatcaaatgg aaacctctag acaaatggcc    150420
     ttaaatggta ttggttttgc aattttaccg gaagtgacga tgttaggcta cacagataaa    150480
     atcaacaaaa ttccgttaac agaaaaagat ggctcaattt taagccggga aaccaactta    150540
     ctgacttatg aacagtcact cagtttacca caagtgaagg cgtttttaga aataacagat    150600
     aaattccttg aacaagttaa atagctatgg caaaatagaa agcagaacgt atcggaaggg    150660
     gacaaaaatt catggaacaa atggatgcac accaaattat ttcttttatt caaaatagca    150720
     agaaagcaac accagtaaaa gtttacctta aaggggactt agaaaaaatt gattttccaa    150780
     gtgatgtaaa aactttcatt actggaaatg cgggaactgt ttttggagaa tgggcagttg    150840
     ttgagccatt attagaagca aataaagcga atattgaaga ttacgtaatc gaaaatgatc    150900
     gtcgtaactc cgctattcct ttgttagata tgaaaaatat taacgcacgt attgagcctg    150960
     gtgcagtcat tcgcgaccaa gtaacaatcg gcgacaatgc ggttattatg atgggagcaa    151020
     gtatcaatat tggttcagtt atcggtgacg gtacgatgat tgatatgaat gtagttcttg    151080
     gcggccgtgc aacggtcggt aaaaattgcc atattggtgc aggttctgtc cttgctggcg    151140
     tagttgagcc accatccgca caaccagtta tcgtagaaga caatgttgtt gtaggcgcca    151200
     atgtcgttgt tttagaaggc gtacgcattg gagaaggcgc agttgtagca gcgggcgcaa    151260
     tcgttacaaa agatgtagct cctggaacag tcgtggccgg aattcctgca cgtgaactta    151320
     aaaaattaga tgcaaaaaca gcttctaaaa cagaaatcat gcaagaactt cgccaacttt    151380
     aaaaaatcaa agggaactgt ttcgtctgtt ggcgaagcag tcctttttag aaggagagat    151440
     tcgccgtgtt aaatgaattt attgccattc gacgtgagtt acaccaaatc cctgaaacag    151500
     gttataaaga gctaaaaaca caagcttact tattagatta tatcagcaaa ttaccgagtg    151560
     gacatttaga agtgaaaaaa tggcgtacgg ggattttagt tttagtaaaa ggaactaatc    151620
     cagaaaaaac aattggttat cgtacggata ttgacgcatt accgatcaca gaagaaactg    151680
     agctgccttt tgcttcaaaa catcctggca atatgcacgc ttgtgggcac gatttacata    151740
     tgagtattgc gcttggagtg ttgacacatt ttgcgagtaa acctgctaaa gataatttgc    151800
     ttttcgtgtt ccagcctgca gaagaaggtc caggtggtgc aaaacccatc atggaaagca    151860
     ctgaatttgc cgagtggcga ccagatagca tttatggact tcatatcgca ccggaataca    151920
     aagtaggaga aattgcgatt aagccaggtt tactttttgc gaatacatcg gaactgttta    151980
     tttcgttcaa aggaaaaggt gggcacgcgg cgtatcccca tttggcgaat gatatggttg    152040
     ttgcagcaag tgcgtttgtt gggcaaatgc aaacgattat aagtcgtaat attgatccaa    152100
     tggatagtgc agttattacg attggaagga ttcatggcgg agaaattcaa aatgtcattg    152160
     cggaaactgc ttatttagat ggaaccattc gaacgctttc tccggaaaca atggagattg    152220
     tttggactcg tttgaaacag ctagctaaag gctgggaaga agcttaccaa tgcgaagttg    152280
     aatttcatcc tggctcggat tattatcaag tagacaatga tccagttgaa acagaagaat    152340
     tcatccactt tttggaagaa caatatccag aaagttatgt gccagctcgt tcagcgatga    152400
     ctggagaaga ttttggttac tttttatccg aaattaaagg gtttatgttt tggttaggcg    152460
     tggattccga gtacagtttg catcacgcga aacttaatcc aaaagaagaa gctattccat    152520
     ttgcaattga tgtattaatc cactttttgg aaagtaaata aaaagacgtc aattcgttct    152580
     caaaaggagc gaattggcgt ctttttaatt attatttggt ccgaatgtgc taacaaaatt    152640
     gagtggtagt tcaatcttgt tttctgcgag tgcctcgcga atatctttga gtaagtcacg    152700
     ttgaacagaa tactgctcgc cgttcactgc tttaccgact acgcggataa tcatatttgt    152760
     tgcgtctatg ttttgcacgc ctaatacaac agggggctca acgatatttt tattctcttt    152820
     tgcagctacg tcacaaacct caccaataat tttaattgct ttttctggat cttcatgtgg    152880
     actaatttga atgtccacca tcacacgcat attaccgcgc gaatgattac taacgaccat    152940
     aatttgtctg ttaggaatga aatgaagcgt gccatcaaaa tcacgtacct gtgttgttct    153000
     aagtccaagt gcttccactg ttccattaac tagtccaata gtaatcgtat caccaacatc    153060
     gagttggcgt tcaagaagaa taaaaaatcc agttacaacg tcactaacaa gaccttgcgc    153120
     accaaaggca attgccaaac tggccacccc agcacttgca ataattgccg taacatccat    153180
     aaagttctgt aataataaaa tcgcaaaagt gaagaataaa acatatccat aaaaattaga    153240
     aattaagctt tctaacgtgt ccgcgcgccc aacagaaact gcttgttgtt gccgatattt    153300
     gcggaagaaa ctacgaataa ttttattacc aatcacacgg aaaataaaat aaagagcaat    153360
     taaaatggca atttttattc cgacagaaat aatatgattc caaaattggt cccagtcaat    153420
     agaactgaac cactttttga gtaaattcat tttttggtcc acatcctttg aaagttctcc    153480
     atccatttca tctccccctt cctaatgaaa tgtccttttc tattctaaca aatattttac    153540
     aaaaatgctg ttttaaaaaa taaattgtta ccggaaattg cgtgtttttc ccgaaaaatc    153600
     ttcttttttt acaaaaaaaa ttaaaaaact gttagccact gttgttgtaa gatggaggcg    153660
     ctttcttaaa agcttaaatt agcgcaaatt gaactgtatg atgtgaaact aagccaaaac    153720
     ttgtgtacaa tgataaatgt tattgctttt ttaaaagtga tatgggccga atttttgcct    153780
     agtaaataat tcaatctaaa aaaagaaagg ggattttatt ttgagcaaga ttaaagtaga    153840
     agagctaacg aaaatttttg gaaaaaaggc ttccaaagca tcttctttac tttctcaggg    153900
     gaaatcgaaa acagatattt tgaaagaaac aggggcgact attggtgtta ataaagcatc    153960
     ttttagcgta gaagaaggag aaattttcgt tattatgggg ctttctggta gtgggaagtc    154020
     gactttggta cgacttttaa accgtctaat tgagcctacg agcggaaaaa tttggcttga    154080
     cggaaaagaa ctatccagtc taaataaaaa agaacttttg gaagttagaa gaaaaagcat    154140
     gagtatggtc ttccaaaact ttggtttatt tccgaataga acaattaatc gtaacgtaga    154200
     atacggcctt gaaattcaag gaatggacaa agaagagcgt gaaaaaaatg cagcagaatc    154260
     gcttgcgctt gttggtttag ctggttacgg cgatcaatat ccttcgcaac tttctggtgg    154320
     gatgcagcaa cgtgtaggtc tagcgagagc acttgctaat aatccagata ttttactgat    154380
     ggatgaagct ttctccgcgc ttgaccctct taacagaaaa gatatgcaag atcaattgct    154440
     agatttacaa gataaaatga agaaaacgat tatctttatt acccatgatt tggatgaggc    154500
     acttcgtatt ggtgaccaca ttatgattat gcgtgatggt tctgtcgttc aaacaggttc    154560
     tccagaagaa attctggcac atccagcaaa tgaatatgta gaaaaattca ttgaagatgt    154620
     agaccgttcg aaagtctata cagcgagcaa tgttatgatt cgtccagaaa tcgttaattt    154680
     tgaaaaagat ggtcctcgtg ttgcgcttaa acggatgcgt gaagctggaa cttccagtgt    154740
     attcgttgtt aaacgtaatc gtgagctagt tggtattgtc catgcagcag aagtatctaa    154800
     actagtaaaa gaaaatatta cttcactaga aacagcttta catcgtgatg tgcctacaac    154860
     tggcctagat acgccacttg cagaaatcat ggatactatc tcgactacaa cgattccgat    154920
     tgctgtaaca gaagatggaa aattaaaagg aattattatt cgcggatccg ttctggccgc    154980
     actttctgga aacgaggtga acgttaatgc ctaatattcc aacgattcca ttagctagtt    155040
     ggattgacaa attagttgat ggcttaacgc aatttgaagg attttttaat gtaattacga    155100
     atatcattgg cgggattgtt gacgcattcc aatgggtgtt cgatttagtt ccaccatggt    155160
     tatttattat tttacttgta tttggcacat tttgggtgaa ccgtaaaggc aaaaaatggg    155220
     gtttaattat ctttgaagtt gtcggtttac ttttaatttg gaacttggac ttctggcgcg    155280
     acatgacaca aacattaacg cttgtgctga caagtagttt aattgcactt gttattggag    155340
     ttccacttgg tatttggatg gcgaaaagca atattgttga aagtatcttc aaaccggtac    155400
     tcgattttat gcaaactatg ccagccttcg tttacttaat tcctgccgta gcatttttcg    155460
     gaattggaat ggttccaggg gttgtggctt ctgttatttt cgcaatgcct ccaactgttc    155520
     gtatgactaa tctaggtatt cgccaagttt caacagagct tgtagaagca gccgattcgt    155580
     tcggttcaac accttggcaa aaactttgga aagtacagct accaatggcg aaatcgacca    155640
     tgatggctgg gattaaccaa agtatcatgt tagcactttc catggttgta attgcttcca    155700
     tgattggtgc aatgggactt ggaacacgtg tttacttcgc agtaggacgt aacgacgctg    155760
     gtggtggatt tgtagctggg attgctattg ttattgtagc aatcatccta gaccgtctga    155820
     cacaagcttt caataaaaaa gcgaaatcag aataaggagg agagtagatt gctaaaaaaa    155880
     ttaatcacta ctgcagtttt ggctatgctt attttcactt tagcagcctg cgggacaacc    155940
     cttgctcctt atgacgcgaa aaaagattta ggcgaacaaa tcaattacac aatcacaggt    156000
     attgatgctg gagcaggaat tatgcttgca acacaaaatg cgattaaaga ttatcattta    156060
     gatgatgata attggcaatt acaaacaagt tccactgcgg caatgacaag tacacttcaa    156120
     aaagcgatga aagataagcg tccgattgtc gtaactggct ggacaccgca ctggatgttt    156180
     acaaaatttg atttgaaatt tttggacgat cccaaaaatg tatatggtaa tgcagaaaac    156240
     attcacacga ttgtacgtaa aggcttaaaa gaagataaac cttccgcgta ccaagtgtta    156300
     gataatttct tctggactgc ggaagatatg tctgaagtaa tgctggaagt taatgacggc    156360
     gtagaccctg aagaagctgc taaaaaatgg attaaaaaca atccagataa agtagcaaaa    156420
     tggaccgatg gagtggaaaa agttgatggc gatgaaatca agttaactta tgttgcttgg    156480
     gattctgaaa ttgcctctac aaacgttgtc gcagaagcct taaaacaagt tggctataaa    156540
     ccaaccatcc aagcaatgga aatccaacca atgtgggcgt ccgttgcaac ggatgcagct    156600
     gatgggatgg ttgctgcgtg gcttccaaat acttccggaa tttactataa agattacaaa    156660
     ggaaaatttg aagatttagg accaaactta aaaggtgcta aaattggtct agcagtacca    156720
     aaatacatga caaacattaa ttccattgaa gatttaaaaa caagcaaata aacttttaaa    156780
     aaggcatgaa gaaaatcaag tgatgcttga tagtttctcc gtgccttttt ttctctataa    156840
     gggtaaaata gtagttgatt catgaaattg ctaggaggaa gatgcatgtt taaaaaattc    156900
     ttaaaaaaat cgaaacaaga agtactattc gctcacgtaa ctgggcaagt tattgcatta    156960
     gaagatgttc cagatccagt ttttaatcaa aaaatgatgg gagaaggcat tgcaatcaaa    157020
     ccagaaactg gcaccattgt cgctccaata gacgggaaaa ttattcaact ggcagaaaca    157080
     aaacatgctt ttggtattcg tacagatatg ggacaagaaa ttcttgtaca tattggctta    157140
     gaaaccgtat ccttaaatgg agaagggttc aacgttttag tcagtgtagg agataaagta    157200
     aaagtaggcg atcctattgt agaagctgat tttgatttta ttgaaaaaaa cgctgccagt    157260
     actgttgtac caatggttat aacgaatagc tcagaaggta aatatgattt tgatttccat    157320
     gctgtaccaa aggcggaagc agggaaaacc gaagtcatta caactaattt aaaataatga    157380
     aacaaaaatc cgtgaaaagg taattttctt ttcatggatt tttttgtatt caagcacgcc    157440
     ttaaaagggt aaaatgaagg taattagtta ttaaaaggag cggaataata tgttagaagt    157500
     gatagttcaa aatccaagag acgcttactt agcggaaaaa tatggcgcaa atagaatgga    157560
     agtagtttca gcaataagcg aaggcggttt gactccaagt tatggtgcta ttaaagaaat    157620
     cgtacgtgcc tctaagttac cagcaatgat gatgattcga ccacatagtt tttcttttgt    157680
     ctatgatgag gcagctaaaa tagtcatgga acgagacatt gagcttgcaa aagaagttgg    157740
     cgtgcaagga attgtttacg gtggtataac agaaaacgga gcaatcgatc aagctcttct    157800
     cgaaaaagta attgaatgga aaggtgattt aaaccttact ttccaccggg cgctggaagc    157860
     aaccaaagat atcgaagcga gttaccaagt tttacgtaca tatggaaaag acatcaacca    157920
     attattaact tcaggtggta cagcaaacgc acttgactcc ttgccacgcc taaaacgctg    157980
     gattcaagat agcgaagcac agccagattc attccaagtt ttagttggaa gtggcgtcaa    158040
     accagaaaat atcgcgacct tccaagcgac attaaatcat agcgactacc atgtaggaag    158100
     cgcggctaga gaagccaatg atttttccaa agacatttta aaagaaaaaa tcgatatttt    158160
     acagcaacaa ataaacaaag attgattctt tgtagtaggt agccttacaa gcttagataa    158220
     gctataatga aacaagacta ttcttaatga aaaggtggaa aaaaagtgaa taactatatt    158280
     ggcaaaagcc aagtaatgac agtaaaagaa atcaaagata caggatggct ccttgaaaaa    158340
     gacggagtaa ctgttttttt atctaaatca aatacgcatg aaacggaact tgctgttgga    158400
     gcagaagtaa ccgtatttat ttttgtggac tatgaccgtg aaattgcagc aacaacgatt    158460
     attccgaaaa ttcaagtagg acactatggt tggggaacag taacagaagt acgtaaacat    158520
     ctaggcgttt ttgtcgatat cggcattgaa aaagacgttg ttgtctcttt agatgattta    158580
     cctgcattac cccatctatg gcctaaaaaa gaagatcgta tgatgattgc actgcgtgtg    158640
     gatgaagaaa atcgtgtttg gggtgttctt gcagaagaag aacaattccg cgcaattgcc    158700
     gttcgcgcag aacaagattt atttaaccaa aatgtcgaag gaaccattta tcgtttatta    158760
     aaagtcggtt catttgtttt tacggatgat tttcatattg gttttattca tgaaagtgaa    158820
     cgaacttcgg aaccaagaat gggggaacgt gtgaaggccc gtgttatcgc tgtaaaacca    158880
     gacggctctc ttaatttatc gcttcgtggt agagcgcatg aagtattaaa tgatgacgcg    158940
     gaaatgattt taacttattt gcgaagtgtt ggtggagaaa tgccattcgg agataaatca    159000
     gatccagatg ccattcgtgc caaatttggt ataagtaaag ctcaattcaa gcgtgcgatt    159060
     ggcacacttt taaaagcgag acgtatcaca caagaaaatg gtgttgttac aaaaattacg    159120
     gaagaaacat ccgactaaag tagtaggcta tgttccaact agcgcggttg tttcaatcaa    159180
     taaatcctcg ctataattaa cacagcatgt acaaagtaac gaaaatcgag aaataacttt    159240
     gtcaaaagag gaacgtaagg aggtgtgtca gcttgaaaaa aatggaaagc tcggttgttt    159300
     ttgtattttt aattgcgatt attgttggtg tgggactgga gatgttattc cagtgggagt    159360
     tgcttatttt atttgcactc ggaatatttt ttatctttac atcaagaaaa gcaagcgcaa    159420
     caaagaaaag tgcaagaaac tcattattta ttggaatcgt atttatcatt atcgccgtgt    159480
     tacttacaac cacttttaaa gttgggcttg ttgttgcagg tatttacgcg atcattcact    159540
     atattagtcg gaagcgggca ccccaattat taatgctcaa aacgagagaa ccggatagca    159600
     agattgatcg tacggataag tttattcgta atcagtggtt cggtaaccag cgcatactcg    159660
     acgtagtgta tgaatgggac gatatcaata tccaaacggg gattggtgat acgattctcg    159720
     atttagggaa cacggtttta cccactggcg aaagtgtcat tatgattcgt agcgtttcgg    159780
     ggaaaatccg gatattggtt ccttttgata ttggtatttg cattgagcat tccgcaatct    159840
     tcggaaacat ccaatatgat aaagaaagca cctctattca aaataatagc atcaaggtct    159900
     actcagataa ttatgaaagt tccgcacgaa aagtgaaaat catgacttct gtaatcttcg    159960
     gagatttaga ggtgattagg ctatgagttt ttcgaaactg atgatggctg tttgctcagg    160020
     tttactgctt gttgcaacag ctatcggtac ggtcggttac tattttttta gtgaaggctc    160080
     ttggtataaa attctcatcg aacaaaaaat cttttacatt ccctttgtgg ttttcgttcc    160140
     gcttactgcc atttcgattg gtttaattat tggcggtctg atcggttatt ttgttaaaca    160200
     aaaatttgaa tcaattgact tctcgattcg attgcttgga caaggtgatt tggagaaaaa    160260
     gattacgagt gaagaagacg agaacttttt agaagtgcag caagtataca agcaaatcga    160320
     ccgcttacgt gataaaatga aagcacaaac gattttgacg caaaaacttg caagcgaccg    160380
     tgctgaatca actggccaaa cgaaagaagc tattttgtca gaagagagac accggattgc    160440
     tagagaatta cacgattcag tgagccaaca gctttttgca gcaatgatgc ttttatcagc    160500
     cttgaatgaa cagagtgaaa aaagcgcgac accggcgatg caaaaacaac taaaaatggt    160560
     tgaatctatc gtaaatgaat cccaatcaga gatgcgtgcg cttttacttc atctgcgtcc    160620
     aacgcaactc gagggtaaat cattaaaaac tggtattgag caattattaa aagaattaac    160680
     aaccaaattg ccaatcgaag tagaatggca aatcgaggat attagtttgc aaaaaggcat    160740
     tgaggatcat ttgttccgta ttgttcaaga attactttcc aatacattac gacattctaa    160800
     agctaaatta ttagaagtac gcttagtcac gatggataat ttagcggtga tgaaagtagt    160860
     agatgacggc gttgggtttg atatggataa tgttcgacaa ggctcttatg gattacaaaa    160920
     tatgcgagaa cgagttgccg aattcggcgg caccatcaaa ataattagtt tcccaggaag    160980
     aggaactagt gtagaaataa aaatcccact tgttgcgaaa aaggacgtgg aaagcgaatg    161040
     ataaaagtat tacttgtaga tgatcatgaa atggtacgta taggtgtctc agcttatctt    161100
     tctgtgcaag atgacatgga agtagttggc gaggcagaga acggtcgtga aggggctgat    161160
     atggctctag aactacgccc ggatatcatc ttaatggatt tagttatgga tgaaatggac    161220
     ggcatcgaag ccacaaaaga aattatgcaa aactggaaag aagcaaaaat cattatcgtt    161280
     acaagtttta ttgatgatga aaaagtatac ccggcacttg aagctggagc gagcagttat    161340
     atgcttaaaa cttcgacagc gagcgaaatt gcagatgcga ttcgagctac atacggcgga    161400
     gactctgtcc ttgaaccaga agtaactggc aaaatgatgc aacggctaac cgctaaacca    161460
     gaaaaaaact tacatgatga tttaacgaat cgtgaaaatg aaatcttact tttaatcgca    161520
     gaaggtaaat ctaatcaaga aattgcggat gaacttttta tcactttaaa aacggtgaag    161580
     acgcatgtaa gtaacatttt atcgaaatta gacgtgcaag atcgtacgca agcagcaatc    161640
     tatgcattta aacatgacct agtagaaaaa aagtagcaag gaggtaacgt acacatgaaa    161700
     gaaggatttg cagtcatcgg tcttgggcga tttggtggga gtatttgtcg ttcacttgtt    161760
     gagcaaggaa tggaagtact tgcgattgat tcggatgaag agcgcgtcaa tgaatatatg    161820
     tccattgcga cccatgcagt tatcgctaat tcaacggatg aaaatgcgct acgccaacta    161880
     ggtattcgta actttgagca tgttatcgtt gcgataggtg aagatataca gtcgagtatc    161940
     ttaacaacac ttattttaaa agaaatgggc gtgaaatacg ttaccgcaaa agcgacaaat    162000
     gataagcatg ccaaattgct tgataaaatc ggagcagacc gtgttgtcca ccctgagcga    162060
     gacatgggac gacgtattgc gcattatatc gtatcgaaaa acatgctaga ttatcttgaa    162120
     ctatccgatg aatatagtct agtcgaaatc tctgtatctg atccacgttt ccttgggaag    162180
     agcctagttg atttagattt ccgtaactct tttggtgtca atattgtcgg tattaaaaaa    162240
     gataaacaaa tgattattac tcctgaagcc aatgatgttc tacatgaagg agatattcta    162300
     atcgttatcg gttcggatga tgacattgaa cgactacaag aaaaaattca ataaaaagaa    162360
     aacctatgta atataaagag atatgtcaac atgtcgagta tattcttagg tttttttatt    162420
     gtttgcgaat taccgcttgc tatctagcca gttattttct attatagtta cagagcttca    162480
     cataaaggga cagaaggagg gggaacagat gaagaaattt ttgcttgata aaatcggcgc    162540
     tcgaggatta attcagatgt tgcaagcatt tatttatgcg agcatttgtg tagtggtcca    162600
     tacagttatt tttcctgatt tggccggggt attaccaata gtagtactaa tagggattat    162660
     ttcaatgcaa cctacatatg gaattacaag aaaagtcatt ccccaaatag cgctagcatt    162720
     cactctagcg tgtgtttttg tcattataag cacctatttt ttcccaatca atgtgtatat    162780
     ttactatgtt gtcatgatag ttgttatttt ggcggtgaat ttcttgatgc cgcagaaata    162840
     tatggtaatg acactcgcga ttgggacagc actttacttt cttggaacag atgatttacc    162900
     aatgcctctc tatgccatga taattgtagc gttaatggat gtgtttgtgt tctttttact    162960
     tgtgcagtta gtcgtaaaat atgtacattt accactcgaa aaaaccgttc aaactattat    163020
     gaaacaattg gtaggactat ttgacaagga aattgaaagt gtatttaaaa ataatggtaa    163080
     atttatagca aaaccattgt atagtatttt tgttcaatca caaatgttta ttaaagaata    163140
     tagtgctagt aaaaaagcga atcctcgtca tgtggaactg tatcaagcat tactgcctaa    163200
     ttatctacaa cttttttttc atatgcaaac aatggaagac attggacgag ttggtttgtc    163260
     ggaagaagca aaacaggccc ttgctcaaat taacgtgaaa gtttctgatg aaattaacgt    163320
     gaaagaagcc gatccagttg cctcttttca tgtgaagaaa tttgttgaga acttcctagc    163380
     tgttaaggtt ggaatgaatg agttagtaga agggagaggg cagaaatgaa aaagatttct    163440
     atgagagaac gtttcgctct tgatcctcga gttgctaaag tgcttattag tattacaata    163500
     gcagtgattt tattcccggt tatgggtgat tggattgtgt atccaacata tgtatttaat    163560
     gctatttata ttaccgcgca aatgagtaag ggtgatacat ataaatcaag catcgagcgg    163620
     attatcggta ctattgtagg tggactactt gcagcctttg tatacttact agtccccaac    163680
     catcattata ttatgattcc gattggcgca gcgcttgcag ttatgctaag ttatctattt    163740
     actaaaaaat tcacgatggt tattgttgtt attacagtaa tggtacttgt cggaaaaggc    163800
     gacggagagc cgatagtctt tttaagagac cgactatttg atacgatgat tggacttgtg    163860
     attggttttg tcgtctatgc tctctaccca cgtaagaaaa acaaaaaatt aaatcaagtg    163920
     tttatttctc aggaaaaagc agtattagaa agaataaaag aaattgatat aaatagtgaa    163980
     gatgcgaaat ctctagctcc caaaataaaa ggtttgtgga agcagttaat agatttaaga    164040
     aaaacgcgcg aacaaattat tacagacagc agttttgttg cgagtttgac ttcggatgaa    164100
     ccaatgcttc attttactca tttagtagag caagcaatta ataatattga aattttatat    164160
     catgtgacgc ttgaaaaaga gtctgaacct gattatgaag ttgtatttgc ttatcatcaa    164220
     caagcttgcg ctaaagtaat tacagagatg gatgcactta ttacgaaaca taaataaaaa    164280
     agatgactga agctcgttca agcctcagtc atcttttttt attcagtaat atctaaactc    164340
     tttttaaaca tagtaattat tcgctctaaa tctgttttat caggagcgaa ataatataaa    164400
     tcaaatccgt aagactcgct ataaatcatt tccccttcac ctttaagttc ttgggaatca    164460
     acgtttttaa gtacggaaga ataatttgct gccatggatg taatatctgt aagcgtcata    164520
     ttagtttgga aattatcgcc aacagctttc ataatgcttt cgaaattgga aactccggat    164580
     gaactgataa ctttattcgc aataccaata atgacatcgc gctgtctatc ttgacgacca    164640
     aagtcaccac gggggtcttc atgacgaata cgaacatatt gtaaagcttc tgttccattt    164700
     aaagtaatgt tacctttaac aaatttgcta tttacttctg ttaagtcgat atcgttataa    164760
     acagtaatac ctccaacagc atcaactagg tctttaaagc cctccatatt gattgaaatg    164820
     aaataatcta caggaacacc tggcataagt ttttcgaccg ctgaaactgt tcctgagggg    164880
     ccaccgttgg aataagaggc attaatctta ccaatgtcgc catttccgta gtctactttt    164940
     gtatcacgag gaatactaac catttctacg gcattttgtt gtttattagc tgtggcaaga    165000
     ataattgtat ctgcgcgacc atttttttca ccagctcggg catctgaacc catgagtaac    165060
     acagagaaag gttttttctt ttctaaatca cttaaagttt tattacttga ttctagaggg    165120
     acatttattt ttgaaaaggt attttgaacg gtgatgtaat acttcgctgc caatcctgtt    165180
     atagagaaga agataattcc taaaagagca acactagcaa ttttcataac tttagtaaaa    165240
     gtggacgttg tttttttctt tttttcagtc ctagtttctg tcataaaatt ttcctcgtct    165300
     ttctattttg tttgtttaaa cataccatcg tctttctgag aaatcaacaa aaaaacgata    165360
     aatgattttg aaaccattta tcgtcttgaa aactatactt ccatgattat tggtaaaatc    165420
     attggacgac gttttgtttt ttcgtacaag aaaggttgca aagtatctgt aatttcattt    165480
     ttgatttcag accattgcgt tgttttttgt tccattactt tgtttaagtg tcgcgttagg    165540
     aggccttgcg cttctccgat gagattaccg gattcacgca tataaatgaa gccacgtgaa    165600
     ataatatcag gtcctgccat cacacgagaa tttttcatat caatggatac aacaacgatt    165660
     acgaggcctt cttcagaaag aatacgacga tcgcgaagga caatattacc gatatcgcca    165720
     ataccgctac catcaatata gacgcttgct gcatggattt taccagcaac atgagctgtt    165780
     tcactcgtta atgcgagtac atctccgttt gccataataa agctattttc ttccggaaca    165840
     ccacattctt cagcagactc tgcatgaatt ttttgcattc tgaattcacc atgaatcggc    165900
     ataaagaatt taggtttcat caaacgtagc attagttttt gttcttgttg accaccgtga    165960
     ccagaagtat ggatattgtt tactttacca tggataactt ctgcaccagc ttgataaagt    166020
     aaattgattg ttcggtttac actcgttgta ttaccaggga ttggggaaga cgagaagact    166080
     accgtgtcac ctggttgaat ttggatttga cggtgcgtac cgttagcaat tctagaaaga    166140
     gcagccattg gttcaccttg actccctgta caaaggatag tcacatttcc agcgggtgtt    166200
     ttattaagtt gatgcacatc aataaatgtg tcttttggcg cttgaatata gcctaattgt    166260
     ttaccgattt ccatagcaga ttccatacta cgaccaaaaa cagcgatttt acgaccagtt    166320
     tcgatagagg attccactac ttgttgtaaa cggtagatat tagatgcgaa ggtagcgaaa    166380
     ataattcgtc cttctacatc gcggaaaata tttttaatac tttcgccaac gacacgctca    166440
     ctcatggtga aatttggtac ttccgcattt gtactatcag atagtaaaca aagaacgcct    166500
     tctttaccga tttcagccat ttttgttagg tttgctggtt cgccaactgg agtaaaatca    166560
     aacttgaagt caccagtatg aacgatgtta ccagatggag ttttgacaac aataccatac    166620
     gtatcaggaa tactatgggt tgtacggaag aaagagatac ttgtttttct gaatttaaaa    166680
     acgtcatctt cttcatattc ataaattttg gtttgacgaa gcaagccatg ttcttctaat    166740
     ttgttgcgga taagtgcact cgcaagtttc ccagcgtaaa ttgggatatt aagatcgcga    166800
     agtaggtaag gaacgccacc gatatgatct tcatgaccgt gggtgataaa aagtccttta    166860
     atcttatctt tgtttttaac caggtaactg tagtcaggaa taacataatc aatacctaaa    166920
     agttcgtctt ctgggaactt gattcctgca tcaattagaa taatttcatc ttgaaattgt    166980
     acgccatatg tgtttttacc gatttcgcct agtccaccaa gagcgaaaac agctgtctca    167040
     ttatttttaa caaatttcat ataggcttat ttttcccaga gcgcgaagtc tgggttttcc    167100
     ttttcataag ctaaatgcgc gtcactaatt ttttcgacaa attcgatgtg gaaaggctca    167160
     tcttttaaaa gttggcgtac ttttacttcg ctttccgctt ctacatatag tgattgtgtt    167220
     ttttcacgta cgggtgtttc tgtaagtgtt tcttgataaa atactttaaa aatcatgttt    167280
     ttctctcctt aaaatttaag ttttgttttt taaaaataga ttttcaagct gaaaacctaa    167340
     tatttattta gtattcattg gcttgctttc agttgtggac ttagtagcaa gcggatatgg    167400
     gtgcacgaga tactgacaat caggcataaa aaagacaaag aaaaattacc acagactaat    167460
     gtataaaaat agctgtgcac gtatgttaaa tttcttatcc gttataattg cataccttta    167520
     ttttgggaat ttgaaacaaa tttccgagta aaagatgtaa ttataagttt tttttcacgt    167580
     tccattgtcg ttctacaaat gttcatccga tctatatcct tcattctaat ataccataaa    167640
     tccagataat tgctactaga aagtataatt aattttgtca accctgttat caaggagatt    167700
     ttctgctata atttaaacat aatgatttaa aaatggatag aggatagagg cgtttaatca    167760
     atgagtaaaa ttgtgttttt tgatgtagat ggcacacttg taggagaaac gaaagaaatt    167820
     ccagcatcag cgaagcaagc gattgctaaa ttgaaagaaa atggtgttta tgtggctatt    167880
     gcaactggtc gcggtccatt tatgcttgac gaaatcagaa aagagttaga tattaattct    167940
     tatatttgct ataacggtca atatgttata tttgaaggca aagaaatata cgctaaacca    168000
     ttaccaaccg agtctttaga acgtttaatc acggttgcat cggagcatga gcatccaatt    168060
     gttttttccg gaaaagattc catgcgcgcg aatttgcctg atcacgaccg ggtgacgatt    168120
     ggaatgaatt cgattaaaag agagtaccct aaagtagatg ctaattatta taaaggtcga    168180
     gacatttatc agtgcttact tttctgtgat gaatcgtatg atgcttacta ccgagaagaa    168240
     tttaaacaat atggtttctt gcgatggcac gatgtttccg tggatgtttg tccagcagac    168300
     ggttccaagg cggaaggtat taagcagatg attaaaaaac ttggcttttc gatgaaagat    168360
     acttacgcat tcggcgacgg tttgaacgat attgcaatgc ttcaaactgt tggaacaggt    168420
     gtggcaatgg gaaacggccg tgatgaggta aaagcagtgg cggattatgt tactagtcat    168480
     gttgatgatg atggggttta taatgcttta aaacagttaa aattaattta aaataacaaa    168540
     aaaagcctgt gctctatttt tgagcacagg ctttttttgt tatttttgga acggaacaca    168600
     gctagttctc tcgattaagc ttgtattcac ttggatttgt ctggtttcaa aattcgtatc    168660
     tgctttaatt tgtttggaca agagggcaag cgtttgttca gcaatatcac gttttttaac    168720
     atgaacagtt gttagttctg gtgtaattac tttactttca ttgatattgt caaaacctaa    168780
     tacggaaact tgttcaggta ctttgatcga tagactttgc agcattttaa tcatgctaat    168840
     agccatgtaa tcattttcgc aaaaaagggc agaaggtaaa tcttgcaatt cagcaatggc    168900
     ttcttttacc gaagcttcct cttggatttg cattgcagat agatgaaaga catgttcttc    168960
     aggaactgaa atatcggctt cttctaaacg agcaaaaaag ccacttttcc gctcatcaaa    169020
     atttttaatg cgtggtagcc ccatcacata accaattttt gtatgtgata gttgtaaaag    169080
     gtagtcagct gctttatatc cgccaagaaa attattaata gaaacaaagt tggctgagat    169140
     atgcggatgg tgtgtatcta agacaacgat tttaggatat tcttgctgta ttcggttaat    169200
     ttcttcagcg tttaaattag tgccaagtaa aataaggcct gctgttggtt gctctttttc    169260
     tgcttcagca agttcttcta atatggttgt tgcatcaaag gtagagataa ccaaatcata    169320
     tgggtaacta gcaatttcag cagataaata gctaagcagc tcactgaaaa agggtaagtt    169380
     ctgatattgt tcggtaatca aattaggact tttgcatgcg ataaaacgaa tggttgattt    169440
     ctttttcatt tttttattgg tgtttcgtaa tgggacgtaa ttattttctt cgacaatttg    169500
     tagaatatgt aaacgggttt cttcacttac gccagctttt ccattcagcg caagggaaac    169560
     agccgatttc gaaacgtttg ctaatcgtgc aatatcttcc agcttcatta ttcatttctc    169620
     cttgtttact aaatttatct agtttagtat atcatgttta gtaaatcgga acaaaaaaat    169680
     agcatatttc cagtcattca aaactttagt ttagttattt atcataaaat aaactaaaat    169740
     aaaatataaa ataatcttta attttattga cttggtttat aaaaaatact ataatgcaaa    169800
     taaagaaagc gattactggt tgctttctat gagactaaaa taattactaa actaaaaaag    169860
     gtggttagaa gatggaggcg attaaaattg ggtttgcacc gacaaggcgc agtatattta    169920
     gtgcgccaga tgcaatcaaa tatgcaaatc tcacacgaga taaactaaac gaactaaata    169980
     ttgaatttgt ggacattaca gaatttaatg aagatggatt actttatgat gatgcagatg    170040
     tgatgaaaat tgcagcaaaa tttaaaaagg ctggaatcca aggtttgttt ttaccacata    170100
     ctaattttgg aacggaatat gtttgtgcaa gacttgctaa agagttagat gtaccagtgt    170160
     tgctttgggg tccgcgcgac gaacgtcctg atgaaaatgg tataagactt cgagatacac    170220
     agtgcggttt atttgcaact ggaaaaatct tacgtcgatt tcaagtacca tttacatata    170280
     tgacaaattg ccgtctatct gatccagagt ttgaacgagg aattcgagat ttcattgcag    170340
     tttgtaatac agtaaaaaca tttcaaaaca tgcggatttt acaaattgga ccacggccat    170400
     tcgatttttg gacaacgatg tgtaatgaag gagagttgct agaaaaattt aatgttcaat    170460
     tagcaccaat tccacttcca gaattaatga aagaaattcg tagtgtatct agcgaacaaa    170520
     tagaggaagt agatggaacc gtcgaatatt gtcacgggtg tgcaatcgtt aaaattaaag    170580
     aagttgactt acgaatggtt gctgctctta aagtagcaat gaaaaattta gcaacgaaat    170640
     atggttgtag tgcgattgcc atccaatgct ggacagcact tcaagatgaa attggtatta    170700
     tgccttgcgc tgcaaacgcg atgctcattg atgaaggaat tccagttgtt tgtgaaacag    170760
     atatccatgg agcaatttct tgtttattaa tcgaagcggc aaatttaggc agaaataaaa    170820
     gctttttcgc tgattggact gttagacatc cagataatga gaatggtgaa ttgctacaac    170880
     attgtggact gtttccgttt tctgttgcaa aagataaacc ggcaattggc tatccgttag    170940
     cgtttgattc acctggtgca gtcgaagcgg aagcgaaagg tggcgaatta accttatgtc    171000
     gttttgatgg tgataatggc gaatattcct tgttactggg taaagcgaga ggtattgaag    171060
     ggccatatac aaaaggaaca tatctttgga ttgaggtaga caatttgaaa cgattagagg    171120
     aaaaaatcgt ttctggacca tatattcatc atgttagtgg catccatgca gatgtggtcc    171180
     caattcttta tgaaacatgc aaatacattg gcataaagcc agacctctat gatccaattg    171240
     aagaagatat aaaagcttat ttacgcggtg aatagagaaa ggagtaaaaa atgagtgaat    171300
     taaagttaaa atcgtttgaa attagaaaag atgttctaaa aatgatatac gatgcaaaaa    171360
     cgggacatac tggttcagat ttatcatgtg cggatattct cgtggcgctt tgctatggtg    171420
     tgctgaatgt taatccggaa aatccagaag ctttagatcg tgatcgttac gttcaaagta    171480
     aaggacatgc tgtcgaagtt ctttgggcag ttttagcaga taaaggattt tttgcaaaag    171540
     aggaattggc tgatttctcc gcatttggct cgcgtataat cgggcatcca aataataaag    171600
     tagctggaat tgaaatgaac acaggttcgc tcggccatgg tttatctgtt tctgtgggta    171660
     tggcattagc tgctaaaatg gatgggaaaa gttatcacac ctatacactc atgggggacg    171720
     gggaacttgc agaggggtct gtctgggaag gcgcaatggc tgcagcaaat tataaattag    171780
     ataatttgac tgcgattatt gatcggaact ccttacaaat ctccggtcga acagaagatg    171840
     taatgagtgt agaacctttg gcagataagt ggcgcgcatt tggttgggat gttatcgaag    171900
     ctgatggaaa taatccggat aagctacaag caatttttaa aacagttaat gagactggaa    171960
     aacctcgtct aattattgcg aaaacaataa aaggttatgg tgttaaaatg gctgaaaatg    172020
     ttgctaaatg gcatcattac gtaccaagca gtgaggaata cgaaatagct atgaaagatt    172080
     tagaggaaag aatggaggcg tgccgtcatg aataaaatag cgaaccgcca agtaatgtgt    172140
     gaagttttaa tgaaagaagc aactcgtaac gatagtaatt tagttgtttt aacaagtgat    172200
     tcaagaggat ccgcttcact gggggctttt gctgagaaat ttccagagcg attaattgaa    172260
     actggtattg ccgaacaaaa tattgttgga attgcagcag gtttagcaca tagtggcaaa    172320
     cgagcttttg tcgcttcacc agcttgtttt ctaagtatgc gcagtattga acaggtgaaa    172380
     gtagacgtgg cttattcaga cacaaatgta aaattgattg gcatcagcgg tggtgttagt    172440
     tatggtgcac ttggtatgag ccatcattcg cttcaagata ttgctgttac tagagcgatt    172500
     cctaatttag aagtcattct accagctgat cgtctggaaa ctgaagctat ttttgactat    172560
     ttgcttcaat caaatcggcc ggcgtacgtt cgtcttggca gaaatgcggt agaagattgt    172620
     tacgcagaaa aaccagtatt tcaaattggg aaagctggaa ctcttaggga aggaaacgat    172680
     gtgtcaattt tagcaactgg tgaaatggta cgtgtcgcac ttgatgcaag tgaagaattg    172740
     aagttgaaag gaatcagcgc acgcgtattg aatttttcaa caatcaaacc atttgaccaa    172800
     gaagtagtaa aagcggcatt aactgaaacg aaactactta ttagtataga agaacatagc    172860
     atttatggtg gcttaggtgc agcagtgagc gaagtggtaa gtagttcgcc aacaagtatt    172920
     cgtcatttga ttttaggaat tccagatgaa cccgctatcg ctggaacgag ccaagaaatt    172980
     tttgattatt atggcttatc tgctactggt attgttgcta caatcatgaa aaacctaccg    173040
     atcattggag acgaaagaag atgaagaaac actatcaaat agccattgat caaagcacat    173100
     ctggtacgaa agtattattg tttaaagaag gcaaacttgt agatcgttta gataaaaagc    173160
     atcgacagtt gtatccaaag aaaggctggg tggaacataa tcccatcgaa atttgtcaaa    173220
     atgtccgtac attaattgcg gacatcttga caaaacatga tttaattaca gcggatatcg    173280
     aacgacttgc tttgacgaat caacgggaaa caattgtagc ttgggataaa caaacgggga    173340
     agccacttta taatgcgatt gtatggcaat gtaatcgaac aaaagaaatt tgcgaaacgt    173400
     taaaagaagc tggttatgaa aaaagaatta aacagcttac cggactgaaa attgattctt    173460
     atttttctgc ttctaaaatg atgtggttat tggaaaatat ttcagcggtg cgggatgcag    173520
     caagtcgtaa tcaattggca tttggcacaa tggatgcttg gttgttattt tcgcttacgg    173580
     atgatagtaa ttatttcaca gaccgaacaa atgctagccg cacactcctt tatgatattg    173640
     aaaaaaatga ttggtcagat gagttactcg aacttttcgg agtcaaacgt gcttatttac    173700
     cagaagtgaa acaatctgct ggaagttttg gaagttatca ggagataccg attcatagtg    173760
     tgatggctga ttcagaagcg gcactttatg gacaaggctg tgatacattt ggggcagtga    173820
     aggcgacgct tgggacagga tgctctgtta tgatgcaaat tggtgagaac agattacctg    173880
     aaaacgatgc tattttgaca actcttgcct gggatgttgc aggcgtgaac cagtttgcgt    173940
     tagaaggaat tattcgttct tgtggagaca cattggtttt tttatccgaa caattagaac    174000
     tatttaatga ttacgataca gcttgtaagc gagcatttca attaccatgc aatgagggtg    174060
     ttgtgctaat tcctggacaa ttaggtttag gcgcccctta ttggaataca gatatacgag    174120
     cagagattct cggtctcaca cgagaacata caaaatggca tattattcgt gccggtttta    174180
     caagtattgc atttcaaatt aaggctgtta ttgaccaaat ggagttaatg ataggtcaaa    174240
     atattaagcg cttacaagta gacggtggat taacaaagca acatgagttg atgcaatatt    174300
     tagcagatgt tttaaaagca gaagtggcag tcagtcccgc ggaagaactt tcggcaattg    174360
     gtgctattga aattgccgac aataacctac aaaataagag aacgatagca aaattgtacc    174420
     aaccaagtat cactcataca catgctctgg aagattttca agaatgggaa aaacaagtga    174480
     aaagcagtat tctaaaaata cagaaggtga ggaattttaa atgaataatt cggatcttgc    174540
     aaaagaggtt gtaaagcttg ttggtggaaa agaaaacatt ttgagtgtga ttcactgtgt    174600
     gacacgacta cggtttaagt tacgtgatga aaatctagca gaaacagaaa aaatcaaagc    174660
     cttaaaaggt gttatgacgg ttgtgaaaag tggtggacaa taccaagtgg ttattggtga    174720
     tcatgtgagt tatgtttatg atgaggtcat tcgagtatta ggtattaaac cagatgatgc    174780
     actgcaagat aatcctgaac aagaacacaa aagtattttt aataagtttg ttgaattaat    174840
     ttctggaatt tttatgccag tactgggtct attggcagct tcaggtattt tgaaaggatt    174900
     cctgacagcg gcagttacaa tgggactaat taatacctca gctggtgttt acgaagttct    174960
     ttacgcggca agtgatgccc tcttttactt tatgccaatt atacttgggt tttcagcagg    175020
     gaaagtattt aaaacgaatc aatatctttc tgctgcggtt ggtgcagcac ttgtttaccc    175080
     gacgcttgtt gatatgtata gcagcggagc tcatttaaca tttctacata tccctgtaat    175140
     tttaatgaat tatacaatgt ctgttattcc tgttatttta gctatttact ttatgagcaa    175200
     actggaaaaa gtattagtga aatttattcc gaaaagttta caattgattt ttgttcctct    175260
     attattactt ttaattgtgg tgcctgtgtc tctaattatc atcggacctg tttcaacgta    175320
     tgctagccaa ctacttgcaa aaggagcatt ggggctttat tcgcttagcc cgatgattgc    175380
     agggttcttc ctggctgggg tttggcaagt ggctgtcatg ttcggattgc actgggcatt    175440
     tatcccgatt ttcattaata atatttctgt tttagggtat gatccaatta atgcaatgct    175500
     ttattgtact gtattcgcgc aaactggcgc ggttatggca gtaatgctca aaactcgaaa    175560
     ccaagaattg cgttcccttt ctataacagc aactatttct gggtttttag gaatcacgga    175620
     accagcgatt tatggagtaa acttgccgta taaaaaacca tttattatgg cttgcgtagg    175680
     atcagcattt ggtggggcaa ttgcaggtat gagtgctgca aaaatgtttg gaggtttcgc    175740
     ttctggtggg atttttggta ttccgatgtt cattaatcca gatggaatag gctgggattt    175800
     ttggggattc ttaatttctc tagtagtagc attcagtgta gcattgattt taacttattt    175860
     ctttggattt aaagataaag tagaggaagt agtaattcaa acaggagaaa aagctacatt    175920
     agatgaaact atttatagcc cacttcaagg ggaattgatt gcattaaatg atgtgaaaga    175980
     tgaagttttc tctgctggta taatgggagc aggagtagcg attcttccag cgagtggcga    176040
     gattcgtgct ccatttgatg gaacagtact tagtgttttc caaaccaagc atgcgatagg    176100
     gttgatttcc aaacaaggag tcgagttgtt aattcatgtt ggacttgata cagttaatct    176160
     aaatggtcaa ttttttgata ttgaagtaag cgaatcagaa gaaataaaaa aaggtgattt    176220
     attaggaaca tttgaattgg atacaataaa aaaagccggc tatgatatta caacacctat    176280
     tattgtaact aatagtgcta cactcgccga tgttattaca gtaaaccttg gaaaacacgt    176340
     agacaataac caaaagattt tagaagcaaa ggcttaatat agaaagggtg aaaaaaatgt    176400
     taaaacaaag tgcagataag cgccggattg agaaaaatga taaacctttt ttctaccttg    176460
     cagatactgt ttggagtgcg tttacgaata ttgatttaac agattgggcc tactatttaa    176520
     aagtccgaaa agagcagggg tttaatgtac tgcaaatcaa tattttgcca caatgggatc    176580
     gaagtgtact aaaaaaaatt caagagccgt ttggtataaa tgaaggtttt ttcgatttaa    176640
     aagctaaaaa tgaagcctac tttaaacatg cagaaaagat gttagaaatg gcagtgaatc    176700
     aaggttttac tccagcgctt gttttgcttt ggtgtaatta tattccggag acgtgggggg    176760
     cgaaatttgg tacttcacca ctgtttcgaa aagaagacat taaaccctat acagaaatga    176820
     tgttggaaca tttcgagcaa ttcgaaccaa tttatatcat tagtggggac acggattttc    176880
     caacggaaac tgtaacagat tattatttgg aagctttaga aaccgtttct aaaaaagcgc    176940
     cacacgcact taaagttttg catatttgtg gtcgattaaa agatattccg gaaaatctgc    177000
     aaacacatcc agcacttgat ttgtattttt atcaatctgg acataattcg gagcaccaat    177060
     caatggccta tacgttggca gaacacttta gtcagttaga gccaatcaag ccagttatca    177120
     attcagaacc gtgttacgaa ttgatgggat atagtcgaca aaaatatggt cgttttagcc    177180
     gagaagatgt acgaaaagca gcttggcaaa gtgtcttatc tggtgctata gctggtattt    177240
     cttatggggc acatggcatt tggagttggc atgaagaagg aagtacattt ggatcagctc    177300
     taggtgaagg atttgtttct ccatttaatt ggcgacaagc acttcatttt gaaggagcta    177360
     cagattatgc atttctaaaa tcctttattc tggctaatga cttaacaaca ctggcaccaa    177420
     taaatctagt tttaaatcaa actccagaaa ttcgagcagc ggagaccgaa aaagtagtta    177480
     tcatttatgt gccatcaaat gtcccaattt atttgaaagg gcaatttgtt tctttggatg    177540
     actatgcgat tgatttggag caaggtaaaa aggttagcct cgcaaaaata cttcatgaag    177600
     aaaaaacaga aattcagatg actccttttt tgaaagatag cttatatgta attcacaaat    177660
     aaattccaat ttctttctgg aaaaaataat tttgtttacc aataaaaact aaagcgagac    177720
     cactatttca gcgtggcctc gcttttggct tttacagaag tttgttctaa tttttgctta    177780
     acgaatttaa gttgtgcgac gattattata ctaataataa caagtaaata ccaactcgta    177840
     atttttgaaa cgtgcactgg acgccatgca actagctggt ctggataaga ccaagctccg    177900
     taaaaactag caatgttctc cgcaagatag atgaaaaaag caatgcataa aaaggaaaaa    177960
     gataaaggca ttttgagctg agtcgaacta actttgaaat aaacatatgt ctttcggaat    178020
     aaaacgagaa ctaaaacaat caaaatccag cgaaaatcca ttataaaatg atgcgtgaaa    178080
     aaattagcgt aaatcgctat gcaaaggcta cttactaacc agatatttgg ccaatttgtc    178140
     attttaagat caaatctttt ccaagcctga caaatataac tcgccacact tgaatacata    178200
     aaaccgctat aaaggggcac gccgaaaagt ttcattaaac caggctctgg ataactccat    178260
     gaccccatat gtactttata gatttcaagt ccaagtccaa taatatgaaa aaccataatt    178320
     accttaagtt catcccatgt ttctaaacca aattttataa gtagcacttg cgttgcaaga    178380
     caaataatca aaagtaagtc ataacgtgca ataaaaggaa tatcaatcaa ttttgtaagc    178440
     gcgagcgaaa taaagataat acctggaaaa atacaacaaa gtgcttgctt ccaagtaaac    178500
     acccaaagta agcggaaaaa ttgcataaaa aaacctcttc tcatgatttt ctctagttta    178560
     ccaaaaaaaa ctaaagaaaa ggacaagaaa aggttaaaaa agttcatttt gatgattgat    178620
     atttctaaat ggggcatctt cttcaaatgc taaaggtttg gtatggagtt tttcgagtaa    178680
     agctctgaca cgatgttgct catcttgtag taagtgatgt agcacttctc gtgagtaggg    178740
     aatattggca accaaatagt gatttgcttg cgctgtttta gcaaaatgat taggataatc    178800
     agccagtcgt ccaatttctt ttggagtcaa aaaaggcata tcgacaggaa gcactaggaa    178860
     attagctttc tgataagcat ttgcttctac catcaccgca taaatgcctc caagcggtcc    178920
     aaattcactg aatgcggttt gatctggaat gatttcaatg cttggttctg catcaaaaag    178980
     agccacgagt tttgaatgat tttcatgatt tgccgataca aataccatat cgcaaagcgg    179040
     cagcaactta ctaaccgtta gctcgaccca cgtttttcca gttgcctcat cctgaaaaaa    179100
     cgcttttggt tccccaaaac ggcttgagcg accaccggct aatacaatgc cgacattaac    179160
     tttttcgttt ttcaaggcgt ccctctcgca taactaaaat ttcttcggtc atcatttctg    179220
     cttccgaggc ataatgcgtg acaaaaataa cgggaatatg gaagtctttg gccatttgac    179280
     caactaattt catacaaatc aaacgcgttt cttcatctaa accattgaaa ggttcatcca    179340
     gtaaaagtaa ttttggctcc gtaatcattg cccgagccat cgcaacacgt tgtttctcgc    179400
     caccagataa tttctgaacg gaagaataaa gcaggtgaga aatttgtaga taatcactca    179460
     tttttcgtac ttgttgctga atttccgcct gttctttttt cttctttttc ttcactttca    179520
     agccaaaagc aatattttca tagacattca tatttgggaa tagagctaaa ttctgaaata    179580
     aataacctac tttgcgctct gtcacaggaa gatgtaacga aatattggaa tcatcccacg    179640
     gagtcccgtc aaattcaata atgccgccgt caatactttt caagccacta acgcactgaa    179700
     atagagttga cttgcctgaa ccacttgcac ccatcatcgc ggttactggc ttttcaaacg    179760
     tataatcaat atttaaatca tgaaaaggaa gttttttatg aaattgtaat cgtagcataa    179820
     ttacatcccc ctcgttaaat tactctggcg tatagttaat acatgaatga caagtaaagc    179880
     aaacacgccg attatgacgt taattaaccc aagataaatc gcagtacgca tgtctccttg    179940
     ttgcaccata aaatagatgc ttgaagcaat ggtgtcggtc ttgccttcaa tataaccagc    180000
     caccatcaaa cttgcaccaa actcacccat cgcccgacaa aaactaagca gaacccctgc    180060
     taaaattggt tgccagcaat tcggtaaaat aatttttgtg aaaatctgtt ttttattcgc    180120
     tgaaagagtc tctgctgccc atacaagttc gtgatcaatt gataaaaatg ctgatttcaa    180180
     gccttgatac ataattggta aaataataat cgttgttgca acaattgctc cactaaggga    180240
     aaaaataaag ctgaaatcaa aagtatccca aagcacgcca ccaataaaat cattgcggcc    180300
     gaggatattc agtaaaacta aaccaaccac cgttggcggt aaaacaagcg gaagtaaaat    180360
     taaaatctcc actggtaact gaaaacgtga ttttcgaccg gcaaaataat aactcagtgg    180420
     taacatcgtc ataaatgcga gaaacgtaga aattgtggct acaagtaatg tatgccaaac    180480
     agatgtaaac ataaatctcc tcctgaaccc tctagtactt ctattattat cgttctctct    180540
     ggtataaaat gtcaaactta agtacaatgt aactaaataa aaaaggggga tgaagaatga    180600
     aaaaaatagt acttattata tgttgtggat tattactact tctcggagct tgcgaggata    180660
     cgcctgagaa agtccaaaca acgactatac atatttcagc agcagcaagt ttaaaagatt    180720
     cgatagacga cgtaaaacca ctttttgaaa aagccaatcc aacgattaaa ttatcttttg    180780
     attttggtgg ttctggacaa attcgcgaac gtgtcgaaag cggggcacca attgacggcg    180840
     tccttttagc gagtaaaaaa gatgcagata cactgattaa gcaaaattta gcagaaaaaa    180900
     cgaaagaatt tgcgggaaat gaactcgttt taattgaacc taaaaacgtg gatcagaaga    180960
     cagaggcgaa cttagaacaa ttactaaatg acgcatccaa aatcgccatc ggggacccag    181020
     aatcagtacc agcaggtgct tatgccaaac aaacgctcga aaacctaaat ctatataatg    181080
     cagaaaaagc aaagcttgtt cttgcaaccg atgttcgtca agtcttatcc tacgtggaag    181140
     ccggaaatgc agatgcaggc ttcgtttacc agacagatgc tctattaagc aagaaagtac    181200
     aagtgaaggc aaaaatcgat gagaaactcc atgatccaat cgcttactac agcgcacaag    181260
     tcagtgattc agataaaaaa gaagaaaccg ctacatttct tgattttatg aataaatcag    181320
     aagcgcaaaa aatactggaa aaatacggat tcaaagcagc aaactaatga gaagtcgctt    181380
     tactttttaa aacaagcaaa ctcctgtata ttggtactaa agaaaacgca tacatttatt    181440
     gtgaaaggga agtgcgccca aatgattgaa aaaagaaata ccattagaat ggaacaagcg    181500
     agagaagtat tatgtaacca aataacgcat cttccagtag aaaagaaaca tgtgacagag    181560
     gcgttaaatc aagttttaca agaacctatt ttcgcgccgt ttcctgctcc atattttagg    181620
     cgttctggtt atgatggctt tgcgattact gaggtggatg acgggaatta tcctatcacc    181680
     ttgcgcgttg tagcagaagt tccgtgtgga gaaacatacg ataaaccgct aaaacctggt    181740
     gaaaccgtcc gaataatgac tggggcaaaa gtgccagata atgcctcgaa aattattatg    181800
     cttgaacaat caagagaagc ggataacgag aatgaaatca tacttataaa tacacaaaaa    181860
     tctagtaaca ttacagaaat cggtacggag tttgccaaag gagatttgct gttagatcgt    181920
     ggacacattt taaatgccgg ttcgataagt ttactgtcat cctttggaat tcaagaagta    181980
     caagtcatca gaaagccaaa agtagctatt ttatccacag gtagtgaact tgttcctgct    182040
     ggaaatccac ttccagatgg caaaattttt aatagtaatc aaccgttact ggagaattta    182100
     ctaaaagtac atcatgccga gatttgcgct gccgaacaat tacctgataa ttatgaggac    182160
     acgaaaaacc gtttactaga attgactaag atagcggact taatagttac tacgggaggt    182220
     gtttctgtag gtgattttga ctacatggct gatattgcaa aacaagaagc agaattactt    182280
     tttaataaaa ttcaaatgcg accaggcagt ccaacaacag ggatgtggtt ggataaaacg    182340
     cttatcatcg cgctttctgg caatccaggg gcatgcttta caggttttta cttattagta    182400
     gaaccagtat taactacctt aatggggaaa gatacaactg agacgactca agtccgtgca    182460
     aaaatggcga gcgattacac caaaaataat ggctatgatc gttttttacg aggaacctat    182520
     cgtttgtctg acgaagggga atatttggtt gagttggttg gtagcgacat gtcgagtgcg    182580
     ctcggtaatc ttcatttaac aacctgttta ttcaaaatcc cacgagggca agtagggaaa    182640
     ttaaaaggag aagaggtcga agcatggctg ctatactcca aataatcggt tttaaaaata    182700
     gcgggaaaac aactttacta aatgcattaa ttcgcgctag tcggaaggaa aactacacag    182760
     tatctgccat caaacacgat gcccatgatt tttctgtaga tcacgcggga acggattcct    182820
     actcgtttca agaaagtggt gcagaagctg ttgttatcgc gaattcgaga caatatgctg    182880
     tgatggaaca aaccggtatc gatttaaaaa cagccattca aaagttgcca gaatcagata    182940
     tcgttcttat agaaggctac aaagaaggtc cttttcctaa aattattttg gttcgcgaac    183000
     aggcagaaat cgaactttta aagaatagta aagctgtcca taaaattgcg acacataatc    183060
     cagcgctaaa aaaagaagcg atttttattg gagaagaaaa tgctttaaac ctttttgcag    183120
     aaacgttaat caaggagttt ttaaaatgag atatgtagcc ttacaacatg aaaaaattga    183180
     aattggccca ctttctgaaa aactaatcaa taaaaatcac ggtgggacta atctttttgt    183240
     tggtacaatt cgagaatgga ctggtgatat ccaaacagaa gaaattcgtt acacatccta    183300
     cgaagaaatg gcgctcaaag aactaaacaa gttggctaca gaggtagaag cgaagtgggg    183360
     agcagatgta gttatcgttc accgactagg acttttgcaa ataaccgata tcgctgtggt    183420
     cattggcgta tcgacaccac accgcgccgc ttgctacgag ggatccagat atattattga    183480
     acgtttaaaa gaacgtgtac ctatatggaa agaagaaaaa gacgttgata aaacaaggtg    183540
     gggtggcatc aatgctcaca acagttaaat ttttcgcttt tttagctgaa aagacacata    183600
     aaaccgaagt aaaattgaat ttgcagcagt gccagacagt tggcgaggtc cgagaagtta    183660
     ttagtagtga gtttcctgaa atagccgtag atttggcaac atgtatgcta gctgtgaata    183720
     tggaatttca acaagatcaa gattttttac cagaagaaat aaccgaaatt gcagtcattc    183780
     cgccagtaag cggtggataa ggagggaacc agatggaaaa agatgatttg acgcatttta    183840
     atgatgaaaa acgcgcaaaa atggtggatg ttacaagcaa atcagaaaca aaacgccgtg    183900
     caatcgctag cgctacgata catatgaatg aagaaacgtt agcacgtatc catgctggta    183960
     aaattgctaa aggagatgtt ttagctgtcg cacaagtggc tggaatcatg gcggctaaaa    184020
     aaacaagtga actaattcca atgtgccatc cgattatgac gacgaaagct gatatttctt    184080
     ttgaagatga tgggaaaact gcgctaacta tcacatctga agtcgtaacc gttggaaaga    184140
     cgggcgtaga aatggaagca ctcacggcag taaccattgc cgctctaacc atttatgata    184200
     tgtgcaaagc aatggataaa ggcatgcgca tcgaaaaaac ctatttagtt gagaaaactg    184260
     gcgggaaaag cgggacattt aaagcagaag cgtaactatt ttgtaggata ggagttttgt    184320
     tttatgcaat tattaaagga taaatttggg cgggtacacg attatattcg tatttcagta    184380
     acagatcggt gtaatttaag gtgtgtgtat tgtatgcccg aagaaggcct gacatttttg    184440
     ccccatgaaa aagtactatc caaagatgaa attgtcagtt ttatggaatt aatggtgaaa    184500
     ttcggcatca aaaaagtacg catcactggt ggagagccat tacttaggac cgatattgtg    184560
     gaaattgttc gcgggcttgg agcaattcct gaaatagaag atatttcgat tacaaccaat    184620
     gctatgtatt tggcgaaaaa agccgaagcg ctgaaggagg cggggctcac acgtgtaaac    184680
     atcagcttag attcccttca cgcagatcgt tttaaagcaa ttacacgagg cggtcgtttg    184740
     caaaaagtac tcgatggcat tcaaaaagca gaagaagttg gattgtttcc aattaagctt    184800
     aatgtcgtcc taattaaagg acaaaatgat gacgaaataa cggatttcct tcgatttaca    184860
     aaagataaag atattaatat tcgtttcatt gaatatatgc caattggtca tgctggtacg    184920
     agttggaaag aaaaatattt gccgctggat acaatttttg aggcttgtaa tgaagctggt    184980
     tatgagtatg aaccagtgga ctcaattcgt ggaaatggcc cctccgaaaa tttccgtatt    185040
     aaaggagcga aagggacgtt tggtgtgatt cacccggtta gcgctcattt ttgtgatagt    185100
     tgcaaccgac tcagacttac cgcagatggt tatattaaag cgtgtttata ctgggatgaa    185160
     gaaatgaata ttcgcccatt tatccaagat ccagtcaaat taatgcaact ggtgcaaaaa    185220
     gcaattgata ataagcctga aaatcatgaa atggcattaa aattacaaga tgaagtacaa    185280
     tctaataaac caacttggcg gcgtatgagt caaattgggg gataaataaa acatccggtc    185340
     gcatgtgcgg ccggatgttt tatttttgtc gttctgctat taaatgaggt aattctggga    185400
     taatcaattt ttgaaccgcg agctggcaag cattacttga tccaggcaac gcaaaaagca    185460
     gtaagccgct ttctgaaaag ccagcgaatg cacgagacac catggcacga ctaccaactt    185520
     cttcgtaact gagcatcctg aaaatttcac caaacccagg gatttcttgc tgaatcgttg    185580
     cgaataatgc ttcatatgta acatcgcgcc tagcaatgcc ggtaccacca tttgtgataa    185640
     gacaaaagga cccattagct gctaactcgt ttattttttg cttaatgagc gtaacatcat    185700
     caggaacgac aacccgtgaa atcacctcat gcccagctgt ttctaaggca gattgaatca    185760
     gttgaccact agtatccgta tccaaattcc ttgtatcact aatcgtcaaa atactacaag    185820
     tcaccttaat aaatgtcttt tgttccataa ctgcctcctt tagttaaaaa ataaatgata    185880
     tattttctta gcttctgcta tattttctga tccatgaagt aacacacgcc catttttaaa    185940
     aataacaaat tgaaactttt cgtattggaa actgagtaaa gcggggtttt cattataaat    186000
     aattttttgt tccgtcagca gtagtttaat ctcgcggtaa ttacttttat ttggtaaacg    186060
     aaattgtact gtatcacgcc cgcaaagagt aaccgtttgc ccggaaaaag gaacttctga    186120
     aaccattttt ccaggtgcgc aactagagca atcgggacgt tttttgactt cgatagtttg    186180
     gaaagaaaag tgccaattat ctagttggta gtaggtattt gctttgaaat cagggttgat    186240
     aatcatttga gtaagtaggg aaacttgcat gccggcgacg attggaatca gcgcaccatc    186300
     aacgccaata atatcgcaac ttgctgcgtt ggtttgggga atatcaccaa gtaaacagtg    186360
     taaacaagca gagtcaggcg gaataattgg catgagattc gcgtaatttc cagcacacga    186420
     ggtgaaaatc cacggaattt gatggctgaa acaaaactga tttaaaaagt cgcgggtcat    186480
     aaaattatct gtacaatcta gtatgtaatc aattgtccca acataaggcg ttaaactcgt    186540
     tacgttcgca tcatctacaa tatattcgat tgtaatatcg ctattaatga gttgtaaagc    186600
     tttagatgcc gcatacgatt ttgcttgctt gtctaacgca tcttgttccg tgaaaagcga    186660
     ttggcgttgc aaattactta gctccacata gtcacggtca attaaaatta actttccaaa    186720
     gcccattcgc gcacaaattt ctgcggcata tgacccaatc gccccaactc caacaatcaa    186780
     aatcgttttc gtaagtaatt tttcttgacc atcttttcca atatttttaa cgcgcatctg    186840
     tctatcataa cgttccaagt ttccaccttc tttccaatct tattttacca gataattgca    186900
     taaagcgctt acttgcaagg tttaagttta ttgttgaatt cctgttacga catctttata    186960
     atgaaagaaa aaactagagg tgctaactat gaaacagcgt gtagaaacag aaaaatttta    187020
     tccagcttat ccagtttttg tattaacgta tttgaatgag attggagaac cgcaaatgtc    187080
     aacgggatca tcatcgtaca cattaggaga tagtatcgtt atcggcgtgt cagcagaaag    187140
     taatgcgggc aaacacttgc atgctggcca aaaattcgca gtaaattttc caaatacaga    187200
     gcagttagga ttaattgaac aagggggatt ctcgtcggga aagcgtaacg ataaaataaa    187260
     agttcatcaa atcgaattaa ccaaaagtga tagcggggga gtagcttata tagatgtgtg    187320
     tccgattgtt ctcgaatgca ccgtgattca aacagtttct gacatggact atcatacaat    187380
     ctttgctaaa attgactcgc gattatttga aaaaaattta gtggattcag agggtcattt    187440
     tattcacgaa gaacttgatt tagtgctatt ctcaggcgat gcaaatgaac gtaaattcag    187500
     acagttggat gcaaaaatag aaacaattgg tggccattca taaagacaaa aatccccaca    187560
     ggatcttaat tcctgcgggg atttattcaa tttaaccaaa tacgtccaca tctggtggca    187620
     agtaagatgg attttcttta ttaatatgat cataaaacat aataccattt aaatgatcga    187680
     tttcgtgttg aataacaatc gctggataac ctttgaagcg taatttgagc ggtgtaccat    187740
     tttcgtcaaa ggcatcaatg gttacacgtt cacttcggac cacataacct ggaacttcac    187800
     ggtcaacaga aagacaacct tcgccaccag aaagacaagc ttgctgcaca gaatggctac    187860
     gaatttttgg attataaagc acataactat aaagacgatc tttttcatca tgtacatgaa    187920
     tagctaggaa acgtttagtc acagcaagtt gtggagctgc aattccaacg ccaccacgca    187980
     acccgtattt ttctgctaaa tcttcatctt gactgttaat cagaaattcg agcatatcgc    188040
     gtcctaattt tttttcttca tctgaaagcg ggaaagtcac ttctgtcgca acttctcgaa    188100
     gtgctggatg accttctcgt acaatatcgt ccattgtaag catgatttga ttctctcctg    188160
     ttctttaata acttatcttt attttaacaa aagaacgaaa aaaaaggaat gaaagattac    188220
     caggctcgaa aaaaagagtg ttttaatagg tctaaagaca tatttgttaa aaaagataaa    188280
     gttttaaaag cgaacaataa ctattatttt ttaaaaaatg ttcgtttaaa ctaaacgaag    188340
     aaaaaattta tatgtttgtg aattcacaaa ctatcgatat ttgctgtttg aaagtttgaa    188400
     ataggtgtga taatgcgaga gttgcaatat tatataacag tttttatctg tttcatcttt    188460
     ttttaataca gaacgggaaa gcgaatgatt taagtaataa tgccattgta agcgataaaa    188520
     caaatagaga ttaacttatt gacttcataa tcttggtagt gtaaattaag agagaagatt    188580
     agtgtattaa taaaattctt gttttcgagt aaaacagaaa taacatttta aataaaagga    188640
     aagttcctgt ttttttatga aacattgtga aagaatgaaa gttttttcac atactctctt    188700
     aaaacccatg ttttcaatga ggaatttgtg gtaataactg gagaggctac gtaattagtt    188760
     aataggaatt tagaaaaaag cttccggaat ctgcttcttt ctatagaata acttttcttt    188820
     ttactacgct attataatta atacacaatc aggatggcag ttttaaaaaa accatctagt    188880
     aaggtaaatg accggacgag cgttacataa aacgcatacc taactaatga agaatttgaa    188940
     actgtacaat gtgaatgacg aaagggtgga tacgaaatgg cttctaaaac aaagaaggct    189000
     attatcgacg taaagaaaca atttgaggct gttcataaac aatttgaatt ggttcaaatt    189060
     ttgaatgaaa aaggagaaat tgttaatcca gatttaatgc cggatttaac agatgatcaa    189120
     ttagtagaat taatgactcg tatggtttgg actcgtgtac ttgaccaacg ttctatctca    189180
     cttaaccgtc aaggacgtct aggtttctac gctccaactg ctggacaaga agcttcccaa    189240
     cttgcaagtc actatgcact tgaaaaacat gactatattc ttccaggata ccgtgatgtg    189300
     cctcaactta tctggcacgg acttccactt acaaaagcgt tcttgttctc tcgtggacac    189360
     tttgtaggta accaattccc tgaagattta aatgtattat caccacaaat catcatcggt    189420
     gcacaaatcg tgcaagctgc cggtgttgct ctaggtctta aaaaacgtaa aaaagatgct    189480
     gttgtaatca cttatacagg tgatggcggt tcttcccaag gtgacttcta tgaaggaatg    189540
     aactttgcgg gtgcttacca tgctccagcg attttcgtag tacaaaacaa caaattcgcg    189600
     atttctacac ctcgtgaaaa acaatctgct gctgaaacat tagctcaaaa agcagttgca    189660
     gctggaatcc caggcgtaca agtagacgga atggatccac ttgcagtata tgctgtaact    189720
     aaattcgctc gtgaacgtgc agttgctggt gaaggcccaa ctctaatcga aacaatgact    189780
     taccgttatg gtccacatac actttctggt gatgatccaa ctcgttaccg tacaaaagaa    189840
     cttgatggtg aatgggaact taaagatcca atcgttcgct tccgtacttt cttagaaggt    189900
     aaaggccttt ggaacgaaga aaaagaaaat gctgttatcg atcaagcaaa agaagaaatc    189960
     aaagtagcaa ttaaagaagc agacgctaca ccaaaacaaa cagtgactga tcttcttaaa    190020
     aatatgtacg aaacaccaac tgctcctatc aaagagcaac tggcaatcta tgaagcgaag    190080
     gagtcgaaat aatcatggcg caaaaaacaa tgattcaagc gattacagat gcgcttgcag    190140
     tagaacttga aaaagacgaa aacgtattag tttttgggga agacgttggt aaaaacggcg    190200
     gcgtattccg tgcaacagaa ggattacaag aaaaatttgg cgaagatcgt gtatttgata    190260
     ctcctctagc agaatctggt atcggtggtc ttgctatcgg tcttgcactt gaaggtttcc    190320
     gtccagttcc agaaattcaa ttcttcggtt tcgtatttga agtaatggat tctgttgctg    190380
     gtcaaatggc tcgtatgcgt taccgtacag gcggaactcg taatgctcca atcacaattc    190440
     gcgcaccatt tggtggcggc gttcatacac cagaaatgca cgcggataac ttagaaggat    190500
     taatggctca atcacctggt ttaaaagtgg taattccatc cactccatac gatgcaaaag    190560
     gtcttttaat ctcagcaatt cgtgataacg atcctgttat tttcttagag catatgaaat    190620
     tatatcgttc tttccgtgaa gaagttccag aaggcgaata cacagtagaa attggtaaag    190680
     cagctgttcg tcgtgaaggt acggatgttt ctatcatcac ttacggtgcg atggtgcaag    190740
     aatcaatgaa agcagcagaa gctcttgaaa aagatggcgt atctgtagag gttatcgatt    190800
     tacgtacaat tagcccaatt gatgtggaaa caatcattgc ttccgttaag aaaacaaacc    190860
     gtgctgttgt agttcaagaa gcgcaaaaac aagcaggtat tgcagctaat atcgttgcag    190920
     aaattaacga tcatgcaatc ctttctctag aagctccagt tatgcgagtt gctgctccag    190980
     atagcgtatt cccgttctct caagcagaaa cagtttggtt accaaatcat aacgatatta    191040
     tcgaacgtgt aaaagaagtt attgcatttt aattcataat gaccgtttta aaacttatgg    191100
     ggagttttag aaggggaaag aaatattttt atactaaggt tcagtttatc tgaaccttag    191160
     aaattacagg aggcttaata aaatggcata ttcatttaaa ttaccggata tcggtgaagg    191220
     tatccatgaa ggtgaaatcg ttaaatggtt tgtacaacca ggcgataaaa ttgaagaaga    191280
     tgaatcccta tttgaagtac aaaacgacaa atcagtggaa gaaatcactt ctccagtttc    191340
     aggaacaatt aaagaaatca aagttgctga aggtacagtt gctacagttg gacaagtact    191400
     agtaacgttt gatggcgtag aaggtcacga agacgacgcc gaagaagaaa gcgcagcacc    191460
     aaaagcagaa tccacagaat caactcctgc acccgcacaa gctagcggaa aaggaatttt    191520
     tgaattcaaa ttaccagata ttggtgaagg aattcatgaa ggtgaaattg ttaaatggtt    191580
     tattcaaccg ggcgataaag tagaagaaga tcagtccatt tttgaagtac aaaacgacaa    191640
     atctgtcgaa gaaattactt ctccagtaga tggtactgtt aaagatattt tagttagcga    191700
     aggaacagta gcaacagttg gtcaagtatt agtaacattc gaaggtgatt ttgaaggaga    191760
     agcaagccat gaatctactc cagaatctcc agcagaagac gctgcacttg ctaacaacga    191820
     tgcaacttcc gcaccagcaa caggtggaaa cggaactcca tcatctaaaa aagatcctaa    191880
     tggccttgta attgcaatgc cttctgtacg taaatatgcg cgtgaaaaag gcgttaatat    191940
     cgctgaagta gcaggctctg gaaaaaataa ccgcgtagtt aaagctgata ttgatgcttt    192000
     cctaaacggc gaacaaccag ctgcagcaac aactactgct caaacagaag aaaaagcagc    192060
     tgcaccaaaa gcagaaaaag cagcaggaaa acaaccagtt gcaagctccg atgcttaccc    192120
     agaaacacgc gaaaaattaa caccaactcg tcgtgcgatt gcaaaagcaa tggtaaactc    192180
     aaaacataca gctccacacg ttactttaat ggacgaaatc gaagtaactg cacttatggc    192240
     tcaccgcaaa cgtttcaaag aagtggctgc cgaaaaaggt atcaaactta ctttcttacc    192300
     ttacatggtg aaagctcttg ttgcaacgct tcgtgacttc ccagtgctta acacaacttt    192360
     agatgatgcg acagaagaac ttgtttacaa acattacttc aacgttggta tcgcagcaga    192420
     tacagaccac ggtttatatg taccagtaat taaaaatgct gacaaaaaat ccgtattcca    192480
     aatttctgat gaaatcaacg aactagctgg aaaagcacgt gatggtaaat taactgctga    192540
     cgaaatgcgc cacggttccg caactatttc taatatcggt tctgccggcg gacaatggtt    192600
     cactccagta attaattacc cagaagttgc tattctaggt gttggtcgta ttgctcaaaa    192660
     acctatcgta aaagatggcg aaattgtagc agcaccagta ctagctcttt ccttgagctt    192720
     tgaccaccgt gtaattgacg gcgcaactgc tcaaaaagca atgaacaata ttaaacgttt    192780
     attaaacgat ccagaattat tactaatgga ggtgtaacaa aatggtagta ggcgattttc    192840
     cagaagaaag agacaccata gtcatcggtg caggcccagg tgggtatgta gccgcaatcc    192900
     gagctgcaca actcggacaa aaagttacca ttattgaaaa agaatattac ggcggtgtgt    192960
     gcttaaacgt gggatgtatt ccttccaaag cacttatcac aatcggtcac cgttttaaag    193020
     aagctggaca ctctgataac atgggtatta cagcggacaa cgtgaactta gatttcacaa    193080
     aagcacaaga atggaaaggc ggcgtagtta acaagcttac atcaggtgtt aaaggccttc    193140
     ttaagaaaaa taaagtagaa atgttagaag gagaagcgtt cttcgtggat gatcattcct    193200
     tacgtgtgat tcaccctgat tccgctcaaa cttatacatt taacaacgta atcattgcaa    193260
     caggatctcg tccaatcgaa atcccaggtt tcaaatatgg taaacgtgta ttaagctcaa    193320
     ctggtgcact tgcactaaca gaagttccga aaaaattagt cgtaattggc ggcggatata    193380
     tcggaacaga actaggtgga gcattcgcta accttggtac agaactaact atccttgagg    193440
     gtggtccaga aatcttacca acatacgaaa aagacatggt ttccctagtt aaacgtaatc    193500
     tgaaaagcaa aaacgttgaa atggttacta aagcacttgc aaaatctgct gaagaaactg    193560
     aaaacggcgt taaagtaacg tatgaagcta acggtgaaac aaaaactatc gaagctgatt    193620
     atgttttagt aacagtaggt cgtcgtccaa atacagacga aatcggttta gaacaagctg    193680
     gcgttaaagt aacagaacgc ggtttagtag aagttgataa acaaggtcgc tcgaatgttt    193740
     ctaacatttt cgcaattggt gacatcgttc ctggtgttcc tctagctcac aaagctagct    193800
     atgaagcaaa aatcgctgct gaagcaattg ctggcgaaaa atccgaaaac gattatacag    193860
     cacttccagc tgtcgttttc agtgatccag aacttgctac agttggttta acagaaaaag    193920
     aagcaaaaga aaaaggcttt gatgtaaaag ctgctaaatt cccattcggt ggtaacggtc    193980
     gtgcgctttc tttagatgca ccagaaggat ttgttcgtct agttactcgt aaagaagatg    194040
     gcctagttat cggcgcacaa gttgccggaa tgaacgcttc tgatattatt tcagaaatcg    194100
     gcttagcaat cgaatcaggc attacagcag aagacatcgc gcttactatc cacgctcacc    194160
     catcactagg agagcttaca atggaagcag ccgaacttgc tttaggtcgc ccaattcata    194220
     tgtaatcaac acgaagcgga gatactcttt tttgggtatc tccgctttta aatatagaaa    194280
     taagtgcgta ttttcacaaa aacacttttt agttcatttt ttgaattatt taaagtatcc    194340
     gttttagaaa aaaaggagta taatgtaaca agtgaacgta aaaagtcaaa tctaattgaa    194400
     tcaggtgaaa aaatggagaa acaaacagca acttggaaga aagctctatt ttggtttgcg    194460
     tatgtagtag caggaatttg ttttgtattg acaatcgtag cctttggagt aggtttcttt    194520
     catcatatgc atgatacagg tggatggcgc tcggttattc aaattctcga aacaccaatc    194580
     actggctttg tcaaaatgac tggtggctat atcggtaaag ggattttaga agtaattatt    194640
     ctgattatcg ttagttatgt actaccaatc ttcttctgtt ttgcaacgca ttatttaaaa    194700
     gtgaaacgac gtgaaatgac ttaaaataag attattttgt aaaaagcaaa gcgaatgagc    194760
     attgcttttt atttatttgg tcaagttatt ttatttttgc ctcggaagca tgctaaaata    194820
     acaataagag acttgatgag gaggagacgc atatgccatc taagaagaaa aaaattgtcg    194880
     ttatcggcag aagtaatcta caaaatctct acattcatac agttcttttg aaaaaattac    194940
     cagccgagat ttacttaata gacgatcaag cgaaaacaag cgtacaagat tttgattatg    195000
     cgagttatta tcatgcagat gtgaccattc actcaggaac attcaatgag tgtcgcaacg    195060
     ctgatatagt cgtctttttt caagaagaaa tgtccaatca aatcgtttca aaagaagata    195120
     atgtcgcgct aatcatagaa aaagtgaaga aaatgatggc aactggtttc cgaggaattg    195180
     tcttagtggc aacagctgag agtaatgtcg ttgccgcgtt aattaaacgc ttctccggtt    195240
     tatcagcaaa tcaaattatt acgcttggca ccatgcttgc gacgtcttat tttcaagtgg    195300
     aaattgctaa attatttaaa atcagcccta aaaatgtaca cggatatatt attggtgata    195360
     atgcagaaga tgtcattcct gtatggagca gggctttcct tggtggcaaa ccaattttaa    195420
     gttatttagc cgaagatcaa aaaagaatct cagcagagga tttacaaaat ttaacaaaaa    195480
     tgattactaa aattccggat tttccttttg aaaataaaga tggttgtact ttccgattta    195540
     gcactgtaac tgttcttgct gaattaaccg aagtcatttt gcgcgacgaa gcaagagtta    195600
     tcacagttgg tgttgaagtg aaagaagcat acggtttaga aaatcctgtc ttcattagtg    195660
     tcccagctgt cattggtgca gaaggagtca gagaactact tgaattaaat ctctcagacg    195720
     atgaacaaaa agaattaaaa caaatcgccg caaaaaccac cgagaaattg gaagaattgc    195780
     aacttaacaa aggagggatt agttaatgga atacagttat ccactaaatc cagactggac    195840
     aaccgaagaa atgacgattg ttgtacaatt tttagaagct attgagcgag cgtatgaaaa    195900
     gggcatagat acgcttgagc tcaaagaaaa atatcgagca ttcaaacaag tagtccctgc    195960
     caaaggagaa gaaaaacgga ttggcataga ctttgagaaa gccagtggct attcggccta    196020
     taaagtcatg caacttgtaa aaaacgcaac tactagtaaa ataaaaatgc aaccataatt    196080
     aagaggagga atttttttca tggatattag tcaaattaaa gcagaagtag taacaccaga    196140
     aactggaata cacgtaggtg aaaaggcagc gcccgttaaa gtaatgtctt tcgttaactt    196200
     acgttgccca ttctgtcgtg agtggaatga aaaatccaaa gacgttctca cggaatatat    196260
     tcaagcagga aaaatcgaat taattattaa accatttgat aaagagaaag aatctttaca    196320
     acgaggaaat gtgacgcatc gttatttaga ttattcaaca ccagaaaaaa cacgtgaaac    196380
     aatcaacaag atttatagca agcaagacga gtggggtagc ctttcacttg atgaagtagc    196440
     tacttatatg gaatctgaat taggcctaac agagcaagac aataaagctg catcagaaaa    196500
     aattgtcgca gaagcaaatg cagcaaatgt tgtttttgta ccgactgtta ttgtgggtga    196560
     acatattttt gatgagcata ttagccctga agagttacgt tcgctacttg atgatgaatt    196620
     agctaaataa ttaaatagaa ggaatccagt tgatagaagc aaatgtcaca atttgcgcta    196680
     tcatctggat tctttttttg tgagaaattg aataactcca tgcaaactcc atctttattt    196740
     tatataataa aaagaacagt aggaggcaaa tatggaaaaa atactcattg cagaagatga    196800
     ttcagctatt ttaggagtta ttacagcatt cttaaccgaa gcagggtatc aagtaatgac    196860
     agctaaaaat ggaatagaag catatcatct atttcaaaag gaaacatttg atttaattat    196920
     tatggatatt atgatgccga gtatggacgg gtacacacta acagaactga ttcgttctac    196980
     ttcaaccaca ccgatactta tgatgacggc gctctctgaa gaagatgacg agttgaaagg    197040
     ctttgatcta ggggcggacg actatataca aaaaccattc tcttatttag tattattaaa    197100
     acgagtgcaa gtacttttga gacgagtgaa ccaaagtgaa acaaagaagc aaatactacg    197160
     atgcggaaat atttctgtag ataccgaaac ctttgaagtg atttcagctg gagaaacaat    197220
     cgaattaacg aaaaaagaat ttgatatttt agtactcctg attaaaaatc aaaagaaggt    197280
     gattactcgt gaaatgatat tgtcacaagc atgggatttc gcagctattg tggatacgtc    197340
     cattatcaat acgcatatga aaaatctacg caaaaaactg cacactgaaa aaattcaaac    197400
     gattagaggt gctggctata aaatggatga ataaagtgag aaccagaatt agttggaaaa    197460
     ttttcttaat atttgtgagt atcattttac tttttacggc tctagtctat gccatgctaa    197520
     tctttttctt accacaattt tattatgatt ataaaataaa acaaattaat gattatgcaa    197580
     atgaagtcgt aaaagcaggc gaagcggatg atattgaagg tgtggaaaaa gcactaaatg    197640
     attttatgga aaatacaaat attttaccaa ttttaataga tagtaatgga aatattgttt    197700
     atataccaaa tgtgaatatg gcatccatta aatcagcaac atcgactgtt gtagacggca    197760
     cgaaagcaga aggtggtaca actgcaacgg attattcagg tggaacagaa acaaaaaata    197820
     aacctatttc tatcaatggt caaacctaca atctcaccta tacgattaac atccaaaaaa    197880
     ttaatgatat ttcgaccgtc ctattacaat ttgctcctta ctttatttta tttgcattta    197940
     tattaagttt attaaccgcc tactttttct cccgcagaat ggtgagacct cttttacgaa    198000
     tgaataaagt tgcctccaaa atggcgaatt taaactttac agaagtactt ccgattacat    198060
     ccaaagatga aattggtcag ctttcgggaa atttaaacga aatggcaatt aacctagaaa    198120
     aaacgatgct tgaattaaat gaagtaaata aaaaattaca aaaagaaata gaaaaagagc    198180
     gtcaactcga ggaaatgcga aaaagttttg ttacagctat ttctcatgaa ttaaaatccc    198240
     ctcttgctgc agtaatgggt caagtagaag caatgcgtta taatgtagct ccatatgaca    198300
     atcatccaaa atacttacaa gagtcatacc agattttgga aaagatgtct cagatgatac    198360
     aagaaatgtt agacgtatcc aaagttgatc aaacaaacta tatgatagag aaaacttctt    198420
     tttccttaac tgaaatggtg gagaaaatta tctatagtaa aaaaatggta ccacatcgtc    198480
     tgtctcaaaa agttgttttt caagtgaagg aagatgttac agtaacagca aattatgcct    198540
     ttatcgaaaa agcaatcgaa aatatttttg agaatgcttt taattattct aaagaagaaa    198600
     caaccatttt agttgaaatt caaaatcggg aaaaaggttt ctatttttct gtgcataata    198660
     aagctactag tattcccgaa gaagaattga acaaactatt tgagccgttc tatcgccttg    198720
     agaaatcagg taacaaaaaa acaggtggaa atggtttagg gttgtttatt attgcaaaat    198780
     ttttagatat ccaaagaatc cactacaaac ttattaatga aaaagacggt gttacttttc    198840
     aaatatggca ataaaaaaac agcaaaaaaa caggtagagt ccatgtgaac tctacctgtt    198900
     ttttatatgc ttaattatat taagaaacgg aggttagaaa atggatttta tcagaagagc    198960
     ctttattagt attaatgcta agaaagggaa atcgcttgta ttatttacgc tattattagt    199020
     cattttcagt ttagttttta caggttttgc cattcaggaa tctactaaac aaagtgctga    199080
     atcagcaaga aaacaacttg gagcaaacgt tactctacaa atgaatcaag aggaaataat    199140
     gaaaaaggcg caaagcgggg aagaaataaa ggaagaagat ttatcgattc caaccgagga    199200
     tgtaaataaa attaaaaaat tgccacaggt tgacaattat acaattagct cagaaggttc    199260
     cgcatcaaaa ggtgatttaa caccaatccc tgctaaaaaa caagaaggtg gccaaggggg    199320
     catgacccaa gttgctggaa cagatacaaa tgggaaaaag gtagaaaccc caagtttttc    199380
     agtcaaagca gtaaaccaaa cagctacttt aaacagtttc aaagataaaa cagataaaat    199440
     tatttctggg aagccattaa catcagatga caaagaaaat acagcgctta ttgaaaaaca    199500
     attggctaaa aaaaacaatc ttaaagtagg cgacaccttt caactgacga atgataaaaa    199560
     gaaaaaagtg aagtttgttg tcaaaggtat ttatcaaagc aatcaaaaaa tagaacctca    199620
     actagaatca tttcaaatga tgctccctgg aaataaaatc tatgccaata taaaaggagc    199680
     aaaagatttt ctttggagtg gaggcattga aaaagctgaa tttaatttaa aagatccaaa    199740
     agaaataaat tcatttatct ctgaagcaaa aaaattaacg gatgtagata atggagatat    199800
     gttccaattt gatgcacaaa acagtgctta caaaaaaatg attggaccga ttgagcgagt    199860
     ggcatctttt agtaatatta ttgtgatgat tacacttctg gctggtggct taatccttgc    199920
     gcttatcgta ttactatcca ttcgtgagcg taaatttgaa atgggtgtgc ttttatcact    199980
     tggggaaagt aaaacaaaat taatgagtca atttttagta gaagtattaa ttattgcagc    200040
     acttgctttt tctttttctt gtgcattggc taatccaatt ggccaagcta tctctaacca    200100
     aatgctttcg actgaagtca cgaaagaagc aaataaagag aatgaaactt ccacacaaga    200160
     aagcatggca atagctctag gtggggaaga gaaaactaag gttgatgcgg agccgattga    200220
     taaaatagat gtcgtgatta caagcaatat aatggggcaa gttggtgggc ttggttttat    200280
     tttaatattc ctagcgacaa cgataccgtg tttatttatc attcgactac aacccaaaat    200340
     gctatttact cagaaagatt aaggagagac ttaaatggaa actaatttag agttacagga    200400
     tattacttat cagtacgact cgggaaacaa agctcaaatt gttttaagaa acctttctta    200460
     tacattttca gaaggaacat tttatacgat tttaggacca tctggtgcgg ggaaaacaac    200520
     attactttcc attgctgccg gtattgataa accaacctcc gggaaattaa ttattaataa    200580
     aaaagtatta aacgaaacaa tgagtttaca gagttatcgt aaaagtctaa gctcaattat    200640
     ttttcaaacg tataatttaa ttccttatat gacagctgta caaaatgtct atacagcgat    200700
     gggaatacaa catagtcaaa tgaaagataa acgcaaaaga gctattgaat tgctaaagga    200760
     agtagggttg acagataaac aaattaatag tccagtctta aaattaagtg gtggacaaca    200820
     acagcgcgta accattgctc gcgctttatc aggaaatgcg ccatttattt ttgcagatga    200880
     gccaaccgga aatttggatc atgaaacctc ggaacacatt attgatttat ttcgtgattt    200940
     agcacataaa aagaataaat gtgtcgtcat ggtcactcat gataaccatg tagctagtcg    201000
     ttctgatgtt attttgaact taaaaggaaa aacattaata taaatgaaat aaaaaaagcg    201060
     aatgtattgg cctaaaattt taggtaatac aatcgctttt tgtttatttt taaaagaatt    201120
     ttctccgcca gaatacaatc gcaagtgctc cagcaatccc gaatgcaaaa ccgagcgtaa    201180
     gcatccaagc cattggtgta ttcataaacg gtaatttcac gttcattccg taaaaactaa    201240
     acaccatcgt tggaatcgtc aagatgatgg taaaagaagt aagaaatttc atcacgatat    201300
     tcatattgtt cgagataatt gaagcatagg catccatcat cccgctcaaa atattcgagt    201360
     ggacttccgc catttcaata ccttggcgat tttcaataat aacatcttct aataagtctt    201420
     gatcttcttc gtacatttta acaatatttt gacgcatcat tttatctagt acgactttat    201480
     tcgatttaag ggctgttaca aagtaaacta aacttttttc aatccccatt aaatcataaa    201540
     gttgtttatt tttcatagat tcatgtagtt ctttttcgat ttcgtccgtt tgacggttca    201600
     agcgttttaa gtgacgcaag aaagtagtgg aaatcatgta taagatttgc aatgcaaacc    201660
     gcgttttcat atgtgtataa aagcctttaa tacggtttct aataaaggac tgcacgatag    201720
     aagaatcgat tgtgcaaatt gtaataaaat agtcttttgt aataattatc cccattggaa    201780
     tggtttcgaa tgaagcgtaa tgaatatcat cttcatcgac taccggaaag tcacaaacga    201840
     ttaaaacaga atccgagtcg tcatcgcgtt caatccgggc actttcatct ttatctagtg    201900
     gatcttctaa gaactcaagt ggaatttcgt agttatcggc aattttatta atttcttcgg    201960
     aagttggagc aacaatatta atccaacaat tgcgcgtcac ttcttctaat tcaattaatt    202020
     tgccgttttc atctgatttg aaaatttgat gcatgctttt tacctccttt tttaacaggt    202080
     aaatttcacg cggttagagt ttcgttcccg tgaaaaatca cctgtatgaa tacttcgatg    202140
     tggaccaggg tcacttgctg tttgctgctc ctttttcacg ttcctcaact ccttcaaatc    202200
     atagtaattc acaactctac cattatacct agattatagt catttgtaca tcttttattg    202260
     aagcgcagcc ttatagagcg gaattaactc atctagcacc atttcagcct ctttaataaa    202320
     gtctttagca ggggacagat gattatcgtc aggtagataa attttcccaa ctaaaaattc    202380
     cccttttttc acatcgcgga aacgttcaag cgttgcctct agttggccgt catgcacagg    202440
     atacgttttt tcttccgtat gatctgggga aatagcaaag ttgtccggta aatcagccaa    202500
     taatttcttt tctttcaaaa agcgattagc aattttcaaa ctttcttcat tttcataaat    202560
     aaaagcgagc cagatgaata aatacttatc aaacaatcct acttggaaat gaggatgctt    202620
     tttataacca cgtttatcat ggcaaatggc gagccacgtg ctatcaggtg ggttaactga    202680
     acgtctttgg tgacgagcaa tatgtaaaaa catttcatcg ccaagcttgg cacttaaata    202740
     agtagtcaat tcttccccaa cagctctgaa ttttggttga atatcatttt gaattccggt    202800
     catgcgtgct tcaagcccag aaatctgcat tgttttaaaa tctttcttac taaatccttt    202860
     aaaagtcatc tgttttcctc ctaattttgc atatattttc attatacgga agttaagttc    202920
     caagtgaaag aatcttgttc tattcagata attcattttt gtgataaaat aaacaaaaag    202980
     agtgcgaaga ggtgtgcata tggacagcga aaaaatagat tatttagcaa ggttatggat    203040
     tatggaggcc gcagcaaaga ttaagcaatc tttcaaagaa acgttagaca ttgatgtcaa    203100
     atccggtcgc aatgatttag tgacgaatat ggataaagaa accgaagctt tttttgttca    203160
     acaaattaaa gaccattttc ctgaccattg tttatttggt gaagaaggaa tggcgtcaga    203220
     tgtaacagat ttagatggag tggtttggat tcttgaccca attgacggga cattgaattt    203280
     tgttgaacag caacgcgact ttgcgatttc ccttgcagtt tatgaagatg gaatagggcg    203340
     gcttgcttat atttatgacg ttacacgcga tgagctgtat tttggagaaa aaggaaaagg    203400
     tgctacagta aacggcagaa ctatccctaa acttgaccca gcaatagacc taaaagatac    203460
     gctattaatt gctaatttga gcgtgacaag aaaattcccg accatgtggg aagcggtaaa    203520
     agtttctaga ggattgcgat tacacggagc agcttcactg gaatatatgg acgttgctac    203580
     tggacgagcg ggagcctatc tctctgctaa tttagcaccg tgggatattg ctgcgggaaa    203640
     aattatcgta gaagaattag gcgggaaagt gacacggatt aatggtgaaa aaatcaatat    203700
     gttagaaaaa ggaagttcta ttgtagcatc gccaaaaatc catcaaacct tattagataa    203760
     ctacctgcct taaagaaagc gctcaacata aaaaaacttg ttttcagaaa ataaaaatcg    203820
     tgccaaatcg gctcagctat gctataatag gtaagttgat ttaaacgaga cgatagcgac    203880
     ggaggaaaat aaatctattt tcctctttct tttggctaat cttcacgata aatgtttgga    203940
     tttttaattt aggaggaaac aagattgaat ttaagaaatg atattcgtaa tgtagcaatt    204000
     attgcccacg ttgaccatgg taaaacaact ctagtagacc aattattacg ccagtcaggc    204060
     acattccgcg acaatgaaac agttgcagaa cgcgcaatgg acaacaatga tttagaaaga    204120
     gaacgcggta ttacaatttt agcgaaaaat acagcgatta agtatgaaga tacacgtgta    204180
     aacatcatgg atacacctgg acacgccgat ttcggtggag aagtagaacg tatcatgaaa    204240
     atggttgatg gtgttctttt agtagtggac gcgtatgaag gtacgatgcc tcaaacacgt    204300
     tttgtactaa aaaaagcact agaacaaaac ctaactccaa tcgtagtagt aaacaaaatt    204360
     gaccgtgact ttgctcgccc agaagaagtt gttgatgaag tattagaatt attcatcgaa    204420
     ctaggcgcaa acgacgatca attagaattc ccagttgttt atgcttctgc aatcaacgga    204480
     acttcaagct atgattccga tccagcagaa caaaaagaaa caatgaaacc acttttagac    204540
     acaattatcg aacatatccc ggctccagtt gataatagcg acgaaccatt acaattccaa    204600
     gtatcattac ttgattataa tgactatgtt ggtcgtatcg gtattggccg cgtattccgt    204660
     ggaacaatgc acgtgggaca aacagttgct ttaattaaac ttgatggcac agtaaaacaa    204720
     ttccgtgtaa cgaaaatgtt cggtttcttc ggactaaaac gtgacgaaat taaagaagca    204780
     aaagctggtg atttagtagc attagcaggt atggaagaca tcttcgttgg tgaaacagta    204840
     acaccatttg accaccaaga agcacttccg ttattacgta ttgatgagcc aaccttgcaa    204900
     atgactttcg taacaaataa cagtcctttc gctggtcgtg aaggtaaaca cgtaacaagc    204960
     cgtaaaattg aagaacgttt acttgcagag cttcaaacgg acgtatcttt acgcgtagag    205020
     ccaacagctt cccctgacgc ttgggtagtt tctggtcgtg gtgagcttca tttatccatt    205080
     ttgatcgaaa caatgcgtcg cgaaggttat gaattacaag tttctaaacc agaagtaatc    205140
     atccgtgaaa ttgatggcgt gaaatgtgaa ccagtagaag atgttcaaat tgatactcca    205200
     gaagaattca tgggttccgt tattgaatct atcagccaac gtaaaggcga aatgaaaaac    205260
     atgattaacg atggcaacgg acaagttcgt ttacaattca tggttccagc tcgtggctta    205320
     atcggttata caactgattt cctttcaatg actcgtggtt atggtattat caaccacaca    205380
     ttcgatagct accaaccaat ccaaaaagga cgcgttggcg gacgtagtcg tggtgttctt    205440
     gtatccatgg aaacaggtaa atctactact tacggaacaa tgcaagtaga agaccgtggt    205500
     actattttca tcgaacctgg tacggatatt tacgaaggta tgatcgttgg ggaaaacaat    205560
     cgtgaaggcg atatcgctgt aaacattgta aaagcaaaac aaatgactaa cattcgttct    205620
     gctaacaaag accaaacaaa cgtaatcaaa aaacctcgtc acttatcact agaagaatca    205680
     ttagaattcc taaacgaaga tgagtactgt gaagtaactc cagaatccat ccgtttacgt    205740
     aaaaaaattc taaacaaaaa cgaacgtgaa aaagcagcaa aacgttcaaa aactgctgaa    205800
     taattaacga acaaaagacc aaataatttt taagtatatc gcttaaaaat tatttggtct    205860
     ttttatgcat tattttatgt aaaaaaggga ataaaaataa tgaatttgta acactattgt    205920
     aatatgaagc gcaatttggt atattatatg taagtagaaa aggtggttag gaatatgaaa    205980
     aaatggatgg ttattatatc aatcattagt ttagttgcac tattaggtgc ttgtggcaat    206040
     aatgataatg aaaaagatca agaagataaa tcaacaacag attcaacaac taaaaaagca    206100
     aaatcttcat caaacgaatc aaataaagcg gcggaaacaa aagaaaatga taccaatgat    206160
     aaagcagcta ccactgataa gggaagttca aatcctacta aagaagaaaa agatacgtct    206220
     acaacaacag atacaccaaa aaaagaaaca ccaaaaagcc ccgcgaaaac agaagcattt    206280
     tctttttcac cttctggatt caaagtatct acagttgaat ctattcttgg tggagatgta    206340
     acaacgacgt atttatctag ctctaaatca ttccaaaagg attttgaagc tttaacactt    206400
     tttatcaatc aatataaagt agaacatgtc attaatccaa caaaagaagt aagtgcgagt    206460
     aacccagaaa gttatttagc aaacaagaat ggttatgtta ttacacttga tatctccatt    206520
     aaaaataatt cgaaaaaaga taagatgtat aaagcagatc aaattagttt gcttggagca    206580
     agtaaatctg tcggcgggag tttagataac tttatccctt ctggttttca tcttatagga    206640
     agttcatcgg atccatataa ttttacagca ggtaaaactg ctagagggct tttaactttc    206700
     acgatggatg aagcaactta taatgattta gcaaaagatt cgcaaatagg cgtaccagat    206760
     ccaagtagat ttgactctag tagcactaaa ggaagtagtc aagataacgt tgttgcaccg    206820
     tttccaatta aataaaaaag tacgaagaga tttgaaaatc tcttcgtact tttttattct    206880
     gatatggttt ctttattatg ttctaacata ttttttaact cactattcga aatcactact    206940
     ggtttatgaa aattgaaatg gccagaatta acgcgactga tagtgttaat agctactcga    207000
     tgttcacatt caggacatag atacattcta ataggtttat tacgtaattg ttttgtttta    207060
     aattcgcgat tgtctagctc atctacacgt tcgcataaga tacattttgc gttcaatttg    207120
     tcttcacctc acacaagtat tatagcatga ttattgaaaa aggcgagtaa aagtgaattt    207180
     ttcaaaaatt ttaattagat cgtgcttgcg tggcaaataa attatgctat actagtacta    207240
     tctagtatta acttttactt aaggtttttc cttgagatga aaataaagcg ctatttttgg    207300
     cgtatgatag ggggttctgt gatggcaaat aaaaagatag atcacagaga agaggcagtg    207360
     gagcttttaa aacaagacgc aaaacgaatc ttacagttga ttaaagtcca aatggataat    207420
     ctaacattac cgcaatgtcc agcatatgag gaagttcttg atacacaaat gtatggttta    207480
     tcacgtgaaa ttaactttgc aacccgccta ggactaattg aaccagaaga aggcaagaaa    207540
     ctaatgtcta cactggaaaa agaattgtcc actttacatg aactgtccat gagtaaaaaa    207600
     taatgaatca aatgaaaaga tgtctgattt tttctggcat ctttttttgt ttggtagtga    207660
     aaaggctaaa aaatgagcca aaagaaggag gcgattcttc ttttcatttg gaggtctttt    207720
     cctttataat aggaagaata gaaaacaaga tgggatagta acttctcagg gattggacga    207780
     tgccgatgtt taaacgaatt ttaaaatctt atgattatgc atttattgcg gtatttatcg    207840
     tgctatgttt atttgggctt attatgattt atagtgccag ctggtcttta gcaattggca    207900
     aaggcttacc ggcagattat ttttatgctc gtcaagtaaa gaactttata attagtttta    207960
     ttttctttat tctttttgct cttttgccat ttaaatttta tcaaaataat aaggtgttaa    208020
     tgttaattgt atttgggtct atcggtgttt tattactgat tttcttagtt ggtaaaactg    208080
     taaataatgc gaatagttgg ctcgttttag ggccacgctc acttcaacca ggcgaatttg    208140
     ctaaattagc agttattatt tatatgtcgg ctatctatgc gaaaaaacaa agctatatcg    208200
     atgatttcaa ccgcggtgtt ttaccgccca tattcttttt agcatttgta tgtttcttaa    208260
     ttgccatcca accagatact gggacagctt ttattatttt cttagttggt tgttgtatta    208320
     tcatcacttc tggaatgcga cttcgaacga ttatgaaatt aattgggatt ggtatgggta    208380
     ttattattgg actcacgctc atcttattcg cactacctga tagtgtgagg aacgaaattg    208440
     tttctccaac aaaagttgct cgtattacaa cttttatgaa tccttttgaa tatgcggata    208500
     aggaaggaca ccagctaatt aattccttct atgcaatagg ttcaggtggc gtttctgggc    208560
     aagggcttgg cgagagcgtt caaaaacttg gttacttacc agaagcacat accgatttta    208620
     ttattgccgt tgttgcagaa gaattaggtg tgtttggtgt tatgtttatt attttggcac    208680
     tattcttcat tatctttaag actatcacca ccggactcag ggcgaaggac ccatttgcct    208740
     cattaatgtg ctatgggatc gctagtctga ttgcaattca agcatttatt aatcttggcg    208800
     gagctagtgg gctgattccg cttactggtg taacactgcc atttattagt tatggtggct    208860
     cttctttaat ggtgctgtcg atgatgcttg gtatcgtagc gaatatctca atgtttacta    208920
     aataccaacg tgtttataaa gcagatggtt ccacgaaaga gttaccaaag aaacaaaaaa    208980
     gacgttaaat tatgtagaaa aagctaaata attagctttt tcttttttta cgataccgca    209040
     tgtttttggc gttttatagc cagtttattc gtgttttcga tattgtttta aatatttaga    209100
     aagaaaataa tttacatctg atggtattta atactataat tgaagttata taccgtttta    209160
     cagcctaaaa aaaggggatt atcatataag tgtacataat catttcaacc gttggaggct    209220
     acgtataaag tatagaacag atcagtgttg gttaggagga aaaaaatgaa tcgaattaaa    209280
     aaagtattag tagcaaaccg cggagaaatt gctatccgtg ttatgcgtgc gtgtactgaa    209340
     ctcaaaatca aaacagtggc tatttattca caagaagata ctggaagttt tcaccggtat    209400
     aaatcagatg aagcttatct ggttggagca gggaaaaagc ctattgatgc gtatctagat    209460
     atcgaaaaca taatagagat tgctaaagaa tctggtgcag acgcgattca tccgggatat    209520
     ggtttcttgt ccgaaaacat tgaatttgct cgtcgttgtg agcaagaagg cattattttc    209580
     gttggtccta aatcaaaaca cctagatatg tttggtgaca aaattaaagc aaaagaacaa    209640
     gccctattag ctgatattcc agtaattccg ggaagtaatg gacccgtggc tggtattaaa    209700
     gaagtagaag aatttggtga gaaaaacggt tatccattaa tgattaaagc ttcccttgga    209760
     ggcggcggtc gtggtatgcg tgtcgtagaa tcaaaagaac atgtcaaaga aagctttgaa    209820
     cgcgcatctt cagaagcaaa agctgcattc ggaaatgatg aagtatatgt agaaaaatgt    209880
     gtgatgaatc caaaacatat tgaagtacaa attcttggtg acacccatgg caacatcgtt    209940
     catttattcg aacgtgattg ttcaatacaa cgacgtcatc aaaaagtagt agaagtagct    210000
     ccgtgtaatg cgattacttc tgaactacgt aaccgaatct gtgatgctgc agtaaaacta    210060
     atgaaaaatg ttgattatat taatgctgga acggttgaat ttttagttga aggtgacgat    210120
     ttctacttta tcgaagtaaa tcctcgtgtc caagtggagc atacaattac agaaatgatt    210180
     actggtattg atatcgttca atcacaatta ttcattgcag atggttatgc acttcacgac    210240
     caactagtag ctattcctaa gcaagaggat atccatattc acggttctgc tattcaaagc    210300
     cgtattacaa cggaagatcc acttaataac tttatgccag atactggtcg agtagatacg    210360
     tatcgttcca caggtggttt tggtgttcgg ttggatgctg gtaacggctt ccaaggaaca    210420
     gtagtaacac cattttatga ttcattacta gtaaaattat gtacttgggg aatgacattt    210480
     gagcaagcaa cgcgcaaaat gcgtcgtaac ctgatcgaat tccgtatccg cggtgtcaaa    210540
     acgaacattc ctttcttatt gaatgtagtt cgtcatccag attttgcgag tggtaattac    210600
     aatacaagct ttatcgatac aactccggaa ctatttaaat ttccacatat tcgcgaccgt    210660
     ggtacgaaaa cgttgcgtta tattggtaat gtaactgtta atggtttccc aggaattaag    210720
     caccgtgata aacctgttta tgcagaacca cgtttgccaa aaattcctta tggttcgcaa    210780
     atctctccag gaacaaaaca aattttggat gcaaaaggtc cagaaggcgt tgtcgactgg    210840
     gtgaaaaaac aagaagaagt acttttgaca gatactacgc ttcgagatgc acatcaatct    210900
     ctacttgcga cacgtgttcg ttcaaaagat atttttcaag tggcagacgc aatggcacat    210960
     ttattaccaa atatgttctc atttgaaatg tggggagggg cgacttttga cgtggcatat    211020
     cgtttcctaa atgaagatcc atgggtgcgc ctagaaacac ttagaaaaca aattccaaat    211080
     gtgatgttcc aaatgttact tcgcggagct aatgcagttg ggtataaaaa ctaccctgac    211140
     aatgttatcc gtgaattcgt taagcaatca gcacaatccg gtgtcgatgt attccgcgtg    211200
     tttgacagct taaactggat caaaggcatg gaagtgtcca ttgatgctgt tcgtgaagca    211260
     gggaaggtcg tagaggctgc tatctgctat acaggagata tcgatgatga cacaagaacg    211320
     aaatatacga ttgattacta taaagatatg gcgaaagagc tcgttgctca aggtacgcat    211380
     attttaggca ttaaagatat ggctggactt ttaaaaccac aagcagctta ccgtttaatt    211440
     ggtgaattaa aagatacagt agatgttcca atccaccttc atacacatga cacaagcggc    211500
     aacggtattt atacttacgc agcagcagtc agtgcaggag ttgacattgt ggatgttgca    211560
     tcaagcgcga tgagtggggc tacaagccaa ccaagtatga ctggtcttta ctacggatta    211620
     gtgaatggta accgtcaaac gaacttagac gctcaaaatt cccaaatcat taatcattac    211680
     tgggaagatg tccgtcacta ttataaagac tttgacaatg cgcttaattc acctcaaaca    211740
     gaagtataca ttcatgaaat gccaggtggt caatatacta accttcaaca acaagccatt    211800
     gcagttggac taggcgatcg ttgggacgaa gtgaaagaaa tgtatacagt ggttaatcaa    211860
     atgtttggtg atatcgttaa agtaacacct tcttccaaag ttgttggaga cttggcgcta    211920
     ttcatggttc aaaatgaatt atccgaagaa gatgtatatg aaaaaggcga taccattgat    211980
     ttcccagatt ccgttatcga attctttatg ggggaaattg gtcaaccata cggcggcttc    212040
     ccagaaaaac ttcaaaaact agtactcaaa ggacgtacac cacttacaga tcgtccaggc    212100
     gctttaatgg agccagttaa ctttgttgat gtcaaagcag aattaaaaga aaaaatgggt    212160
     tatgaaccaa ctgaaaaaga tgtcatttcc tatattttat atccaaaagt gttcctagat    212220
     tatcaagata tgattaacaa atatggtgat gtaacagtcc ttgatacacc gacattctat    212280
     aaaggaatgc gtttagggga aacaatcgaa gtagaacttg aaaaaggaaa aatcctttta    212340
     atcaagctaa attccattgg tgaaccaatt gcggatggca cacgtgttat ctattttgaa    212400
     ttgaatggac aaccacgtga gattaacatc caagatatga acgttcaatc tactgttatt    212460
     gcacgccgta agattgatac aactaaccct gaacatgttg gagcgacaat gacaggttca    212520
     gtcattcaag ttgttgtgaa aaaaggcgac tctgtgaaaa aaggagatcc actactaatc    212580
     acagaagcaa tgaaaatgga aacaacgatt caagcgcctt tcgatggaga agttagcagc    212640
     atttatgttt ctgacggcga tactatcgaa tctggtgatc tattaattga agtaaacaga    212700
     atttaaaaac ataaatgact aacgggtggg aatatgacgc taatttaaag tgaagaactt    212760
     taaaaatcga taagttaaac gtgttatata gacgtttttc cagatttatt agcgttagat    212820
     ttcccgcctg ttttttctga aaaaggagaa catacatatg aaatggttta aaggaattgc    212880
     cgtagtttta ttgcttgcta ttttaactgc atgcgggaat acggaagtaa aagagacaac    212940
     gaagcaaaca gaagaaatca aagtgaaaga tgcaacgggt gaaacaatta cactgaaaaa    213000
     agctccaact aaaattgttt cattaattcc aagtaatact gaaattttat ttgcactagg    213060
     acttggtgat gaagtaaaag gagtatcggc atatgatgat tatccaaaag aagctcagaa    213120
     aatagagaaa gtgacttcta cttcagttga tacagaaaaa attattgctc ttaagcctga    213180
     tttagttctt ggacacgaat cgatgcttgc aacagaaaaa gacgcttata aaatacttac    213240
     agatgcggga attaacgtgt ttgtagttcc agacgcaaca aacttaaagg aagtagaaaa    213300
     atcgattgct accattggtg atctaacagg aacggaaaaa gaagctacaa aagtgaccga    213360
     ttcaatggag aaacaaaaag tagctattga aaagaaagcg aaagaattaa aaacatcacc    213420
     aaaagtatgg attgaaatta gtccagactt atacacagca ggaaaaggaa catttatgaa    213480
     tgaaatgcta gagcttgctg gaggaactaa tatcgtaaca gaatcaggtt tcattcctta    213540
     caatgaagaa aaagtagtag aactgcaacc ggatatcatt ttatctgtct atcctgatgc    213600
     caaatcaact atccaaaaac gtgcagcatg gaaagatatt ccagcgataa aaaacgataa    213660
     aatctatgaa atggatgcca ataaattaag tcgtccagga ccaagattgc ttgaaggagc    213720
     agcagatatt caggctgttc ttgaaaagaa taactaatat ttagagcata aaaagcagat    213780
     tccgctttac aaaaattcac ttttaaggta acttaacata ggatggtttt tgtctaaaaa    213840
     agatattttt agcagaaatc aaaatataaa ctaactgtaa catgtattga agaattaaca    213900
     aaaacagcaa gaaacactaa catagaaaac taaagacatc attatgtaat agttcctgtg    213960
     taaagtgagg tggctttgtt aaacgttaga ttgaatttta agtatggcag ataagtaaca    214020
     cattattatt tgggaagaag tgtttttgtg aaacaaatta tagaagtatt aaaagaacaa    214080
     tttaaatatg caccaatgat atttagaatt gcccgttatg aagataaggc aacctatcaa    214140
     agtcattacc taggattagc atggcaagta cttaacccgc taattcaaat cgcaatttat    214200
     tactttgtgt ttggttttgc atttaattca tcatctggat ctaatgcaag ttacattgag    214260
     tggatgctag ctggtattat tccttggttc ttcattagtg gagttattct tcaaggtgca    214320
     aatagtatat ataataaaat aaatatggtt tcaaaaatga attttcctat gagtatctta    214380
     ccaagtatta atatagcttc taatttaacg agttatttta caatgatggt acttctagtt    214440
     gggttgtttg cggtaaaagg tacgccaatt acaatatact ggggacaata tttgtattat    214500
     ttcgtcgcga tgattgcttt cttatatagt tttactctat taaatgcaac tataagtgtt    214560
     cttgtacgcg attactacat catgctacag tcattaattc gtgttttatt ctacatgtca    214620
     ggtgttgttt gggatttaca aactaagtta cctgaatggg catttaatat tttgaaatta    214680
     aatccgattt attatctaat taatggcttt agagaaacgt tcttgatgga gaagatgttt    214740
     tgggaaaatc cgtcttacac ggtttatttt tggctattaa caggcgttct attatttgtg    214800
     ggggcctctc tgcatatgaa attccgtgaa cgctttgtag attatttata ggaggtatga    214860
     caatggataa aaatattaaa gtttcattta aacatgtgtc caaagaatat gacctctacc    214920
     aaaataaatc tgataaaata aaaggtttat tcttgccaaa aagtaagaga gtacagtctt    214980
     tttgggcgct tagaaatgtt tgttttgatg tatatgatgg agagacagtt ggattaattg    215040
     gtattaacgg ttcaggaaaa tctactattt ctaatatcat gtcaggtgtt atcccaccaa    215100
     cgcaaggaga agtagtcatt aacggcgaaa catctcttat tgcgattgct gttggtttaa    215160
     aaggcccatt atcaggttta gaaaatattc gtctcaaatt acttatgcat ggcttaaaag    215220
     gttcgcaaat agattcctta ttgccaagta ttatagaatt tgctgacata ggtgatttta    215280
     tcaatcagcc gataaaaaac tattcaagtg gtatgcgttc ccgattgggt tttgcaattt    215340
     cagtgcatac agatccagat attttagttg ttgatgaagc cttatcagtt ggtgaccaaa    215400
     ctttctatca aaagtgtgtg gataaaatta atgaatttaa agcacaagga aaaacgatag    215460
     tgtttgtcag tcactcgcta ggacaagtga aaagtttatg tgataaaata atttggatgc    215520
     atcatggtga agtcagagaa attggtgacg ctgcagaagt tgcagaaaaa tatgatgaat    215580
     ttgttaaatg gtttaataaa caaccaaatg actttaagaa aaaatatcaa aaagaacaaa    215640
     aagaaaagca aaaacttcca caagaaaaga tttatccaac ccctaatgct aataaatata    215700
     aaatgggtct atttgataaa tgttttttag ttgttctgtt agctttatta gttctgtttg    215760
     gatcactgat atctacaggt aaatccttca tgggattatt tagtgctact gacaacaaag    215820
     tggaacaagt aacaaaagta gataaacgta ccgattggaa ataacactaa gctgtttgct    215880
     tcttaataca agatgcagac agcttttttg gttgaaagtt tttagaagtc atcttttaga    215940
     caaatattgt gtgctttttt aagaataata ttaataattc ttcagatgta tgttagaatt    216000
     agtctatctg aaattgtgaa attaatttag gaggggaaaa atgattaaaa aagtttttca    216060
     ttttatactt gtactgatgt taagtgtaag tataatacct ctattccatg ctaaagcagc    216120
     tgaaacaact aatggagtag atagtagtga acaggaagat aataccgaag ttgcgcgtga    216180
     agaaatgcct ccagagtctg aggaaccagt attctcgctt gaacaaaata gagatgatgc    216240
     tatggctgct ttagtcgtgc ctcaaactag aaatagtttt ttgagagcag ctagtactcc    216300
     gacatttcaa caaacattta taaattccat ttccacgcaa gcaatggatt tatgtaaaaa    216360
     gtacaattta tatccatctg taatgattgc tcaagcggct cttgagagta actggggaag    216420
     aagtgaatta gggaaggccc ctaattacaa cttgtttgga ataaaaggat catataatgg    216480
     caaaagtgta acaatgaaaa cttgggaata tagtgattcc aaaggttggt atcaaatcaa    216540
     cgcaaacttt gccaaatacc catcacacaa agaatcttta gaagacaatg cgaaaaaact    216600
     tagaaatggc ccaagttggg actctagtta ttacaaaggt gcatggcgcg agaatgcaaa    216660
     aacatacaaa gatgcgactg catggttaca gggacgttat gcaacggaca acacatatgc    216720
     ttctaagcta aatacgctaa tttcttcata taatttgact caatatgata ctctgtacga    216780
     tacgattaaa caacaaaaaa atgtttctga agatgctaaa gtagttaaag cagatgggca    216840
     tggtgtttat agtggaattt acaatacgtc tgcagccagt gcgaaaaagt tatctactgg    216900
     agcgccttac aacaataaag atgtaaaaat tttaaaagaa ggcactacaa gcagaggaac    216960
     gtgggtccaa ttttctctca ataataaagt aatcggctgg atggataaac gcgcatttgt    217020
     ctattatcca aaagcaacaa atgtaaaaac gcttaaccta acaggtaaaa tcactgctgg    217080
     atctactaat ggtttatggt ctgaggttcc aggtacagtg aatgcgaaaa aattagctac    217140
     aacagctggt gcttaccaaa ataaagatgc taaaattatt aagcaaggtc aaattagtgg    217200
     ccgaacttac tatcaattcc aagtaggcgg taaaacaatt ggttggttgg acgctcgtgc    217260
     atttcatgtt tatgataaaa tccaaagcca gtcaaatgta aattggaatc gaactatttt    217320
     aaatgccgat aagcacggtg tgtactcggg tgtttataat acttcatcaa gtagtatgaa    217380
     taaactaagt acaggcgcga aatataataa taaaaaagta aaagttatta agcaagccaa    217440
     gaccgcgcgt ggaacttggt atcaattcca agtaaatggc aaaacagttg gttggatgga    217500
     ttatcgtgca ttctttgaca caattacctc ccaaaaaaca atgaataaaa cagttactgt    217560
     gggtaatgcc acgaatcatg gcgtttttga tggggtttat cgaacctcgc caacggtaaa    217620
     acgaatttct ttggggaaac catacaataa taaaaaagta aaagtgctca aagaagctgt    217680
     aacagaccat gccacatggg ttcaatttaa atacggtaac acaactgcat ggatggacaa    217740
     aaaagcattt aaatattaaa ttataacact tccataatct aattttatgg aagtgttttt    217800
     tgtaagtact ttgataatca gtttttacgc taccagtgat ggacttcgct cgctaaaaaa    217860
     ggtatactaa ttttcgtagg taaagattat atgtaccttt gaaatcaaat tttcgttaaa    217920
     agtataaaaa aatagaacta ctttaagatt ttatagtgag gaaggattgt atttatgagc    217980
     aacagtaaat ttattattac agaattatac tgggaaagaa ttcaactaca tgtaaagggt    218040
     aaaatagaaa atatttcgtt agagaactat acgttttcat ttaggacttt aacagatgaa    218100
     tttcattttt caccaacggg aatcaaattg gaaggaaaca catttgatct tcgtttcaat    218160
     attgctattt taaatgatgg gaattattta ccaagtgggg attatctctt atccttatat    218220
     aacagtgaaa cagcggatga aattgttgcc caaccggctg ctgaactata taaatttcca    218280
     gaagatgaag atcttttaga agaactaaac gaagctaaaa ccgaaaacga aaaaaacaat    218340
     gtgcttttag caggtttaag aaaagaattt aaacgcggtg gggcgaatct caagtatacg    218400
     tataaagtca ccccaatgat ttctgcagat gtaaatgaat ttgttttctc tgtttcattt    218460
     acaatccctg taccaaaacc aacaaagtgg caagtattca aaaataaaat taaagaaatg    218520
     tatcatactt tcagttttaa ttttagaact ggtttgttta aatctatttt ctatacctca    218580
     caagccctag tacctaaaaa cggaaaacga attctttttt cttcagattc ccgtgcagaa    218640
     attggtggta attttgagtt cgttctaaat aaaatgaaag agatgggtat tgataaagat    218700
     tataaaatca aaatgacctt taaacccaac attcgtttga gaagagcttt tattgagaaa    218760
     tttagatttc catttttgct agggagttca gatattattt ttattgatga ttatcatccg    218820
     atgatttata caattgactt cagcgaaaaa acacaagtaa ttcaattatg gcatgcatgt    218880
     ggggctttta aaacagttgg attcagtcgt tcaggtaagc aaggcgggcc gttctttgat    218940
     gatagagcac atcgtaatta tacacgtgct attgttgctt cagatacaga cataccattt    219000
     tatgcagaag cttttgggat aaaagaatct tctattttac caactggtgt accaagaaca    219060
     gatattttct ttgatccaga gtacaaaaga aatattgtta ctacgatgga gcagttgttc    219120
     ccagaaactc aaggcaaaca agttatttta tttgctccaa ctttccgtgg aaatggtgcg    219180
     aatcaagctc attacccata ttttaaaatt aatctggcta agtttgctga atactgtcga    219240
     aaaaataatt cggtcgtaat ctttaaaatg catccgttta ttaaaaatga atttattatt    219300
     ccagaacaat atgcagatgt tttcattgat gctagttctt atcgtgaagt aaatgatatt    219360
     ctattcatta cggatatatt gattacggat tattcatctg ttattttcga attctctacc    219420
     ttacaacgca aaatgctgtt ctatgcattt gacttggaag attatgtttc tacgcgtgac    219480
     ttttatgaag aatatgaagg ttttgtgcca gggaaaattg tatatgattt cgaagcatta    219540
     attaaggcgc ttgaaatgaa tgattttgaa caagaaaagg taaaaccatt tttagataag    219600
     cactttaaat atcaagatac taattctgca aaacgaattg tggaagaaat ctttaaaaaa    219660
     taaagaaaga ggtaactgtt tataacaaac agttacctct ttctttattt aagttcatcg    219720
     ccgagacgga taattaggtc gcggacatcg tctttaattt cgggatgttt tagcgcaaat    219780
     tttaaagtag tttcaataaa gccgaattta tcaccaacat caaaacgttc tccttcaaaa    219840
     tcataggcga aaacaggttg aatttcattt aaacggttaa ttgcatcagt taattgaatt    219900
     tctccaccag aaccagcttc ttgtgtttct agatacttaa aaatttctgg agttaataaa    219960
     tatcttccta aaatcgctaa gttggaagga gcatcttcta cattaggctt ttcaacaaaa    220020
     ccagttacat tatacaaacg atcacttact tctttgtcag gatcaataat gccgtaacga    220080
     tatgtttctt cgcgaggaac attttgtaca ccgataacag aactatgagt cttttcgtat    220140
     tgatcgatta attgtttagc acaaggggtt ttagattgaa cgatgtcatc cccaagcatt    220200
     actacaaatg gttcgttacc aatgaaacct ttagcttgta aaattgcgtc tccaagtccc    220260
     ttaggttttg actgacgaat aaaatgtaag ttaatattag tggtttcttc cactaaatgt    220320
     aataaatcta atttgttttt ttcacgtaaa ttattttcaa gttcaggtac agagtcgaaa    220380
     tggtcttcta tggctctttt tcctttccct gtaacaatta gaatatcttc aattccagac    220440
     gcaactgctt cttcaacgat aaattgaatc gttggtttgt ctacaattgg aagtatttct    220500
     tttggcatcg cttttgttgc aggaagaaat cttgtaccaa gtcctgctgc cgggatgact    220560
     gcttttttaa ctttcatggt tttcctcctt gaaatcacat tacattcatt ataagcaatt    220620
     tgatttatca aaacaagctt agactatatt tcatcaataa gataacgttt gcatttgata    220680
     caaaagaact attagcggac aaaatattgc ttttttaaat tttttttaat atgattgaag    220740
     atgacttagt tttggaggga gaaagttaat ggaagatgtt agaaaaaaat ggaaaaaggt    220800
     acagtgggat aatgaaatta cgtataaaac attccttaca tatagtgttc tctttgtctt    220860
     agtaacaata agtatttact tacttttttg gttaagaggt tattcattta tttggtctca    220920
     tgatggtttt aaccaacact atccgatttt aaaagaattt agaaatatgt tagtagattt    220980
     cctgaaacac ccaactcaag tgccggaatt atggtcttgg caaattggaa tgggaggcga    221040
     tgtggtcggt agttttggct actatgttct aggtgatatt tttgcttatt tagtagtact    221100
     atttccagca gatcagatgg aacttgcata cacaacatta attctattac gcttgttttg    221160
     tgtaggtatt gccttcttag ctctagcgaa aaactttaaa attaatcata ttgctgcagt    221220
     tacaggttca ttagtctatg tgttctctgg ttatttattt gtttcggcaa caaggcatcc    221280
     attttttatt acgccgatga ttcttttacc gctactttgt ctttgtgtag agagagtgct    221340
     tcaaaagaaa tcaccagttc cgttaattct tgtgatttgt tggacattag ttagtaactt    221400
     ctattttgca tatatgcttg cgattatggt ttgtatctat acagttatta gatactttac    221460
     tcattacaaa aagcaaggaa ttccgctact aagtactatt ggaaaattag cggtctatgc    221520
     aattactggc tttttaatgg catgtatttt atttttacct aatttaatcg cctttttagg    221580
     ttcttccagg gcaaatggag agtttgcgaa tgggctatgg ttctatgatt tgtcctatta    221640
     cttatcgctt ggaaaaatgt acattacaac cgaaagcgct ggttattggg caaacttagg    221700
     tttcgcagca attgctgtgt ttgtacttcc gtttatttgg cagtatcgaa aaaaatatcc    221760
     ggttgtattt attagtttgg ttttaggact tggcatgatg ctatttccgt ttttcggggc    221820
     attatttaat ggtttaagta gtccttccaa tcgttggatg tttgcagttg ctcttcctgt    221880
     aagtattgga gtttcctttt tattaacaga ctataaaaca ttaacgaaaa aagatatgcg    221940
     taattttctt attacactta ttatctttat cgttgtttca tggtggggac cgaacttcaa    222000
     tatttatcaa cctatcttgt tagttccttt aacattaatg cttttaacct tttttgtttt    222060
     ctttttacaa tttattaatt tgaattatat taagaagaaa gcttataatg gcttgtttta    222120
     ctttttgatt ataatgttag tatgtgtcaa tttagcttat atgggtaatt atatgtttag    222180
     taaaaacggg gctaataaag tacaaggtca attaaattct ggggttgttg aacgtaaaat    222240
     aactgaacta tatgggggag cagataaaaa gattgataag agctctttct atcgtaccag    222300
     cctttctagt gggtataatg gattttatga taattcagat gcaaacattt tgttagatgt    222360
     aaatacggtg aattcatttt attcgattac taatggtgca gtagctgact tagcttctga    222420
     attaaataat agtcagtttc gcatgacgtt gccgcttggg caaatggata ataggactat    222480
     ttttacgaat atacttggaa cgacttactt atttgcacgt gatgatcaag ctggcagaat    222540
     accatatggc tttaaaaaaa ttgattctgc tgaaattgaa cgagtagata aaccaggcat    222600
     tagccataca gatgtatatg aatctgaaaa tagtgttcca ttgatgtata tgaactacca    222660
     tacggaagat agagaatcat atgaaaagct ctctccgctt gaaaaagagg aagcactttc    222720
     ttataatgct atcattgata ataaagacac atccaaacgt gagtataaat cgaatattaa    222780
     agaacttgaa tttgaaacga gtatacctaa agttaatggc aaagctcctg caaaattaac    222840
     gaaagacaaa atagaggttt ctaatgctga aaatagcatt caatttaaat tgaaaaaccc    222900
     ggaagaaaca aaaaatgcag aactttactt ttatattgat ggtttagatt tcacgccata    222960
     cactttcaaa caaagaaaag atattgcgtt tgctaaagat gagtataaaa caaaaaatat    223020
     gcgttataat tattaccgga acaaccttac caaacgtata aaagaagact atacattaac    223080
     agccaaaaca tctaaccgtg tagtttcagc gagccaagtg gataaaagtg agctttctgg    223140
     gtattttaaa cgggacaaca tgcttttaaa tggtggtttt tctgaaaaag ctcggaaaca    223200
     agtatctatt aatttgagcg gtcttggtac gtacgactat gataatatca aaatttacgc    223260
     ggttccattt gatgattctt atacgaaaag aatgcaagaa ctaaaaaaac aagctgcaac    223320
     agacttgaaa tttgatacaa acaaagtgtc ggctaaggtt tcagcaaaac aagatggtgt    223380
     gttagttaca acaattccat atacaaaagg ttggaaagta aaagtagatg gaaaagaagt    223440
     atcaacagaa aaagtcaata caggatttat tggtttttcc ttagataaag gactccatac    223500
     aatcgaaatg aattatgaaa cgccaatgct taaagctggc atggtggcga gtggcttagg    223560
     tgtcatcctt tttgctggaa ttatcgtggt gtatcatctt agaaagcgca aaaataaaac    223620
     acaataaatg agggaaaacg ttaggtagct atgttacata gccctaacgt tttttgttag    223680
     ttctgagatt aagcaaaagt gtaaattccg attatagtat gatataattt aactgttaat    223740
     ctattttagg aggatataat gagaaattta aaagatagag tactcaattc attaaaaggt    223800
     aataaaaaag atattaaaat tagtgttgtt gtacctacat ataatacaga attagaaggt    223860
     cttaaaaact taatggcgtc aattgataag caaacaatga atccagatga gtatgagctt    223920
     gtttttgtag atgatggatc tacaacagat acatacgaac gtttgcaaga gtttgctgaa    223980
     acacgtccaa atatgaccgt taaacaaatt gaaaactctg gttggggaag cagaccaaga    224040
     aatattgcaa ctaaaatggc taaaggagaa tatatccttt atttagacca tgatgacaca    224100
     gttttccctg aaacatttga acgcgtatat aatttcggaa aagaaaacaa tttagatgta    224160
     gtgagcggga aagaagtaag aacaaatggt tggtcatggg gatggaagca attctctgag    224220
     aacaatccgc atgcagaaga aatgggtatt gaatgtttac ttccaatgac tccacacaaa    224280
     ttttataaaa gagaattctt gttagagaat gatattacat ttgatgatgg agctcgagtt    224340
     ctttgggaag atgtatattt taactctaag gcgttcattc acggtgcaaa agttggtatt    224400
     ttagccgatt atcctacgta ctattggatt gcaactggtg caaataattc cagtagtttc    224460
     ggacgtgatc cgcatgaaaa atggaaccaa attaataaat tatttaattt ctttaaagac    224520
     aatatcaaag agcaacgtga cttagatttt atgctaactc attggtatcg ctcacgagtt    224580
     cttgggattt tagggcaatg gctactaaaa aacaacaatg aacgtattga tattgaattt    224640
     aactatgcaa aaaaacttgc cgaagaatta ataccagcct atattagcga aaacttagat    224700
     aaaaacaatc aagtaaaaga ttatttatta agacaaggtg atttagattc attaaaaaaa    224760
     cttgctcaaa tcgatgctgg aattacagcg cttagctatg tggaagatgc ttactttaaa    224820
     gaagacaaac tattcttcaa aacaagtaca aaaatgacat atgaagacaa agaagatttc    224880
     tttattgaaa aaacagcaga tcgaatggaa cgtattttac cagaagaaat caaatcgaaa    224940
     ttgccaaaag aattctttga ttatagtgat gatttagctg aatttacgta tgagccaagt    225000
     attaaaggac gtaattcaag agctacctgg aaaatcgacg gttctactag taatgtagaa    225060
     gttgttaata aaaaagcaaa tttgtataaa atagaaggtg aaatgtcttt ttctgttcaa    225120
     attaatgatt atatattaga tgcagctgat aaaaaacaac catgggatat tgccacacgc    225180
     tttaccggcc ttgggtatac aagtcaccga gcattaacca ttggtaaaat tcttatcaaa    225240
     acagcgttaa taaataacaa aacaatgatt gtttataaaa atgcatctgg tttaataagt    225300
     ctggatgttg gaagtagcgt tcgttcaatc gtggaagatt ctggtgtgaa acgtgaacaa    225360
     attcttattg ataaaacatc tggaaaagta actattccat taaatgaaat tcatgtgttt    225420
     ggtgaaagcc ttattgaagg taatgcagaa ttaaaaccgg tgggaattag tgatgcggat    225480
     ccaattaatg taaaagctaa attgattggt gaagctaata aagcaagagt agaagttctt    225540
     ttgggtgatg aaaaactatc tggtgaatat catttagtaa ctaatatcca aggtaaaaaa    225600
     gataaacagc aaattaaaat aacgctttaa gaatggagag aaaagaatga aaggtataat    225660
     tttagcagga ggaagtggaa ctagacttta tccacttaca aaagcaattt cgaaacaaat    225720
     gttaccaatt tatgataagc cgatgattta ttatccgcta tcgatcctaa tgttagcagg    225780
     tattaaagat attttaatta tttcaacccc agaagatact ccacgctttg agcaattatt    225840
     agctgatagc gatcaactgg gtattaatat ttcttatgcg gttcaagaaa aaccggaagg    225900
     attagcacaa gcgtttatta ttgctgaaga ttttattggg gatgattcgg tttcgcttat    225960
     acttggagat aatatttatt acggacaagg tttatccaaa atgcttcaaa gagcatctgc    226020
     taaaaaagct ggagctactg tatttggcta ccacgtgaat gatcctgaaa gatttggagt    226080
     tgtggagttt gatgaatcaa tgaaagctat ttccattgaa gaaaagccta ctgaaccaaa    226140
     aagtaattat gcggtaactg gtctttattt ctacgataat cgcgtagtgg aaattgcgaa    226200
     aagcattaaa ccatctgaac gtggtgagtt agaaatcact gatgttaata agcgttacct    226260
     tgaactggga gaactagatg tagaacttat gggcagagga tttgcttggt tagatacagg    226320
     aacacatgaa tctcttcttg aagcgtctac ctttattgaa acaattgaaa gaagacaaaa    226380
     cttgaaaatc gcttgtcttg aggaaattgc ttatcgaatg gggtatattg atgaggctgc    226440
     agttgaaaaa ttggcagaac cacttaagaa aaatgcgtat gggcaatatt taatgaaatt    226500
     aattaataaa taagaagagt gaggcgtact aatggaaatt gttgaaagta aactagctgg    226560
     tgttaaatta gtaaaaccaa aagtgtttgg agatcatcgt ggttttttca tggaaagcta    226620
     taatgaaaaa gcattccatg aagctggaat cgatatgaag tttattcaag ataaccactc    226680
     tctttctgtg gaagcgggtg tacttcgggg tatgcattat caaacgaacc caaaagcaca    226740
     gacaaaatta attcgtgttg cgacaggcgc aatttatgat gtagttgttg atatgcgtaa    226800
     aggttctcct acatacggtg agtgggaagg ttatatttta agcgaagcaa acaaacatca    226860
     acttctagta ccacaaggat ttgctcatgg cttttgtacg attaccgaaa atgtgaatgt    226920
     gctttataaa gtagatcaat tatattcccc tgaaaacgat gcgggaattg cctacgatga    226980
     tccggattta aatattactt ggccaacaga taaattaatt ttatcggaca aggatacgaa    227040
     acatccacgt ttaaaagacg ctgaaaataa ttttgtatgg gagaataaat aaatgaattt    227100
     attagtaaca ggtggggcag gttttattgg cagtaatttc gtacatcata ttttaaataa    227160
     gcatgatgat tataaagtcg taaacttaga tttgctgact tatgcaggca caatgagcaa    227220
     tttagaggat atcaaagaaa atcctaatca tgttttcgta gaaggaaata tttgtgatta    227280
     tgatctagtg aaaaaactag taacagatca taaaattgat actattgtta acttcgcagc    227340
     agaatctcat gtagaccgta gtattatcaa tccaggtatc tttatcgaaa caaatgtaca    227400
     aggaacgcta aatcttttaa atgttgcgaa agaattaaat gtcgcaaaat atctacaagt    227460
     atctactgat gaagtgtatg gttcacttgg agaaactgga tatttcactg aagaaactcc    227520
     aattgctcca aatagtccat actctgcaag taaagcttca gcagacttat tagttcgttc    227580
     atattttgaa acatacggct taaatgtaaa tattactcgt tgttctaata attatggacc    227640
     acatcatttc ccagaaaaat taatcccgct aatgatcaca aatggtcttg acggggaaaa    227700
     tttacctatt tatggtgatg gtaaaaatat tcgcgattgg ttacatgtgt cagatcactg    227760
     tgcagcaatt gatttagtaa tccataatgg taaatctggt gaagtttata acgttggtgg    227820
     acataatgaa cgtacgaata atgaaatcgt gcatatcatt gttgacgatt tgaatctttc    227880
     taaagataaa attgtatatg tagaagatcg tcttggtcat gatttacgtt atgctattga    227940
     ccctaagaaa atcgaaacag agcttggttg ggaaccaaaa tatacatttg atacaggaat    228000
     taaagaaact atcgaatggt atgtaaataa tgaagcttgg tggagaccac taaaatcacg    228060
     cgcaaagttg ggtgaataaa tatgagtatt ttagtaacag gagcaaatgg gcagctcgga    228120
     acggagctag ttcaattatt aaaagaacat aatttaaccg tgactgagtg ggacaaagat    228180
     tctgtagata ttgtggataa agcagctgta aaaaaagcaa tgcttgattt aaagcctgaa    228240
     tggattatcc attgtgccgc ttttactaat gtagaagcag cagaagatga attaaaaaac    228300
     gttaactggg aagtaaacgt ggatgggact gaaaatatca gtgaagctgc agaaatagtt    228360
     ggagctaaac ttgtatatat cagtacagat tatgttttcg atggtactaa aaaagaagca    228420
     tatttaccag atgataaaac aaatccactt aatcaatatg gaattgctaa attagcagga    228480
     gaaaaagttg ctttagaaaa aaatagccaa acttatgtta ttcgtacttc atgggtgttt    228540
     ggtaaatatg gtaataattt tgtatacagt atgcttaaac tagctgaaac gcataaagaa    228600
     ctaaaagtag taaatgatca attaggtcgc ccaacataca catatgattt agctgacttc    228660
     attcgttttg ttattgagaa gaatccggca tatggtattt accaattctc taatagtgga    228720
     actgcgacat ggtttgagtt tgcaacagaa attttgaaag ataaagatgt tactgtgaat    228780
     ccatgtactt cagatgaatt tccacaaaaa gctgaacgtc caaaaacatc tattatgagt    228840
     ttggaaaaag tagagaaact aggttttaac attccaactt ggcaagatgc tttagttcgt    228900
     tttaaaaaat aataaaaaaa acaattatac gatgcattcg tataattgtt tttttatatc    228960
     tttatggggt ttatttgttt ataatagtaa tgtgtataaa ttactctatg aacaaaagga    229020
     gccggatatt ttgaacgatt caagggactt acattccatt tgttttgttt ctacagaagt    229080
     ggaagataag aacaataacg tacattttat agcagaatct gcagatttat tggcagattg    229140
     cttagtgcta ttagagaaag agaataaaca ctatttaact tttatgaaag aaaatttgaa    229200
     tacaattgcg ttagccgaga aaatcgaata tgcaccagat atcatttgcc caaataaagt    229260
     tttgaaaggt agtttgtata caaatcctga atgcatagat aacagccttg ctggtagtac    229320
     tttctccaaa gatttactta agagagtagc aaatgaaatg aagcaagaag tatttgaatt    229380
     aacaagcttt aattattatt gttatcattt ggcggagaag attggtcatt tgggagaaga    229440
     agctagctat tcgctctctt tggcggactt agatgactcg gttacacgtt tacttgatat    229500
     taaagataat cattaccgaa aagattggac aattttatat tatgtaaata agtttttaat    229560
     gatgcattta gaaaatttac cgaaaatttt tgaagaatca gatgaaaaat ttcaaattaa    229620
     ttatttagaa aaacttactg aacttattgc gaaactgccg gatgaggtta tttttgagtt    229680
     agatgcgctc gattatttgg ttcaaaatat attaaatgat tcatttgaat ggattaaata    229740
     cgaagcatat ccagcttgtt taactttagc tgaaataata agtcaccgag cagcaccaaa    229800
     taaattcacg gatactaaat ggctgtgttt agaaaaatgt gtccgaaaag gttctgtaaa    229860
     tccgctaaga aacaaaaaaa atccaactgt tttgacacca ataaaaaaga aatttgtttc    229920
     tttttttagc cgtaaagtgg tgtttacaat tgcaaaactg ttacctgttg cgaaagataa    229980
     tgttttgtta gtttcgaata aaattagtga tttagatgct actttcatgc cgatttacca    230040
     gacaattaag caaaagcatc ctgaaaagtc tgtgcgtgcg tacatgaaaa tgcgaccaga    230100
     agataatcat gcaatgtatt atttaacata tttttggaat cttggaagag caaagtatgt    230160
     gtttttagat gactattatt atcaattgta ttctattaga atgaggaaag aagcggaagt    230220
     tattcagctt tggcatgcag caggagcgtt taaacgattc ggtcatagtt ctctaggatt    230280
     taaagactcc atatcgcttg attttgaaac aagagcgcac caaaattaca caacgagtgt    230340
     catatcatcc agtgatttaa aaccgattta tgcagaagcc ttccatatgg atgaaaccaa    230400
     aattgaagca tttggtctac cacgtttatg gaagttattt gatcaagact acaaggaatt    230460
     cagactagat tatttccaaa aaatgtaccc gcttcttaaa gggaaaaaag tgattactta    230520
     tgcaccaact tttcgaggga attcagaaga gcgaaaagca ttccaactcg aattaaattt    230580
     acgtaaaatg aaagaggaac taggacaaga atatgtagta gtaattaaac tgcatccatt    230640
     agtaagcgtt gaaacgcaag ttccagaaga tttagctgat tttgtacttg attttagtgg    230700
     aattgaaatg aatgacgttc taatcgtaac agatattcta ataactgatt attcgtctgt    230760
     tatttatgat tactctatct tgaatagacc cattattttc tacgcatatg atcttgaagc    230820
     ctattcatta gaacgtaatt tttatcatga ttatttggaa tttgttccag gtccagtggt    230880
     tgctacaact gaagaagcaa ttaaacttat tcaaacaaat caaatgataa cagggaagtt    230940
     acaggacttt gcagagaaag catttgaata tcatgatggt gatgccgcag ctcgaattat    231000
     tgattatgta atgcaagatt gatgtctgta caaaagatat tgagtttatg gtacaataaa    231060
     gctatgttta ttagtaaaat gttaaaggag actaaaaatg atttatgcag agatattagc    231120
     tggcggtaaa ggtacgcgca tgggaaatgt caatatgccg aagcagtact tgccattaaa    231180
     aggaaaacca attattgttc atacaattga gaaattcatt ttaaatgacc gttttgaaaa    231240
     aattattatt gcaacaccta aagattggat taatcacaca caagatatta ttaaaaaata    231300
     tatatttgat tcgcgtgtaa ttgttattga aggcggaaca gatcgaaatg aaacaattat    231360
     gaacggtatc cgttatgtag aaaaagaatt cggcttaaat gaagatgata ttattgtaac    231420
     gcatgatgcc gttagaccat ttatcacaca tcgtattatt gaagaaaata ttgatatggc    231480
     attagaattt ggctctgtag ataccgttat ccctgcagtt gatactattg tagaatctac    231540
     taaccatgac tttatcacag atattccagt tcgtggcaat atctatcaag gtcaaacgcc    231600
     acaaagcttt aacatgaaaa cgattcaaaa acattataat aatttaacag atgatgaaaa    231660
     acaaatctta acagatgctt gtaaaatttg tttgcttgcc ggtgaaaaag ttaaacttgt    231720
     aaacggtgga atttcaaaca taaaaattac cactccatat gatttaaaag tggcaaatgc    231780
     gattgtacag gagaggatta actcatgatt aaccaagtat atcgcctagt ttctgagaga    231840
     caatttgaag aagcgaatat tgaagaagca cttactgaag atgttgttgt agtaagacct    231900
     acatatcttt ctatctgtgc tgcagatcag cgttattata caggttctcg cggaaaagaa    231960
     atgctttcca aaaaattacc aatggcgcta atccatgaag gtgttggcca agttacgtat    232020
     gacgcaactg gcgagtttga aatcggaaca aaagtagtga tgattccaaa tacaccgaca    232080
     gaagatgatc cagttattgc cgaaaactat cgtcgctctt cgctatttcg ttctagtggc    232140
     tatgacggct taatgcaaga gaatgttttc atgagaagag atcgcgttgt tcgtttacca    232200
     gaaaatatgg acatggaagt tgcggcttat tctgagttaa tttctgtagc gtttcatgca    232260
     attacaagat ttaaacaaaa agcaaatgct aatcaatctg tatttggtgt atggggcgat    232320
     ggtaatttag gctttatcac ttgtctattg ctaaaaacta tctaccctga aagtaaagtg    232380
     attatttttg gtaaaacaca atataaactt gatttctttt cttttgtaga tgaagctcat    232440
     ttagttgatg aaattccaga aggtctagtg attgataatg cgtttgaatg cgctggtggc    232500
     aaaggaagtc agtacgcagt tgaacaaatt attgatttaa ttaaaccaga aggaacgatt    232560
     tctttattgg gcgtttctga gaaccccatt gaatttaatt cacgtatggt attagaaaaa    232620
     ggattgacgg tattcggtag tagccgtagt gggaaagaag atttccaaaa caccgtaaat    232680
     tttcttagtg aaaatgaacg tgctgtagaa tacttatcta gtctaatagg ccaacgtaaa    232740
     gtagttcgta atttacaaga tattattgaa gcttttgaga cggacttacg taatccattt    232800
     ggcaaaactg tcatggaatg gaaagtataa tataaagtat gaaagaaatc tcaggtcaaa    232860
     tattatgtcg aaaagcataa tgggtctgag attttctttt taataaagaa agtagagatg    232920
     atagtgaaaa atatagcgat ttctatgtac atgtttctgt taagtctatt ttcttttttt    232980
     agtcgatttt ttggcgtgaa aaaacgagta ttgattatgg cctcattccc agaaaataca    233040
     acagcgattt tgaatcaaat gaaaaaaatg ggctatactc cgaacacaat ttgttttcat    233100
     acagagagag ttcaattcaa tactaaagaa cttgattttg ttcgtttttc acctaataat    233160
     ttggcgaata aatggaaatt aatgttttac ttaaatacat caaaagtgat tttagtcgat    233220
     aactattacc ctgaactagc agcggtttct tttaaagatg gtgtcgaatg tattcaatta    233280
     tggcatgcaa atggagcttt aaaacaattt ggatgggaag ataattcgat ttcagaacgt    233340
     tcagatgcgg acaaaaaaag atttaaagca gtatatgaac attttctaaa agtagtagtt    233400
     ggttcagacg agatgggcga aatttttaaa agaagcttct tattaaatga atctcattta    233460
     ttaaaaatcg gtgtacctcg aacggatgtt tattttgaag aaagcctaca acagcaaaaa    233520
     agaatagaat ggcgtaataa atttcacgct gaaaataaaa aagtgatttt atatgcacca    233580
     acatttagag ataatgagct tgcggaagcc aagttagtaa tggattttaa cgcaatggaa    233640
     cgagcttttt cagaggatta cttactggtt ttaaaattgc accctgcagt taaaatagat    233700
     gtacaaagtc taaatacaga ttttattatt aatgtagata aaaatgttgc acttgaagaa    233760
     cttttagcgg ctgttgatat acttattact gattattcct ccattccatt tgaatttgct    233820
     ctttttgaaa gaccgatata cttttttagt tatgacatgg agaaatatga taaagagcgc    233880
     ggcttaataa aaaattatca agaaattatc ccaggaccga tctcccaaac aacggcagag    233940
     cttattgagc aaataaaaac gaaggccaca agcgagactt tagcactttt ttcgaaaaaa    234000
     tggaataaat attcggatgg tcatgcaagt gaacgcatgg ttgtttatat gaaacaatta    234060
     atggaggagg ctaagtaaat gaaaaaggtt attacatatg gaacatttga cttgcttcat    234120
     tgggggcata ttcacttatt aaagcgcgct aaggctcttg gtgattattt aatagtagca    234180
     atttcttccg atgaatttaa tcgaattaaa cataaagaag cttatcatag ttacgaacac    234240
     cgtaaattaa ttattgaagc aatacgttat gtggatgagg tgatcccaga gaataactgg    234300
     gaacaaaaaa gagatgatat agagaaatac ggaattgatg tttttgtaat gggtgatgac    234360
     tgggaaggcg aatttgattt tctaaaagat gtgtgtgaag ttgtttatct tcctcgaaca    234420
     gaagggattt ctacgtctca aataaaagat gaactaaaat aaaaatgtga gaggagcatt    234480
     cttttggaac ctttagtaag tgtaattatt ccagtttata atgtagaaaa gtatgttaaa    234540
     cgatgcttgg attcagttct tgagcaaaca tatcataacc tcgaagttat cgtagttaat    234600
     gatggagcga ctgataattc agctaaagtc ataaaaagta tctcagataa tcgaattcgt    234660
     tattttgaaa aagaaaatgg cggacaagct actgcccgaa attttggatt agatgtggct    234720
     acgggagatt acatcgtgat ggtagatagt gatgattaca ttagcaaaaa cctagtagaa    234780
     acttgtttgg atactgtaca aaaaacgaat gctgatttag tcttgtttac ttcatataat    234840
     gtgaatcagg aaggaaaaat gcagtatata aagcgtgata aaggcatcaa agttttagat    234900
     gcaggtccaa ctccatggaa caaattttat caagcagatc tatggaaggg ttcgcgtttt    234960
     ccagtaggtt attggtatga agatctagga attattccag tcgtcacgct aaaagcaaaa    235020
     aatccagtga aaatccagga cgcactttat tactacataa ctgatagagc ggattcacaa    235080
     tcgaatattc aacaagtaga tcacttttta gatgtggtta ttatgttgga aaatgttgaa    235140
     acagaattaa aaaaactagg tatttacgaa gaatcaaaag atcaacttgc gtacctatat    235200
     atagaacatc taatttatcg tttagtttta cgaaaagcga tttacattac gaataagcaa    235260
     gaacgaaaaa aacttattaa gaaaattagt acaattattc aagagaagtt ccctaattgg    235320
     ggtagttatc cttatcaagc gggtggcaaa ctaactgcaa cattaaagaa aaaagcatta    235380
     tggctttatt tacatcattt gtacttgttg ggtgatttag tatggaaata tccattttct    235440
     atcagaagta agcaaacagg gttttaaagg aggttatcat tttgcataaa ttaagtgtgg    235500
     tcattgccgt atacaatgtt tctgagtata tagaagcatg cttaacatca gtcttagaac    235560
     aaaactacaa gaatgtggaa ttaattattg tcaatgatgg ttcaactgat gatacctttc    235620
     aaaaagtaga aaaactagta gacggacata cgaatgttat tttgattgat caagaaaacc    235680
     aaggtgtttc tgctgtccga aataatggtg taaaagccgc tacaggtgat tatctaggct    235740
     ttgtcgatgg agacgatatc attgctaaag atatgtttca aaaaatgatg gattcttttg    235800
     aaatgtcgga tgcagatatg gtaacaattg gtgtggcaag actttcagga gataaagtat    235860
     acccttctac attacacgaa agatatatgg tagaaaaaaa agaagccaca acaattgaag    235920
     aaacaccggc acttttatat gatactactt cgtggaataa agtatttaaa aaatcttttt    235980
     gggataaaca ccatttggaa tttccagagg gccaaatgta tgaagatatc gcattaatga    236040
     ttccagcctt tttgtatgca gaaaaggtaa atattattcc tgatgttggc tattattggc    236100
     gcagtcgcga gggtggagca aaatcaatca ctcaaagacg aaatgacatt gccatggtga    236160
     atgatcgttt acttgctttg aaaaaagtaa atcaagtact taatgagaaa aatattcagg    236220
     gtgatttaag atatcaaaat gaacgtaaaa actttgaaat tgatttgttt tccatgattg    236280
     aatgggcatt tttagcgccg aaggattact atttggctct tcaaccactt atcaaaaatt    236340
     atgttgagca agaaatgaaa acaactgctt tgaatgatat tccaaaagaa aagaaacgac    236400
     ttttcaaagc tttgttagca aataatcgtc cggcttttct cctaaatagt tacatttatt    236460
     ttggtaagaa agctgtgaaa aaaataacga aataagagac aaaggacaaa atacttcgga    236520
     tctttagtac acttgtaaac aattgattca agtgtgccat tgcatcatta gaagtactat    236580
     gtcttaggct ctttttttgt tagtaacagt taatttaata gtgaatctac cttttatatg    236640
     ctatgataat tggtatataa taagtcaaat taatgcttat aaaaaatgat aggagcagaa    236700
     gaaatgacaa atttatttca agatgatagt ctaacgctgc atacagactt atatcaacta    236760
     aatatgatga aagcgtattt tgacgatgga cttcatgagc gtagatcggt gtttgaagtg    236820
     tttttccgag atatgccatt tgattcgggt tttgttgtgt ttgcggggct agaacgaatt    236880
     attcattata tgcaaaattt acgttttaca gaaacggata ttgcttattt acacgacgaa    236940
     cttggttttg atggaccttt tctagaatat ttacgtaact ttaaatttaa aggaaatatt    237000
     cttgctgcga aagaagggga gtttgttttt aaaacagagc caatccttca agtagaagca    237060
     agtctagcgg aagcacaatt aatcgaaaca gctttgctta atattgtgaa tttccaaacg    237120
     ctgattgcaa caaaagcggc gcgaatccgt tctgttattg acgacgaaac gtttgcagaa    237180
     tttggtacaa gacgtgcaca agaaatggat gcggctattt ggggcacacg agcggcttat    237240
     attggtggtt gtgattcgac gagtaatgtt cgcgctggaa agattttcgg tattcctgtg    237300
     tctggtacga tggcacatgc gatggttcaa gcttaccgcg acgaactaga agcatttaga    237360
     agttacgcaa aaacgcattt tgattcaatt ttcttagtag atacatacga tacgctaaaa    237420
     tctggcgtac caaatgcgat taaagtggcg aaagaaatgg gcgataaaat taactttatc    237480
     ggcatccgcc tagatagtgg cgatatggct ttcttatcta aaaaagcacg ccaaatgtta    237540
     gacgaagctg gctttacaga agcaaaaatc tttgcttcga gtgacttaga cgaacatact    237600
     attttatcgt taaaagcgca aaaagcaaaa atcgattctt ggggcgttgg cacaaaacta    237660
     atcaccgctt acgaccaacc agcattaggt gccgtttaca aaatggcggc gattgctgat    237720
     gaaaatgata ttttacagga ttcgattaaa ctttcaagta acaccgaaaa agtgtcgaca    237780
     cctggtaaaa agaaagttta ccggattatt acgaatgaag atggcttgaa agcggaaggc    237840
     gattatattg ctttggcgga tgaatcactt gagaatgtcg acaaactaac gatgttccac    237900
     ccagttcata cgtatattat gaagacagtc gagaatttca ccgcgcgtga gctacttgta    237960
     ccgattttcc aaaatgggga acttgtgtat gatatgcctt cactcgatga aattaaagca    238020
     tataaagaag agaacttggc gctactttgg gacgagtaca aacgaacagt tcgtccggag    238080
     caatacccag ttgatttaag tgtaaaatgt tggaaaaata agatgcgtaa tatcgaaaaa    238140
     gtacgtaaaa gtgtccaact tcattcacca gttgaactag atatgccgtt ttaggaggaa    238200
     ttataatgga aatcagagaa agaattttag cagatatgca agtggcagaa acgattgatg    238260
     cacacgaaga aatccgaaaa agtgtcgagt ttttaaaagc atatttaaaa aagaatacgt    238320
     tcttaaaaag ctttgttctt gggatttctg ggggacaaga ttcgacttta acaggaaaac    238380
     tagcacagat ggcgataagc gaaatgcgag cagaaacggg cgacgatgag taccgattct    238440
     tcgctgtgag cttgccatac ggaacgcaac tagatgaatc ggaccgtcaa gatgcactga    238500
     actttatgga accagataat cgtttaaccg taaatattaa agcctcagtg gatgcgagtg    238560
     ttgcggcgct tgcggaagcg ggagtggaac tatctgattt cgctaaaggt aatgaaaaag    238620
     cgcgcgaacg gatgaaagtg caatacgcaa ttgcagcgat gcataaaggc gtagtggttg    238680
     gaactgatca ctccgcggaa gcagttactg gcttttatac gaaatacggc gatggtggaa    238740
     cagatattaa tccactgttc cgcttgaata aaagacaagg caaggcgctt cttaaagagc    238800
     taggctgccc agaacatcta tatttgaaaa aaccgacagc agatttagaa gataataaac    238860
     cggcacttcc tgatgaggtc gcgcttggtg tgacttatga ccaaattgac gattacttgg    238920
     aaggcaaaga agtcccagca gatgctgcgg caaaaattga gaattggttt attaaaaccg    238980
     aacataaacg ccatatggca attaccatat ttgatgattt ctggaaatag gaggttgttt    239040
     aaatgaaagt tggttacggg ttattaactg cattttatac acatccagga gagcgagatc    239100
     atttagtgaa gattttgctt gaagcagcag aaagtttgga agagtataat acgtgcatcc    239160
     agtatatcgt cagcgaatcc gaaaacgaag cagatacggt ctttgtttct gaaatttggg    239220
     tcgacaaagg gcaccacgaa gcttctcttg ataaccctgc tgtaaaagcg acgattgaac    239280
     gtgccaaacc attaataaaa gaagtaaaac gaatacaaga attagacata ctcggcggaa    239340
     aaggcgtata agcttaacaa caagaatgat tctgggactt tcctggaatc atttttttgg    239400
     agggatgaca aatgcaaacg ttgatgattg tttgtgctgg tggtgcgact tccagcttaa    239460
     tggcacaaaa cgtagtgaaa agtgctacgt cagaaggaat ggacgcggtt ttactatttc    239520
     ctgatgatgt gaaatataaa gatagttttc gcgaaaaata tagcacgcgg gatttagttg    239580
     tcgtcatggg accggtcggc gcgattacgg ccggtaagtt tcgcgattac aaagaacaag    239640
     tcgatgcagt tttagtagca ccgcaagtaa aatatatgta taaaacagta gaagaagtgc    239700
     taggcgaact gaatattcct tgcgccaata ttaattcact cgatttcggt cggatgcgcg    239760
     gcgacaagat tcttacgcaa ggtctagcct tgatgaacgc gaaaaattcc aaataaggtg    239820
     ttgcaacttt agaggggaaa cgttaaaatg aaagaagatg aaaaggacaa gtgatttgtc    239880
     cttttcttat attattgtga agtaaccgcg attttgcggt ttcattttat agataagggt    239940
     ggttttgttt aaaattatga aagactttac cgagcaagag aaaattatcg ttctagattt    240000
     tggtagtcag tacaatcaac taattacgcg ccgcattcgt gaattcggtg tgtacagtga    240060
     attacatccg catactatta cagttgaaga aatgaaagca ctaaatccaa cggggattat    240120
     tttttcagga ggacctaaca gtgtgtatga cgaagatgcc ttccgcgctg acgaaagaat    240180
     ctttgacatg ggaattccga ttttgggaat ttgttacggc atgcaattaa tgacaacgca    240240
     cttcggtggc aaagtagaac gtgcgaaaga ccgcgaatac gggaaagcgg acattcacgt    240300
     tgagaagcca aaccgtttat ttgctggact accaaccgat caagttgttt ggatgagtca    240360
     cggcgattta gtcgttgagg agcctgctgg ttttgaagta acagttacta gtaaatcttg    240420
     cccaattgca ggtattgcgg acgaagaacg ttcactttac ggcgtgcaat tccacccaga    240480
     agtacgtcac tccgtttatg gcaacgaatt actgaagaat tttgcattaa atgtttgtgg    240540
     ctgtaaaggc gactggacaa tggaaaactt tagtgaagta gaaatcgcaa aaatccaaga    240600
     aatcgtaggc gacaaaaaag tcttgcttgc cctttctggc ggtgtagatt cctctgttgt    240660
     tggcgtgtta attcataaag caataggcga ccaactaaca tgtattttcg ttgaccacgg    240720
     ccttcttcgt aaaggggaag ctgaccaagt aatggagaca ttacaaggcg aattcaacat    240780
     gaacatcatc aaagtagatg cgaaaaaacg cttcatggac aaacttgctg gcgtttctga    240840
     cccagaacaa aaacgtaaaa tcatcggcaa cgaattcatt tacgtatttg acgatgaagc    240900
     caacaaatta gatggcgtag aattccttgc acaaggaaca ctctacacag acatcatcga    240960
     aagtggtaca gcaactgccc aaacaatcaa gtctcaccac aacgtaggcg gcttaccaga    241020
     agatatgcaa tttaaactaa tcgaaccatt aaatacactt ttcaaagatg aagttcgcgc    241080
     actaggaacc gaacttggca tgcctgacgc aatcgtttgg cgccaaccat tcccaggccc    241140
     aggcttagga atccgtgtgc ttggcgaaat tacggaagag aaattagaga ttgttcgtga    241200
     ttctgattac atcttgcgtg aagaaatcaa aaacgcaggt ctagaacgcg aaatctggca    241260
     atactttact gctcttccaa atatccgtag cgttggtgtt atgggtgatg gtagaacgta    241320
     tgaccatact gtggttgttc gtgcagtgac gagtattgat ggtatgacag ccgattgggc    241380
     acgtattccg tgggatgtac tggagaaaat ttcggtacgg attgtgaatg aagtggatca    241440
     tgtgaatcgt gttgtttatg atattacgag taagccacca gctacggttg agtgggaata    241500
     gtaaacggag agctagaaag cctttattga taagggtttt cagctctttt tttattttca    241560
     ttgcactttt attgcactat ttggttgctt gttttgtcga tagttcactg tgaactgatt    241620
     ttttggtgac gaatcaagat tttgctcagc gggttgaaag gaaataattc catttaattt    241680
     actggcaact tcaaaattac tatttggata caagtgtcca taagtgccta gtgtagtttc    241740
     gatatcttca tgtcctaggc gctctttaat aattagagga ttttcaccca tactaatcaa    241800
     taaagaagca tgagagtgac gtaaggcatg tatcttaata cggtgaatgc cagccatttt    241860
     ggaaaatcgg tcaattgcat gagcaatcgt atgtttttga gttggaatac cattgtagct    241920
     cattacaaaa tttgtcttta ctacattttg ttgaacttct ctccaatcag caagataact    241980
     caaagtaact ttatcaagaa caatgtgacg aacacttgct tttgtctttg gctctacaaa    242040
     tttatagtca atctgacttt tataatataa ggtttttgta atagatacta ctccagtttc    242100
     aaaatcaata tcttcccatt gaatagctgt agcttcaccg attctcatgc ctgtcataaa    242160
     caagaaccat aatgagataa aaagaaaatt ttgatagtaa tcctccttat atattaagga    242220
     aagtactttc tcaaattctt cttttgtcca gaactccacc ttaggtttca ctttctttac    242280
     gttcccaata atctttgatg ggtttgtagt agtaatacct aaaacgattg ctctatccat    242340
     tgcaacagag aatagacctt gtacagctct cacataagat ggcttgagat tctttgtcat    242400
     tttaagttgc caatcttgga cattgattgg ctcaatatca gataccgcca ttttataaaa    242460
     atatggaaag tgcttctgaa tagtagggat tcgattctca tatgttctta gcttaacttg    242520
     tgttttatac caaggaagga aaatttcatt gatataatac tcaaacatca ttttatcttt    242580
     attctcgttt aaatcatctg ggttcattag caataggcga gaatattctt ctctggcttc    242640
     cttttttgtt ttgaagccac tacggtactt ttgaatcttt ttgcctttta cgtcatagcc    242700
     taaattggca cggaaatagt acgttccatt ttttgctttt ttaatttggt cattagtcat    242760
     agtttttact ccttcttgtg caaaaactaa tcagacctgt tttcatttga aaacttgata    242820
     cctagaagtt cttcaacagc ttcacgaggt actctatcca attttcttga ttgataatag    242880
     gtgtgtcctc ttgatatcat cagctctttt gctttcttga taatatcagc tgaaaatgaa    242940
     tttccatatc ctagcttaat taagtcttgt ttagtgactg ttaccattaa aactcctttc    243000
     cattataggc taggaaaact ccaatattca cctataatta taacaaataa aagcacattt    243060
     ttaaatccgc ttacatatat attttttgct ttttataaca tacaagaaca gttgtaggac    243120
     aacttcactg gaattccacc accctcattc ctatgagaga cgcttattta taagtagtgc    243180
     gtgtgtatca ttatctcaat atataattca tcgctcccta gattcctaca tcaaggtttg    243240
     cagtccaaaa atgtatcgct ctttcttttt ataaaagaag tcatggcgta ttggctacac    243300
     agctagttat atactgaatg tattcaagca tgtaatattt aattgtcaaa gaacaatcgg    243360
     cattgatttg cctatcaaag atcacaaaga cttgtgggct ttgatagaca aactaattaa    243420
     gattctccat gtaccaaaat taattgacac atggaaaaat tgagactaag ataattcaaa    243480
     cttcaaaaca gcagtgatta actttgtttc taacattcgc tttatttctt cctctacatg    243540
     aatataggca ttgccatatt catcaaatag tgttttttga gaaagacgaa tgatataatg    243600
     ctcgaagtgt ttcaatattt gattgattgc atttacatca ccatttacag cttgaagaat    243660
     tactacaaat ggtaatacct ctttagttga tttcatttca atgttcctcc atgagttttt    243720
     ttaactcttt taatgcattt gttttgtgat aatgtacggt gctttccgct aaatccatta    243780
     aggtagcaat atctgcattt gtcatactaa ggaagaatga aagaagaatt atatcctgtt    243840
     ttctttttgt tagtttaccg attgcttgag ctatcaatac atcttcaatt cgtatgtcat    243900
     agtcataaga agccattatg atatagtttg aatcgtaatc atcaaaaata cttagttgac    243960
     ttagttcagc cattgataat gcttcaagag atatcagacg ttcattgcgt cgtttgttct    244020
     catcgtagat atctctagcg aaattacgta caactgtttt acagaaacta tcaaattgat    244080
     gttcaatagt tttttcatag ttagaagttg ttgtcataag agttcacccc ctttccattt    244140
     gcaagtaatt aattaacctt gcttactcct atcacggtgg agagggggtg aatcttcgat    244200
     aaaaacaaaa aaatacacac ttttacctca tggcaaaaat gcgtattctt tctatatcca    244260
     tatttaattg ttagttttct ttttttatcc cctaaccaaa acataacagc acctctgtaa    244320
     aagctaccgc tgttttggaa aaattaacaa attaagaaaa acagattaca atagaaactt    244380
     catgaaaagc tacttacaaa gcggtagttt tttttattac cttgtaagtt tcattagtca    244440
     ttgtaatctg taaataattt ttagtatgtt attatttttt cactttcatt aatcttaatc    244500
     catttaatgt aactagtaat gtggcaccca tatcagctac aatcgcaatc cataatgtta    244560
     accagcctgg aagcactaat agtaatgcta gtaatttaat tccaagggag aaagttatat    244620
     tttgcttgat tatttttaat gtttttcgac taagatttac aatgaatggt aatttcttta    244680
     agtcatctcc cattaaggca acatcagctg tttctaaagc agtatcagtc ccagctcctc    244740
     ccattgctat tcctacagtt gaagcagcta aggcaggggc atcatttact ccatctccaa    244800
     tcatagcgac tttgccgtat gtttgtttca attctttgat gtaagtaagt ttatcttctg    244860
     gcattaattc tgcttttata tcagaaacgc cgatttcctt acctataaac tgtgctgtgt    244920
     cattattatc tcctgttaac ataatagtgt gagcaatccc taatttatga agttgtgcaa    244980
     taacttcttt actagattcc ctaacttcat cagccacagc tatgattgct aaaatatttg    245040
     attctgttcc aaacagcata gctgtttttc cttgtttttg taatgattgg taagtttgag    245100
     atatactttg agatttttct aaactagatt caaaaagttt tgagctacca atgtaatagg    245160
     ttataccgtt tacctcacct ttaacacctt taccagtgat tgatgaaaaa ttatcaattt    245220
     ctattgattt gtaatcgaca ttatcaatca tagcttttga aatgattgct gaggcaagag    245280
     ggtgttgtga catggtttcc aaagcagtaa taatagaaag tgaattctgt tcgtccatat    245340
     gttcagaata aggaataaaa tcagttacaa ctggttttcc tttcgtcaat gtacctgtct    245400
     tatcaaaagc aattgcttgt agtccaccaa tttcttctaa gtaaattcca ccttttacaa    245460
     gaacaccgtt ttttgctgaa ttaccaattg cagaaacgat agatactgga gtggaaatta    245520
     ctaatgaaca aggacaacct acaactagaa gagataaccc ttgatatacc catgtgtccc    245580
     aatcaccacc aaagaatagt ggtggaacga ctacaacaag caaagcaata agcataatag    245640
     taggtgtata atacttcgca aacttatcta caaacgcttg tgctggtgct cgttcacctt    245700
     gtgcttcttc aactaaatgt ataatctttg aaattgtagt atcttctaca tgtttcgtaa    245760
     cctttacttc taatagtcct tcttcgttta atgtcccagc aaaaacttca tcatcaactt    245820
     tcttttcaac tggaatagat tctccagtga ttgcggactg attaattgct gaataacctt    245880
     ttataacaac tccatccatg gcaatctttt gcccgggttt tataatcatg atatctccaa    245940
     tttgaatatc actaactgca atcatttgtt caacatcatc acgacgtatt aacgcctctt    246000
     ttggagcgat gtccattaat gaacgaatag attgtcttgc tttatccata gaatatcgtt    246060
     ctaacacttc actaaaagca aaaagtatta ctacaataga accctcagcc cattcaccta    246120
     tgatggacgc accgataatt gctatagtca taagtgattc cattgtaaag tctaatttaa    246180
     ttaaattagc gaatccctct ttaaataaat taaatccacc aaccacaatt gcaataacat    246240
     acaagatgat agttgtcgtt gaatcttcac cactaatatt ctgagaaata aaggctagta    246300
     taataaaaat aattgagaca actaaatgcc aatttttctt aagaaaggat tctttcttag    246360
     caggtttact tgaataatct ttttcatcag tgactcttag attttcaaat gctcctgctt    246420
     tttcaatttg actgatggaa gtttctccat aaactgaaat ctttcctgct ccaaaattaa    246480
     cctttgcatc agttacaccc tcaaggtttt taacattttt ttcaaacttt cctgcacaat    246540
     tcgtacaaga cataccgtct acacggtatg ttgtttgttt actcgcttta ctcataaaat    246600
     tcctcctttt tcaaacattc aagtgtttgt ttgaatattt acaaatacat aatatcagat    246660
     tatataaaaa cattcaagcg tttgtttgaa taaaatcaat ttcatcaaaa ttgttcttgt    246720
     cttaaggtaa gtaaatgtta taatagcaat taaaaaagga gacgttaaat gaagaaaaca    246780
     acgtatatac taaaagaaat ttgcttatgg aatgaatatt taaacttaaa accaaattat    246840
     aatcttctaa atgatagaaa aattgtattc tcaaaatgca tttctccaag tgagttgata    246900
     tgaaaaataa gacaattata tcaaagcaaa atttagttct aatagttata atggtaggtg    246960
     ctacccttac agaccagtta tcaaaaattt ggataacttc aaatttgcaa ttaggagaat    247020
     caattgaaat tatcccttct tttttcaaga taacatacgc tcaaaataca ggtgcagcat    247080
     ggagcatttt agaagggcag atgactttct tttatgtgat aacattagtt gcattgatac    247140
     tattaggatg gtatttttat cgtcttaaag actatcaaat tattcaaaaa attggagtag    247200
     cgttaatggt ttctggaaca ttaggtaatt ttatagatcg actacttttt caatatgtcc    247260
     gtgactcttt agactttcat attttaggtt acaattttcc tatctttaat gttgctgatg    247320
     ttttacttat ttgtggggtt ttattcatca ttatcgatga agttttaaaa tcttttggtg    247380
     ttagttacaa aaaaatgtag ccttttttca agtagaagat ttatttttta aaatagtata    247440
     acaaaacctc tctttatttt tttaagctac aactaataat actagcttgt ttaaaagata    247500
     aagagaggtt ttaattgtgt ttgaagattt ttttaaagta caatatcttt gattaatgtt    247560
     tcaactaaag aattatttaa tgaataatag accatttttc ctattttttt attttgaact    247620
     actccagctt tacttagtat cttaagatgg tgtgaagtag tcgctactgt tgatttcaca    247680
     atgattgaaa tatcacagac acataattcc ttttccaaag ttaatgcata ggcaatagtt    247740
     aacctagttt cttcagatag ggctttaaaa atttggctaa tatcgctaat ttttttatct    247800
     tctaatgatg tttgaatttt ttgaaccttt tcctcatcaa aacaggttat ttcacaaatg    247860
     tcattcacgt tcctaaacac tccttttcaa aatacattca agcatacgtt tgaatataat    247920
     ctaatgatac cacgcttttg ctgtttgttc aatttttttt gtttttatta actattatgc    247980
     gagcaaaaga agaaagctaa ttgtttttta tgattatcca attctcattt ttttgtaaga    248040
     ttatcttaaa ttgagaaagc tgtgtaactt ttgtttcttt atcaaggtat ttcactgtta    248100
     caatggctgt aacttgattg tctgcttgtg tgtaaacagg gtttacaagt tccacaaata    248160
     cataatcttt attaattaca tcaagagctt gattacttac atagtaagat agctcttttt    248220
     ctgttgcagt aggatagagt ttgaagaacg tatctaggaa actattgatt tcctctgtcg    248280
     tatttgcgtc cacagttccg tcactatcgg aaagtacagg ctcatagctt gccttttgtg    248340
     gtttgctgtc aatggtaggg ttcttaatga ttaccatatt actagcttca tcaacataga    248400
     cagtaacaga ataagtggaa gtgatattct tcttattctc actttctgta atctgttgtc    248460
     ctactgaaaa gagtacatca tattcagtat cgctactttg ttctacactc catacttgaa    248520
     aactgttaac gatagaacta gtagggatat ctgaacgaac catttcagta tttagctgtt    248580
     gtaagttttc ggtcagataa ttctttaagc gttcaattcg attgctctgt gaatcttgcg    248640
     actgttgcca tgaaaaatat tccttgctaa aggattctac aaagctctca atactgttgg    248700
     tatcaacaac ctgtttctca atgatttctt tttcatggac ggtgtgcata tcaatggctg    248760
     taaagttttt ataaatacca aagctcatac ttcctattag taatacccat aaggcaattg    248820
     tgagcttttt atgtgttccc actttgatag tgggaatctt tttttgcttc tttggtttgt    248880
     ctggtttttc ttttcgttca attttgattt tcattttatt aattcctttc tatttgataa    248940
     tgcgtccagc tccaattaaa tgagcttgcc aataactgtc ggtaaggttg gtataaccaa    249000
     taggatcacc tgcgtggtac atttggttat taccaacata gattccaacg tgcgtcacgt    249060
     aactaccagc gtcataggta gagtggaaga aaactaaatc gcctgctttg gcttctgata    249120
     aggggatatg ctgtgttgcg tcatattgag cttgtgcaac tctaggaagt tgaatccctg    249180
     caactgcata gctccattgt gtcaatccgc tacaatcaaa agaagtagag ggagaagaac    249240
     caccaaacac ataagggtag ccctcatatt tcagtgcttc attcataatc gcttgcacgg    249300
     tttcatcatc aaactggact ggtgtaaggt attgagaaac aagcaataca taaaactgat    249360
     ttccatagtt gtaccgccaa ccaccattta caggaattgc aatagggtta ggatagtcaa    249420
     ctttcacacc acctgcttta tcctttgaaa aagattctgc aagttcatag ctgtactttt    249480
     ttccattact agctacatag ttgataaagc caccaccata attgtaggat tgaatgactg    249540
     tgttaatatc acaaccgttg ctttcagcac tagctaatag ctcactaaag tatttacaac    249600
     cctgtttgat ggattcttct gtactaaggc tgttcggtgg aagtcctaaa gattccgagg    249660
     attgcataac atcttcggca gttccgccag attccacctg cataattgct agaatgtaat    249720
     tcacgtattc ttcaatgcca aactccttac aatacttctc aaccattggt ctatgtgcca    249780
     gtacctctgc tgatacattt agaccacctt gttgaatcat ttcttctctg ctactacgtg    249840
     tatcatcttc ctctgcaaaa acgatagtta caaatagcaa cagactaaag aacatagaga    249900
     aaaccactcc aaagatggcg aagtatttta ctagcttcat tacttacgcc ttttcgtagt    249960
     ggtttttgtt attttatttt cagttttact attttttgag gtagtagaag tgttctctcg    250020
     tttgttggct ttcacttgct ctttggttgt attcttttgt ttctgcaaag gtcgttcatg    250080
     ttgctgattc gtagaagctg ttctttctgg tgtcgccttt ggcgtactag cttgtggtgc    250140
     tggtgtcgga gcagtacgag gtactggttg tttgcgttcc tcataatcac gttgtcgttt    250200
     ttgcatagaa gcataaggtt ctaagttgga tttttcagct tttgccttat ccatttcttg    250260
     acgtctttgt gcgacagtcg ctttcttttc attccgcttt gtagcacgtt cttgttgttg    250320
     cagatttctt gtgtcagcaa atgattgaga gaattcactt acattccgca caaggtcacg    250380
     cttgccttta tgaacagcat atttcgcatt ggttggagca tttttgatag tgtctttcat    250440
     atccccagct ttatcaacca ttcgattttt ggcttccatc aagtcgccca ttttttcacc    250500
     tgctcgtgtt ccagcagaac gattctgttt cgtagaagtg ggacggttgg ctgttgattc    250560
     attcccattc tcattttgtc gttcatggtt agctttcgtt gtcttagtag gagtaggagc    250620
     ttctttctct ttaccagagc gactattttt accaattgct cggctaacat ttctctgtaa    250680
     tcgccttgat tgacgattta aaaacattct aggcttacgg aacatttgtc gtcccatgct    250740
     ttgagaatcg ttactctgta aggagaacat attcatgata tcccctagtt tgaagtagat    250800
     tccagcaaac gttactatct gtaagaacat aatcatgaag aatggagaag agccagcaag    250860
     agaatacagc atagtagaga tactaaaggc tactgtgata actaaagtta gaccagccct    250920
     tgtcataata acgttgaaca gtttcataat tgccttttta cccatgccat caaaactagg    250980
     tatcatactt aataagaaac tgataggtag aaacatggca aagataataa agagtacctg    251040
     tgaaaatatc atcattccag taagtaaaaa gacaaagacg gatataccaa tgttaaagat    251100
     aaataagaag aataccgttc ctaatctgga aactgtttta ctaatggaaa ggttggcatt    251160
     gttaaatgtt tcaatttcag taatcacaat atcttctcta tcttctccgt tgttggtgtc    251220
     tgggcttgta gatagcaaac tctctacacg atcagcacca agtgaatcaa cgtcagtcgt    251280
     gccgtactgg agcaatagcc acggttgttt tacctgtaca gaaaataagc tatcacgaat    251340
     catatcaacg ctatctttac ctttgctgtc tgtatctggc ataacgattt ttgttcctac    251400
     atcaagagct gatgtactaa tatcttttga aaagtcattg atgttgccga tatagtctgg    251460
     agcataagca atgaatgaag cagatagaat gaatacaact ataaagttga gaactgctcg    251520
     taccgctttg gtggtttctc gtttgattag tcctgtataa gtcacataga ttcccaagat    251580
     aaagataaga ataagcaaga atcccacgta aaagccagaa gtagagaaac cattttttgt    251640
     gacacctgca atggtctgaa tgttttttcc tatggaatcc actgtcttac tgatgaagtc    251700
     taagctatat gcttcctgta ccagatagcc tgtagcgtta gataggtaga gcgagattgt    251760
     ccatacaaaa ttggtaatgg catataaacc ataactcacg gactttccga taccgtccga    251820
     ccagttccaa ggcaaccagc cccaatcatt atttacatag aagtcaagtt gatagttgcc    251880
     aagcccatac ttagaatact cattgctggt gttgatagtt tcatcaacta gaccagctgc    251940
     atgagcaacc gttccaacac ttgctaacat gataatgagt atcacaaaga aaataatcgc    252000
     tatcagtaca tagcgaatga tttttttata gatgggtagc tgtttgattc gttgtttctt    252060
     ttctattttc cttgcttttc gttcttcctt agtccgcatt attccacctc atttctaata    252120
     ggtgggcgag tatcaaaggc ttgtaagagt tcttcaaaaa tagggtggaa ttgcattact    252180
     cccacacgac cgtaaaggtc agagattaaa cactgtccgt tttccaattc tcgtagtcgt    252240
     ttctgattgt tttcatcttc tgggtcaact ccaaagaatg tcagggtctt tttgatttcc    252300
     acaaggtcag tggaacgaaa cgcaaacttt agaccgatat tgttcttcat tttttcgtct    252360
     aaaaggtcat ctgcattttg cgtaacaaag taaacaccag cgttcatggc acgcccagct    252420
     ctaactagtt tcatagataa cgtcttacct tgtgccacct gtaagaaaga ccatgcttcg    252480
     tcaaggtcaa ctatcttaaa gatagagcgg tctgtgtgga taaagtctaa tgcaaaggta    252540
     ctaatgacaa tcagcatggc aacactcaat aattccatag tagtgtattc ttcaaagcta    252600
     gtgtcagcgt ctggcaatac gaggtcagca acttgaataa tgttcagctg tttttctaag    252660
     ctgatagact gtgttacatt tccatcacta aaaagtaagt gtgcaaaatc atagtcaaca    252720
     aaactttcga tatggtcggc tatgctgtta ctgatagaag tatcttcttt tcgtaattca    252780
     tcaataacaa gtaataaccc tcgctgttca ctttgggtta cattacgaat cgcttttcta    252840
     agcactggaa acttatcact gtcacgactg gagataccag taaggaacgt tagaatatca    252900
     atagctaaac tttcagaatc ctttttacgg ctcaaaatga cataagggtc aagcagtcct    252960
     ttgttttcat catcactcgt taagttgaca atgtttatct cgtgggcgat ttctggtagt    253020
     gtttctttcc atttgccacg ttctgcttta gggtcaacga taaccgcttg tccaccaaat    253080
     agtaccgcat aataaacaag catattgtta ctgaatgatt taccaccacc caatgaacca    253140
     ataaatgcac tggctaacgc attggtaact gaacctttga caccttgact agcaagggca    253200
     ggtttcagat agacattctt tccagtgtcc agattgtacc caacataaat accctcatgt    253260
     tcgccaaggg tttgtgtcgc tccaaaacca agtccagcca aaaaatctga tgtgacgtat    253320
     tgaatatagt cattgatgta ccgtttactg gcagggataa attcgccatg tagccctaac    253380
     atatctccaa agggacgcac gagtttgatt gataagtcgt cgtaaaagtc tttgacttca    253440
     tcacaacgcc ttttcaactc gtcgagatcc tttgcagata cacgaacaac atagctaagt    253500
     ttatacatgg attctttact ttggtcgagt gtcgtttcta attcattcac ggaatccaaa    253560
     gcgtcaatta cattattgct tgtttcgttg tcgctttccc aagcatgaga atctaaatct    253620
     tttaattctt tctttttgtt tctcacggtt gtaagagctt ttttgttggc tacaatttct    253680
     acattcatgc tggtatcaat aggaaaggta aattgttgct gttgataata gaagatttca    253740
     gaactaggaa aatcaagttc gcctacaatt gagttaatcg tgaagtaggc aacataagtg    253800
     gtttcatctt catgaatgat ttttaagtaa cgctggcttt catcaattag acaacgagta    253860
     ggtttgagga tatcatattt ctttactaga acttctttat cctggtattt cttaggtaaa    253920
     tgatattcgt attcttcgta aggtgtacca gtttgtccgt agatatgttc aatgatataa    253980
     ccaaaatcat ttttatctag cttacggatt ttgaaccgtc tggagatttt actttccaat    254040
     agattttcca tttttgagaa tcggtcaatc tctgcattac tcatagacac aaagtcgccc    254100
     atgagcttat ggttcacacc atttagaaat tcctgcacag ctttcttgat ttcttgacta    254160
     accgattgaa tggaaagttc ttgttcattc agcagtaact tgaatccaat aaaaaagcga    254220
     tagtctactt gattgtcgcc aatcatagaa actaacgctt cggtttgttc atcaattttt    254280
     ctgtgagcga cttcttttag tcgtcctttc acttccagct ttgagcgttc ctgtgtcgct    254340
     ctaatactgg attctgtcgc aagctgtaac gcatgaatct ttccatcacg gctttgagct    254400
     acaagctggc ggaagttatc atgcacttga tacttttcat ctggacttag aaagctgtaa    254460
     ttgtaaggta tcagttcata ataagcgaaa cattcgccat cattgttaaa gaccagatta    254520
     ttttcaatat atttaattgg atatgccata atacagttca ctccttacgg ttgttattgc    254580
     ttcattgaat tgttgctttt gaagtttcac ggcttttcct gcataggtag tttttgcccg    254640
     tataaaatac gtgaggatag actttaaaaa tccatagggt ttcttgccgt caaacgtctt    254700
     ttggctcata aaccaagcca agcctactgg aatcccaata tactttagca acgccccatc    254760
     aataagcgat aaaggcggta ggctaccaaa cataacgata acaagtagtg aaacaatgaa    254820
     ccatgtcatt tgcgtaaaag ttatgggaaa tggtagttgt aaatcattga tggcgtagat    254880
     tactttttct acgttccaaa tgctggtgta gcttcttatt tttttcatat tatcacgtcc    254940
     tttctttgtg attgtccgtc cactacgatt aagaaacaat caaggcaggt agcattttct    255000
     tgcgaaaatc tccacctttt aatgccttga caatttcttt ttttgccatg cttttttcgt    255060
     gccgaaaacg gaaaacaaat aataagttta cttgtgtttc gtttcgttag ctcattttat    255120
     ggcaaaaacc atcttcgtta gatggtggaa gtagctagtt ttcttttcgc aaggcgttgc    255180
     cctgcaccca gcctcttcaa aaaacaaata ttaattgcaa tactcaaata ccccatgtga    255240
     ggttacaagg aaattgccgt taatttctaa atctctacca atggcttgat agttaagata    255300
     catttgtaga cgctctggaa tttctcccat caaaccatct tctacatagt aataagcgat    255360
     atcttccata gaatcacaat cgctgtagca gatgatatcg tccttgcttt ctagcaattc    255420
     ctctaggcta ctaaaccaca taccttgtat gtcttttagc tcgtcataga taggcgaacc    255480
     gtccagctcc ataatcattt cacatagacg attaatttca ctaatcggtg tatattcgtc    255540
     aatatcgaat ggcaattcat agtcgtggat agcgtattct tcatactcgc cattcaagcc    255600
     gattttttct tccatttctt catagtcgat aggtggggta aaccatgcac cgacaagttc    255660
     gccctcgttg tacttcccaa ggttggcaac atagattctc atttcttcca tgcgaccacc    255720
     ccctaagctc caatgattcg attgaatagg ttcagcagta cgtctttcac gccccctgca    255780
     ttgaatacca gtcctacggc aatcagtgcg ataatcaaga atccgattag ttttgaaaac    255840
     tctcgtttga accccaaata tagtccaatg actacgattg ccagtaagac aagggattgt    255900
     gcgttactca aaaaccagtt gtataagttt tgtccaaaat tcatgtgttg tttctccttt    255960
     cactcatgta tttcttgcgg ttaataaaat acctctcaac acgttctatc agttgagagg    256020
     gtctaagatg ttccccataa actgttacct tgttaggata atgaggataa aatgtttgct    256080
     tgtaaaagtc atattgatat ggttcatcaa ctcctttccg aaacccctca ataatgagag    256140
     aggtatatat gcctgtatct tgaatgtaga tttctaactc aatcccgcag ttgaaaccaa    256200
     gctcatagag ttcagccgtt aagccactca tacaatcaca tcttcaactg ctagattctg    256260
     ttgctctatc agcttttcgt gtttctctgt aagattggcg tcacgtatca tagctggtat    256320
     gatgtctgtt tcattaagca catctaagat actggctacc tttaaggtag gggctacttg    256380
     atggcgtaac cagttgagtg tccgctcata gctgtatggt tctggttttg ttgtcaaacg    256440
     tagctcgcca cgattcttac caatgaacca ttcccagcgt tcacttgttt gccattggct    256500
     acgccgtttt gtggtatcct tatccgcaaa acgaatataa cgattaatga tttcaaaagc    256560
     tgttttttca gcatttctat aagctaacaa gtcttgaatg gcatgagtag ctctgtcatt    256620
     tttcaaacga atctcaaagc gatttttgac ctctgggtcc tctaagggaa tatcattctt    256680
     aataaattgc tcgtaatctt tctcgtagat acaaaagtac acttcgcttt tgagtgaacc    256740
     aatatacaag gtgtttccca tatcagattt ttcatctcta tggacgagtt cgccacttcg    256800
     gtaattctta aaggtacgaa agatagaaat acattcttcc tgttctgatt tacgagccaa    256860
     ctctggaata tccaagatac cgaccttgtc attgatagct aaatccaagc gtttgaatac    256920
     gccgttgact tccaaacaat ccgtaaagaa gtcataccag cttcggtgtt gagccagtag    256980
     gaagttttca tattgccgac agccttttcc tttcagctcc agcaaaacgc cttttgtaat    257040
     atcataagaa accattacca taatgtcgcc aaagcggtaa tgctctggat aagagtagta    257100
     gccaaaatct tcatgaatca tatagtctat attgaggtgc aatatttctt ctatgatttt    257160
     ttctacgtta tccgtaggga aacgaatccg cacatagtcg aataacattt ctagcggatt    257220
     gtctggattg aagcgttcaa gtgaatcaag caaagccgtt ttgacttgct ctgttggaat    257280
     gactttttca ttctcaatgt ctgataggta ctgtctggta ataccagaag caaccgccag    257340
     cttattttga gaaagtccat atgccatacg cttttctttt agttcttcaa tccaagaggt    257400
     tttattgttc aatcacattc ctccaatcaa aaaagcagat gttgtcaact tttaatgtcg    257460
     agtttacatc tgcttcaaat tgcgaaacac cgcatagtta cggaagtttc ttattctttt    257520
     ttgttgtttt ctagtgtttt tgtgcccccc tgttaggtat agggggctag acgtttggcg    257580
     tggctgacgc cacaccaata cgctagtctg aacctgtggc tttcacttcg tccgccactg    257640
     gatcagccag cgacttattg gcaagtttac ctatttgttt taggaagtca tatccttttg    257700
     gcactttggg tgtataaaac tcacttatga cacttgtacc agtgtctaca tagccacgcc    257760
     ctttgatggg cttcaagaaa aattgttttt gcgtatcatt tccaaacatc atgccatatc    257820
     ctaattcact caaacgacct agagccacac ggaaattgaa ttggtcacgg attccgtcgc    257880
     ctaaatattt tgcatctgga cgttggcaag ctaagattaa aaagaatcca gcttgacgac    257940
     caagcataac aatttgtttc agcttgctta tgacttcggc actatctctg cctagcatat    258000
     ccatgaacgc tacatattcg tcaaagatta aaaaatttgc aggtagtcca agataggcgt    258060
     agttttctcc tgtcttatag tttgggtgtt gcttcatggc ttcacttcgt gcaatcatat    258120
     cctcataaaa ttgattaata cattgaagca tatcgtcttt acgaaagtag acgttgtcca    258180
     tgacagttgc taagtctgca aggtcagagt ttttagggtc tagtatatat aagttcgcat    258240
     tggtgtgaag caaggcttca atgatggtaa gaatgaagta actcttacca ccaccagtac    258300
     caccagcaat caacatatga gggagtttgt catattccca ataaacagaa tccatgagct    258360
     ttaagcgtcc atcatgagcc gttgcttcat caatctggat acgactagcg atagtatcat    258420
     atagtaaggt gtactcaatg taggaatcct ttaattcctt atctacaagc tcacaataca    258480
     acccagtttc tagcttattt tcaagctgta aaagctggtc ttgatacttt cccatagtga    258540
     tttcaacatt gatgtgaata agtccatctt tgagatagta gtacatctta ggaaagtgac    258600
     tgattcgctc ttttgtcttt gagctgggta ggtctttaaa gaatccctct gattgaatct    258660
     gttcagcttc ataccagcca ttttgtagaa ccatctttgc gagcttttgt ctgtgttcaa    258720
     gctgtttgat gttatcaatc ttataatagt aataaagaaa tcctacaata agacatacaa    258780
     aaagggcagt gattacacta cccaagaagt atggtgtttg tagttgttta ataaaatcat    258840
     caagtgttac agtttcccaa tccaccgcca tgatagcttt taagtgaaac ggtatcatga    258900
     caagagagaa taaggtaacc attgaaacgg taaagaagtt agacagtaag tgtttgtcac    258960
     tttgctttat cttttttcca cgatactgaa atagttttct cataggctaa ctatttctta    259020
     tcgtgatttt gtttctggtc ggcttgctgg ttttgtgctg gtcttttcaa gacgatatct    259080
     tcggctttga tataccagtc tacatctgca ccttgaaatg tagcagtagc taccgtatca    259140
     gcaatagggt taatgatttc aacttcggcg ttgtagtcaa agttttttac tccagcagaa    259200
     gcaggaatac ttacttgtat catacgtcct tgttctttac attttaggtc aaaagttcgt    259260
     tccttgacct gttcggttac attaccctca tcatcaacaa tcttgacctc tctacgcaga    259320
     gcggaaaact tcaacgttcc aaaagttttt tctttttcaa ttacgattcc ttcggctaat    259380
     ctcatattta tttacctgtc ctttcttata ccttgacgat atcgtccgca tacataacat    259440
     aatttgtgaa tccacgagta ccaatcttat agccctctgc tgtgatacgt gggtttacta    259500
     attttacttt ttgctcgatt tcaaaatgtt tttctccagc ttcggcaggg agaatgacga    259560
     caatatcatc tgctctttga atgtttgaat aaaggttata gctacgagag agaatggtag    259620
     gtttaccatt aattcttcgt tgttcaactt taccctctcc tgcaaattct aattgtccaa    259680
     atgttttttc catgttgggt attacgtgtt ttaattccat atattttacc tcgttctttc    259740
     ttgaatattt atttaaaatt aaatgtaatt agttttattg ttaaggctgc ttacgttggg    259800
     gaacgtatag agtgcatagt atcctttcca tagaaaaacg caaggtacgt caatgtcttg    259860
     tcgtgatcct tgcgtctaac tttctattat tcaatttttg cttttttacg gcggaagtat    259920
     agaactccta atgtactaac agataacaac atacctaatg caaagatagt aatatttgtg    259980
     gtatctccag tttgtggcaa tgaagtaatc ttttctggga ttttattatt tgtcatttcg    260040
     catttcacaa cctctccatt ttcagtgatt tcaaatagca taggggtatc atcaagctgg    260100
     taaccagttg gagcgtcata ttcttgaaaa tagtattttc ctgctggtag cttttcaaaa    260160
     gtatagatac ctttatcatc agtgcgaccc tcagcaatag tatttttttc ttcatctaag    260220
     attctaatac ctgtgtttgg taacaattcg cctgtagata catctttctt tgttaattct    260280
     gctgtacctt tcttaaggtc gttttcaatt tctagtagaa ttgtaggttc ttcatctgta    260340
     gaactggttt ctccaagcag tttatcatct tcatcaaagg ctttgattcc atcttttgtt    260400
     gattcaatac gaatgacttt ttcggacata agataatgag tagacgaagc ggacttttct    260460
     tttaaataga atgttccaac tggaatgttt ttaaagtttc cttgtccgtc tttatcaatc    260520
     gttacttctt gaatgacttc gttatcttcg ttttctaatg tgaaaatagc acctgtacca    260580
     agtccatcat aattaaactc aacaccagat tctttatcga agatagcttg ttcattcaat    260640
     ttcttgataa taaactcatt aaaatgtaat ttatttatta taggagtacg tgcaatttta    260700
     agcatagtct cgttgccaac agctactgta tcttggtaga tataaatagg gtaggtagcg    260760
     ttgttatttt ctgctgtaaa cttaaaatcg tattctgtat cgtttaaaac gtgagaagtt    260820
     cctgcttcaa gttcttttag ataatatttt ccttgtggta atttcaattc aaaagaagca    260880
     acaccatcac ttacagtttg atatcctaac agcgcgtttg ctggtacgtg tacttcatct    260940
     gttaaggctt gcgcttcacg agtgaacaca ccgaatactt tttcttgtcc ttggataact    261000
     tcaatttctg gttgattgtt attccatgaa aggatagatt cttcatcttt aaataatcgt    261060
     aggtctaatg tttgaaactc gtttgtcgct ttgattgctg tagaagctaa ttcaacttct    261120
     tgacctgcat aagttaaaga gaacggaata gggcgtgtat ctaagatata tcctgctggt    261180
     gctgatacct caacagcttg atattctcca agatataagt taggagagtg ccattgtcct    261240
     ttttcatcag ttgttacagt agcgacagta tcgccttttt tagcttttaa tgttccatca    261300
     actgaatgaa tatcttgtgt cgcttcaata cgataggtaa cgcctgctac tacatttgcg    261360
     ttgtacttga atgtatgaac atctccatat tcggattctg tgacttcgat ttctttagcc    261420
     tcttctccag ctttcgtaag ggtagcgata cctagctgtt ctttattatc aaaagtaagc    261480
     tcaattgttt tgtttggttc aattgttaca acttgcgata cacctttatt tacataacca    261540
     ttaggagctt tcacttctgt gatagtaatt tttgttccct ctggaatatc tttaattaaa    261600
     gcaataccgt ttgaatccgt aactaactct gtagatgtac cgttatactc aaacttcatt    261660
     gtagtatctg gtaatggtct accagtttct tcatcaactt tagtaatttg aacattacct    261720
     aacttgataa catcaacttt cactgtggct tgctttgcac tttctaagtg aaactcaaca    261780
     agtgtttgat gttgtggctt tgtatagaca atagatgttc caacttcatt ttgtggtact    261840
     ttacgataag taatagaacc atcatttgag ttagcatttg gcgtaattgt gatgttgttt    261900
     ccatcttgtt gtaaagtggc gttagtattg tttgattcta agctcattcc actaaggaca    261960
     ccgtgtgaat ctgccaaagt gatactttct ccaactgtta cttttacttc ttgattatgc    262020
     caagaaggta aggtatcatg gcgatttacc atagccatga tttcagcttt acgttgttgg    262080
     taatttggaa tagttgacga tacatattgg tcgcctaatt cttcccaaat catgacttga    262140
     gttacaacat aatcataatg agattgacct gtattcgtat atccgtaata agctattttt    262200
     gataagatat cttttttagg ggaaatatac gattcaggaa tataaccacc acctgtcgta    262260
     gtgaatattc cagattctac acagaatact ttcttaccgt ccatcttcat aacgtagatt    262320
     ggattgtgag tgatagcata tcctaaatgt ggacttactc ctgtatagct gtaagctgta    262380
     ggttcattca acacaagatc acttgcgtga acagatgttg aagaagtaaa aaacgttcca    262440
     cagatggtta ctaaaaccat aatataggtc gtcatttttc ttaatagact ttttgatttt    262500
     gttttcataa tgtttccttt caatttgatt tttggtataa taaaagacgt tcagataaga    262560
     acgtcttaat gcaataatat ttagtttgat ttctattttg aatattgaaa ttggaatcaa    262620
     gaatcaaaca aataacaagt ttactgatta ggtgcaaatt gcactttgat tgcacttttt    262680
     attttatttg atatggatta taagacttaa tagtctttca aatcccttta ttttactgca    262740
     tttttagtta tatcccatac gtttaaaaca gagtgggaat agaaagctaa cataataaga    262800
     ataggaatat caataaatca acgtttttca acttatgaaa tgcttgattt tcattaaaaa    262860
     tgatatattt ccctaccaca aatccctgtc aagatgatgc ttgacaggga tttgtttttt    262920
     gtgggcttac attttaatac taaattgtaa tataatttat ttattaatat gatttttaga    262980
     aaaaactgtt ctaaaaagga gggggaacga tgaaaacgaa gatgccggaa atgctttctt    263040
     tcatttcaga agaagctgtt agtagaaaaa tgacaagtga ggaaattgct gctcactttg    263100
     gttatgataa acatcacttt agtcgaaaat ttaaagaaat taatggattc agtgtggttg    263160
     aatttctttc tagtttaaaa gtggaaaagg cgattattga acttgatgaa gaagtacgca    263220
     tactcgactt acaagaacat tcaggttttg aaagtagtgg tagtttcaca aatacgttta    263280
     aaaaatatac aggtagttct cctagaaaat acaaaaccga aatgaatgat attttttatg    263340
     atatgaaacg ttttgaaaat gataataagg ataagtcaat agcgcatttt caagaaaata    263400
     atgattcttt ttgcaatgta actattgatg tacctgatga atttgagaag ggtatcatat    263460
     ttattggact tttccgtact cttataccga atcatatgcc tatatcggga ttagctacta    263520
     aaaatttaat aggaaatcaa ttgaaaaata ttccaagcgg agactattat ttattagctt    263580
     gtgcgataag ccagtctaat aacattctat cttattttaa cttaagtaat agtttgagag    263640
     ggaaagaaga tgaaaagcta tcttttccta aatgttctgg caatcattac gcgattaagc    263700
     tgagaaaacc aataccagaa gatccaccaa tattagctaa tgtgggaaaa attttaatct    263760
     cctgtttgaa gaacacaatc tagaacaatt ttgtttaact ttgaaatgtt aaaataattg    263820
     taggctaatg aaaaggagag ataaggtatg gctttaaatg caaagagtat cactatagga    263880
     ctaccagtaa gtgatttgga gaaatctgct agttggtatg aaaaactatt tatgagtgat    263940
     gaaaaattaa caccagttga aggggttatt gaatatcaaa ttggttcagt ttggattcaa    264000
     ctttttgaag aaaaaataaa tgtttcagaa aacgttttac gcttaggggt agaggattta    264060
     gatgtggaat ttgaacgttt aaaaacactt ggagtaataa ctgacgaggt gatagaagat    264120
     gtacctggta ttattcgata ttttgtcttc tctgatccag atggtaataa gttgtcattc    264180
     tattggttgt atgaagagga atagatttaa ataatattat atgatgaacg ataacgctaa    264240
     aacgacggat gaatgattcg tcgttttttg atgttagaaa taatgcttaa gtggggtaag    264300
     atataacatt gtggattaaa atagatttag tgtatttata cactttgtta tgaagggtta    264360
     gttaagtatt cttgttgaaa aattgaaatt taatattcta gaggcaatat ttttagatta    264420
     aagtgataac tttttgataa cagcaatttg ataagagcca aataatatgg gaaatatgaa    264480
     ttttaaatgc ataaaacaac gtcgaaacta aattaatatg tttaatgtta gagttgtctt    264540
     gctgtgtgga aatagagtgt aatactccta tttttaaagg ctgaaattgt aatcaagtaa    264600
     attggttgtc cattcctttt attttagata tcccttcaag taaattatca taatttactt    264660
     gaagggataa attattttta tagttttaaa gagtttttat tttttacaaa tataatttaa    264720
     tactaaagat tcaatgttaa gttgcaaaat agtcaagaat agatttgttt caaaattaat    264780
     ttatcatcta atagaaaaaa atttcaaatt aaataatgat taaatttgtg gtaaaactat    264840
     ttttacaaat aatcactctg aaattagtag ttatgcttaa cctcatgcaa tatattatca    264900
     attgcttcaa cgatagattt aactttgtac caagcttcta ttaattcgat actatcagga    264960
     atatgatttt gagaatgaac cataaaattc aaaattttca ttagagaact attgttgttt    265020
     tttgataatg atatattaat taattcggct tgttcggcat acttaggaaa atgtttagtt    265080
     atgtggttac taataaactc tgaataaatt tcatttactg tttgatttcg ttttatacgg    265140
     tcttttgcta tagccttcat tttctggaca tcttgatagt ctaaatttgc aaagtaatca    265200
     atatattcat gtccatatac ttccataaga gaccttaata agaattgtgt agctaaacga    265260
     aaatccttat atctaatctg attaatctca attactagag tatttatacg cacattagaa    265320
     tgatataaat ttgtaaaggg catagtacta cttagaagtt ttccgctccc tatttttggg    265380
     ggtaattttg gttttagagt ggatgatata gattctatgc ttttatattc agttttcaaa    265440
     ccagtatctt ctcgtacact aattccattg tttgaagttg cttctttatt ttgtgtttgt    265500
     tgttctttag aatttgataa tttattactt ttattttttt gttcaatatg tatagaattt    265560
     attgctttac tttccaactg tttagatttt aattcttcta taatgggtat tactatttgt    265620
     tcaattattt tccttttatt aaatttacga gaaatagata aattttcaat tttagcaatc    265680
     tggtttactt tttcaataac acctttaatt aaatataatc tttcacatga aaaagaatct    265740
     atattgtctt tttcaatgcc tagtgactct ctcacttcca aattattaaa taatctttgg    265800
     atattagtat atgccatttc ttcttgaata tcttctttaa aaaattcttc atatttgtca    265860
     ctaataatct ttgcaataga tgtactgttt tttggattag ttcgaagttt aaagatttct    265920
     tgttccttag tattccagga tttaagaccc ctacctttat cttctcctga gtgtatacgc    265980
     ctcataatga aaaaagcatc ctcttcatct gttattaagc attcaatttg agagagattt    266040
     atttttgaag gagtgtcact tttcattttt ttgattcgat caatttggtt ctttggtaaa    266100
     aaactaaatt tttctggatg taaaattagt tttatacatg caactcgtct attaccttca    266160
     tatacagtat atctatcggc attattgagt tttacaattg taactagact tgcatttacc    266220
     aaaccattag tatagatatc ttgtgccaaa ttaatcatat tttgatatcc agaaacatca    266280
     aataactttt ttaaagtatc taattcattc agacctactt catgcctagg attttcaata    266340
     tagttatcaa ttttttcgat ttctacatat tttacaccca tttttatacc tccagaaaat    266400
     gtaaatattc actatctttt attcttcgtg ttttttttga gaagaataaa aattcagcac    266460
     ctcttttttt ttcttgcagg gtataagata aagtaaaaca aatactatct attttattat    266520
     acattctgct aatctctggc gctaaatcat aagtaactat ccatttttta ttttttaact    266580
     catttatgat tttttgagat aaagtttgat gatctccagt actataaaaa ttagtataca    266640
     agccttgtcc tttttgatag tagggcggat caaaaaaagt aaatccattt ttctcaactt    266700
     ttattacatc atcaataaaa tccaaagctt ctaaattata aatttcgatt ttatctttca    266760
     cttgtgcgat ttttaatatt ttttctatta acttttcctt attaaaacgg caatcaataa    266820
     gataatttcc tgtttgttga tatccaccaa ttggtccagc tttatcgatt ataccggatc    266880
     tgtttgttcg attgagaaag agggttgaaa atcccacttc aactacagaa tggtcataaa    266940
     tatcttttcg aatttctttt tgtctaaacc actcttcgat agtaacttca gacgaattaa    267000
     tcatatcaat taattcgtct gtataatcaa ggacactttt ccaaaaacag tatatactgt    267060
     agtcataatc atttataatt attctattta catctttgct caatagaagt tctaaggcaa    267120
     gaccagaacc accacaaaaa ggctctatgt aggtatcaat atcattaact gctactagtt    267180
     tttttatata tttatacatt ttatgtttac caccaggata tcttagtgga gatgggttca    267240
     ttttgtttcc tccaaatgaa atatttgctt aagaattgca acaaatgcta atttaattat    267300
     aacataacct ataataacta ataaacaaat cacactaaat cattttttaa aaattgctct    267360
     atgaaccctc aaaataaatt ttttaataat tagctagctc aaaaaataaa atttcacata    267420
     gttttatact taaacttttc agagaggcaa aaaattgttt tataaattga ttttcattta    267480
     taaaaagagg gaaagcagtg aacttatgag ttttaaaagc ttattttatt tacaaccaat    267540
     attttatttt tctaatactt attagtgatt aagtattaga aggattcctt actgactata    267600
     tggacgttaa taaatatatc tttatctggc ataaagttaa aaacgagtcc atgggagact    267660
     acgacggttt tagggactta tgtttccgat actcaaaatg tactaacaga attaggcaat    267720
     ataaaatcat tagattttgg aatgaaaaaa aatagattca atcttttaaa tgcaccggat    267780
     gaattatata ttaatccaaa acaattttgg gaggagttta atcagccttt cctagataaa    267840
     gcgattcagc gaggagatga cgtagctatg gctacaaagc cgactgtaga aaacttatac    267900
     atcgctggga ctaaacaact tacgggtttt ggccgtgaat ataaatactt actacaacat    267960
     ggttatgctt atgatgtaaa aacaagcaca atgaagttga agaaatgagg aattcaagca    268020
     tgaaattaga cgataatgca aaagaaataa tccttaaaaa aagtgaattt ctactccata    268080
     ataattttaa attaatagaa ataacggacg ctactatcac attttcaaac aagaaaattg    268140
     cttttgtcat cggttatgaa agatatgata atgtaagtaa tattaatata aagtttttgg    268200
     aagaaaatga aatgtttaat cttggatgga ttgcttttgt aagaagaaat cagacgccgc    268260
     ttcctcagaa taaattagat aatatattag agttacttga ttatgctgaa aaaaattatg    268320
     ctaaagttat taacttacaa ttttgccaag aaagtagagg aatgatagaa gacttcttga    268380
     aagaataata actggaatta tagtaaaaaa aggactgtga tcaattggat ttccacaaag    268440
     aagttgaaaa aacattcaaa ggatacgagc aaaagtatca attgatgcta actaaaattg    268500
     ataataatga agttgctttc atcggagaaa attatgcttt aggtataggt tggagtacgg    268560
     acgggattga ttggcattat ttcaaactag ataattcgat gctctgtaaa tttagtctag    268620
     ataatttatt aaacgcaaaa ctaactcaca tagaacgaga cggattattt cctagtaaaa    268680
     caatttgcga gaaaataatt aatgaattaa taatctgcga aagagtattc aataaccatt    268740
     ttcaagaatt gctacggggt gaaacattaa gcgactatgg aaataaagaa tttgtttcga    268800
     atttggagaa gagtattatt gaacgtgaac tattgactcg ataataatgc atattaggag    268860
     aaccgcatta ttcctatgaa tttgattgca taaaatctta atacaaaaat aacaaagttg    268920
     gtgaaattaa tggagtttaa gcacgaagta gagaataact ttgcgaatat aattcaagaa    268980
     tatcgattta acttaattaa agtaaatgaa gacgaaataa tgttattaaa tcctaattat    269040
     gctctaacta tttggaaaag tagagaaggt attgatattt attacctgtt tcttcatagc    269100
     ttagaaaaag tgaaaataac caatttctta ttttcaaatt atgaaaaaga tttgttagcc    269160
     aatataactc ctgcaaataa tttgaccgac caaatttcta acagcttact tattcatgcg    269220
     agaggtttaa gtaaatattt ccctgaattg ttatctggtc aaaatgactg ggtaaaggag    269280
     tttaaagaga ataagtttta taatgagccg agagctatta acaaagacga gtattcagcc    269340
     tatcaaacta ttataaaaaa tatcaacggc aaaaaaattg aaggatttca aaatgagata    269400
     tgaagcagat tttataaata gattccaacc attaatagaa gaatataagt tgaattataa    269460
     agttatatct gaagaggagc tagcactttt tggttctaat tttgcgcttg ttttttcaat    269520
     tcattttgat gaggtttctt tgaattatgt atgtcgtgat aaagataatt tgcttgttag    269580
     ttatgatgta tggtcttatt ttttacatgt ctttgatgat aaagataggg agaatttgcc    269640
     aaaatataat tctgtgcgtg aacgagtgga tgtttcattt ttaatacttg caagaggtct    269700
     tccacgtcat tggaacaatg tacttaatgg agatgacaag tggttggaag cttataagca    269760
     gtataaatta gccggtgttc ctaaaaaggt aatcgggcac ttgaaggata gtttgagttt    269820
     aaatatttga ccaagaaatg ttgagaatgt agcagaaaag aggagttcaa ctatgaaaat    269880
     ggacaataat tcaaaagaaa taatccctaa aaaaagtgaa tttctattcc atggggaatg    269940
     caatgtgttc ttttttatat gaacaagagg gcgtaagtta tagtaagatt caacccaata    270000
     ggtcttttat ggttatggag ggcgcgagtg ttgttgggag aaggaagata               270050
//

If you have problems or comments...

PBIL Back to PBIL home page