(data stored in ACNUC10821 zone)

EMBL: AL591982

ID   AL591982; SV 1; linear; genomic DNA; STD; PRO; 295050 BP.
XX
AC   AL591982;
XX
DT   21-OCT-2001 (Rel. 69, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Listeria monocytogenes EGD-e, complete genome, segment 10/12
XX
KW   .
XX
OS   Listeria monocytogenes EGD-e
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [2]
RP   1-295050
RA   Glaser P., Frangeul L., Rusniok C.;
RT   ;
RL   Submitted (06-JUN-2001) to the INSDC.
RL   Glaser P., Institut Pasteur, Genomique des Microorganismes Pathogenes, 25
RL   rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE.
XX
RN   [3]
RX   DOI; 10.1126/science.1063447.
RX   PUBMED; 11679669.
RA   Glaser P., Frangeul L., Buchrieser C., Rusniok C., Amend A., Baquero F.,
RA   Berche P., Bloecker H., Brandt P., Chakraborty T., Charbit A.,
RA   Chetouani F., Couve E., de Daruvar A., Dehoux P., Domann E.,
RA   Dominguez-Bernal G., Duchaud E., Durant L., Dussurget O., Entian K.D.,
RA   Fsihi H., Portillo F.G., Garrido P., Gautier L., Goebel W., Gomez-Lopez N.,
RA   Hain T., Hauf J., Jackson D., Jones L.M., Kaerst U., Kreft J., Kuhn M.,
RA   Kunst F., Kurapkat G., Madueno E., Maitournam A., Vicente J.M., Ng E.,
RA   Nedjari H., Nordsiek G., Novella S., de Pablos B., Perez-Diaz J.C.,
RA   Purcell R., Remmel B., Rose M., Schlueter T., Simoes N., Tierrez A.,
RA   Vazquez-Boland J.A., Voss H., Wehland J., Cossart P.;
RT   "Comparative genomics of Listeria species";
RL   Science, e1252229 294(5543):849-852(2001).
XX
DR   MD5; e6731781242051c72d30fbd36533d597.
DR   ENA-CON; AL591824.
DR   BioSample; SAMEA3138329.
DR   EuropePMC; PMC4299700; 24730374.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00615; LhrA.
DR   RFAM; RF01475; rli45.
DR   RFAM; RF01476; rliF.
DR   RFAM; RF01478; rli47.
DR   RFAM; RF01479; rli48.
DR   RFAM; RF01485; rli61.
DR   RFAM; RF01486; rli62.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01776; RatA.
XX
CC   E-mail: pglaser@pasteur.fr
CC   Phone: +33 1 45 68 89 96, Fax: +33 (0)1 45 68 87 86
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..295050
FT                   /organism="Listeria monocytogenes EGD-e"
FT                   /strain="EGD-e"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:169963"
FT   CDS_pept        complement(224..751)
FT                   /transl_table=11
FT                   /gene="divIVA"
FT                   /note="similar to cell-division initiation protein (septum
FT                   placement)"
FT                   /db_xref="GOA:Q8Y5N7"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5N7"
FT                   /protein_id="CAD00098.1"
FT                   /translation="MPLSPLDIHNKEFTRGFRGYDEDEVNDFLDQIIKDYEQVIKEKKR
FT                   IEDTLNNSEERLGHFTNIEETLNKSLIVAQTAAEEVKASAEKEAKLIIREAEKNADRIL
FT                   SDSLSKARKIAIEIEDLKRQSKVFRERLRMLVEAQMDLIKSEDWQQMMAYDVDATELAS
FT                   IKEVESAESEER"
FT   regulatory      complement(760..765)
FT                   /gene="divIVA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(845..1366)
FT                   /transl_table=11
FT                   /gene="lmo2021"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y5N6"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5N6"
FT                   /protein_id="CAD00099.1"
FT                   /translation="MKKILGNTRRQLILKWLKEAETPISGNQLASKTNVSRQVIVQDIS
FT                   LLKAGNEPIMATPQGYIYAKETSFAGERRVIAVKHTKEQAVEELNILVDHGVSVVDVIV
FT                   DHPIYGEITASLHLKSRFDVEKFIKKVQTTGATMLSGLTDGTHLHTIEADTKEQLEQAI
FT                   EALEKAGFLI"
FT   regulatory      complement(1371..1376)
FT                   /gene="lmo2021"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(1371..2477)
FT                   /transl_table=11
FT                   /gene="lmo2022"
FT                   /note="similar to a NifS-like protein required for NAD
FT                   biosynthesis"
FT                   /db_xref="GOA:Q8Y5N5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5N5"
FT                   /protein_id="CAD00100.1"
FT                   /translation="MIYFDHAATTKMSEAALEVFMSASREFFANSESLHDAGTKSAALL
FT                   EKCRGSFAEILHVPSRGIMFTSGGTESNQIAIQTLLHSTKKKEVLVSPLEHASVWQQLE
FT                   ALEEAGACWLRLLPVDAFGRVDPAVLSDMISPDTGLVIIQHVNSEIGSIQPIRELAHIA
FT                   KQAGVYFHTDIVQSFGKLDLTLDDVTSFSISSHKIYGPKGAGLLFIKPDVPMQVPLPNV
FT                   HHEFGFRPGTVNVPAIAAFTTAAYDIMGNREKEARRIAELKKAICEALTAKVKVEGGLN
FT                   TSPFILGITLPNMQGQEALLALNEADIQISTTSACSLRDPAPSRTLLATGKTIEEASRF
FT                   IRLSFGRENELSDSLIFKKELDKLLRKR"
FT   regulatory      complement(2486..2491)
FT                   /gene="lmo2022"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      2594..2599
FT                   /gene="nadB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2608..4062
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /note="similar to L-aspartate oxidase"
FT                   /db_xref="GOA:Q8Y5N4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5N4"
FT                   /protein_id="CAD00101.1"
FT                   /translation="MIKERVIIVGSGISGCTAALRLMQDYDVTIITKGYKEESNSMLAQ
FT                   GGVAAAVSKNDTPKKHFSDTFQAGCFHNKVLAVNQLVTHGPMVIQKLIAEGMAFDEQDG
FT                   ELALGLEGAHQLPRILHTGGDQTGKFLTTFLQEKLTDIHWQEQKMAIEIIKQNDSAIGV
FT                   HCLDKENRLHTYYGEHIILASGGLGQLFPVTTNAATISGDGLALAYRAGAKLTDMEFIQ
FT                   FHPTLLFLNGRCHGLISEAVRGEGAKLIRADGSAIMTDVHPRADLAPRDIVAATLFAEI
FT                   QDGNEVFLDITAIPNFEKRFPGITANLDAHHIPFRETKRIPVHPGAHFLMGGIRTDLSG
FT                   KTNIPGLYAIGEVANAGVHGANRLASNSLLETLVFGEKVAEYIRTQKINPIDHPEIPLS
FT                   NQIQTPHLPDKQLLQEKIWETLGITRKPEKITEFLHWLTDFDYANHTRKTAEISHMLIT
FT                   AKLIAESALKRTESLGAHRILKGVIK"
FT   regulatory      4047..4052
FT                   /gene="nadC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4059..4904
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /note="similar to nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="GOA:Q8Y5N3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5N3"
FT                   /protein_id="CAD00102.1"
FT                   /translation="MNSILMNQAIQAFLLEDIGQYDLSAGTVFPRDTMGEGVFLAKETG
FT                   ILCGISIPPKVYELLGGNIQFEAYKKDGDWVQKGDIIAAVKAPVRTLLSGERVILNLMQ
FT                   RMSGIASQTNFAIKQLDDSAIRICDTRKTAPGLRAFDKYAVQTGGGFNHRNGLYDGVML
FT                   KDNHIAFSGGITSAVSTVRGKLGHMVKIEVETETAEQVKEAVQAGADIIMFDNRTPEEI
FT                   KQLVKLVPPHITTEISGNVTLENIHRYKGSGANYISLGSLTHSVRAFDISFNSKGGIKA
FT                   "
FT   regulatory      4886..4891
FT                   /gene="nadA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4901..6001
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /note="similar to quinolinate synthetase"
FT                   /db_xref="GOA:Q8Y5N2"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023515"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5N2"
FT                   /protein_id="CAD00103.1"
FT                   /translation="MNLLETVEQDTMPTHYKQMTQVEMIARVTEIKAQLGENLFIPCHH
FT                   YQKDEVVPFADAIGDSLQLAQIAAQNKKAKHIVFCGVHFMAETADMLTTSEQIVTLPDM
FT                   RAGCSMADMADIHQLTNAWPKLQTLFGDTILPVTYINSTAAIKSFVGEHGGTTVTSSNA
FT                   TKIVSWALEQKERIFFLPDQHLGRNTAFELGIPLEHMAIWNPIKNELEYEGNLDDCKVI
FT                   LWKGYCSVHQHFTVKNIENIRKNHPNMRIIVHPECTHEVVSLADDSGSTKKIVTEINNA
FT                   APGTEWAVGTEANLVGRIIQENPDKKIVSLNPFMCPCMTMNRIDLPHLLWTLEAIQNGE
FT                   KRNQIKVDEQTTKFALKALERMLQLS"
FT   regulatory      complement(6279..6316)
FT                   /gene="lmo2026"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(6329..8209)
FT                   /transl_table=11
FT                   /gene="lmo2026"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8Y5N1"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5N1"
FT                   /protein_id="CAD00104.1"
FT                   /translation="MKKKFVYLLLLVLFMTVLPFQMLEAQAASTSWIEQELDGNEPFIA
FT                   ETEKILSKNRQDITLADLETIQKIHVFGADSIPNKISDYKNLTALEANYGTITEVPESV
FT                   GSLKELVTLNVDENNLQEFPMVIFQLPKLEVLYISRGNITEIPTEITTLASHLKVLDVS
FT                   NQKLVTIPDSILTTNWKAMHDGKLGMSLAGNQIASDIPANYLDNFNSGGNMLEFYDNPT
FT                   IDYLQKQDQLTYTGGTIEVPLNTDFKQLTPDKTNLGLKSNIPLFSQHEFMYYDDGTSAN
FT                   ILTNGVATDVGDGYITIKSTLSTNSNPFAKVRVPIKVTAPLKGADVTVQYLDSNGDTLA
FT                   TPDILSGNEGDAYASTPKTIDGYTLTQTPTNAQGTFTEEPQTVIYVYTKNSVAAAPVTV
FT                   KYLNEEGKILTASDNLTGNVDDPYQTKAKEFAGYTLDESKLPTNASGVFKTNAQTVTYV
FT                   YKTIPASIKAHDSTMNVGDTWSAKDNFDSAVDSLGVAVPFDEVKVDGSVDTTKAGVYPV
FT                   TYSFAGDSVTIKVTVKATVVPAPPITPIKPVVPAPANPNTPSTQQTPTKQSGTLKIKAT
FT                   HQEQPIVAGNLKLPTTGDNLWDSVLYSIFGFITVCLSFVLFFRLKKQKNS"
FT   regulatory      complement(8220..8225)
FT                   /gene="lmo2026"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(8420..8444)
FT                   /gene="lmo2027"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(8500..9603)
FT                   /transl_table=11
FT                   /gene="lmo2027"
FT                   /product="putative cell surface protein, similar to
FT                   internalin proteins"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="PDB:5KZS"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5N0"
FT                   /protein_id="CAD00105.1"
FT                   /translation="MKKILTGLSTTLLLTVLLLTITGGDLKAKAASDLYPLPAPIIDVF
FT                   PDEGLAKDMAKNLNKDSVNDVIDQDDLDALTGLGFETETITNDSMQLLERAMFNNVNIV
FT                   SVMEFGEDLTEFPDISTIPHLNTLFFNTPPEGVTRNLSLPDYQNYPEMVTITMSGSNLI
FT                   GAIPDFTGMPDLSQLYMADMMITSDDVPDFHTIPKLSTLDLSHNQLTNLPDFQNLTNLA
FT                   ELNLSFNNLTNTMTNFTNLSNLNNLNLDYNHLNELPSNVLNSIFIENQSGTVPDQIIKQ
FT                   GETCTIQLPIYFQLAEINMLVNPTVLGSYSADIPVEVVTTTNADTESITLDTSELSPGV
FT                   YNFNVQFNDAYPITQEGCVYDWVLTVN"
FT   regulatory      complement(9611..9616)
FT                   /gene="lmo2027"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(10009..10785)
FT                   /transl_table=11
FT                   /gene="lmo2028"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5M9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR040591"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5M9"
FT                   /protein_id="CAD00106.1"
FT                   /translation="MDGIYQHFRAEEYAFIDKILGITMQVENEYTPQLTDFLDPRQRFI
FT                   TETVIGGYDEINVQFFGGVAHAERRRALIYPDYYTPTEADFEIALFHIRYPVKFTTLTH
FT                   QKILGTLMSLGMKRDIFGDILNNGTEWQLLVESTMKDYLTLQLEKIGKVNVMLEETELT
FT                   NAVYAPVIWEEMGLTVSSMRLDVIISNAHHISRQKAKQLVTAGLVKVNWKTVENPDFEC
FT                   EEEDVLSARGYGRVKVLSTGGRTKKDKIRIEIGYLK"
FT   regulatory      complement(10793..10798)
FT                   /gene="lmo2028"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(10883..10902)
FT                   /gene="lmo2029"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(10909..11199)
FT                   /transl_table=11
FT                   /gene="lmo2029"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5M8"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5M8"
FT                   /protein_id="CAD00107.1"
FT                   /translation="MQSILYQVVEIVLFIIRWLPTLMFIYFLMSWFPGARESKIGQFLA
FT                   RIFEPILEPFRRIIPPIGMFDISSLVAYFIFQYAMRVLTGLIQVYVIPMLF"
FT   regulatory      complement(11211..11216)
FT                   /gene="lmo2029"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(11222..11680)
FT                   /transl_table=11
FT                   /gene="lmo2030"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5M7"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5M7"
FT                   /protein_id="CAD00108.1"
FT                   /translation="MGLSNKFKSFFFLDEEEEYYEEEVAREPEPMQKKTKKEKPNKNRF
FT                   YAVEEDDAKVVSMQGAQFSSRMVLAEPRVYAEAQELADYLKEYKSVVVNLQRISHDQAT
FT                   RIVDFLSGTVYALGGDIQRVGNNIFLCTPDNVEVDGSISEMLDEQNFM"
FT   CDS_pept        complement(11684..12373)
FT                   /transl_table=11
FT                   /gene="lmo2031"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5M6"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5M6"
FT                   /protein_id="CAD00109.1"
FT                   /translation="MTKQANLQKVTAQIEHACEESNRQSEDVTLVAVTKTIDVTGITEL
FT                   YDLGIRHFGENRADVFLEKTVELADKDDICWHYIGSLQTRKVKDVLPQIDYLHSLDRSS
FT                   LAKEIEKRATKPVKCFLQVNISGEESKHGFSKEEALSFLQEANFTFIEIVGLMTMAPIT
FT                   NSDIELHHVFHELKQLQQEIHALQLKNIPCTELSMGMTNDYGIAITEGATFIRIGRALV
FT                   NDDNMEV"
FT   regulatory      complement(11689..11694)
FT                   /gene="lmo2030"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(12380..12385)
FT                   /gene="lmo2031"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(12492..13667)
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /note="highly similar to cell-division initiation protein
FT                   FtsZ"
FT                   /db_xref="GOA:Q8Y5M5"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5M5"
FT                   /protein_id="CAD00110.1"
FT                   /translation="MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNT
FT                   DAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAG
FT                   MGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIV
FT                   IPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINLDFADVKTIMTNRG
FT                   SALMGIGIATGENRAAEAAKKAISSPLLETSVDGAKGVLMNITGGSNLSLYEVQEAAEI
FT                   VSSASDEDVNMIFGSVINDELKDELIVTVIATGFDEAKQAQQQAQANRRPNQSIQVNRP
FT                   NYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG"
FT   regulatory      complement(13675..13680)
FT                   /gene="ftsZ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(13734..15014)
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /note="highly similar to cell-division protein FtsA"
FT                   /db_xref="GOA:Q8Y5M4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5M4"
FT                   /protein_id="CAD00111.1"
FT                   /translation="MGDSEIYVSLDIGTASVKVIIAEMADDRLNIIGVGNVESSGIKKG
FT                   IIIDIDKTVESIKKAIEQAERMVGVEISQVIVGVVSSQVHLEACRGIVAVGSENREITD
FT                   EDVWNVMDAAQVVPLSPEREIINTIPDQFVVDGLTGITDPRGMIGVRLEMEGTLITGSK
FT                   TILHNTLRCVERAGLEISDIALQPLAEASISLSEDDKEFGTALVNVGAGTTTVSVFEQG
FT                   RLTYTGVIPVGGDNITKDLSLGLNTSTANADRVKLDHGYAFYDDASPDEVFAIDVIGSD
FT                   QKQHFTQVEVADIIEARMEEIFQLVVEELTRVGKTHLPGGYVLTGGSMAIPGAIDLAGK
FT                   TLAAHVRLAIPDYIGVREPSFTTAVGLIKYAYQMAELEGRDVSSSANEPRYDDEAPKQK
FT                   QPKPKQKKSDDEKVSTKMKNFFGAFFE"
FT   regulatory      complement(15024..15029)
FT                   /gene="ftsA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(15381..16193)
FT                   /transl_table=11
FT                   /gene="divIB"
FT                   /note="similar to cell-division initiation protein divIB"
FT                   /db_xref="GOA:Q8Y5M3"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026580"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5M3"
FT                   /protein_id="CAD00112.1"
FT                   /translation="MAENKRVISIENRIPELKKYRKKKLVRHLAILIGIFVILIAITLY
FT                   FLSPLSKLDKIAVSGNKQLTENEVRKESGLEIGEFVIGISNGKTEDALKKNTLIKDATV
FT                   SKEGLNDVQINITEFKTIGYQQQDGKYYDVLESGIMLTDQPRQFPIGNDLLFQNFKNGK
FT                   TLEKMVDQINKLPKDVVSSISEVIYSPTKSDKNHIKLYMNDGNQVSADISTFAEKMQHY
FT                   PAIVAQLAKGQKGVIDIEVGSYFQSYYQQNAEKKATEEAAKEKKETNE"
FT   regulatory      complement(16201..16206)
FT                   /gene="divIB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(16216..17307)
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /note="similar to peptidoglycan synthesis enzymes, putative
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="GOA:Q8Y5M2"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5M2"
FT                   /protein_id="CAD00113.1"
FT                   /translation="MKVAISGGGTGGHVYPALALIRELKKSHPEAEFLYIGTEKGLEAG
FT                   IVKREGIPFEAIEITGFKRSLSLENIKTVMRFLSGAKKSKQILRDFKPDVVIGTGGYVC
FT                   GPVVYAAAKLKIPTLIHEQNSVAGLTNKFLSRYTDKVAICFEEVSDSFASEKIVFTGNP
FT                   RASEVVGVDSEGALEAYGLVSGKPTVLVFGGSRGARGVNEAVEAVLPEWNNRDFQLLYV
FT                   TGDVHYEKIKDSLAELNLGNHISVQPFIYDMPKILNAVTLVVSRAGATTLAELTALGVP
FT                   SILIPSPYVTANHQENNARALEKNNAAIVITEAELKNTDLMATVDSILNDEAKLNSMKL
FT                   SAKQMGRPDAAAKLVEAVLSIMK"
FT   CDS_pept        complement(17304..18671)
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /note="similar to UDP-N-acetylmuramoylalanine D-glutamate
FT                   ligase"
FT                   /db_xref="GOA:Q8Y5M1"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5M1"
FT                   /protein_id="CAD00114.1"
FT                   /translation="MKKIEMYHHKKVLVLGLARSGVSAATIMHKLGAFVTVNDQKPFSE
FT                   NPEAQGLLEQGIKVICGSHPIELLDEGFELVIKNPGIPYNNPMIEKALKLKIPVITEVE
FT                   LAYQISEAPIVGITGTNGKTTTTTIIHHMLNTHKENSSLLAGNIGFPASAVAENATSDQ
FT                   YISMELSSFQLMGVETFKPHISVITNIYEAHLDYHTDRSEYVQAKWHIQKNQIADDFLV
FT                   INWDQEELKNLTKQTKAQVIPFSTTQRLGQGSYVQNGNIMFNDEVIGERDNILLPGEHN
FT                   LENVLASVAVAKTLGVTNEEIMHVLETFKGVEHRTQFVVEWQGRKFYNDSKATNILATQ
FT                   SALKGFKNPVVLLAGGLDRGNSFDELLPFFKNVKTLIVFGETADKIGRVGKIAGIEVHY
FT                   VDNVEAAVPVAYRESAPGDIILLSPACASWDQYRTFEVRGNAYMDAIGELIEEVEK"
FT   regulatory      complement(17315..17320)
FT                   /gene="murG"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(18683..18687)
FT                   /gene="murD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(18812..19786)
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /note="similar to phospho-N-acetylmuramoyl-pentapeptide
FT                   transferase"
FT                   /db_xref="GOA:Q8Y5M0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5M0"
FT                   /protein_id="CAD00115.1"
FT                   /translation="MSLYMLVSTFAVAFIITVIGVPLFIPFLVKLKFGQSIRDEGPKMH
FT                   EKKSGTPTMGAVVFITAMLISFLVFSFISGEVSAATWLLFIALALFGALGFLDDYIKVV
FT                   QKRNLGLTSKQKFLGQVVISILFYLVYHFNDFAETLNIPFTNIEVDLGWFFVIFILFWL
FT                   VGFSNAVNLTDGLDGLVSGLSVIAFSAFGVIAFYQEQMDVAIFCFAIVGGMLGFLLFNK
FT                   NPAKIFMGDTGSLALGGSIAAISILVHQEWLLLLIGIIFVIETASVILQVFYFKATGGK
FT                   RIFRMTPIHHHFELGGWSEWRVVLTFWGIGLVGAIISVCVVIF"
FT   regulatory      complement(19794..19799)
FT                   /gene="mraY"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(19833..21308)
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /note="similar to
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate
FT                   ligase"
FT                   /db_xref="GOA:Q8Y5L9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5L9"
FT                   /protein_id="CAD00116.1"
FT                   /translation="MKLNELMQAIPVFTGEVSETIEISHIAQDSRKVKPGTLFICIDGE
FT                   VVDGHKFASRAVELGAVAIIAEKQVDVSIPVIYVRDSKRAMAMLADYFYGSPTQALKLV
FT                   GITGTNGKTTVSHLVEQIVRENGEQTGLIGTMYRKIGDQILETKNTTPDSLTLQETFRD
FT                   MLLSGVSTAVMEVSSHALVQGRVYGSDYDVAVFMNLSQDHLDYHHTMEEYANAKSLLFA
FT                   QLGNSYHTSNPKIAVLNADDAESVRMQKATAAHIITFGIKQEADFQASNIKITSHGSTF
FT                   DLGTPVGNFTLKIKMIGNFSVYNVLAAIATSFALHIPMEKAIKTVESIPGVKGRFELVH
FT                   AGQEFPVIVDYAHTPDGLLNVLETIDEFAEKRVFVVVGCGGDRDKGKRPQMAKIAVDYA
FT                   TNPIFTSDNPRSENPRAIIEDMIQGVPESDAYVVHENRRDAIRFAVNQAEAGDVILIAG
FT                   KGHEDYQVVGDEVIDFDDRVEARIAIEKKLGLA"
FT   regulatory      complement(21317..21322)
FT                   /gene="murE"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(21483..23738)
FT                   /transl_table=11
FT                   /gene="pbpB"
FT                   /note="similar to penicillin-binding protein 2B"
FT                   /db_xref="GOA:Q8Y5L8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5L8"
FT                   /protein_id="CAD00117.1"
FT                   /translation="MKRRIGNMRRGALVLFIFFTILFLLVSGRFLYLQITGEANGVPLA
FT                   AKASKQHLKSSVLEAKRGSILDRKGEVLAEDTASYTVAAVVSDKLSKTTKNPMRVVDEE
FT                   KTARILAKYIPMDESDILDKLHEKGKYQVEFGAAGKNISTETKAKIDKENLPGIEFTRQ
FT                   SERFYPNGTFATQLIGFAQQEEEKNATVLEGKMGIESRYNDILTGKNGKIDYSTDRMGY
FT                   ILPNSKNKVTEAKDGKDITLTLDKKIQTFLEDTMTTVDAKYKPKNMMAVVADPKTGEIL
FT                   AISQRPSFNPADRSTITGNSSSIWQDLPVEYAYEPGSVMKIISLASAIDTNAYNANEYY
FT                   QSGSYKVGDIAIHDHNNGNGWGSITYREGVERSSNVAFAKLLNKMGTDTFKTYLDKFGF
FT                   GKKTGIALPNETSGKILYNYPIEKVTTVFGQGTTVSMMQMIQAASAIASDGTMKEPYVV
FT                   SSVKDPNTGEETDTKTKIAGKPISAETAKKTRDELKNVISGEHGTGKLYAIPGYDVAGK
FT                   TGTSQIPDPKTGKYMTGADNYIFSFLGMAPADNPELVIYVTMQQPQLSGSQTGGEAVSE
FT                   VFNPVMKNSLQYMNIKPGDAEKLASEKVPVLAGKKVDEAKKIVKDKGLEPIVVGNGKKI
FT                   VQQLPQANAEIMQGQKVILMTDGDMTAPDMVTWSKDDALKVSEITGIPFEFSGNGYVKS
FT                   QSVSAGSVINSETKMKITLAPPEEISAFNQNHDQDTAEKNKKATDIQENAGIGDLLN"
FT   CDS_pept        complement(23735..24097)
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /note="similar to cell-division protein FtsL"
FT                   /db_xref="GOA:Q929X7"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q929X7"
FT                   /protein_id="CAD00118.1"
FT                   /translation="MSNVAYKSNLEPNRVHREAEQPKKQILKRGQMTLGEKVIITIALA
FT                   IVLVVAFRIISVQAQIYTVNQEIQTKETKILEQQKSNEDLKVEVKDLGRYERILKIAKE
FT                   KGLKLDGDNVKVVDGQ"
FT   regulatory      complement(23749..23754)
FT                   /gene="pbpB"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(24107..24112)
FT                   /gene="ftsL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(24114..25052)
FT                   /transl_table=11
FT                   /gene="lmo2041"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5L7"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5L7"
FT                   /protein_id="CAD00119.1"
FT                   /translation="MFKHETVLLHETVDMLEVKPDGIYVDATLGGAGHSEYLLNKLNEK
FT                   GHLFAFDQDQTAIDNAKIKLADYSDKVTFIKANFRDMKEALNERGIEAVDGILYDLGVS
FT                   SPQLDERERGFSYHQDAALDMRMDQEQELTAKTVVNEWSYQDLIRIFFQYGEEKFSKQI
FT                   AREIERRREVKPIETTGELVDIIKTAIPAPARRKGGHPGKRTFQAIRIAVNDELGAVED
FT                   SLEKALTLIKPGGRISVITFHSLEDRITKQLFQEATKGPDLPPGLPVIPDEYKPDFKLA
FT                   TRKPIVPSEEELEQNNRARSAKLRVIEKIIK"
FT   regulatory      complement(25060..25065)
FT                   /gene="lmo2041"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(25065..25496)
FT                   /transl_table=11
FT                   /gene="lmo2042"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5L6"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5L6"
FT                   /protein_id="CAD00120.1"
FT                   /translation="MFMGEYQHNIDIKGRLIVPAKFRELLGDNFVITRGLDKCLFAYPQ
FT                   EEWKKLEEKLQTLPLTKKDARSFTRFFFSGASECELDKQGRINIPSNLLQYADLEKETV
FT                   IIGVSSRIEIWSKSEWDDVFNEAEESFADLAENMIGFDI"
FT   regulatory      complement(25506..25512)
FT                   /gene="lmo2042"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(25682..25706)
FT                   /gene="lmo2043"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(25699..26946)
FT                   /transl_table=11
FT                   /gene="lmo2043"
FT                   /note="similar to integral membrane proteins"
FT                   /db_xref="GOA:Q8Y5L5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5L5"
FT                   /protein_id="CAD00121.1"
FT                   /translation="MFRELHPNIRARILIQFLSKVIGSMIFPFMAIYFSMEINSSVAGF
FT                   LLMINVLAQFLAGMYGGHLADIIGRKKLMVTGELLKVFAFLGMVLCNSPMFHSPWITFV
FT                   MLLIIGVAQGLINPAGEAMLIDVSTLENRSFMYSVSYWANNLSIMIGIMVGGWFFVDYL
FT                   FPLLVVLFIMSFVTAWLTISLISETLQQKEMPHKGSYGLMGMLKNYGQVLHDYRFLLYT
FT                   IGGIAIMSIEFQRSNYISVRLAEDVKALLVHLGPLGNISLNGVQIVSVLTAVNTLFIVL
FT                   FTVPIARFVTKRAQQPIMYVGFTLFALGFAVCAFANNLAVLLLATMVLSIGELLYVPTR
FT                   QTILAAIVDDDKRGAYMAFNGIIFQIGKMIGSVSLVFAPFIGKYGMGAFTIILGILSIV
FT                   FSAVALKSGWEKVLVK"
FT   regulatory      complement(26954..26959)
FT                   /gene="lmo2043"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      27050..27055
FT                   /gene="lmo2044"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        27062..28876
FT                   /transl_table=11
FT                   /gene="lmo2044"
FT                   /note="similar to transporter binding proteins"
FT                   /db_xref="GOA:Q8Y5L4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5L4"
FT                   /protein_id="CAD00122.1"
FT                   /translation="MDKDYFTMRAHLYNITTDLEVPFKLNDVANIWFCTTKNAKRKLQQ
FT                   YQAKKMLTYLPGLGRGNVSRIIFPKQLELEVLDVLEQSLAEDAFSNILFLLQLPIPKSW
FT                   FTSISTEIQQMFGLQVTENQQEVLRSIVRRKLTTLDPLQTSVSMEAFLITQISDSLVKY
FT                   DEKKKRIIPHIAHHWKVSDDFTEWTFYLRKSVLFHHGRTLDSEDVKYTLMRSMQAESVS
FT                   FWQLQDIQSIYCPNKFTLSIQLKKTDPFFIRYLCTANMAILPRDIIFDEYKWISTGPFR
FT                   VAERNDERLILEAFDGYFLERPILDRVEFWTVQTGNNLKTIPMQFTSVDYEENPAYVER
FT                   RKPGVGVNFICFNTHRNGTPQHPAFREAIYHLIDCQKASDQHFENYGTVASNYYPEKSL
FT                   PPKKHPEKITTLLKTANYQGEKVVFGTTQHPTAVKESKWIQEQAVKFGINLERKIISHQ
FT                   EASYSNVPAEETDFMMMGEIPASDDEMAYLDFLNNPYLLPQQLFNQVIIKELTEKLVAF
FT                   KKEKDASKRDALQTSIDSWLTENHYLIYLHHPEKSQSLHSMIKGIAENPYGYFDLSKVW
FT                   IETSPLKTLKPDYKQSHRGKAPHTIKQK"
FT   CDS_pept        complement(28806..29192)
FT                   /transl_table=11
FT                   /gene="lmo2045"
FT                   /db_xref="GOA:Q8Y5L3"
FT                   /db_xref="InterPro:IPR016945"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5L3"
FT                   /protein_id="CAD00123.1"
FT                   /translation="MFDWLTNSTAIIIILPVVVFILTMFFSSFKLKKSQRRIMLAADLS
FT                   TIFLIIAVHFFMIVLFNRSFLLYILLFLFILGIVIVVTAAKKEGEIQFRKILRGYWRLC
FT                   FFIFALLYVALYLYGIVYSLVLMF"
FT   CDS_pept        complement(29185..30078)
FT                   /transl_table=11
FT                   /gene="lmo2046"
FT                   /note="weakly similar to ketopantoate reductase involved in
FT                   thiamin biosynthesis"
FT                   /db_xref="GOA:Q8Y5L2"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5L2"
FT                   /protein_id="CAD00124.1"
FT                   /translation="MANQLKVGIIGAGAMGLLYAANFANISELTLFTRRKEQSDLLNQK
FT                   GLSLKDNSELKNIHIQATVITDAEKLSEQELLIIAVKQYSLKTILPLLRSIPERVPLLF
FT                   IQNGAAHLDSMPLLGNKRTILLGISEHGAGREDDTTVIWRGHGRTKYSIYQGELNEAVI
FT                   KILDSNPDFPVEKHASYLDIINEKLFINAVINPLTAVLQVQNGKLLENKEWHELLKTIV
FT                   KEIQTVLPVENALEKVEVICQVTATNFSSMALDRMNNRMTEIDGIVLPILEKGESLPTL
FT                   HALYHLIKGLEGESDV"
FT   regulatory      complement(29198..29203)
FT                   /gene="lmo2045"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(30087..30092)
FT                   /gene="lmo2046"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(30158..30186)
FT                   /gene="rpmF"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(30228..30401)
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /product="ribosomal protein L32"
FT                   /db_xref="GOA:P66207"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66207"
FT                   /protein_id="CAD00125.1"
FT                   /translation="MAVPFRRTSKAKKRKRRTHVKLQLPGMNECSNCGEYRLSHHVCPE
FT                   CGQYDGKDVANS"
FT   regulatory      complement(30411..30416)
FT                   /gene="rpmF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(30492..31028)
FT                   /transl_table=11
FT                   /gene="lmo2048"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5L1"
FT                   /protein_id="CAD00126.1"
FT                   /translation="MKWSISQLKKYRDSNFTINEKADLKKFFQENNIDVRDASPVQITG
FT                   ELIVHPEEVTANLTMRGEWTLPCARTLEDVIYPYEVHATETFVKSKEQVLDESWHVMEQ
FT                   DMVDLTPVVEELLLVEIPMQVFSEDALEMSNLPRGKEWEMKTEEGNLLEQIAKEPKVDP
FT                   RLAGLANFFDEKKED"
FT   regulatory      complement(31037..31042)
FT                   /gene="lmo2048"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      31144..31149
FT                   /gene="lmo2049"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        31158..32330
FT                   /transl_table=11
FT                   /gene="lmo2049"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5L0"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5L0"
FT                   /protein_id="CAD00127.1"
FT                   /translation="MKATGIVVEYNPFHNGHKLHLNKARELTQADVVIAVMSGSFVQRG
FT                   EPAIIPKWERAKMALSAGVDMVVELPVSFATQHATIFAEEAVRILDAIHIDTLFFGSEH
FT                   GVAEDFTFAAKKVVENEARFDEAIQLALVDKKTSYARAYTEAFKKLFGQNLLDITKPNN
FT                   ILGFHYALAVQKQNPSISLQTIPREHAGYHDEEASHDQIASATAIRKLILAGKLEEASH
FT                   YLPASSIDILRNYEGPFLSWTDYWSFLQYRLIQASTEELEGIRGVSEGIQNRMQQAATK
FT                   AQNFSDFIELTKTKRYSNARLQRTALQILLNAKSKASSPYIRILGMNKTGQKYLSLHKK
FT                   NISLPIVTTVSKAPPGLLEEELRATNIYTLVKKLENYQAGDFHIPPILTL"
FT   regulatory      32399..32404
FT                   /gene="lmo2050"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        32412..34652
FT                   /transl_table=11
FT                   /gene="lmo2050"
FT                   /note="similar to excinuclease ABC (subunit A)"
FT                   /db_xref="GOA:Q8Y5K9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5K9"
FT                   /protein_id="CAD00128.1"
FT                   /translation="MVQEYIRLRGARENNLQNISLDIPKRKITIFTGVSGSGKSSIVFE
FT                   TIATESQRQLNETYSAYLRNFLPKYTQPDADSIENLSTSVIIDQKRLGGNSRSTLGTIT
FT                   DINSILRLLFSRVGKPSIGTANLFSFNDPAGMCPDCHGVGQKVSVDLVKLLDPNKSLKE
FT                   GAILFPTFSVDSWYWNSYAYSGFFDVNKKIKDYTDEEYDMLLHGKDIKVFLETPMGSMN
FT                   ATYEGLIPKFNRLYIQKEGEMSASTKKRVDKFTHIAPCTTCEGTRLSAQALSCKINGAN
FT                   IADFTAMQLDELKDTIARIDDPIATPMVKSVTERLQHLIDIGLGYMTLDRQTASLSGGE
FT                   SQRVKMIRHLNSSLTDLLYIFDEPSIGLHPRDVHRLNELLVKLRDKGNTILVVEHDPDV
FT                   IKIADHVVDVGPHAGKHGGEIQFVGSYTDLLKSDTLTGQFLNRHLPINSKPRQPKGFLT
FT                   TEKSSRFNLKNIQANIPKEVLTVITGVAGSGKSTLIHSVFLKEYPDAIVIDQSAAHANI
FT                   RSNPATYTGIMDPIRKAFGKENDVSPSLFSYNSKGACENCKGLGFTTMDLAFMDSIRTP
FT                   CEVCHGKRFQDSVLQYKLNGKSISDVLELTVSEALDFFTDKKILKKIEAMEEVGIGYVT
FT                   LGQALSTLSGGECQRLKLANELHKKGSIYIMDEPTTGLHMSDIEHILTIIHTLVNKGNT
FT                   VIVIEHNVDIIRNADWIIDLGPEGGSAGGQIIFEGAPLDLLENQQSLTAKYL"
FT   regulatory      34661..34689
FT                   /gene="lmo2050"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(34661..34689)
FT                   /gene="lmo2051"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(34695..35735)
FT                   /transl_table=11
FT                   /gene="lmo2051"
FT                   /note="weakly similar to proteases"
FT                   /db_xref="GOA:Q8Y5K8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="PDB:3I18"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5K8"
FT                   /protein_id="CAD00129.1"
FT                   /translation="MRKEWKKITAIVLLIIIIAGFFIPVPYYISKPGGTEELAPLVTVD
FT                   NHPNKKDGSLSLVTIAMGKANIYTYMTAKFLPYHELEKDSEIKYENESDEEYNVRQMQM
FT                   MNESKNNAIQVAYKAAGQEVKVTYDGVYVLSVKDDVPAADVLHAGDLITEIDGNAFKSS
FT                   QEFIDYIHSKKVGDTVKINYKHGDKNEQADIKLTAIDKKGTPGIGITLVDDEKITADPT
FT                   VKIDSEKIGGPSAGLMFSLEIYSRFQKNDLTDGKKIAGTGTIDPDGTVGRIGGIDQKVV
FT                   AADKSGAKIFFAPNDPITEEMKKSDPSIESNYDTAVKTAKDIDTNMKIVPVKTFQDAVD
FT                   YLKKLQ"
FT   regulatory      complement(35746..35751)
FT                   /gene="lmo2051"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(35754..36236)
FT                   /transl_table=11
FT                   /gene="lmo2052"
FT                   /note="similar to phosphopantetheine adenylyltransferase"
FT                   /db_xref="GOA:Q8Y5K7"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5K7"
FT                   /protein_id="CAD00130.1"
FT                   /translation="MGDKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKP
FT                   LFTIEERMEMIRQVTAHLPNVQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIA
FT                   SMNRTLNADIETFFVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNKAVQAKFK"
FT   CDS_pept        complement(36239..36796)
FT                   /transl_table=11
FT                   /gene="lmo2053"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5K6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5K6"
FT                   /protein_id="CAD00131.1"
FT                   /translation="MRVIAGERKGHALKAVPGNNTRPTTDKVKESLFSIIGPFFDGDMV
FT                   LDLFAGSGGLGIEALSRGAERAVFIDQAALAIKTIRQNLEGCHFTERAEVYRNDAERAL
FT                   KLLHKNEWKFDLIFLDPPYKKQQLEKLIGTLEKLELVNENGRIICEHDKEAIMPDTIGK
FT                   FEKIKSVSYGITVLSIFEFQEA"
FT   regulatory      complement(36244..36249)
FT                   /gene="lmo2052"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(36806..36811)
FT                   /gene="lmo2053"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(36858..36886)
FT                   /gene="lmo2054"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(36893..37174)
FT                   /transl_table=11
FT                   /gene="lmo2054"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:P60415"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60415"
FT                   /protein_id="CAD00132.1"
FT                   /translation="MENDRQAIVVWMNHLKQVRSLKRFGNVHYVSRKLKYAVLYCDMAE
FT                   VEDISNKVSRFHYVKRVEMSFRPFLKTEYESKKEMMYEHKNEDVQISI"
FT   regulatory      complement(37182..37187)
FT                   /gene="lmo2054"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(37205..37654)
FT                   /transl_table=11
FT                   /gene="lmo2055"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5K5"
FT                   /protein_id="CAD00133.1"
FT                   /translation="MLATMENMALLDLSDELASMILNSEEAQNYKLAKEALLNDATSQK
FT                   NIRQFIRIKEQYEEVQRFGRYHPDYKEVTRKTRAYKREVDMDQNVAAFRRAEMDLQSLL
FT                   DEISLLLASAVSENIKVPTGNPFFETKSACSTGGCGSGGGCGCSA"
FT   regulatory      complement(37663..37668)
FT                   /gene="lmo2055"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(37702..38757)
FT                   /transl_table=11
FT                   /gene="lmo2056"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR029410"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5K4"
FT                   /protein_id="CAD00134.1"
FT                   /translation="MKFIMRVAVLLIICLFIGYNTDLFFSKSVEKNTAEDTATKSNFPD
FT                   NKKTTNENPKQVQDSSSLARFINKNVSELKKEFGDPVRVDKTAYGYDNYIYSQPGTSYM
FT                   QVGVAKNIVQTIYALGQDLNVMPYTIGMSTEKVFTDANLQSEISFNYKDSYYKFELSEE
FT                   DLNARPIVNIGSGVYAQLNFDKFKSKLISVRYLNKLSFVKMRPYELSYQGEIYEEKLSP
FT                   ADWNAIDDASSKQVLEITNVIRDRYGIEEVAWDESVARVAYGHSVDMKKNDYFDHTSPT
FT                   QGDLSKRLSKGDVKYTKAGENIAYNYVDSAAAVEGWLNSKGHRENLLDGSYTYMGAGTY
FT                   RKYYTQNFIIK"
FT   regulatory      complement(38765..38770)
FT                   /gene="lmo2056"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(38853..38893)
FT                   /gene="ctaB"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(38904..39809)
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /note="highly similar to heme A farnesyltransferase"
FT                   /db_xref="GOA:Q8Y5K3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5K3"
FT                   /protein_id="CAD00135.1"
FT                   /translation="MNQIEKTGELSASRFTVRDFTELVKIGIVNSNTITAFTGMWLAFQ
FT                   LNGISFIQNVDVIFFTIVGSALIVAASGAFNNVIDRDIDGIMERTKNRPTMTGKISGKR
FT                   ALMVALVLGVVGTIMLFMTTWQAGVLGVIGVFLYVVVYSLYAKRKLVSNTVIGSFSGAV
FT                   PPLIGWFAVEPTFSIVPIMLFLVMFCWQPPHFYAIAIKRKEEYAAAGIPMLPVVKGIER
FT                   TKKSMFFWVILLTILPFFMFDLGIVYVILATLLNIGWLALSIYGFKMEDSIKWAKWMFV
FT                   YSLNYMTILFVAMVVISIFL"
FT   regulatory      complement(39817..39822)
FT                   /gene="ctaB"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      40028..40033
FT                   /gene="ctaA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        40046..40963
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /note="similar to heme O oxygenase"
FT                   /db_xref="GOA:Q8Y5K2"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5K2"
FT                   /protein_id="CAD00136.1"
FT                   /translation="MKKFLKVWSVLTIICMTVVVFGGALVTKTGSADGCGNSWPLCNGQ
FT                   LVRLTDVTPEKLIEFMHRMTTGISSIFVIVLAICAWIYMKNRRETKPLAIIAVLFLIIQ
FT                   ALMGMAAVVWGQNPYIMALHFGISIICYASIVLLALMIFEVDRKFDARNLVMGTKLRVN
FT                   IYALTIYTYLAVYTGALVRHEKASMAVPVWPFENGHFIMPTSVQDYVQYFHRLAAFILI
FT                   VWLLYVTWLVFRDYRRYRVLTFSMVLSLVFIALQAVTGALSVYTGVNLYIALAHSLIIT
FT                   MLFALLCYLCLLASRSKSNRLRIK"
FT   regulatory      40972..40994
FT                   /gene="ctaA"
FT                   /regulatory_class="terminator"
FT   regulatory      41057..41062
FT                   /gene="lmo2059"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41071..41814
FT                   /transl_table=11
FT                   /gene="lmo2059"
FT                   /note="similar to potassium channel subunit"
FT                   /db_xref="GOA:Q8Y5K1"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="PDB:4H33"
FT                   /db_xref="PDB:4H37"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5K1"
FT                   /protein_id="CAD00137.1"
FT                   /translation="MDKTKRKMIYETFMLILILLSLALLPYRNNFTFILNWIIWVIFTL
FT                   DYLVRLYRADNKWHYVKTHPFQLIAIIPFYGGFRAARIVSFVHLLSITAMGRRYIVPIY
FT                   SFFRSNGLNRFLMIFVLLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVT
FT                   PIGRILASIMMLFGIAFIGMITSTITNFFRAKKPTNSSTQRANKITQLISETPDLTKEE
FT                   IAVVEQFLTLRKKELADENTKSDSE"
FT   regulatory      41799..41821
FT                   /gene="lmo2059"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(41801..41823)
FT                   /gene="lmo2060"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(41820..42461)
FT                   /transl_table=11
FT                   /gene="lmo2060"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y5K0"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5K0"
FT                   /protein_id="CAD00138.1"
FT                   /translation="MERKIMHLAVGKPKELNLSNNKRMMTGIEKKLVQSAYLTTTGFEN
FT                   DAPHNLKYHGGPDRTVCIYPYEHYAKWTEMFGEELQVTAFGENLITTNMLESSVQIGDK
FT                   FQIGETVIQITEARNPCSTIEKFNGIPNLYKAIHKTGLTGYLCRTITPGIIHATDEIKQ
FT                   IHQESHGVTVAFCHEKVLHKKGTKEDLERILAVEALSERYRDQVEKQIKK"
FT   regulatory      complement(42468..42473)
FT                   /gene="lmo2060"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(42480..43097)
FT                   /transl_table=11
FT                   /gene="lmo2061"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y5J9"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5J9"
FT                   /protein_id="CAD00139.1"
FT                   /translation="MKKIMSSIVVLLAVFIIPFQASAHVSVLPSESTVDSWETYTMKVP
FT                   SEKDAASKKIVLKVTKGVSFESYEPVPGWTTTIDKKNGTVTWQTEGSGIEKGQFQRFSF
FT                   IAKNPSEEGEVPWNAYQYYEDGSIVEWVGAEDSETPHATTKIVKESSKSATGSHGEVVA
FT                   GAENTAGDTSSSGDNTILLWTAVAISVIALITGILAILSRKK"
FT   regulatory      complement(43103..43108)
FT                   /gene="lmo2061"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(43109..44734)
FT                   /transl_table=11
FT                   /gene="lmo2062"
FT                   /note="similar to copper export proteins"
FT                   /db_xref="GOA:Q8Y5J8"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5J8"
FT                   /protein_id="CAD00140.1"
FT                   /translation="MKLLKRVSFFLIILYLLIVPVQHVSAHAYLENSNPADQSHIQTAP
FT                   EKVTLVFNEEIEADFPLIEVKDSSGKQVETGKTSVSKKNNHMVEASLPADLKADVYSVS
FT                   WRVVSADGHAVTGIISFKLGDTKATFQASEVPSSGADLQISSIQKAILYIGFSLFIGVL
FT                   VFGLGLYPRKEQISEKISGHLKKVTWIALALLGVALLIQLFVQTSITTGVSISESFGPS
FT                   KLAAFLTTKTGYIWISEFVVWLLLAIFTVMMFFKKKQWGWFALLTESALIGYLIFAKAQ
FT                   NGHAAASADKIVSITADMLHMIAASVWVGGILVLLFVLPRTGKARKVWIRFAIVAIIAV
FT                   ASILVSGLLMAVMNIGQMANLFTTNYGKILLFKIGLFILMALLGLGHYIYIKLKNQQLP
FT                   FKTILIELIIGTIILVVASVLTNVQTPPPSAPKAFDETIAAEGEKAKINLRVEPATVGQ
FT                   NQFIITFTSADGSAKTDFEQVTITTKSTKTDEKSTFQAKLANDTQYFAEGLYFNQTGKW
FT                   EITVHGLTKDFTDINQTFTTNITQ"
FT   regulatory      complement(44740..44745)
FT                   /gene="lmo2062"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      44860..44865
FT                   /gene="lmo2063"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        44874..45065
FT                   /transl_table=11
FT                   /gene="lmo2063"
FT                   /db_xref="GOA:Q8Y5J7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5J7"
FT                   /protein_id="CAD00141.1"
FT                   /translation="MLRYIELFFMFAFVTLITMWIQALLAKWQPTILRSFWLRTLTFII
FT                   IGYALMAPTLYIGSLLLK"
FT   regulatory      45112..45117
FT                   /gene="lmo2064"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        45127..45513
FT                   /transl_table=11
FT                   /gene="lmo2064"
FT                   /note="similar to large conductance mechanosensitive
FT                   channel protein"
FT                   /db_xref="GOA:Q8Y5J6"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5J6"
FT                   /protein_id="CAD00142.1"
FT                   /translation="MKKMLVEFRDFALKGNVLDLAVAVVIGAAFGKIVSSLVDNIIMPL
FT                   VGVLLGGLDFTDLSFKVGKSVIQYGAFIQSIVDFIIIAFAIFIFVKVLTSFIKKKEQTV
FT                   EETPVPPTEEYLKEIRDLLKEQQK"
FT   regulatory      45524..45543
FT                   /gene="lmo2064"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(45624..45643)
FT                   /gene="lmo2065"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(45652..46044)
FT                   /transl_table=11
FT                   /gene="lmo2065"
FT                   /db_xref="GOA:Q8Y5J5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5J5"
FT                   /protein_id="CAD00143.1"
FT                   /translation="MNWTRISSIIIVGFTAIGAIYGGLSMVFMPSGGLLSLSTGLLDGS
FT                   PFVDYLVPGIFLFVFVGLFHLAALIYLLKKLPRTKEVMFAAAAVLAVWMIVQLLIIGYV
FT                   FILQIIFLVVAAVEMFLAIQLKKQQR"
FT   regulatory      complement(46050..46055)
FT                   /gene="lmo2065"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(46089..46298)
FT                   /transl_table=11
FT                   /gene="lmo2066"
FT                   /db_xref="GOA:Q8Y5J4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5J4"
FT                   /protein_id="CAD00144.1"
FT                   /translation="MRENSIIGRIIAFCAICFAFFNPKTVTYWLGVRAESGPAWYLTTV
FT                   VACGIAVFVLIDLIKKIKRRKAAE"
FT   regulatory      complement(46309..46314)
FT                   /gene="lmo2066"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(46414..46440)
FT                   /gene="lmo2067"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(46449..47426)
FT                   /transl_table=11
FT                   /gene="lmo2067"
FT                   /note="similar to conjugated bile acid hydrolase"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5J3"
FT                   /protein_id="CAD00145.1"
FT                   /translation="MCTSITYTTKDHYFGRNFDYELSYKEVVVVTPKNYPFHFRKVEDI
FT                   EKHYALIGIAAVMENYPLYYDATNEKGLSMAGLNFSGNADYKDFAEGKDNVTPFEFIPW
FT                   ILGQCATVKEARRLLQRINLVNISFSENLPLSPLHWLMADQTESIVVECVKDGLHIYDN
FT                   PVGVLTNNPTFDYQLFNLNNYRVLSSETPENNFSKEIDLDAYSRGMGGIGLPGDLSSMS
FT                   RFVKATFTKLNSVSGDSESESISQFFHILGSVEQQKGLCDVGGGKYEHTIYSSCCNIDK
FT                   GIYYYRTYGNSQITGVDMHQEDLESKELAIYPLVNEQRLNIVNK"
FT   regulatory      complement(47435..47440)
FT                   /gene="lmo2067"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(47633..47656)
FT                   /gene="groEL"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(47684..49312)
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /product="class I heat-shock protein (chaperonin) GroEL"
FT                   /db_xref="GOA:Q9AGE6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AGE6"
FT                   /protein_id="CAD00146.1"
FT                   /translation="MAKDIKFSEDARRAMLRGVDQLANAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDPFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIQEGLK
FT                   NVTAGANPVGVRRGIEKAVATAIEELKAISKPIESKESIAQVAAISSGDEEVGKLIAEA
FT                   MERVGNDGVITIEESKGFATELDVVEGMQFDRGYTSPYMVTDSDKMEAVLEKPYILITD
FT                   KKINNIQEILPVLEQVVQQGRPMLIIAEDVEGEAQATLVLNKLRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGQVITEDLGLELKTATVDQLGTANKVVVTKDDTTIVEGAGDSTQI
FT                   SARVNQIRAQMEETTSEFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTALVSIYNKVAALEAEGDVETGINIVLRSLEEPVRQIAHNAGLE
FT                   GSVIVERLKHEAVGVGFNAANGEWVNMIDAGIVDPTKVTRSALQNASSVAALLLTTEAV
FT                   VADKPDENGPAAVPDMGMGGMGGMM"
FT   regulatory      complement(49323..49328)
FT                   /gene="groEL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(49348..49632)
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /product="class I heat-shock protein (chaperonin) GroES"
FT                   /db_xref="GOA:Q9AGE7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9AGE7"
FT                   /protein_id="CAD00147.1"
FT                   /translation="MLKPLGDRVVIEVLEAEEKTASGIVLPDSAKEKPQSGKIVAVGSG
FT                   RVLDNGTKEPLEVAEGDTVIFAKYSGTEVTYEGTDYLILRESDILAITK"
FT   regulatory      complement(49642..49647)
FT                   /gene="groES"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      49854..49859
FT                   /gene="lmo2070"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        49868..50554
FT                   /transl_table=11
FT                   /gene="lmo2070"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5J1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5J1"
FT                   /protein_id="CAD00148.1"
FT                   /translation="MAKRYITIVLVYLLLLFSASAGIPIIQHVLLSTTSLSIEDAASYG
FT                   MVIWSIFSNLLSLAIIIPMLYRKPKENKIELGEKTKPLLSIVWIVGGVIGLYAAQIVCS
FT                   IIITLISGDLSNSANTELLVDLTKAAPIFLIFISILGPILEELVFRKVVFGGLSNVMNI
FT                   HVAAVISSLFFGLLHGDISFLLTYFVIGLILCFLYTKTKRIVVSMGAHILMNTIVLLLS
FT                   LGIIGG"
FT   regulatory      50546..50550
FT                   /gene="lmo2071"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50556..50759
FT                   /transl_table=11
FT                   /gene="lmo2071"
FT                   /db_xref="GOA:Q8Y5J0"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5J0"
FT                   /protein_id="CAD00149.1"
FT                   /translation="MKNSLMKQSFLYFALGLVFVYFVVVRVADYGYDVLAYILIIMTLM
FT                   DFGIGIGLIITGFKRRKKTCRK"
FT   regulatory      50744..50789
FT                   /gene="lmo2071"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(50746..50780)
FT                   /gene="lmo2072"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(50786..51433)
FT                   /transl_table=11
FT                   /gene="lmo2072"
FT                   /note="similar to a putative DNA binding proteins"
FT                   /db_xref="GOA:P60384"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60384"
FT                   /protein_id="CAD00150.1"
FT                   /translation="MMEETTKIPQATAKRLPLYHRYLKYLDESGKERVSSAELSEAVKV
FT                   DSATIRRDFSYFGALGKKGYGYNVSYILDFFSKTLSQDKQTNVALIGVGNLGTALLHYN
FT                   FMKNNNIKIVAAFDVDPAKVGSVQQDIPIYHLNDMEEIVRENGVEVVILTVPADEAQVT
FT                   VDRLIEADVKGILNFTPARISVPKQVRVHHIDLTTELQTLIYFLENYPAKTE"
FT   regulatory      complement(51444..51449)
FT                   /gene="lmo2072"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      51729..51734
FT                   /gene="lmo2073"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        51744..53696
FT                   /transl_table=11
FT                   /gene="lmo2073"
FT                   /note="similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="GOA:Q8Y5I9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5I9"
FT                   /protein_id="CAD00151.1"
FT                   /translation="MILLQVQQISKFFGAEVILDNIKLEVKTGDRIALVGRNGAGKSTL
FT                   LKIIAGKMSYDGGTISKPKSVEIGYLAQNTGLESSKTIWDEMLSVFDSLRKMEADLRKM
FT                   ELRLGEPELYNDPEKYQALMTDYDTLQHTFKESGGYTYEAEIRSVLNGLRFYPEDYEVE
FT                   IASLSGGQKTRLALAKLLLAKQDILVLDEPTNHLDIETLAWLETYLQNYHGSLLIVSHD
FT                   RYFLDKVVNQVYEISRTKIDYYKGNYSSFVNQKQAKLEQMWKEFDKQQKQIAKLEDFVA
FT                   RNIVRASTTKRAQSRRKQLEKMDVLGRPQGDEKAAHFGFQFEKQTGKDVLMVDQLSIGY
FT                   AKDKRIASNLTFEMKRQDSLALVGPNGIGKSTLLKTLIRDIPALSGEFHFGAGVKIGYY
FT                   DQEQAKLTSNKTVLMELWDDYPELNEVNVRTTLGNFLFSDDDVLKNVQSLSGGEKARLA
FT                   LAKLTLLEANVLILDEPTNHLDIESKEVLEAALIDFEGTILFVSHDRYFINRIASKIVE
FT                   LAPEKATVFLGDYDYYQEKLAEEKELARLDAEDRRKKGEQVEATASVRKLNYQEEKEQQ
FT                   KLLRQRKRKLEEIEKSMEETDEKIAELELQLTNPEVFQDHEKALEITQELDAVKADGEK
FT                   LMEEWEQISEELESI"
FT   regulatory      53709..53714
FT                   /gene="lmo2074"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        53720..54679
FT                   /transl_table=11
FT                   /gene="lmo2074"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5I8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5I8"
FT                   /protein_id="CAD00152.1"
FT                   /translation="MKKILIISSSIIVGLLVIITICASFYLYSYALARDNSSMNDTATT
FT                   DETTDTAKLAKKNREANVAWMEKQNLIKWTETSADNLKLVANYLPADIPSNTTIILAHG
FT                   YRGKSGKVEMAGLARMYHEKFGYNVLMPDARAHGESEGDNIGFGWPERKDYVQWIDQVI
FT                   DKNGTDTQIALHGVSMGSSTVLMTSGEKLPKQVKSIIADCGYTSMDAELSYQLKAMFHL
FT                   PKFPIIPTASLINKFKEGFFFSEASAVDAVAKTDLPIFYIHGDADAFVPTYMVDELYDA
FT                   TNSYKEKWIVKGAEHGQAFTVDPKTYEEKVRQFLNKTM"
FT   regulatory      complement(55152..55191)
FT                   /gene="lmo2075"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(55223..56257)
FT                   /transl_table=11
FT                   /gene="lmo2075"
FT                   /note="similar to glycoprotein endopeptidase"
FT                   /db_xref="GOA:Q8Y5I7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5I7"
FT                   /protein_id="CAD00153.1"
FT                   /translation="MGGLMKKNTLILGIESSCDETAASVVKNGNEIISSVVASQIESHK
FT                   RFGGVVPEIASRHHVEQITLVIEEALKQANVTMDDLDGVAVTEGPGLVGALLIGVNAAK
FT                   TLAFMHNLPLVGVHHIAGHIYANRFETEFKFPLLSLVVSGGHTELVLMKADNEFEIIGE
FT                   TRDDAAGEAYDKVARTLGLAYPGGVQIDKLAKDGEDTFHFPRAMMDEGSFDFSFSGLKS
FT                   SFINTLHNLRQRGEEPNPNDMAASFQASVVDVLVSKTIRAAKQYDVKQLLLAGGVAANQ
FT                   GLRERLIQEVKLELPETELIIPPLALCGDNAAMIAAAGTVSFLQGKRSGFDMNANPGLL
FT                   LEDI"
FT   CDS_pept        complement(56242..56697)
FT                   /transl_table=11
FT                   /gene="lmo2076"
FT                   /note="similar to ribosomal protein alanine
FT                   acetyltransferase"
FT                   /db_xref="GOA:Q8Y5I6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5I6"
FT                   /protein_id="CAD00154.1"
FT                   /translation="MSLEEALLFREATVTDLKSIMNVENAAFTVPWTEAAFRNEFIINQ
FT                   YAYYLLAIYKEQVVGYAGVWLVLDEGHITNIAIHPDYQGNHYGEALLREMIRVAKERGV
FT                   VRMTLEVRVSNDVAQGLYKKLGFQDGAIRKNYYPDTKEDALVMWVDL"
FT   regulatory      complement(56269..56275)
FT                   /gene="lmo2075"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(56694..57386)
FT                   /transl_table=11
FT                   /gene="lmo2077"
FT                   /note="similar to glycoprotease"
FT                   /db_xref="GOA:Q8Y5I5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5I5"
FT                   /protein_id="CAD00155.1"
FT                   /translation="MILGMDTSSDTMTIALFNEGVVIGEYTTNLRKNHSVRLLPAIAVL
FT                   MEECGVKPTDLEKIAVAKGPGSYTGLRIGVTVAKTMAWDAGIPIVGISSLALLAENGLY
FT                   FPGKVVALMDARRGNVYAGVYQVTEGKMQSVIADGHIALTELLEQFAPSEELILFVGTL
FT                   TEQICVTVTEVLGERAVFAQADYTYSRASSLVKLAENLDGEPADNFVPDYLKLAEAESK
FT                   WLESRGSE"
FT   regulatory      complement(56706..56711)
FT                   /gene="lmo2076"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(57383..57844)
FT                   /transl_table=11
FT                   /gene="lmo2078"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5I4"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5I4"
FT                   /protein_id="CAD00156.1"
FT                   /translation="MEFELIMTSERETRLLAKQLGENLTAGDVILLEGDLGAGKTTFTK
FT                   GLGEGLLIPQMIKSPTFTIIREYKKGRLPLYHMDVYRLEDTSADELGLEEYFYGAGVSV
FT                   VEWAQFVREDLPEEYLEIKLFHIDENTRKIVVKPVGQRYEQLAMEVFGK"
FT   regulatory      complement(57397..57402)
FT                   /gene="lmo2077"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(57854..57859)
FT                   /gene="lmo2078"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(57915..57936)
FT                   /gene="lmo2079"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(57949..59094)
FT                   /transl_table=11
FT                   /gene="lmo2079"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5I3"
FT                   /protein_id="CAD00157.1"
FT                   /translation="MMKKGILLSILLALVLVISACGESAEEKAAKTPQGKFVQTMKNGM
FT                   NVPDQYTYTTSFAVNDINVSSTDPSAQTMGILKDIKLSVTTSTDKKANKSEAKFNVTST
FT                   NNLLPISMDLDFLVDSKTGNAYIPLKTIVEPDASLLSYLDQATGGMWSKINTDYPDLKN
FT                   KYLSTEELTSSLTDQPEAKTAVNTKEIEAASKDLNKKAIKLIDTYFTGLEKDRFKEADD
FT                   GTVSVTIKNADIANLMNQVAKLMDDEKVKADFKVIAESQGSDAVTDFDSTYAEMKSSLT
FT                   DAAKELKENKTYLISNKLTVKSGKENSLDTLTLQTKIEDKSDASAPESISFTVKTKAEE
FT                   FVPIEDFPTKDEVISSEELNKIITDITRKMYGDMDISGTNY"
FT   regulatory      complement(59098..59103)
FT                   /gene="lmo2079"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(59199..59221)
FT                   /gene="lmo2080"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(59224..59604)
FT                   /transl_table=11
FT                   /gene="lmo2080"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5I2"
FT                   /protein_id="CAD00158.1"
FT                   /translation="MTGFKKVILPVLLVVLFLAGCNQAEVPALVLDGTITDTSLLENNN
FT                   ELTVNGTLTWNGEKNDYASEVMITVSSNTAVTNATTGKAMKLADIKEEDTVRAVFPQGS
FT                   NITSPAPGKVSENATSLKVTPK"
FT   regulatory      complement(59613..59618)
FT                   /gene="lmo2080"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(59697..60053)
FT                   /transl_table=11
FT                   /gene="lmo2081"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y5I1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5I1"
FT                   /protein_id="CAD00159.1"
FT                   /translation="MLVNFLLVGFGAALGAMLRYGISVLVKSKWKTNFPSATFFINITG
FT                   SFLLGFLVSSALGPVWQLFLGTGFMGGYTTFSTFKVESMELKWKTNYRVLFSYLGFTYV
FT                   FGLIAAFLGMMLGV"
FT   CDS_pept        complement(60043..60432)
FT                   /transl_table=11
FT                   /gene="lmo2082"
FT                   /note="similar to unknown proetin"
FT                   /db_xref="GOA:Q8Y5I0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5I0"
FT                   /protein_id="CAD00160.1"
FT                   /translation="MYFLYVGVFGALGGMCRYAMNLWLGGGDFPSATLAVNLIGCFLLA
FT                   FLMRFLAEKSRVSLVLLNGIGTGFIGAFTTFSAFSVDTIQLVQSGAWLFAVSYVLASFI
FT                   GGLIMVKFGRMLSNKLLNRGEHRVG"
FT   regulatory      complement(60062..60067)
FT                   /gene="lmo2081"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(60440..60446)
FT                   /gene="lmo2082"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(60459..60487)
FT                   /gene="lmo2083"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(60538..61164)
FT                   /transl_table=11
FT                   /gene="lmo2083"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5H9"
FT                   /protein_id="CAD00161.1"
FT                   /translation="MTEKKIDFKKEEKKFYAPKRKPERIFVPEMNFLMVDGKGDPDGEE
FT                   YQKAVQSLYAIAYTIKMSKMGETRLNGYADFVVPPLEGFWWSEEKFDLKDRDAWLWTSI
FT                   LRQPDFVTEEVLEWAKEVAQKKKPDVDTSRVKLVRFEEGECVQMMHIGPFSEEVKTVAE
FT                   LHQFMETEGLHNDTGAVRKHHEIYLSDPRKADPEKMKTILRLPVS"
FT   CDS_pept        complement(61161..62054)
FT                   /transl_table=11
FT                   /gene="lmo2084"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5H8"
FT                   /protein_id="CAD00162.1"
FT                   /translation="MDVTQLKMLHNAKVISEIKKGFSVDRKYQVDETYLVRVFPIDLLQ
FT                   ERKQEFKIIQALDSQTPFVPKAYDFGFIEREGYMIISYLRGEDAESGMTHLSHSEQFKA
FT                   GFSAGEILREVHKIPLDIPKMNWLDFQTAKFKRKVEELKELEITASFLTDTEKFVYKNI
FT                   ARLKNRPICLQHGDFHPANIILNNKKFVGLIDFNRLEFGDPLFDLAKIGFFTTEVSIPF
FT                   ARGNILGYIDKEEVTDFWNLYALYTAMHITSAVSWAAKNESRNFKKLMDYAVKTAASHD
FT                   NFQKIVPNWMNEEEFK"
FT   regulatory      complement(61172..61177)
FT                   /gene="lmo2083"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(62063..62068)
FT                   /gene="lmo2084"
FT                   /regulatory_class="ribosome_binding_site"
FT   tRNA            62187..62273
FT                   /product="transfert RNA-Leu"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 59.49"
FT   regulatory      complement(62284..62308)
FT                   /gene="lmo2085"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(62323..64011)
FT                   /transl_table=11
FT                   /gene="lmo2085"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8Y5H7"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5H7"
FT                   /protein_id="CAD00163.1"
FT                   /translation="MQRKLIGSFFILMVLLIIGSTSEKVQASPTSSNGWQLKWAIKNND
FT                   FEDVDITDYGQNAGTTNVWMVNQAGVDAWGTTNPTGNIEVWQNGNGYNVPAFSGNNFIE
FT                   LNSDGIGPVYQDIRTIPGSNLTWKFSHRGRTGVDTADLLIGSPESQTEVSRVSNGETWG
FT                   SFEGNYTVPAGQTITRLTFNPISTANGSLTSGNFLDDVQLYINVNGAKIGDVVWYDFNG
FT                   DGIQQDSEEPAPGVKVDLLTKDGTFKESATTNNIGSYLFTDVLPGDYQVKFSLPNNDFI
FT                   FSKANQGNDKSLNSKPDKTGIASVNVPNLKSENFDIDAGITTNGKVEIQKLSGDKALSG
FT                   AVYAIKDNSQSEVAKITTNQNGTGTAEGLPPGNYTATEVTAPLGYQKNTTPKKFTITYG
FT                   DTNPVKLTFQNAEKTGSITIFKQDEANKKGLANAVFDVKSIDGTTLKKVTTNSKGYALA
FT                   ENLQPGTYVITEVTAPPGYEKSANEIRVTIPFNPQKTINITFSDNKIMVPLKPTPTKGS
FT                   TVVKVSGETTKITALPQTGDSSSSSTIFTGLLIVVASGLFVYRRY"
FT   regulatory      complement(64019..64024)
FT                   /gene="lmo2085"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(64075..64096)
FT                   /gene="lmo2086"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(64106..65377)
FT                   /transl_table=11
FT                   /gene="lmo2086"
FT                   /note="weakly similar to transcription regulators"
FT                   /db_xref="GOA:Q8Y5H6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5H6"
FT                   /protein_id="CAD00164.1"
FT                   /translation="MNLIGLRIKNIRKEKQLTLKDVAQGIISVPYLANIENGIKVASLE
FT                   TLIHIARRLEIPEEVLLMSEDEENRALLKELDEIFELLVCSNPKEIESRLKKIDENVEL
FT                   QHESPAVELSFYCLQVAFYYKTWKFSRAEEVEAKYLKNAEKRVENAFPLQLLSYYYYGQ
FT                   AVKHSHATCNYQLAVEYWEKCVALTDNKNFLTVFHVCICINYICQSIYEPALGHIQQAW
FT                   DLIKDEEQERFVSILYFYGYIYFQIGFIGEAKYRFKQAQKYFSKYPEAKKIYYFVVQLK
FT                   MAEIENIEGNETLFYEKITCLYKEIMAYKTTNISFNNNDYLVITELMVIFAEKGFVEEA
FT                   TSLMGLMNKVVERVQELNYFMEYTEILLLYQQDEQVSYEKKMIKLLKKIDASNDPVLIE
FT                   RVKKHASKHFAKSTKYKMAYDILS"
FT   regulatory      complement(65388..65394)
FT                   /gene="lmo2086"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(66012..67343)
FT                   /transl_table=11
FT                   /gene="lmo2087"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5H5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5H5"
FT                   /protein_id="CAD00165.1"
FT                   /translation="MAKNMEILETDSVKKIYFRYLIPSLVGMLLMSLNIVIDGIFVGHK
FT                   LGGVALAGINIAVPVFTIFTAISIWIGIGAATQFSFAIGEKNVAKAQTIFTNAILAVVS
FT                   ITVIIGIIAFIFKVPLAYFLGANDDTIGYVLEYMNILLVFGFALTLENILSIFVRNDGD
FT                   PNLSMIALIVTAISNVILNYLFLFVFEWGVTGSALATMIAIIIGVLILTTHFFKKSSRL
FT                   KFVKVDWNKAFFKKTLAIGLPSFLAEVGVSVFTLGYNISIAAIAGTAGVAAFSVLNYTH
FT                   SVILMLFLGMGSAIQPLISYYRGAKARQKELETLKIAIVVAFSTGVGFLLVGFFGSNLL
FT                   VSMFGNFSVEIRELASNGIKLFYTAYLFMGFNFVMMTYFQTSDKVKMATWITISREIIF
FT                   MVIFLLVLPPIIGIPGVWLAIPISEMIVAASIVFYMKKKHILFK"
FT   regulatory      complement(67350..67355)
FT                   /gene="lmo2087"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(67353..67943)
FT                   /transl_table=11
FT                   /gene="lmo2088"
FT                   /note="similar to transcription regulators"
FT                   /db_xref="GOA:Q8Y5H4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:5ZTC"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5H4"
FT                   /protein_id="CAD00166.1"
FT                   /translation="MRKEEIKQAALTLFANNGFEGTSLADIAGVVGLKKQSIYSHFKDK
FT                   DDLFLSIMKDAKSTEIDYYRAKLRDSDLSRPDLVLSSLLFGVKELYDTDEAYQFWLRYG
FT                   FYPPKHLYEVVQADITENVLQMEHEFTDLFSNWMEQKLIPMQDVETMKEAYMGILDAVI
FT                   VDIVYVNDPERTEKKITALWQIFWRGITLKALN"
FT   regulatory      complement(67953..67958)
FT                   /gene="lmo2088"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(68023..68044)
FT                   /gene="lmo2089"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(68054..69097)
FT                   /transl_table=11
FT                   /gene="lmo2089"
FT                   /note="similar to lipases"
FT                   /db_xref="GOA:Q8Y5H3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5H3"
FT                   /protein_id="CAD00167.1"
FT                   /translation="MKNTIKWIAIGFAGIILLPLLIVFFIYKKAVGKKDYNPEVLENLD
FT                   KASQEFVKNTSPLSDVDSRYKYMRLATKALPSAKDIEIGDVENKKIDGPAGKIPIRIYT
FT                   PQEDGPFEIIVYYHGGGFVLGGLQTHDAIARKLVQTTGARVVTVDYRLAPENPFPAAVE
FT                   DAYAALLWVQNHRTSLRAKSSDIIVAGDSVGGNLATVVTQIAKSKGKPNITAQILLYPA
FT                   TDIFSRDASVLYPSMDEFAEGYVLTKESLDKFFKLYIANASDRKYDPLVAPIRSKDLVG
FT                   LPKTFIATAEFDPLRDQGEAYAKKLKDAGVEVFAKRFEKVPHGFMTTNSEATDETYELI
FT                   SEFLEEK"
FT   regulatory      complement(69107..69112)
FT                   /gene="lmo2089"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      69298..69303
FT                   /gene="argG"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69312..70526
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /note="similar to argininosuccinate synthase"
FT                   /db_xref="GOA:Q8Y5H2"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5H2"
FT                   /protein_id="CAD00168.1"
FT                   /translation="MAKEKIVLAYSGGLDTSVAIQWLVESGYEVIACCLDVGEGKNLDF
FT                   IKEKAITVGASESYTIDAKEEFAEDFALIALQAHAYYEGKYPLISALSRPLIAKKLVEV
FT                   ARQEGASAIAHGCTGKGNDQVRFEVAIHALAPDLKVVSPVRDWKWSREEEINYAKEHDI
FT                   PVPIDLDNPFSIDQNLWGRSNECGVLENPWTTPPEAAYDLTVSLEDAPDTADIVEITFD
FT                   AGIPISLNGENMSLANLILTLNEIAGKHGVGRIDHIENRLVGIKSREVYECPAAVTLIT
FT                   AHKELEDLTFVREVAHFKPIIEQKISETIYNGLWFSPLTEALVAFLKSTQKFVNGTIRV
FT                   KLFKGHAIVEGRKSPNSLYDENLATYTSSDTFDQDAAVGFIKLWGLPTKVNAEVNSKVT
FT                   ITTEV"
FT   regulatory      70516..70521
FT                   /gene="argH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        70530..71900
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /note="similar to argininosuccinate lyase"
FT                   /db_xref="GOA:Q8Y5H1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5H1"
FT                   /protein_id="CAD00169.1"
FT                   /translation="MEKLWGGRFQGKSEAWIDDFGASISFDQKMAKEDLAGSLAHVAML
FT                   GKCGIIPASEAAEITAGLKILQEKLAFGELEFSTVNEDIHLNIEKLLHEEIGSVAGKLH
FT                   TARSRNDQVATDMHLYLKQAVAEIIQSLKHLRVVLVQKAELHVETIMPGYTHLQHAQPL
FT                   SFAHHLLAYFGMFTRDLERLEESVKRIDISPLGSAALAGTTFPIDRAYSAELLGFSAVY
FT                   ENSLDGVSDRDFIIEFLSNSSILMMHLSRFCEELILWTSHEFQFVELTDAFSTGSSIMP
FT                   QKKNPDMAELIRGKTGRVYGNLFGMLTVLKGLPLAYNKDLQEDKEGMFDTLETVQTSLD
FT                   IFAGMIETMKVNTEIMEESTQKDFSNATELADYLAKKGVPFREAHEIVGKLVLECTQNG
FT                   IYLQDVALSHYQEINPLIEEDIYVVLSSKTAVQKRNSYGGTGFDQIKVALENAKKTL"
FT   regulatory      71907..71930
FT                   /gene="argH"
FT                   /regulatory_class="terminator"
FT   regulatory      72055..72060
FT                   /gene="betL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72068..73591
FT                   /transl_table=11
FT                   /gene="betL"
FT                   /product="glycine betaine transporter BetL"
FT                   /db_xref="GOA:Q7AP57"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP57"
FT                   /protein_id="CAD00170.1"
FT                   /translation="MKKLTNVFWGSGFLVLLAVLFGAFLPEQFETFTNHIQKFLTSNFG
FT                   WYYLIVVAIIIIFCLFLVLSPIGSIRLGKPGEEPGYSNKSWFAMLFSAGMGIGLVFWGA
FT                   AEPLSHYAVQAPGGEVGTQAAMKDALRYSFFHWGISAWSIYAIVALALAYFKFRKNAPG
FT                   LISATLYPILGKHAKGPIGQLIDIIAVFATVIGVATTLGLGAQQINGGLTYLFGVPNNF
FT                   TVQFTIIVIVTILFMLSAMSGLDKGIQLLSNVNIYVAGVLLVLTLILGPTLFIMNNFTN
FT                   SFGDYLQNIIQMSFQTAPDAPDARKWIDSWTIFYWAWWLSWSPFVGIFIARISRGRTIR
FT                   QFLLGVIVLPALVSVFWFAVFGGSAIFVEQHGNSGLSSLATEQVLFGVFNEFPGGMMLS
FT                   IVAMILIAVFFITSADSATFVLGMQTTGGSLNPPNSVKVTWGLLQAGIASVLLYAGGLT
FT                   ALQNASIIAAFPFSIVIILMIVSLFVSLTREQEKLGLYVRPKKSQRSQL"
FT   regulatory      73598..73629
FT                   /gene="betL"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(73598..73629)
FT                   /gene="lmo2093"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(73635..73832)
FT                   /transl_table=11
FT                   /gene="lmo2093"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5H0"
FT                   /protein_id="CAD00171.1"
FT                   /translation="MEKFLFNATLFASALLLMVGIFKSSIPITAISLVLAVVSQHFFRK
FT                   KYPKQTRSYREIVAAKQKKG"
FT   CDS_pept        complement(73836..74486)
FT                   /transl_table=11
FT                   /gene="lmo2094"
FT                   /note="similar to L-fuculose-phosphate aldolase"
FT                   /db_xref="GOA:Q8Y5G9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5G9"
FT                   /protein_id="CAD00172.1"
FT                   /translation="MLYQKEREDLAKIVKTMFDRFETNAAGGNVSVRMNSEHIIMTPTL
FT                   MSQAKLCDLSPYEILVVDNNNEVVEGDGRVTREINLHRACYVENPNIGCVLHAHPKESM
FT                   LFATLGMELPNLTEATQKIGQIPTLAFAPATSSELAEIVRKHVIELGDKAVPSASLLNK
FT                   HGIVVLDTSLHKAYDMLERIEYNAYIAEKALVFDALGIKKLAHDRELNYNLEE"
FT   regulatory      complement(73841..73846)
FT                   /gene="lmo2093"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(74488..75420)
FT                   /transl_table=11
FT                   /gene="lmo2095"
FT                   /note="similar to 1-phosphofructokinase"
FT                   /db_xref="GOA:Q8Y5G8"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5G8"
FT                   /protein_id="CAD00173.1"
FT                   /translation="MIYTITLNPAIDRLLFIQGELEKRKTNRVKKTEFDCGGKGLHVSG
FT                   VLSKFGIKNEALGIAGSDNLDKLYAILKEKHINHDFLVEAGTSTRECFVVLSDDTNGST
FT                   MIPEAGFTVSQTNKVNLLKQIAKKVKKEDMVVIAGSPPPHYTLSDFKELLRTVKATGAF
FT                   LGCDNSGEYLNLAVEMGVDFIKPNEDEVIAILDEKTNSLEENVRKLAEKIPYLVVSLGA
FT                   KGSICAHNGKLYQVIPPKVQERNDTGAGDVFVGAFIAGLAMNMPITETLKVATGCSASK
FT                   VMQQDSSSFDLEAAGKLKNQVSIIQLEER"
FT   regulatory      complement(74496..74501)
FT                   /gene="lmo2094"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(75427..75432)
FT                   /gene="lmo2095"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(75438..76787)
FT                   /transl_table=11
FT                   /gene="lmo2096"
FT                   /note="similar to PTS system galactitol-specific enzyme IIC
FT                   component"
FT                   /db_xref="GOA:Q8Y5G7"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5G7"
FT                   /protein_id="CAD00174.1"
FT                   /translation="MESLQSVIQFILNLGAAVFVPALMIIIGLIVRMKVRDAVSAGIIL
FT                   GVAFLGMNIVIGFMIEALTPAAQGLAERTGINLSILDGGWTSMATLAWAWPFAFLMFPL
FT                   QLGINAIMLVINKTKTLNVDLWNVWGKILTAVLIIGVTQNVYLAFIVAGIQIVTELILC
FT                   DANQRQIQELNGIPGVTVSHGMMIFCIFLMPLDWLLKKIPALRKDMDANALKDKIGIFA
FT                   ENHVMGFIIGGLLGVAAGYDVAKTLMLAMQAAAALTLFPMVAKLFMQALSPLSDGISEF
FT                   MKRKFKNRELFIGLDWPILAGCSEVWVAIVLMVPVTLIFALILPGNGVLPFAGILNISL
FT                   CAPALIVTGGNLIRMIILGTITTPIFLYVSTFFAGTITDLAHSTGAISLKAGQQITWST
FT                   LEYPVFRYIFAEASQFTILGFIFVAIWVVLLVFYVKMMKKRTIELEKASS"
FT   regulatory      complement(76797..76802)
FT                   /gene="lmo2096"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(76815..77090)
FT                   /transl_table=11
FT                   /gene="lmo2097"
FT                   /note="similar to PTS system galactitol-specific enzyme IIB
FT                   component"
FT                   /db_xref="GOA:Q8Y5G6"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5G6"
FT                   /protein_id="CAD00175.1"
FT                   /translation="MKKVIVACGSGVATSQTVASKVERILKEKGVRATVEAVDIKSLEQ
FT                   HIKTSDVYVAITKANKEFDIPTLNGIAFLTGMGMDEETEKLLNALK"
FT   CDS_pept        complement(77096..77563)
FT                   /transl_table=11
FT                   /gene="lmo2098"
FT                   /note="similar to PTS system galactitol-specific enzyme IIA
FT                   component"
FT                   /db_xref="GOA:Q8Y5G5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5G5"
FT                   /protein_id="CAD00176.1"
FT                   /translation="MDYHDLFQKELTLINSRYESQAELFEYTSKILEKEQYVEPTFREA
FT                   VTSREVVFPTGLEMNGIKIAIPHTDTIYVKRPFVLVNKLSTPIPFVQMGTVDKWIDVEV
FT                   IFMLGIKNPQDQVPLLSSIMEKFMEADFVEQIKEINDSNTLCDFLKKQFGE"
FT   regulatory      complement(77100..77105)
FT                   /gene="lmo2097"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(77571..79577)
FT                   /transl_table=11
FT                   /gene="lmo2099"
FT                   /note="similar to transcription antiterminator"
FT                   /db_xref="GOA:Q8Y5G4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5G4"
FT                   /protein_id="CAD00177.1"
FT                   /translation="MEQNCKELITYLLLNRQVNLRNVSKNFKVSKEAIGAQITQINHLL
FT                   KSEPILIDHDMIFVTDVCREACYRLLTAEEQQLFSFYEVNIRRKLIMIKLLLHNHYMSL
FT                   GALADYVYVSKNTMLTDVKSIKESLHEFEIQLDYSRKDGYAVSGSEFLIRNLLAELIRE
FT                   VVQTPYGKFVLDEKKLITVSEVFLLKKRLEKVESKLQITFTDEQMEELPYILHGIIKRS
FT                   KVTNKKWTFKIEMYDIKNTREFPIMKEMFWGYDFLSENDLLYLSLQVLASNLVESALHF
FT                   SDSEEIAYAVDEFIRLLEMYFATEIMKKNEFKEKVILHVRPAIYRTILGFQINNPLKKQ
FT                   FIKEYTPTFNIVEKASKPFEKLVGHKWSEEEIVYLSMIVLGWMYQIEETEQPIFRAVVL
FT                   CKSGTSISKLLLENLKMMFPNIDFQGAYAVRQLNTVARDIDFIFTTVPVQSDATIFVIP
FT                   SILSKDSRQILREQVDKAIEMDSHKKTKELLAMLKDEIPEENIRLVQAKVESFFNKKEQ
FT                   PVEKKEPEQMRITEEQVHFLEMPLEWEQLVSAAFAPMLERGTVDASYIHTCEEIFYQNY
FT                   EQMMIGPNIYLPHAKPANGVIEQDIQLMIMKANTKTPEDEAVKIMIALAPSEQNKHIPL
FT                   LLKLNEIFLKPEKLVGILASTNKKKIVEILERG"
FT   regulatory      complement(77574..77579)
FT                   /gene="lmo2098"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(79587..79592)
FT                   /gene="lmo2099"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(79742..79773)
FT                   /gene="lmo2100"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(79758..81203)
FT                   /transl_table=11
FT                   /gene="lmo2100"
FT                   /note="similar to transcriptional regulator (GntR family)
FT                   and to aminotransferase (MocR-like)"
FT                   /db_xref="GOA:Q8Y5G3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5G3"
FT                   /protein_id="CAD00178.1"
FT                   /translation="MWRLTGNSSLPIYLQIVDLIETKIMNGELLPEEKLPPERQLAEMF
FT                   GVNRSTVVRALDELTARAVIIRKQGSGTTVNAEKWGLFAGQSTNWRHYLTQGGFTPAVP
FT                   YIRQAGVMERANSDNVIDAASGELPLEMTPKMETPSLSWQSFIAEEQQEDEAGYKPLRE
FT                   TIQKQMKEAYGLQTRSEQIFITSGAQQALFLITQCLLKPGDAVAIESPSYFYSLSLFQS
FT                   AGLRIFALPMDEDGVVISELRDLYHKHRVKMVFVNPTFQNPTGLVMSLKRRKELVKICA
FT                   HLQIPIVEDDPFSELGALDNQIPAPLKRLDTDNVLYIGSLSKIMGSTTRIGWLIGPTAV
FT                   IERLALARQEMDFGLSIFPQVLANSVLNTAGYKAHLLQLHHVLEQRRDDLIEAFEAILP
FT                   SEVTFIKPKGGFHLWVKLPVEFRSVRDFDIFLANDLLVMPGFLFGVKEAVIRVTYARLE
FT                   KKEARRVAEIIKQILVSKKCEEA"
FT   regulatory      complement(81213..81218)
FT                   /gene="lmo2100"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      81315..81320
FT                   /gene="lmo2101"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        81329..82216
FT                   /transl_table=11
FT                   /gene="lmo2101"
FT                   /note="similar to a protein required for pyridoxine
FT                   synthesis"
FT                   /db_xref="GOA:Q8Y5G2"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5G2"
FT                   /protein_id="CAD00179.1"
FT                   /translation="MEKKVGTDRVKRGMAQMQKGGVIMDVVNAEQAKIAEEAGAVAVMA
FT                   LERVPSDIRAAGGVARMADPRIVEEVMKAVSIPVMAKARIGHITEARVLEAMGVDYIDE
FT                   SEVLTPADDEFHLLKSDFTVPFVCGCRDIGEALRRIGEGAAMLRTKGEPGTGNIVEAVR
FT                   HMRQVNGQIRQIAGMTDDELMVAAKNFGAPYELIKEIKTLGKLPVVNFAAGGVATPADA
FT                   ALMMELGADGVFVGSGIFKSDNPAKFASAIVQATTYYTDYELIGKLSKELGSPMKGIEM
FT                   SRLNPEDRMQDRSF"
FT   regulatory      82205..82210
FT                   /gene="lmo2102"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        82218..82784
FT                   /transl_table=11
FT                   /gene="lmo2102"
FT                   /db_xref="GOA:Q8Y5G1"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5G1"
FT                   /protein_id="CAD00180.1"
FT                   /translation="MKKIGVLAIQGAVDEHIQMIESAGALAFKVKHSNDLAGLDGLVLP
FT                   GGESTTMRKIMKRYDLMEPVKAFASKGKAIFGTCAGLVLLSKEIEGGEESLGLIEATAI
FT                   RNGFGRQKESFEAELNVEAFGEPAFEAIFIRAPYLIEPSNEVAVLATVENRIVAAKQAN
FT                   ILVTAFHPELTNDNRWMNYFLEKMV"
FT   regulatory      complement(82790..82813)
FT                   /gene="pta"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(82823..83800)
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /note="similar to phosphotransacetylase"
FT                   /db_xref="GOA:Q8Y5G0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5G0"
FT                   /protein_id="CAD00181.1"
FT                   /translation="MSDLFTTIKGQVTGKNVRIVLPEGTDERIVGAAARLQKENIVKPI
FT                   LLGNKAEIEAKAKEIGVSVEGIAIHEPATDPLFDELVAAFVERRKGKATEEAARKMLVD
FT                   PNYFGTMLVYTGKAEGLVSGAAHSTGDTVRPALQIIKTKPGVSKVAGAMIMVRGEERYL
FT                   FSDVAINIAPVAADLAENAIVSAETAEIFGIDPRVAMLSFSTKGSAKSDETEKVVEATA
FT                   LAKEKAPELTLDGEFQFDAAFVPTVAEKKAPGSVIKGDANVFIFPSLEAGNIGYKIAQR
FT                   LGNFEAVGPILQGLNAPVNDLSRGCNTDDVYNLTLITAAQAVNK"
FT   regulatory      complement(83811..83816)
FT                   /gene="pta"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      84103..84108
FT                   /gene="lmo2104"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        84120..84347
FT                   /transl_table=11
FT                   /gene="lmo2104"
FT                   /db_xref="GOA:Q929R6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q929R6"
FT                   /protein_id="CAD00182.1"
FT                   /translation="MQLNETAVGEKVRISELKIENAMLKRRLLALGCDEGCDICIKQKG
FT                   LFGGPCTFETKGQYISIRQCDACAIMVERR"
FT   regulatory      84330..84336
FT                   /gene="lmo2105"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        84344..86338
FT                   /transl_table=11
FT                   /gene="lmo2105"
FT                   /note="similar to ferrous iron transport protein B"
FT                   /db_xref="GOA:Q8Y5F9"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5F9"
FT                   /protein_id="CAD00183.1"
FT                   /translation="MSQNTYCLLGNPNTGKTSLFNALTGSYEYVGNWSGVTVEKKVGTL
FT                   RSKTGKLIDLPGIYDLNPISRDETVVTRFLLEEKFDCMLNIVDSSQIERNLNLTIQLLE
FT                   FGAPVVMGLNMIDVAAGRGIHLNIQNLAKKLRIPILPVVARSGKGTDDILTTLSEKHVA
FT                   PAIPLVLPYGEPAEKAIAEIQALTKDIIPTKQSRWLAVQFLSKNEVTEEFLTTSPMFEQ
FT                   LKDIRSDLEIALAGKLENHFHQVRVNYIHDICLTSVEYTRNSDIPLSDKLDKIFTHKFF
FT                   GIPIFLGIMWLIFQITFTWVGAPLSDLLDGFIGGSLTDWVTSFLTTIGASGFITDLVAD
FT                   GIIAGVGGVLVFVPQILVIFFFISVLEDSGYMARIAVVMDRVMEIFGLNGKAFIPMIIG
FT                   FGCNVPGIMAARSIEESKERTLTILVSPFMSCSARLPVYALFVGVFFEKYQALVVLSLY
FT                   VIGILMALIVTKILSKTLLKKDNSVFVVELPPYRLPSLKTLWRSTWEKGKGFLRKAGTF
FT                   IFAGSVIIWLLNYAGPSGLDVPMGESFLAIIGGMLAPLLVPLGFGTWQAGATLIPGFLA
FT                   KEVVVSTMAIIYAVGESSMGSIVSTFYTPLSAYCFMLFILLYIPCLATVAAIRKETSSW
FT                   KWTAFAVAYPLITAYVLVFLVYQIGSLFV"
FT   regulatory      complement(86535..86552)
FT                   /gene="lmo2106"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(86557..87411)
FT                   /transl_table=11
FT                   /gene="lmo2106"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5F8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5F8"
FT                   /protein_id="CAD00184.1"
FT                   /translation="MSLKMKWIIAISIIIVLLVVGWFLGTRLTVKKYEVSSTKIEKEIK
FT                   LVQLSDLHFSEFGDKNEKLLHKVENLNPDVIAITGDLFDRQGDSVPKELIKKLTKIAPV
FT                   YFSPGNHEYDVKNAYEDDYKPFLEKMGVVNLEDKTATIDVGGQKFQMSGLRSSANLDYD
FT                   YSYYKKGLAEIQTQQDSQYYQVLLSHMPDYFKLYVENDFDLTLSGHTHGGIVRIPYTNI
FT                   GAIAPGPQRTILPEYVYGEHSKNGKTMIISAGLGAGSLHQKAFPRLGNPYEIVAVTIKP
FT                   ELK"
FT   regulatory      complement(87419..87424)
FT                   /gene="lmo2106"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      87649..87654
FT                   /gene="lmo2107"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        87663..88424
FT                   /transl_table=11
FT                   /gene="lmo2107"
FT                   /note="similar to transcriptional regulator (DeoR family)"
FT                   /db_xref="GOA:Q8Y5F7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5F7"
FT                   /protein_id="CAD00185.1"
FT                   /translation="MNQKERIVEELKLLENMKTISQEELMQIFSISKDTARRDILKLVE
FT                   SGLAERYPGGVSLPVLKPQIESYTSRLVKQSEQKQKIAYVAGKVIKDHMTIYLDVSTTV
FT                   HFLASGLEQNDLVVVTNSMDNAIAASQKEDNKVYLLGGFFNFQSRVLSGEPVLGQLQQF
FT                   NFDVAFIGGAGLTEEGVFYSELTDVYMKQEIIRNSEKVYLLVDSTKVNKKTAFKIDFSG
FT                   IDAVITDEPLPKDLMQHLISKEVEVISLKGL"
FT   regulatory      88415..88420
FT                   /gene="lmo2108"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        88430..89563
FT                   /transl_table=11
FT                   /gene="lmo2108"
FT                   /note="similar to N-acetylglucosamine-6-phosphate
FT                   deacetylase"
FT                   /db_xref="GOA:Q8Y5F6"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5F6"
FT                   /protein_id="CAD00186.1"
FT                   /translation="MAVIKNVKIYKENELIDAVVITEGNLIKEVCSTTPEKYSDEPTFD
FT                   GNGRLLIPGMIDVHIHGAKNYDMMDGSTESIQAVSMACAETGCTSFLVTSVSSSLEDLI
FT                   QMIRQTKKVIGKEKGAKIAGIHLEGPYLNIEKKGMQNPAHLRHPDLKEMKKIFDEADGL
FT                   IKMVTIAPELPGGIELIDFLKKRGVVVAIAHSNATYEEAQDAFEKGASHITHCFNAMPA
FT                   IHHRAPGLVAAALENDSISVQAIVDGVHLHPGIVRLIHKIKGPDKMVLTTDALQAMGVG
FT                   DGEYIFGGHQVTVTEGVARLQDGTLASSTVTMNKSLRLSNEFGINLQDTIQMATSTPAD
FT                   ILGMKNLGRIEKGYSADLVLLDKKFEVLSTWINGEKY"
FT   regulatory      89587..89592
FT                   /gene="lmo2109"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        89605..90402
FT                   /transl_table=11
FT                   /gene="lmo2109"
FT                   /note="similar to hydrolase"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5F5"
FT                   /protein_id="CAD00187.1"
FT                   /translation="MPLFKHEGIDFNYEIQGEGIPFLFLHGLGDNLKFAFETFNNDEKI
FT                   QLISLDQRGHGKSGHDSRKLSYERLASDALALMDYLGIQRFYIGGLSMGAGVAVNLAVH
FT                   AENKVMGLILLRSSATDEPMKKEVIEWFSTVSMYLPKKNGSQLFEQDPIFPSIKDTYPK
FT                   AIDTFKRYFEDDASVNYYKKFIDIPRDRPIKCKSELTNLTIPTLILANNYDVIHPIEYS
FT                   LFYARNMKKASYYELTPKTVDAEKHKIEIDTYINTFILSNSKK"
FT   CDS_pept        complement(90489..91445)
FT                   /transl_table=11
FT                   /gene="lmo2110"
FT                   /note="similar to mannnose-6 phospate isomerase"
FT                   /db_xref="GOA:Q8Y5F4"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5F4"
FT                   /protein_id="CAD00188.1"
FT                   /translation="MTEALFLNPVFQDRIWGGTKLHDYFGYDIPSNTTGEDWAISAHPN
FT                   GPSVIKNGEYKGKTLAELWQENPALFGNPKEAVFPLLTKILDANTDLSVQVHPNDEYAK
FT                   VHENGELGKTECWYIIDCAPGAELIYGHKAASREEFATWAKNGEWDKLLRKVAIKPGEF
FT                   YYVPSGTIHALGTGTLVLETQQSSDTTYRVYDYDRKDAEGNLRELHLDKAIDVTTAPHV
FT                   DAKLDIHTETRGGLTETTFVSNDFFSVYKWDVDGKAEFVAKAPYTLVSILDGEAVLTID
FT                   GDEQAIKKGDHFVLPNEVKSWEITGQITAIVSTPPVK"
FT   regulatory      complement(91456..91461)
FT                   /gene="lmo2110"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(91525..92256)
FT                   /transl_table=11
FT                   /gene="lmo2111"
FT                   /note="similar to FMN-containing NADPH-linked nitro/flavin
FT                   reductase"
FT                   /db_xref="GOA:Q8Y5F3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5F3"
FT                   /protein_id="CAD00189.1"
FT                   /translation="MNDVLTLLRNHRSFRKYKKGVEIPEEKLDAIIRAAQAAPSWINGQ
FT                   HYSIIAIKDQERKNKMAELCGNQPYIAECSVFLCFVADFHRVKVASDMHGKSFQIAGEE
FT                   DLLMVAATDIGLCMQNALTAAESLDYGTICIGGLRRNITATAGFLNLPEFVMPVVGLCI
FT                   GVPDVEAPVKPRLPKEAVYFEETYQTDVMPLLEAYDQEIIPFSEREGFVSYTERLAKFY
FT                   DRPYYPNLTEQIKERGFLGGK"
FT   regulatory      complement(92264..92269)
FT                   /gene="lmo2111"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      92364..92369
FT                   /gene="lmo2112"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        92379..92609
FT                   /transl_table=11
FT                   /gene="lmo2112"
FT                   /db_xref="GOA:Q8Y5F2"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5F2"
FT                   /protein_id="CAD00190.1"
FT                   /translation="MRQQQIDFKWLEENFLTANEAATYLGISKQALLSLAKRDVLPFTK
FT                   KGNMVLFHRMDIELRLEKQQSLREKYRPFET"
FT   regulatory      92679..92684
FT                   /gene="lmo2113"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        92693..93448
FT                   /transl_table=11
FT                   /gene="lmo2113"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5F1"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR031332"
FT                   /db_xref="PDB:4WWS"
FT                   /db_xref="PDB:5LOQ"
FT                   /db_xref="PDB:6FXJ"
FT                   /db_xref="PDB:6FXQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5F1"
FT                   /protein_id="CAD00191.1"
FT                   /translation="MNEAVKTLDGWFCLHDFRSIDWAAWRELNPGNQELMLNELSHFLS
FT                   DMEITKNIGEGEHTIYSILGQKADLVFFTLRDSLEALNEVENRFNKLAIADYLLPTYSY
FT                   ISVVELSNYLASHMAGGDDPYQNKGVRARLYPALPPKKHICFYPMSKKRDGADNWYMLP
FT                   MEERQQLIRDHGLIGRSYAGKVQQIIGGSIGFDDYEWGVTLFSDDALEFKRIVTEMRFD
FT                   EASARYAEFGSFFIGNLLLSEQLSKLFTI"
FT   regulatory      93461..93507
FT                   /gene="lmo2113"
FT                   /regulatory_class="terminator"
FT   regulatory      93632..93637
FT                   /gene="lmo2114"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        93645..94412
FT                   /transl_table=11
FT                   /gene="lmo2114"
FT                   /note="similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="GOA:Q8Y5F0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5F0"
FT                   /protein_id="CAD00192.1"
FT                   /translation="METVLQAKNVRKIYGSKGNVYTALENISIDIKEGEFTGIMGPSGA
FT                   GKSTLLNVLSTIDKPTSGQIVISGQELENMNEQQMSTFRRDKLGFIFQDYNLLDTLTIR
FT                   ENIILPLALAKRPVKEMEEKLAIISEKFGITEILDKYPSEISGGQKQRTAASRAIITSP
FT                   SLIFADEPTGALDSKSATNLLESLRDLNEQDKSTIMMVTHDAFAASFCKRILFIKDGEL
FT                   YTEIYRGTKTRKEFFQKILDVLAKLGGDSDDVI"
FT   regulatory      94385..94389
FT                   /gene="lmo2115"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        94399..96339
FT                   /transl_table=11
FT                   /gene="lmo2115"
FT                   /note="similar to ABC transporter (permease)"
FT                   /db_xref="GOA:Q8Y5E9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5E9"
FT                   /protein_id="CAD00193.1"
FT                   /translation="MTLFDLAKKNIRHNFVHYFLYFASMIFSIMIYFTFLVLSKDPSVV
FT                   ARIDQSAKLSTAFSSSSVILLIFVAIFILYSNNFFTRKRKKEIGLYSLLGLRKKEIGRM
FT                   LFYENFIMGLGALIIGIIAGTLLSKLFVTILLNLINLDSIGGFAFSWAAVIQTSIVFII
FT                   ITLFTSFTGYRIIYRTTLLDLFHSESKREKSPKPSFILALLSILLIGLGYFIAGQPLDS
FT                   KGSIWAQLGFSIGALVILASVIIGTALFITFFLPYLLTKLRNNKRIFYKGSNIISTSQL
FT                   AFRISSNAKTLIIISILSATTLSAIGTISSVYYQANTSASTSAPSSFEYEIPKDSETNN
FT                   KIIETAESDPDHPVEFKQKSTYYIVKAEGARPDFVEYDINEGFPVISESDYNSLVKEQG
FT                   TPEKAASLKGNEAQMVLTITYDEDAQKEMVGEKFTLASPNKPNIKIKSVVQNSPISTIP
FT                   GLLVLPDSQVAKIAADSSIAAHSVESISVKDAKQAQALDKKMRAVIPKDTNFISYTKMY
FT                   QEIITVTGVLLFIGMFIGFVFLAATGSIIYFKQLTEAYNDIGTFDILKKIGLTRRDIRK
FT                   VLAKQLLVVFLIPLIIGIAHSSFALLGLSHMLALDLTLPVVISTGVYTLMYIVYYFVTL
FT                   NSYTNIVFGKK"
FT   regulatory      96349..96372
FT                   /gene="lmo2115"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(96349..96372)
FT                   /gene="lmo2116"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(96382..97206)
FT                   /transl_table=11
FT                   /gene="lmo2116"
FT                   /db_xref="GOA:Q8Y5E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5E8"
FT                   /protein_id="CAD00194.1"
FT                   /translation="MPSKWRGICGSLLIALGITQLYSFISAVIGYFNAEENSFVFVWNY
FT                   WMLLFFGVGLFIIGFAFMRKESFRLASIIGVMCFVLFQGFSVYYYQLRVLSKLEYTQPF
FT                   EWSGTLLCILGLLVLIALLIGPIFQAKEIQADQAWKTKWRYAAGVFSLLGAVTSVFAAV
FT                   TIFRQLHSDNIKEGYLFTTALDGYFACFMAVIFLLVVIFSWRKVSYLLVGILMGAAFIL
FT                   LTNYLSVTNWIDFAKENLSITFGSNEREVFGMQFLMGASAFLSSIFGYIAKK"
FT   regulatory      complement(97215..97220)
FT                   /gene="lmo2116"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      97253..97258
FT                   /gene="lmo2117"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        97267..97728
FT                   /transl_table=11
FT                   /gene="lmo2117"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5E7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5E7"
FT                   /protein_id="CAD00195.1"
FT                   /translation="MNWTIWDKSQKVPYTLLLEADPSEKQIAKYLDKSHVFQLMHDDIV
FT                   IGIICLFPLNNDQLEIMNIAVSSDYRNQGIGKKLLEKAFDYAIHKHFIKIIVKTGNSSI
FT                   DQLAFYQKNGFRMQHIIPNYFTENYPNQTITENGIVCLDQIILLKEIKS"
FT   regulatory      97723..97746
FT                   /gene="lmo2117"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(97723..97746)
FT                   /gene="lmo2118"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(97763..99115)
FT                   /transl_table=11
FT                   /gene="lmo2118"
FT                   /note="similar to phosphoglucomutase"
FT                   /db_xref="GOA:Q8Y5E6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5E6"
FT                   /protein_id="CAD00196.1"
FT                   /translation="MGKYFGTDGVRGVANSELTPELAFRLGRMGGYVLTRHVGEHPRVL
FT                   VARDTRISGEMLESALIAGLVSVGIEVMRLGVISTPGVAYLTKAQGASASVMISASHNP
FT                   VDDNGIKFFGSDGFKLSDDQEEEIEQLLDTAEDTLPRPSGEGLGTVSDYFEGKQKYIQY
FT                   LKQTIENDFNGYHIALDCANGATSGLATHLFADLDADISSMGASPNGLNINDGVGSTHP
FT                   EALAAFVLDKKADVGLAFDGDGDRVIAIDEIGQIVDGDKIMFICAKYLREQGLLNNNTI
FT                   VSTVMSNLGFYKGLKELEIEDVQTAVGDRYVVEAMREGNYNLGGEQSGHIIFLDHNTTG
FT                   DGLLSGIQLINVMKATGKKLSELAAEMKTFPQKLENIRVSDKNHVTDNPKVSKVIDEVE
FT                   AEMAGNGRVLVRPSGTEPLVRVMVEAATKEETDEYCERISAVVRSEMALND"
FT   regulatory      complement(99124..99129)
FT                   /gene="lmo2118"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(99331..99360)
FT                   /gene="lmo2119"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(99365..100723)
FT                   /transl_table=11
FT                   /gene="lmo2119"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5E5"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="PDB:5HQH"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5E5"
FT                   /protein_id="CAD00197.1"
FT                   /translation="MDRILNNKWSIRIIALLLAAILFTSVNANNNNATTFSTTSSSDSE
FT                   VIENVPVKVYYDKTNLYISGIPETVTVTLSGPRSIVQSAKAQQDFTVYADLKNASIGTQ
FT                   EVKLQVKDVSDRLKVKVNPATVNVNVQEKVTKKFSVDVELSKSVVADGYQAGTPIIDPK
FT                   KVSITGAKDTIEQIAYVKATLESDGKHKSEFTDKATVSVFDSNLNKLDVEVNPQEVEVT
FT                   VPVEKVGKSVPVKIKQEGTPESDIEISSMTPDKSEVVVVGDDAVLEKIKEIEIPIDVSK
FT                   IKADTVKEVTVPVPTGAKSVQPTTIEVKIKTVKKSEANNNPTTSDSNNQDTDTTDNNTD
FT                   DSGDNNTKISKSFSNMQVYMSGLKNTFDAQMITPANGKVSVTITGEKKTVDGIAAKDLS
FT                   VIANLSKSKAGSYSIPLELNGLPDNVAYVINPRQADFIITDKEASIEVPSKST"
FT   CDS_pept        complement(100723..101544)
FT                   /transl_table=11
FT                   /gene="lmo2120"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5E4"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="PDB:4RV7"
FT                   /db_xref="PDB:6HVL"
FT                   /db_xref="PDB:6HVM"
FT                   /db_xref="PDB:6HVN"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5E4"
FT                   /protein_id="CAD00198.1"
FT                   /translation="MDFSNMSILHYLANIVDILVVWFVIYKVIMLIRGTKAVQLLKGIF
FT                   IIIAVKLLSGFFGLQTVEWITDQMLTWGFLAIIIIFQPELRRALETLGRGNIFTRYGSR
FT                   IEREQHHLIESIEKSTQYMAKRRIGALISVARDTGMDDYIETGIPLNAKISSQLLINIF
FT                   IPNTPLHDGAVIIKGNEIASAASYLPLSDSPFLSKELGTRHRAALGISEVTDSITIVVS
FT                   EETGGISLTKGGELFRDVSEEELHKILLKELVTVTAKKPSIFSKWKGGKSE"
FT   regulatory      complement(100736..100741)
FT                   /gene="lmo2119"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(101552..101557)
FT                   /gene="lmo2120"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(101674..101707)
FT                   /gene="lmo2121"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(101719..103980)
FT                   /transl_table=11
FT                   /gene="lmo2121"
FT                   /note="similar to maltosephosphorylase"
FT                   /db_xref="GOA:Q8Y5E3"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5E3"
FT                   /protein_id="CAD00199.1"
FT                   /translation="MAQKQLFEIEPWTLRTTKLDKENKRLQESLTSLGNGYMGMRGNFE
FT                   EGYSGDGHIGTYYAGVWFPDKTRVGWWKNGYPDYFGKVINGLNFIGIEVRLDGEKLDLF
FT                   VDEVSDFELELDMEKGVLRRQFTVVKNNKTFRISAERFLSVATKELAVIHYQVEALSSA
FT                   KVELTSFLDGNVQNEDANYEEMFWQEVEKASSASRGSLVTKTIPNNFGTPRFTVSAVME
FT                   NKTNAANETNQTKALYTENHFQFDLQENEVAKIEKRVVITTSRDFEEEDILPAGEKILQ
FT                   SLEIKTYEELLTAHVAGWRERWDKADVEVSGDDSAQQGIRFNIFQLFATYYGEDARLNI
FT                   GPKGFTGEKYGGATYWDTEAFALPMYLSLTDKSVSHNLLKYRHDQLDGAKINAQKIGLD
FT                   GALYPMVTFTGVECHNEWEITFEEIHRNGAIAYAIYNYTNYTGDDSYLKTDGIEVLTEI
FT                   TRFWADRVHLSDRLDKYMIHGVTGPNEYDNNVSNNWYTNYIAAWTIRYTLENLDAEAKK
FT                   RLGVTEYEIAKWEDIEHRMYYPFDEKWQIFVQHDTFLDKELRSTDTLKPEDMPINQNWS
FT                   WDKILRSCFIKQADVLQGLYLFYDDFDFDTKQRNFEFYEPLTVHESSLSPAVHAVLASE
FT                   LGKYDKAVELYKRTARLDLDNINNDTEDGLHITSMAGSWLSIVQGFAGMRVTSGKLSFA
FT                   PFLPNGWDNYRFKINFRDRLLEVKVEVGQVTVKLCHGEAINLEMYKKNYLLETAVIVEI
FT                   "
FT   regulatory      complement(103988..103993)
FT                   /gene="lmo2121"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(103996..104829)
FT                   /transl_table=11
FT                   /gene="lmo2122"
FT                   /note="similar to maltodextrose utilization protein MalA"
FT                   /db_xref="GOA:Q8Y5E2"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="InterPro:IPR016546"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5E2"
FT                   /protein_id="CAD00200.1"
FT                   /translation="MKKIPFIIQYVKSTLGPTAIFEGRKVLKFWQMVIVFIFLNALLLL
FT                   PVSAHFANQSSFDLPSLMPKMATLGTDQLASKISGLTLENGALTDKNAHIVEKTVNGVA
FT                   GVNLTKAELSGAKNVINFKDQEMTLTDASGYNFEVSYPKDATLSEITSGESLVDWVSAQ
FT                   WYLENQAFVFLSMVLMIGSIIFVSSLMLTVFTTLFIWMTKRSSFSSIASFKESVNLTLN
FT                   ALGIPVIAACIIGFIYFDITIIMAVQSLGMVLMIAWTFLKTRFYKTSEKSMAASR"
FT   regulatory      complement(104838..104843)
FT                   /gene="lmo2122"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(104857..105708)
FT                   /transl_table=11
FT                   /gene="lmo2123"
FT                   /note="similar to maltodextrin ABC-transport system
FT                   (permease)"
FT                   /db_xref="GOA:Q8Y5E1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5E1"
FT                   /protein_id="CAD00201.1"
FT                   /translation="MRDFMKDQRTTKFLTQFFTYLFLTVLTIIILYPILITASSAFKPG
FT                   NIAAFTLEWSDSWTLNNFTRLFNETLYLDWYKNTLIIAVVTMIMQVTIVTLAGYTYSRY
FT                   RFKGRKNSLIFFLIIQMVPTMAALTAFYVLAMLLGALDQYWFLTLIYIGGGIPMNTWLM
FT                   KGYFDTVPRDLDESAKLDGAGHFRIFAQIILPLVRPMIAVQALWAFMGPFGDFLLAKFL
FT                   LRTPENLTIAVGLQTFIANPQQQKVALFAAGAILAALPICLLFFFLQKNFVSGLTAGGT
FT                   KG"
FT   CDS_pept        complement(105709..107016)
FT                   /transl_table=11
FT                   /gene="lmo2124"
FT                   /note="similar to maltodextrin ABC-transport system
FT                   (permease)"
FT                   /db_xref="GOA:Q8Y5E0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5E0"
FT                   /protein_id="CAD00202.1"
FT                   /translation="MKLEQKQIKNVRQATLLSIIPGLGQFYNKQNFKGIVFFALFALFI
FT                   IEFFAVGLNALIGLVTLGSVPGVDHSLFLMIEGTLQLIVTLLFIGFWFINIFDARRVAM
FT                   QWNLGETVNRSALAIIKNMLDKGFPYLLTLPAYLVMTFVIIFPVLVTLFMAFTNYDFYH
FT                   IPPANLIDWVGFKNFFNIFFLSSYRDTFLSVFSWTLIWTICATSLQIVVGVFTAIVANQ
FT                   SFIKGKRLFGVVFLLPWAVPAFITIMSFSNMFNDSIGAINSQVIPLLNHLPFIDINAIA
FT                   WKTDPFWTKVALISIQGWLGFPYIYVMVTGVLQAIPGELYEAARIDGASAIQRFRKITL
FT                   PMILFVTAPVFITQYTFNFNNFSIIYLFNEGGPGSVGAGAGSTDILISWIYKLTTGTSP
FT                   QYAVAAAVTLLISIIVITVSMIAFKKTNAFGNEEMM"
FT   regulatory      complement(105717..105722)
FT                   /gene="lmo2123"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(107025..107030)
FT                   /gene="lmo2124"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(107066..107094)
FT                   /gene="lmo2125"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(107103..108362)
FT                   /transl_table=11
FT                   /gene="lmo2125"
FT                   /note="similar to maltose/maltodextrin ABC-transporter
FT                   (binding protein)"
FT                   /db_xref="GOA:Q929P4"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="PDB:5TU0"
FT                   /db_xref="UniProtKB/TrEMBL:Q929P4"
FT                   /protein_id="CAD00203.1"
FT                   /translation="MKRFKKVGIVSAVLVMALSLAACGGGKDTSKSGSSDEKTLTVSVD
FT                   AGYKDYVNKIKGDFEKDNDVKVKVVEKDMFETLEALPLDGPAGTAPDVMMSAFDRIGSL
FT                   GQQGHLAEVKLGNKDDYDEKDQKQVTIDDKIYGAPAIIETLVLYYNKDLLDKAPATFKD
FT                   LETLSKDSRFAFTSEKGKNTGFLAKWTDFYFSYGLLAGYGGYVFGDEGTNPKDIGLNNK
FT                   GSVEGITYATKWFQDVWPKGMQDNKSADDFIQDQFVKGKAAAILGGPWSAANYKEAKIN
FT                   YGVAKIPTLNNGKEYSPFAGGKGWVVSNYSKNKDVAQKWLDYVTNQKNQETLYDMTNEV
FT                   PANLKARDTAKSKNDELTNAVIEQYKNAQPMPNIPEMSEVWTGAENLMFDAASGSKTPQ
FT                   QSADDAVKVIEDNVTQKYTK"
FT   regulatory      complement(108371..108376)
FT                   /gene="lmo2125"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(108576..110351)
FT                   /transl_table=11
FT                   /gene="lmo2126"
FT                   /note="similar to maltogenic amylase"
FT                   /db_xref="GOA:Q8Y5D9"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5D9"
FT                   /protein_id="CAD00204.1"
FT                   /translation="MEKAGIYHQPASSYAYSYDAKTLHIRIRTKRLDISKVTLIAADPY
FT                   LWKDGKWQSESYTMRKIAETEEHDYWFFAITPEHRRLQYGFLLTDTEGETTFYGGRGFF
FT                   EPTEANLATMDYYFKFPFIHAVDTFEAPEWVRNTIWYQIFPERFANGNPAISPENTLPW
FT                   GSKDPNTTDFFGGDIEGIIEHLDYLAELGINGVYLTPVFEAPTNHKYDTIDYKKIDPHF
FT                   GDKETFRKLVKEAHKRGIRIMLDAVFNHIGDTSPEWQDVVEKEEKSAYRDWFHIHSFPV
FT                   RQNENGNIEGEPTLSYDTFAFTTHMPKLNTANPEVQKYLLDIATYWIREFDIDGWRLDV
FT                   ANEVDHAFWKEFKKAAQAEKEDIYILGEIWHDSWIWLLGDEFHAVMNYPFTQTIIENFI
FT                   EEKITPEQMVSGINEQYMRYPNQVNEVMFNMLDSHDTARILTRANNDEDKVKQALAFMF
FT                   AHTGSPCIYYGTEIGMDGGNDPGCRKCMEWDEAKQNQDMLAFTKQLIALRKDNQAIITS
FT                   GELTWLEASSETGITAFSKELNGEKLHFLFNQTKKDQDFTISFANTAIDIWNNQAVSDN
FT                   LTIPAKGFLVIKENS"
FT   regulatory      complement(110359..110364)
FT                   /gene="lmo2126"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      110598..110603
FT                   /gene="lmo2127"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        110609..111244
FT                   /transl_table=11
FT                   /gene="lmo2127"
FT                   /db_xref="GOA:Q8Y5D8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5D8"
FT                   /protein_id="CAD00205.1"
FT                   /translation="MENTLSFKKQGYWLFSSAIIIGVLFLLLPHIISNIGVLEFIGAFF
FT                   NALCMGVIAFIILKAEFLDWFKHFSFKWIIIGAPALIIISSIFNIAWAYFAGSTTENGI
FT                   NSVLTWTYVFTSIPFMLLGEELLSISLLYAAWKKWNWKFWQASLLCSLLFATWHLTSYD
FT                   FNFLQCIITLAPARLILNYLFKKTNSVWVTFIVHFIFDFIAFLPILLK"
FT   regulatory      111250..111273
FT                   /gene="lmo2127"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(111250..111273)
FT                   /gene="lmo2128"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(111280..112245)
FT                   /transl_table=11
FT                   /gene="lmo2128"
FT                   /note="similar to transcription regulator, LacI family"
FT                   /db_xref="GOA:Q8Y5D7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5D7"
FT                   /protein_id="CAD00206.1"
FT                   /translation="MATLADVAKRANVSKMTVSRVINHPDQVSDELKMLVYSAMEALEY
FT                   VPNYAARALVQNRTQVIKFLILEEIDTVEPYYMNLLTGISRELDKYYYSLQLVTQRSRN
FT                   IGAYDGLIVTGIRDKDYDLGLLDIDKPVIFYGENKRGYDSIDVDNKKGTALATEHMVEI
FT                   GFSRIVFLGINLLDEQFMKSRLEGYEEVVKEHGLEPESYFIANSSSIAEEKAFELLRYN
FT                   SEKIAIVCASDRIAIGVVRAAAAFGRRFGENIAVTGFDGVFLDRISSPKITTVRSPVVE
FT                   MGEELAKMLLAKINDHGKPQGNLLFTPELLIRASTTGKEE"
FT   regulatory      complement(112252..112257)
FT                   /gene="lmo2128"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(112384..112620)
FT                   /transl_table=11
FT                   /gene="lmo2129"
FT                   /db_xref="GOA:Q8Y5D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5D6"
FT                   /protein_id="CAD00207.1"
FT                   /translation="MQEQDIRYYVLPTIIIFILGIAAMNASSFPFISFLTTTLVAIAIG
FT                   ITIGGAHQLIRLVIKTYQQTKERRVSQKKWQTL"
FT   regulatory      complement(112629..112634)
FT                   /gene="lmo2129"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(113218..115041)
FT                   /transl_table=11
FT                   /gene="lmo2130"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y5D5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5D5"
FT                   /protein_id="CAD00208.1"
FT                   /translation="MASPLKRLLIGRPLKTSEAGDQKLGKLKALAVLSSDALSSIAYGT
FT                   EQILLVLVTVSAAAMWYSLPIALCVLVLLFALNLSYKQIIYSYPHGGGAYIVSRENLGN
FT                   NAGLIAGGSLLVDYMLTVAVSVSSGTDAIVSAVPSLYPFAVPIAVVLVIGVTIINLRGI
FT                   TESASLLAIPVYLFVFSIIALIFTGLFKVLTGMDASHETAAVGTHVQGVTIFLLLRAFA
FT                   SGSASLTGIEAISNAVPLFKEPRPKNAAKTLTLMAGLLGFFFVGITVLAFVYGTVPELK
FT                   VTVLSQIAENVFGRNFMFYFIQATTALILVLAANTGFSAFPMLAFNLAKDKFMPRMYLA
FT                   RGDRLGYSNGIITLAVGSILLIILFKGKTELLIPLYSVGVFIPFTLSQTGMIVKWWKQR
FT                   PKGWKKSLSANLLGASISFTVLLVLFLTRIESVWPVFVFMPIMIYVFHRTRHHYRKVGP
FT                   QLRIDETMDLPDFKGNAVIICVSDTTKVVEGALQYAKSIGDTVIAVHISIDKKQEKEFV
FT                   ERWNRVHPEVRMANLFSPYRSISDPLMKFIDTAKQKADQDNYSLTVLIPQFIPRKGWQN
FT                   VLHNQTSLLIRTRLLMKRDVVVSTYPYHLKE"
FT   regulatory      complement(115050..115055)
FT                   /gene="lmo2130"
FT                   /regulatory_class="ribosome_binding_site"
FT   tRNA            115375..115446
FT                   /product="transfert RNA-Glu"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 70.15"
FT   tRNA            115604..115677
FT                   /product="transfert RNA-Thr"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 78.67"
FT   tRNA            115687..115770
FT                   /product="transfert RNA-Tyr"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 78.87"
FT   tRNA            115782..115856
FT                   /product="transfert RNA-Gln"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 68.97"
FT   tRNA            115863..115935
FT                   /product="transfert RNA-Lys"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 88.37"
FT   regulatory      complement(116011..116037)
FT                   /gene="lmo2131"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(116054..116743)
FT                   /transl_table=11
FT                   /gene="lmo2131"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5D4"
FT                   /protein_id="CAD00209.1"
FT                   /translation="MQSVFEDLYSKKILEEEFGYTCFLQTLIDNRIPYKKTRIPSNMIL
FT                   LTEDTINTKVYFIEKGIVSLEKNKNVISFLGSNQIAGLNDYFMAEANLYTARVIETITA
FT                   YEFDKEDIICSIIGMQEGWLYLYLNNRNHENVLIEKCNLMRGNGENRLKESLEQLGRYF
FT                   GNEKEGVLRIPKCFTKKIIANYSNLSVRSVTHLCRKLVEAGFLAENSKSFVLLDKYGKI
FT                   EPEVTTI"
FT   regulatory      complement(116751..116759)
FT                   /gene="lmo2131"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      117209..117214
FT                   /gene="lmo2132"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        117222..117953
FT                   /transl_table=11
FT                   /gene="lmo2132"
FT                   /db_xref="GOA:Q8Y5D3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5D3"
FT                   /protein_id="CAD00210.1"
FT                   /translation="MYLKETLDQFASIDNILKLLKKNPSFNKHCIQERLPQKTIITSNK
FT                   QRKHIYIIEEGFMKLIFDDNKPRDFSYILSKGAFPFLPVYIEDIPEHTMMVALTDIVWW
FT                   KIDIGFFKSMMEIEDPRNYLMLHQLAETRRRFYTIAYQEKLTSRESIYYSLSTLIEFGL
FT                   RISEKVVELPEFLTYQILADHANTSKSYTSKVLGHLREDGILESQKKPWRINDVQKLQK
FT                   LIEMNVPLVKIQKKLRADLHS"
FT   regulatory      complement(117930..117953)
FT                   /gene="lmo2133"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(117963..118862)
FT                   /transl_table=11
FT                   /gene="lmo2133"
FT                   /note="similar to fructose-1,6-biphosphate aldolase type
FT                   II"
FT                   /db_xref="GOA:Q8Y5D2"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5D2"
FT                   /protein_id="CAD00211.1"
FT                   /translation="MLVNMKQLLEVAKENKFAVGAFNVADSNFLRVVVEEAEKNNAPAI
FT                   IAVHPTELDFTKDDFFQYVLARIKNSPVPFVLHLDHGDNMGDVMRAVRCGFSSVMIDGS
FT                   LLPFEENIRVTKEVVDVCHKLGVSVEGELGTIGKTGNSIEGGVSEIIYTKPEEAEEYIS
FT                   RTGVDTLAVAIGTAHGIYPKDKEPKLRLDILKEIKALVNIPLVLHGGSANPDAEIAAAV
FT                   EIGIQKVNISSDYKYAFYKKCREILSTTELWDANAIYPDCIDAAKEVVKYKMGLFESIG
FT                   QVEKYQQAKTTAWRSELI"
FT   regulatory      complement(118872..118877)
FT                   /gene="lmo2133"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(118879..119733)
FT                   /transl_table=11
FT                   /gene="lmo2134"
FT                   /note="similar to fructose-1,6-biphosphate aldolase type
FT                   II"
FT                   /db_xref="GOA:Q8Y5D1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5D1"
FT                   /protein_id="CAD00212.1"
FT                   /translation="MYVSMKGMLERANKEHYAVMAINCFNLETARAVIDAAQELRAPII
FT                   IDLLQDHLTSHLGSRFLTKPIIKMAEEASVEVAINLDHGHDVAIVKQCLADGFSSVMMD
FT                   ASSFPYEENVAITKKMVEFAEVYHASVEAEVGNIGAVTGDNYTNQEMYTDPKVAIDFAK
FT                   RTGIDALAISYGSSHGDYPEGFTPAFQFDIVREIKSATNMPLVLHGGSGCGAENIRESV
FT                   RLGINKINVGSDFMKAQVNQIKTNLKESPAVNYVDLIHETIKAGTKAVKYYIHLSGSTG
FT                   KSL"
FT   regulatory      complement(119741..119746)
FT                   /gene="lmo2134"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(119751..120845)
FT                   /transl_table=11
FT                   /gene="lmo2135"
FT                   /note="similar to PTS system, fructose-specific enzyme IIC
FT                   component"
FT                   /db_xref="GOA:Q8Y5D0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5D0"
FT                   /protein_id="CAD00213.1"
FT                   /translation="MKKLQIKKHALTAISYMLPLVVASGLLIAIGNLTNGQVIENYKAP
FT                   YSIPDALVSLGVLGMGLLAPVIAGAIAYSIADRPGIAPGLLMGLIANSIGAGFLGGMLG
FT                   GYLVGYFVLILVKYLKVPKWAQGLMPMMIIPLISSLVVGLLMYFVVGVPIVWATEAMTS
FT                   FLQGMQGSMRFVFGAVLGAMAAFDFGGPVNKVASLFADGLLLEGVKEPEAVKILASMVP
FT                   PFGVTLSWVVSKLIKKKKYTKSEEDNIKIAFPMGICMITEGVIPIAAVDPIRVIISCTL
FT                   GAAVGGGLSMTWGIGSPVPSGGMFIVPAMNEPLLFCLALLIGTCVTAAMLLILKREPTK
FT                   EEELIADQGLEEEDEVDLSGIKIS"
FT   regulatory      complement(120857..120862)
FT                   /gene="lmo2135"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(120862..121173)
FT                   /transl_table=11
FT                   /gene="lmo2136"
FT                   /note="similar to PTS system, fructose-specific enzyme IIB
FT                   component"
FT                   /db_xref="GOA:Q8Y5C9"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5C9"
FT                   /protein_id="CAD00214.1"
FT                   /translation="MNIIGIAACTSGIAHTYIAKEKLTKAGLALGHNVHIETQGTIGIE
FT                   DELSAEQVKNADVVIIAADIKISGKDRFKGKRVVEIPTDLAIKAPKQIINKIDKEINN"
FT   regulatory      complement(121182..121187)
FT                   /gene="lmo2136"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(121186..121659)
FT                   /transl_table=11
FT                   /gene="lmo2137"
FT                   /note="similar to PTS system, fructose-specific enzyme IIA
FT                   component"
FT                   /db_xref="GOA:Q8Y5C8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5C8"
FT                   /protein_id="CAD00215.1"
FT                   /translation="MDIQELDISKVISPALVNLDLQATSKLEVIEELTDLLVETGAVAD
FT                   KDAFIADVLYREEEGKTGLGEGVAIPHGKSTSVTSTSIAVGRTKNLVEWESLDDKPVNI
FT                   IILFAVKNSDATTTHIKLLQKVAILLADDEVIGQFQTVQTKEDFIKLLAKNQD"
FT   regulatory      complement(121667..121672)
FT                   /gene="lmo2137"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(121671..123128)
FT                   /transl_table=11
FT                   /gene="lmo2138"
FT                   /note="similar to transcription regulator"
FT                   /db_xref="GOA:Q8Y5C7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5C7"
FT                   /protein_id="CAD00216.1"
FT                   /translation="MLLTKSEHALINLFLTKNDFLTAKQLAEILDVSSKTIYRKIKNIN
FT                   ETTGRKDIIISEKGRGFKLDYKAYIQAKLETTGDIFGYTPTERREKILLQVLFKSPKYL
FT                   NVTELYEDYYVGYNSIKNDFSLLNQAIEKYDLALEKRQKEIRVVGTEENIRTAINEVIN
FT                   NLDLSTYDDLKTEYSDLNKADVQFIVRQMELIENKLMISIPYPYDINIFSHLYILINRF
FT                   RQGEVEDFKESDDDYIVTNEKLHTLAVEAIDAIEQYLKMKLPKRETFHFLQYLISSRFN
FT                   HEIELVPGKILPIVEEMTDFYIEQVAAKINMPINKKQLKIELLSHMKPMVNRMNHQINI
FT                   KNNLLSDIKLEYGKLFEIIKETARDAAKTFELNTISDDEVGYITIYFAKHIEASPLVKR
FT                   IIIMCSSGIGTSELLKVKVQKAFPDVEIVDVLSSTRFKNSLHDYQNIDFILTTINTEST
FT                   KEIPSLLVSAMFTEKDKIMVKKLMESL"
FT   regulatory      complement(123136..123141)
FT                   /gene="lmo2138"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      123311..123316
FT                   /gene="lmo2139"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        123324..124226
FT                   /transl_table=11
FT                   /gene="lmo2139"
FT                   /note="similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="GOA:Q8Y5C6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5C6"
FT                   /protein_id="CAD00217.1"
FT                   /translation="MTLELHNVTKKFGTKVAVNDLSFRVEPGKILGLIGQNGAGKTTTF
FT                   RLILHFLEATSGKITWDGKEVSKIDPNIIGYLPEERGLYPNVTIEEQLIFFAELKGYPK
FT                   QKIKAEIDSWLERAEIVGKKTDLIKTLSKGNQQKIQLLSTIIHQPKLVILDEPFSGLDP
FT                   VNAEILKKFVFDLRASGAAIIFSSHRMENVEELCDSLLMLKKGNVVLQGTTESVKSVFG
FT                   RKRILIESSHSAAELATLPGVLNVQTHRDGVLQLEIAHESDAEKIFDYVTKDGFIQTFS
FT                   LQAPTLEEIFKWKAGELNE"
FT   regulatory      124204..124209
FT                   /gene="lmo2140"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        124219..125454
FT                   /transl_table=11
FT                   /gene="lmo2140"
FT                   /note="similar to ABC transporter (membrane protein)"
FT                   /db_xref="GOA:Q8Y5C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5C5"
FT                   /protein_id="CAD00218.1"
FT                   /translation="MSKFWVITKQVYKRRVKTKSFLISLLFPVLIAALIAGIPKMVDYF
FT                   DSSSDITKLAVLAEDPVFAKSLAADKNHFKVNTDIKDKKSAQSALKDGKIDGFVTITQK
FT                   DDSVSAVYTTQETAGQDIITRLTKDLTATKIAEKAAAYKITNEQLQSITSPVSVTNDLE
FT                   SNNQLTNHEKDVMSAAVLILTLIIFIFVMSYANIVASEIATEKGTRIMEVILSSVSATT
FT                   HLFAKLTAIIFMLLTQIGFYIICGAIVLIAGRNTEMVQNVLDQIAVFPAYYLVLNLLFV
FT                   ILGLLLYILLAAMIGSMVPNVETVAQFIYPMTILAIIGYWGSIAAANAPDKMLVIIGSY
FT                   IPTFSPMMMLARMDLLSVSTIGIFSSLAILLVSVVGAFFLTVRLYQGNVLLYSNDGLWK
FT                   TWKTSLSYAKRK"
FT   regulatory      125454..125460
FT                   /gene="lmo2141"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        125471..125944
FT                   /transl_table=11
FT                   /gene="lmo2141"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y5C4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5C4"
FT                   /protein_id="CAD00219.1"
FT                   /translation="MQIRLSKREDAASMIELEHLVWTPGTTPGDIHFDSEAEFLLKSPP
FT                   GSKIVVVTDDKVVGILGYKSPIPLASNKHVAEIDIAVHPDYQRAGIGQLLMDKMKEVAR
FT                   EKGYIKIALRVLSINQKAIRFYEKNGFKQEGLLEKEFIIQGEFVDDILMAYFL"
FT   regulatory      complement(126521..126548)
FT                   /gene="lmo2142"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(126533..127198)
FT                   /transl_table=11
FT                   /gene="lmo2142"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5C3"
FT                   /protein_id="CAD00220.1"
FT                   /translation="MEKSGFVADPIYGEIKNEIMANTLENGEKVDIEDIMKRFQVSKRV
FT                   AFSALHCLHKSGILCKNIGESGFSVAVNSEAEHREKSRLKLAFFHLNYAVQKLQEQDAE
FT                   LCATCLRKELVYIKLAAREHDTEVFINHVKNFYACMIHYTEMPAMEKNIDILSQTLRNM
FT                   KEKNEKLFFEAFTIDVSQALEELVTHLEAKEFEKCHTVIQQFYDKNISILFSESKNPE"
FT   regulatory      complement(127207..127212)
FT                   /gene="lmo2142"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      127399..127404
FT                   /gene="lmo2143"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        127412..129154
FT                   /transl_table=11
FT                   /gene="lmo2143"
FT                   /note="weakly similar to mannose-6-phosphate isomerase"
FT                   /db_xref="GOA:Q8Y5C2"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016847"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5C2"
FT                   /protein_id="CAD00221.1"
FT                   /translation="MSTYDLAPEVKIHQFDGAWAGYKDIAGELLTAIQKKNNEHIIVAI
FT                   ECYPGTRNEEIVAELLPLLPVEKAVFADEWALNNEEVTNKVQSHLTDDRVFGIMSHYEV
FT                   SDFYPAEKLAEIQAEISASKGLVVIYGTGATVIAPNPDILIYADLARWEIQCRYRRENK
FT                   PNWKADNANEDALRKFKRGYFFEWRMADRQKKKLYQQIDFLLDTNKKNEPKMVRGEDYR
FT                   NGLKQVSKAPFRVVPYFDASVWGGQWMKNNFGLDPTADNYGWAFDGVPEENSLYMRFGD
FT                   IRIEVPSTNVVNHFPNELLGPKVHSRFGTEFPIRFDYLDTVGGGNLSLQVHPLVEYAQD
FT                   KFGIHYTQDESYYILEADSDSTVYLGTKEGTTKEAIMADLEKAAEGNYRFPDEKYINVF
FT                   PVKKHDHILIPAGTIHCGGPSTVVLEISATPYIFTFKLWDWERTGLDGMPRPVHLEHGR
FT                   ENLQLDRDTKWVNDNLINQFETLHEDNDSKVERTGLHELEFIETQRHWFKETVTVHTND
FT                   SVNMLNLVEGTSAVVESIDDSFAPFEVHYGETFIVPAIVGTYQIRNTNASEKVAVIQAF
FT                   VRNL"
FT   regulatory      129164..129186
FT                   /gene="lmo2143"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(129164..129186)
FT                   /gene="lmo2144"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(129193..129927)
FT                   /transl_table=11
FT                   /gene="lmo2144"
FT                   /note="similar to transcription regulator GntR family"
FT                   /db_xref="GOA:Q8Y5C1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5C1"
FT                   /protein_id="CAD00222.1"
FT                   /translation="MVRKLNKMNDASPLYAQIADDLREKIQSGIWKTGDKIPPELDLCE
FT                   LYNVSRITVRKAIDELVRENLLYRERAKGTFVRDWEEAEDEHFTLVRSFTNEMKELGKK
FT                   AATLHAEVEVINADKKIALQLGLAVGDKVLQVKRLRGTKDLAFALFISAIPYRQAYSLQ
FT                   AEDYYGSFYEYLKGFGIVVNQEKEYIEAMLPNREVQEALAIDKQEPILKRVRMTKQKES
FT                   DFREYSECFYVGKHYRYYIDFE"
FT   regulatory      complement(129935..129940)
FT                   /gene="lmo2144"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(130009..130028)
FT                   /gene="lmo2145"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(130042..131058)
FT                   /transl_table=11
FT                   /gene="lmo2145"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y5C0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5C0"
FT                   /protein_id="CAD00223.1"
FT                   /translation="MKEYFIDRSYKASMGIANAVLVTLGIGLLLQTIGQMTGISFLATV
FT                   GAIGKTMLIPGIGVGIAMCLHANTLVTISAAASAVIGGGAVATLAGGGVAITSGEPVGA
FT                   ILAVIVAVWTGKRVTGKTKFDMILIPGVSLLAGGLSGILFAKIMAPILASVSLGISSLI
FT                   GGSPLISSMIIAFVFGLLILSPASSAALAIALQLDPTASAAALIGCSVQFVSFAVLSYR
FT                   DNNWGAFFAQLICTPKLQTPNIIRKPSLMLVPLLTTLIAGPLGVMVFHIQAASEVAGLG
FT                   LCAFVAPLYLIANYGFSTLAAFILVAVVLPGVIALVVRPFLIKKERLKTGDLTIELQ"
FT   regulatory      complement(131064..131069)
FT                   /gene="lmo2145"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(131127..131981)
FT                   /transl_table=11
FT                   /gene="lmo2146"
FT                   /note="similar to transcription regulator LysR family"
FT                   /db_xref="GOA:Q8Y5B9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5B9"
FT                   /protein_id="CAD00224.1"
FT                   /translation="MDEALRTYIRVVELQSFTKAAEELHISQPAVSLQLKKLEELYETE
FT                   LIYRQAKKFILTATGEILYHRAKQLEGLYKQVEDEISLYHHHLKGRLRIGASFTIGEYY
FT                   LPEVIAKFHALYPDITIELIIENTAKIADKVELLQVDTGLIEGQVSKKDLEISAFSDDE
FT                   MCIVGRADGSLTEIEQGATWIAREEGSGTREYLDHVLSTNGWNVAEKVVAWSNMAVKQM
FT                   VLEGMGYTVISKCVVQTEITAGKMQTFNESGSLMRKFSVLKNRQRLENRIAETFLTFLK
FT                   ENQ"
FT   regulatory      complement(131989..131994)
FT                   /gene="lmo2146"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      132075..132080
FT                   /gene="lmo2147"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        132087..133094
FT                   /transl_table=11
FT                   /gene="lmo2147"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5B8"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y5B8"
FT                   /protein_id="CAD00225.1"
FT                   /translation="MSQILFKTKTFWYGIALTFCIATLSYFLAKLPFLMILGQLVTAIL
FT                   IGIIIRALFPVPDKWFTGIQFSNKVILRAGIILLGFRLNLVDIYHAGWRVFLIAALCLS
FT                   FGITIVYFLAKLFGVDKKLAILVACGTGICGAAAVVAISPQVKADNNQTAVAATIIALL
FT                   GTIFTVIYTLIYPILPLGPDGYGIFAGATLHEIAHVIAAADPGGSSAVDMAVIVKLTRV
FT                   ALLVPVCFVVAKMVNAGTKNRFSWAELPVPWFIFGFLATSAINSFGIIPTSVTDFLVIC
FT                   AYFLIAMSMGGLGLNVHLPSFGKMGGKPFAAALIGSVFLSVFGLALVLLFHLAG"
FT   regulatory      133134..133139
FT                   /gene="lmo2148"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        133150..133791
FT                   /transl_table=11
FT                   /gene="lmo2148"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5B7"
FT                   /db_xref="InterPro:IPR009793"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5B7"
FT                   /protein_id="CAD00226.1"
FT                   /translation="MTKAIWTCRAFLLGYFLVLHFTADTYTFLILNVGLAYIPFEIAVF
FT                   LTKKPRVWWIFWPLGIVWLVFFPNAPYLLTDLLHLQRLEIYGAEGVLSTAPWLWRHFTY
FT                   IIVGVFFGLFIGFWSFAKMLAEIRRRFNWTSLLSYQLLLIGLILLSSYAIYIGRFSRLH
FT                   SIHLLTQPIDSLQIMFSVFHWPFWNFVFYFSIIQYVIYTLFSRFSSSLKN"
FT   regulatory      133795..133835
FT                   /gene="lmo2148"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(133841..134158)
FT                   /transl_table=11
FT                   /gene="lmo2149"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5B6"
FT                   /protein_id="CAD00227.1"
FT                   /translation="MDFKEYQILANRTAATHEQALTNYGLGITGEAGEVADLIKKYAFH
FT                   GHDLDKESLTKELGDVLWYVSQIAKWADISMETVAELNIEKLKRRYPQGFSTERSKLHI
FT                   D"
FT   regulatory      complement(134166..134171)
FT                   /gene="lmo2149"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      134345..134350
FT                   /gene="lmo2150"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        134357..134533
FT                   /transl_table=11
FT                   /gene="lmo2150"
FT                   /db_xref="GOA:Q929M1"
FT                   /db_xref="UniProtKB/TrEMBL:Q929M1"
FT                   /protein_id="CAD00228.1"
FT                   /translation="MKLAGLVLLLIGLIGFGFSFSITGLIGFGVCIISIILVIAGIFTM
FT                   IRSKKRRKRSYSY"
FT   regulatory      134541..134569
FT                   /gene="lmo2150"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(134541..134569)
FT                   /gene="lmo2151"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(134575..134874)
FT                   /transl_table=11
FT                   /gene="lmo2151"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y5B5"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5B5"
FT                   /protein_id="CAD00229.1"
FT                   /translation="MKQLQAEITAFLKERDWLDQYNHPKDLAISLSLEAAELLECFQWK
FT                   TDEIALKENREELLKEVADVLIYALQIAESMGADGEELVRMKLAENRRRTWPKK"
FT   regulatory      complement(134882..134887)
FT                   /gene="lmo2151"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(134936..134976)
FT                   /gene="lmo2152"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(134982..135308)
FT                   /transl_table=11
FT                   /gene="lmo2152"
FT                   /note="similar to thioredoxin"
FT                   /db_xref="GOA:Q929L9"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q929L9"
FT                   /protein_id="CAD00230.1"
FT                   /translation="MTSIEIKSPEEFQAHINGEELVYVDYWKDNCPNCKMLDLSFAEFK
FT                   NSEIASKVKVLKVKLEEMGENFFFDRDVQQTPTLVLYKGGEEIHRLNGFIPPNKIEEAV
FT                   SLNA"
FT   CDS_pept        complement(135305..135742)
FT                   /transl_table=11
FT                   /gene="lmo2153"
FT                   /note="similar to flavodoxin"
FT                   /db_xref="GOA:Q8Y5B4"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010088"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5B4"
FT                   /protein_id="CAD00231.1"
FT                   /translation="MRILLAYDSLSGNTKMVADEIEEILISEGHEVVSFRVSPLAEYPL
FT                   DEDFDLYVLGAWTVDYGRTPPDMKDFIAELAVKPKNVAIFGTGETQWGMDFYCGAVDRM
FT                   AKYFGTSYPTLKIEQMPHTEQDVADIDNWVRKILALRSGIK"
FT   regulatory      complement(135317..135322)
FT                   /gene="lmo2152"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(135739..136788)
FT                   /transl_table=11
FT                   /gene="lmo2154"
FT                   /note="similar to ribonucleoside-diphosphate
FT                   reductase,subunit beta"
FT                   /db_xref="GOA:Q8Y5B3"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5B3"
FT                   /protein_id="CAD00232.1"
FT                   /translation="MANQKEQLTRIKILEPLFPNRSTSIINGETSGILNWNDIPYPSFY
FT                   RAYKELSTNYWIPDEVDMKSDAKQYPALSEQEKYAFDAIIGLLATLDSPQTRFIYNIAE
FT                   YITDPAVHANAAIIAQQEVIHNESYSYVLASITNLQEQNRVFELARTHPTIIKRNEPIM
FT                   DAYDDFMNNKTGETLVKALIQSSILEGINFYSGFAYFYNLVRQNKMTGTGKIISFINRD
FT                   ELAHSKFISEVIRAILGENPELQTEELVEYTHEAFRHAVELETEWSEEVLQGIEGIDVE
FT                   EMVDYVKYRANKMLGMLGIPELYPGHSDNTMTWIKAYADNFTETKTDFFEMRNSSYKKT
FT                   NMDNGFDDL"
FT   regulatory      complement(136799..136804)
FT                   /gene="lmo2154"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(136844..139135)
FT                   /transl_table=11
FT                   /gene="lmo2155"
FT                   /note="similar to ribonucleoside-diphosphate
FT                   reductase,subunit alpha"
FT                   /db_xref="GOA:Q8Y5B2"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5B2"
FT                   /protein_id="CAD00233.1"
FT                   /translation="MKWGLQMTTYIVKDGGNRKLPFDKSRLDGYLEKIHEEFPKLDLED
FT                   YKRKVFNFVEKKEDYAADELVDYLIREAEARTDIHIPEWEHFAARLYLNKLYKKASKNR
FT                   FYNDDDKYGSYVGLQESLGERGIYSGNILKNYSKEDLIAAGKLIDPEKDKLFTYNGLYL
FT                   LATRYLATDSERNVYELPQERWLTIALYLMQNEPKEKRMKLVEEAYWALSNLYMTVATP
FT                   TLANAGKVGGQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSTGAAIR
FT                   GVKGASGGVIPWIKQLNNTAVSVDQLGQRKGAIAVYLDVFHKDIESFLDLRLNNGDQRL
FT                   RAHDVFTAVCIPDIFMEAVERRGEWYLFDPHEVKAKKGWYLQDFYDESKGEGTFREKYE
FT                   ELVADETISKKIVKAIDIMKRIMMSQLETGNPFMFYRDEVNRMNPNKHEGMVYSSNLCT
FT                   EIMQNMSPTKMIQEIISGDQIVITKQAGDFVVCNLSSVNLGRAVVAEEGTLERLIEVEV
FT                   RMLDNVIDLNELPVPQATITNQKYRSIGLGTFGWHHLLALKNIAWDSEEAEKYADELYE
FT                   QINYLAIRASNKLAQEKGAYKVFKGSDWNTGEYFARRNYNSPEWQELAKEVAEKGLRNA
FT                   YLVAVAPNMSTAQIAGSTASIDPIYSAFYYEEKKDYRRPVIAPDLNLSTYPYYEKGAYK
FT                   VDQFASVRQNGRRQRHVDQSLSFNFYVPSGIKASKLLELHMTAWNEGLKTTYYVRSNDI
FT                   DVEECEWCSS"
FT   regulatory      complement(139144..139149)
FT                   /gene="lmo2155"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      139658..139663
FT                   /gene="lmo2156"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        139672..140013
FT                   /transl_table=11
FT                   /gene="lmo2156"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5B1"
FT                   /protein_id="CAD00234.1"
FT                   /translation="MFTKKRGLMLLAAVLLTVCAIWEYAMPTDAAVKSYYVKVEDAGKP
FT                   VQKNQFKGFKYVSNVYDDKGKQKQLTFYSEKELTKNEQFKVLVGENKMVVNYKKIKNVP
FT                   DKIKYLAEK"
FT   regulatory      140018..140054
FT                   /gene="lmo2156"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(140018..140054)
FT                   /gene="sepA"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(140068..141969)
FT                   /transl_table=11
FT                   /gene="sepA"
FT                   /db_xref="GOA:Q8Y5B0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5B0"
FT                   /protein_id="CAD00235.1"
FT                   /translation="MTKKVLPKEASEFTKKVNEKVKKSLPFENTKDFDDAKKGFIGTWD
FT                   HVKVDTEDGHAVWDLEDYKFIEGEAPDSVNPSLWRIAQLNMTNGLFKVTDRVYQVRGFD
FT                   MSNTTIMEGDTGLVITDTLMSVETARAALDLYYEHRPKKPIKAIIYTHSHADHYGGVAG
FT                   LISKEDVASGKVALIGPEGFMEAAVSENIFAGNAMIRRAEYMYGSRLSRGELGQVDAGL
FT                   GKTASKGHMSLLAPNDTITFDHEKRVVDGIEVEFLMAPNTEAPSEHMMYFPQFKLLNIA
FT                   EDAVHNLHNILTLRGAQIRDAYEWWKDIDKAIRAFGDKYEVCIGQHHWPTWGNEEINDM
FT                   LIHQRDAYKYMHDQTLHFINKGLTAIEVAEAVKFPPALEEKWYLRGYYGTLNHDVKAIY
FT                   QFYLGWYDGNPADLYPLPPEDVAKKYVEFMGGVDEVLKKARVSYEAGEYRWVAEVVKHA
FT                   VFADGENGEARALLADALEQLGYQSESGPWRNVFLAGADELRNSVPDEVISGVTLDIVE
FT                   GMPFNLILDYMGIRLNGERSIGKRISMNWKLTDVDENYHLLVNNSVLIYREGEVDDKAD
FT                   LTLTTTRDTFNHIFGGVKSFEAAFADQTAKLEGDVKKFGEFASLLDEFNPVFNIVTP"
FT   regulatory      complement(141979..141984)
FT                   /gene="sepA"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(142054..142087)
FT                   /gene="lmo2158"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(142097..142282)
FT                   /transl_table=11
FT                   /gene="lmo2158"
FT                   /note="similar to B. subtilis YwmG protein"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q929L4"
FT                   /protein_id="CAD00236.1"
FT                   /translation="MSEDKGMKDKAKGLKDKVVGDAKDKFGKATDDKGKQVEGKAQKAK
FT                   GEVEDKTGDAKKKLSE"
FT   regulatory      complement(142291..142296)
FT                   /gene="lmo2158"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(142376..143425)
FT                   /transl_table=11
FT                   /gene="lmo2159"
FT                   /note="similar to oxidoreductase"
FT                   /db_xref="GOA:Q8Y5A9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5A9"
FT                   /protein_id="CAD00237.1"
FT                   /translation="MKKYQLVIVGYGGMGSYHVTLASAADNLEVHGVFDILEEKREAAA
FT                   EKGLKIYESFEAVLADEKVDAVLIATPNDSHKELAITALEAGKHVVCEKPVTMTSEDLL
FT                   AIMDVAKKVNKHFMVHQNRRWDEDFLIIKEIFEQKTIGEMFHLESRVHGANGIPGDWRH
FT                   LKAHGGGMVLDWGVHLLDQLLFLVDSNVKSVSANLSFALGDEVDDGFVTFITFENGITA
FT                   QIEVGTTNFIKLPRWYVKGTEGTGIIHDWDLSGEIVQPTALAKTSEPTPIKAGQGLTKT
FT                   MAPPSEEATNTLSLPAPAKLAPSFYNNFIDVLNNTSEPIVQNEEVYQVLKLIEAIFEAA
FT                   ETNRTIHSI"
FT   regulatory      complement(143433..143438)
FT                   /gene="lmo2159"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(143448..144416)
FT                   /transl_table=11
FT                   /gene="lmo2160"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5A8"
FT                   /protein_id="CAD00238.1"
FT                   /translation="MKLGVFTPLFANLSLEEMLDKVKAAGLDAVEIGTGGNPGNHHCPT
FT                   DELLASEAARKEYLEKFTSRGLTISAFSCHDNPISPNKEEAAASDEILRKSIKLASLMN
FT                   VPVVNTFSGTAGDSDDAKAPNWPVIPWPTVYSDIKTWQWETKLIPYWKEIGELAAASGV
FT                   KIGIELHGGFLCHTPYTILKLREETNDSIGVNLDPSHLWWQGIDPVGAIKILGKAGAIH
FT                   HFHAKDTYLDQDNINMYGLTDMQPYGDVQTRSWTFRSVACGHSLTEWSDIMSALRTYGY
FT                   DYVVSIEHEDPLMSIDEGFDRAVTNLQSILIKDKPLDMWWA"
FT   CDS_pept        complement(144419..145141)
FT                   /transl_table=11
FT                   /gene="lmo2161"
FT                   /db_xref="InterPro:IPR009381"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5A7"
FT                   /protein_id="CAD00239.1"
FT                   /translation="MTRVTVWNEFLHEKEDDAVLAIYPDGIHGQIASFLEKAGIEAGTA
FT                   TLEEPEHGLTEEVLANTDVLIWWGHMGHDRVEDKIVDRVQKRVLEGMGLVVLHSGHMSK
FT                   IFMRLMGTSCDLKWREANERERLWVVDPTHPIAKGIGEFIELDEEEMYGEHFDIPTPDE
FT                   LIFLGWFEGGEVFRSGITYKRGNGRIFYFQPGHESYPTYHHPDIQQVIINGVHWCAEGR
FT                   KNYPAYGNHQPLEKIGRK"
FT   regulatory      complement(144425..144430)
FT                   /gene="lmo2160"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(145143..145883)
FT                   /transl_table=11
FT                   /gene="lmo2162"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5A6"
FT                   /protein_id="CAD00240.1"
FT                   /translation="MKAKIALQLWSVKEACEDDFFGTLEKVAEMGYDGVEFAGYYGKSA
FT                   SEIKAKLAELGLEVAGSHISKEQLEVDLENVILFERELGNEYIICPYADFKTKQEWLAF
FT                   SEKLLEITKTVQQAGMHFGYHNHAHELDKLDDEIILDSLLKNVPEMVAELDTYWIEYAG
FT                   IGVIPFIEKYRNRVPLIHIKDKSRANKESTIIGEGVLDVPGFVKTALHSGTKWLIIEQE
FT                   AFTQDPLTSVAKGYTYLANVLEEN"
FT   regulatory      complement(145151..145156)
FT                   /gene="lmo2161"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(145891..145896)
FT                   /gene="lmo2162"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(145899..146975)
FT                   /transl_table=11
FT                   /gene="lmo2163"
FT                   /note="similar to oxidoreductase"
FT                   /db_xref="GOA:Q8Y5A5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5A5"
FT                   /protein_id="CAD00241.1"
FT                   /translation="MTLKVGIIGCGGIANGKHMPSLLKAEKAEMVAFCDIVLEKAEAAA
FT                   KEFGSENASVYTNYVELLQDKSIDVIHVCTPNISHAEISIAAMEAGKHVMCEKPMAKTT
FT                   EEAKSMIEAAERTGKKLTIGYQNRFRKDSDYLHQVCENGELGDIYYAKAKAIRRRAVPT
FT                   WGVFLDEEAQGGGPLIDIGTHALDLTLWMMDNYKPKYVVGNSYHKLAKKENAANAWGSW
FT                   DPNKFTVEDSAFGFITMENGATIVLEASWTLNTLDVGEARTSLSGTEGGADMEDGLRIN
FT                   GEAHSQMYEKKIQLEAGGVDFYDGTGDDPALIEAEQWLEAIEKNTDPVVKPEQALVVTQ
FT                   ILEAIYESSKTGQPVYFN"
FT   regulatory      complement(146985..146990)
FT                   /gene="lmo2163"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(147050..147928)
FT                   /transl_table=11
FT                   /gene="lmo2164"
FT                   /note="similar to transcriptional regulator (AraC/XylS
FT                   family)"
FT                   /db_xref="GOA:Q7AP56"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP56"
FT                   /protein_id="CAD00242.1"
FT                   /translation="MSEYLEIPELNKAFPFRSFVNEGEVLVYPHWHKEIEIIYALKGSL
FT                   NLGINDMPIQLKEGEIQVINGGDVHYFLASPSSERIVIQFDLSLFQEEMQMDDKMQTLR
FT                   EMLTEMAHLSREWPEETVAKMQSLIMNIHSESSGEKPGKHYILKADLLAIIGLIYREIP
FT                   QIKTQPDSVISEDAVLKSQETLHKLDQIFSYVEKHYQEPVSLQEVANYTGFSTYYFTKF
FT                   FKRNTGMTFVTFLNDYRLNKAKWMLLNEAFPVTEVAELAGFSSVKTFHHAFKRAMGVAP
FT                   LKYRKTIYGNN"
FT   regulatory      complement(147935..147940)
FT                   /gene="lmo2164"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(147968..147991)
FT                   /gene="lmo2165"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(147998..148693)
FT                   /transl_table=11
FT                   /gene="lmo2165"
FT                   /note="similar to transcription regulator CRP/FNR family"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5A4"
FT                   /protein_id="CAD00243.1"
FT                   /translation="MNTLEKRQHEILTNPLHFCKKSGDFAKHSMSIKLSKNELFDVDFV
FT                   TGIYFVEKGIVMKGTQIDDYIGYDQLLKHGDVCNFSSFMSSDLKRNIGAQLLSPSSSVI
FT                   TAVDRDFFIFMVEKHVSIEEFMLYQAKKEIMILQRRCLLNTLKVKDRVKHLIAAIGYEY
FT                   GISNGDNIQIPQELSTTFLSKFMGITREYLSLTLSELKKEGYLLNTKIPVVINVEKLFN
FT                   EIPYESLIL"
FT   regulatory      complement(148702..148707)
FT                   /gene="lmo2165"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(148946..149617)
FT                   /transl_table=11
FT                   /gene="lmo2166"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5A3"
FT                   /protein_id="CAD00244.1"
FT                   /translation="MHSDEEIFKETTPKALLQLLKKDYTFHDYCYQEIIPRGKEIKMNN
FT                   SKGFKIYLVESGYFSYCLQNEYGDSGIISFVGGEIAINLIPIIKEEPEESVLRSLTEVH
FT                   CWVLDPDFVERVLDESGQKAKYLLSNLLYTRKVYFKASKRNFMKKELRIRACLKEIGLY
FT                   MGRVTKDKEFILPDEINNSILAQYANTTREYTNIIVLKLRKEGILDDSHKPWVIKKIDT
FT                   L"
FT   regulatory      complement(149625..149630)
FT                   /gene="lmo2166"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(149653..149673)
FT                   /gene="lmo2167"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(149683..150300)
FT                   /transl_table=11
FT                   /gene="lmo2167"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5A2"
FT                   /protein_id="CAD00245.1"
FT                   /translation="MTKIKRIMTGIIQENCYIIYQDNVALIVDPGDEASKIEAEIAKLE
FT                   VKPVAVLLTHCHYDHIGALEEIRKTYNIPVYVSPLEQEWLSNPELNLSAHIAGKAIIAQ
FT                   PAENEFTLGEYNIEGFRFKVVPTPGHSIGSVSFIFDEFVVVGDALFKGSIGRTDLYTGD
FT                   FDMLINSIKTQLFVLPDDFPAYSGHGDVTTIGHEKKTNPYFN"
FT   regulatory      complement(150308..150313)
FT                   /gene="lmo2167"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      150418..150423
FT                   /gene="lmo2168"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        150431..150820
FT                   /transl_table=11
FT                   /gene="lmo2168"
FT                   /note="similar to glyoxalase I"
FT                   /db_xref="GOA:Q8Y5A1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5A1"
FT                   /protein_id="CAD00246.1"
FT                   /translation="MTAKMLHTCIRVKNLTESITFYEKALGLKEVRRKDFPDFEFTLVY
FT                   MAFEEGGFELELTYNYDQKEAYDLGNGYGHLAVGVLDVRALLKEHQEAGFTVTDLKGLP
FT                   GEDPFYYFLTDPDGYKTEIIQDGAL"
FT   CDS_pept        150846..151004
FT                   /transl_table=11
FT                   /gene="lmo2169"
FT                   /db_xref="GOA:Q8Y5A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y5A0"
FT                   /protein_id="CAD00247.1"
FT                   /translation="MGKYFVIILIALAINGISILFHNDIASLIAVIITAVLLIYLMVDL
FT                   TKMYRRK"
FT   regulatory      151010..151042
FT                   /gene="lmo2169"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(151010..151042)
FT                   /gene="lmo2170"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(151050..151979)
FT                   /transl_table=11
FT                   /gene="lmo2170"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y599"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y599"
FT                   /protein_id="CAD00248.1"
FT                   /translation="MSLTEMLQIKYPILQGAMAQIATYELASAVSNAGGLGIIASGGMS
FT                   ADALREQIRLCKEKTTKPFAVNIMLMMPNCPELVDVIIEEDVRVVTTGAGTPKPFMEKF
FT                   KAAGIKVIAVIPSVKIAQKMEEIGVDAVVAEGTEAGGHVGETTTMALVRQVVSAVNIPV
FT                   IAAGGIADGHGMAAVYALGASGVQIGTLFLVAEECPVPASFKQAVLDATDTSTTVTGRR
FT                   NGAPVRSIKNPMIQKYVELENENASRDKLEELTLGSLRKAVHEGDVENGSVMAGQICGM
FT                   LTEIRSTSDIIENLMKESKQVASNLVIQ"
FT   regulatory      complement(151987..151992)
FT                   /gene="lmo2170"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(152001..153224)
FT                   /transl_table=11
FT                   /gene="lmo2171"
FT                   /note="similar to antiporter proteins"
FT                   /db_xref="GOA:Q8Y598"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y598"
FT                   /protein_id="CAD00249.1"
FT                   /translation="MTKEINRWGVLIGSVGVLLCTGAVYAFSVFAGPLSAAHGWTIPQV
FT                   VMAFTINAAIGPIPTILGGILTDKGKAKWAILIGGILFGLGFALTGFATSTTMLYLSYG
FT                   VLAGLGQGFAYSGCLSNTIRLFPDKRGLASGLITAGMGGATIIAAPIANYLIETYNVMT
FT                   AFKIMGAVYIAVVIGCSFLIRVAPAGYTPKGWTPPANNVAGMVNVPWTGMVRTVTFYLI
FT                   LLMLGIGAFSGLMIASNASLIGQNMFGLTAASAAAYVSIYSLSNCLGRVVWGAVSDRLG
FT                   RSNTLMIIYTVIALSLLALTTLQSVVGFVIGIIGLGLCFGGTMGVFPSIVMENYGPKNQ
FT                   GVNYGIVFIGYSTAAFFAPKMAAQIAGQNGGDFTQAFYIAIALAAVGLCINIVYKLREK
FT                   KQPTKELA"
FT   CDS_pept        complement(153221..154804)
FT                   /transl_table=11
FT                   /gene="lmo2172"
FT                   /note="similar to propionate CoA-transferase"
FT                   /db_xref="GOA:Q8Y597"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y597"
FT                   /protein_id="CAD00250.1"
FT                   /translation="MSKVIKASEAAKLLKDGDTVAFSGFGLACVNEEMAIAVEKRFLEE
FT                   GAPRNLTVMHASALGDRREKGMSHWGHEGLIKRWIGGIAIASPKMAKLIEEDKCEAYNL
FT                   PQGVITQLYREIAAKRPGVITKIGMGTFVDPRIEGAKMSASSKDNLVELLTIHNEEWLF
FT                   YPSFPIQVALIRGTVADEFGNLTLEKEGLHMEVLPIAQAVRNSGGIVIAQVESVAKKGS
FT                   LNPKDVRVPGILVDHIIISEPENHFQTENTQYNPAFSGHIQVPLGDIEPLPLDDRKVIA
FT                   RRSAAELEPQTILNLGVGIPVNVSTVAAEEGVSDQLILTTEAGSVGGVPAGLADFGHAY
FT                   NSEAIVDHHSQFDFYDGGGLDLSVLGLAQTDESGNVNVSKFGSRVAGCGGFINISQSAK
FT                   KLIFAGTFTAGGLKTRVAAGKLEILQEGKAKKFIKQVQQITFSGEYASTTNQTILYVTE
FT                   RAVFRLENGKMVLTEIAPGIDLEKDILGQMEFEPIIASDLKVMDGGMFSEEWGGLKAII
FT                   EKQTREGVSI"
FT   regulatory      complement(153234..153239)
FT                   /gene="lmo2171"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(154812..154817)
FT                   /gene="lmo2172"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(155034..156401)
FT                   /transl_table=11
FT                   /gene="lmo2173"
FT                   /note="similar to sigma-54-dependent transcriptional
FT                   activator"
FT                   /db_xref="GOA:Q8Y596"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y596"
FT                   /protein_id="CAD00251.1"
FT                   /translation="MFDLMDNLLGVQSFGELNKDMPTTLFVTDADGNILISNKFTALTV
FT                   GMSLEELLRCNVRDLVEDGVYNDSVTLEAIRTKQKKTKVINTKKGFSIRSTSTPILYPD
FT                   GTVHLVVTMSDETQPDSFKTWRGEAISGNKESLLLEDYKENDGTVIVAESVAMKQIVRV
FT                   CNQIAPFDSKVLLYGESGTGKEVLSRYIHEKSKQAAGPFISINCAAIPKALFESELFGH
FT                   EKGSFTGADIEKPGMLELADGGTLFLDEISEMPLELQAKMLRVLETGEVRRLGSTTETK
FT                   RRFRLISATNRNLGEMVEKGTFRRDLYYRINVVPVHIPALRERPQDIIGLARQFIQKFN
FT                   QKYQKDFQLSGDKTKELLSHNWPGNVRELRNKIERLVVMSGNKEVTVAETDDFALDLHF
FT                   KEQTKKDSLYLKDYLQGVEKHFILRVLEESNGNVTKAASTLGIHRSVLYRKLKTLH"
FT   regulatory      complement(156410..156415)
FT                   /gene="lmo2173"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(156507..157580)
FT                   /transl_table=11
FT                   /gene="lmo2174"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y595"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y595"
FT                   /protein_id="CAD00252.1"
FT                   /translation="MVEQLVSNAAILLAGFYIISLVYKEPITKELSTNKKIVIGIWAGL
FT                   LGFALMVFGIPISNNVIVDLRHIPIIMVGFYGGPIPAIVSAIIISASRFLLSVNSAAIM
FT                   AAVVMMLIGIITAIFGKRIEKFKIWGVFILNIIACSFVVINLHLILARESHFWINMTVF
FT                   VLIALVIGAVSAGLMSNMIKSKQLFQKYEQDSTLDYLTKLSNVRQFDEKINHVMDAGSR
FT                   QVTLMLIDIDYFKNINDTYGHDAGDAILKQLAIILKRNTSDGSEAFRNGGEEFSIVLLD
FT                   CPIEKGNFFAEQVRRETEEYDFMIPSGQVVKITISVGVSSSKDGANTSEGLFKSADEAL
FT                   YKAKLTGRNQVCIADGN"
FT   regulatory      complement(157585..157590)
FT                   /gene="lmo2174"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(157712..157743)
FT                   /gene="lmo2175"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(157754..158515)
FT                   /transl_table=11
FT                   /gene="lmo2175"
FT                   /note="similar to dehydrogenase"
FT                   /db_xref="GOA:Q8Y594"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y594"
FT                   /protein_id="CAD00253.1"
FT                   /translation="MGKLNGKVAVVTGAASGMGQQIAILFAKEGAKVVVADLNLEAAQK
FT                   TVELVEKEHGTGLAVVANVTKQEDIENMINQAIEAFGTLDILVNNAGIMDNFVPAGELT
FT                   DELWDKVFAINTTGVMRATREALHIFEEKGQGVIVNIASAGGLFGSRAGAAYTASKHAV
FT                   VGFTKNVGFQYANKNIRCNAIAPGAVNTNIGTTIYAPDEFGQERAMIGMGINPRAGDAS
FT                   EIAKVALFLASDDSSFVNGTVITADAGWTAY"
FT   regulatory      complement(158524..158529)
FT                   /gene="lmo2175"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      158682..158687
FT                   /gene="lmo2176"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        158697..159260
FT                   /transl_table=11
FT                   /gene="lmo2176"
FT                   /note="similar to transcriptional regulator (tetR family)"
FT                   /db_xref="GOA:Q8Y593"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y593"
FT                   /protein_id="CAD00254.1"
FT                   /translation="MDRRVKKTKKAFNQALFTLLDQKPFQQITITDIVTEADVNRGTFY
FT                   KHYRDKEELLDSIIEEILMDLKSAYQDPYLHTSHFSIQTLTPSMIKIFDHVYHHQAFYR
FT                   QVIKSTIRPSFQNQVCDVIRELILDDVASFPDSSEANLQLLATYQAHAIFGMIVFWAEE
FT                   DFSHSPAYMSEQLLYIIHAKTQQV"
FT   regulatory      159353..159358
FT                   /gene="lmo2177"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        159366..159713
FT                   /transl_table=11
FT                   /gene="lmo2177"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y592"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y592"
FT                   /protein_id="CAD00255.1"
FT                   /translation="MNDHRILNALSYFSILFAPIIVPVLIWIFAKSEEVSHHAKVALLT
FT                   HIIPTIAGFLCFSSIFVTATTSGGLLANVSLFVTGSLFVFTLVAVVGLFIFNIVRGIQM
FT                   LCEKTEEDIWI"
FT   regulatory      159722..159747
FT                   /gene="lmo2177"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(159722..159747)
FT                   /gene="lmo2178"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(159753..164591)
FT                   /transl_table=11
FT                   /gene="lmo2178"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8Y591"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y591"
FT                   /protein_id="CAD00256.1"
FT                   /translation="MKNIRHWKKLVIAMVIGLLVFQNVSPVLATMTDDETANTTLKIIK
FT                   EDKDTKEKINGSTFEIKNKETSETSDLTISANGEATMDSLLPGDYLVKEKVAAKGYALD
FT                   EKEYSVTLTEKEEVITSVSAKVQEETTKEAATPVKKATQNANLKAAITDNIFNKVTLKD
FT                   GNGDEINTSDRIQNGSGVVLNMNFAFSGKNYKAGDTFTTVLPDAFNFGNKNLSGNFLPS
FT                   TEAEWSLDVTTRELTITFLKDGIQEGDYDVNISTAFKVFTSTEETIQEVVFKTAGKDTI
FT                   YQIEVVPVVNYPTTVAITANPGVVNPTKGQVDAKFNLTKEKDAKGELKLTDYTSGGTTT
FT                   IDKDSIKVYSSDVSAGGTFIGTKKLLVEGTDYTLTYSATSLTVTLNGGLAGKGYQVTYD
FT                   RTINKPSDSLSYMSTQAYTVGDAGTLSSNSAYVYLTMTNYKHLEKKATYNGSTQSIDWK
FT                   INFNFDQDEISPSTVLTDVLADNDVEYVADSLKIKRVTFNATNGSPIVGSDASSDWTTS
FT                   AISANGNFNLTYKNTNTNAYEITYSTKITDFSDRKIKNEITDENGVSADATIAIQPDLL
FT                   KKEAGTIDYFNNTMTWKITANSDRIKMGNLNITDEFSTGVKALKSYTVRAYTDNTNSVL
FT                   LTEGKDYTIDKDVTPAGFYIQLIGDYASTDKKIVVDFVTDIDLSDVTKTIDNKASISYY
FT                   DGGIIKYVDEVTASMTPDPGMMTNGGKYGSYNSTTGNIDWIVSVNAMAKNYDNLIFDDA
FT                   IPTGLTYVEGSLQYRNVASTSEMMNLYIPLNSVGTVAKTGDKNYPTKVDTTGNKLHLEF
FT                   ANLENSRVFIKYSTKPNENWYFYSYVQNTAKVSDNGVGEKSYSYQAYASKLFNAMTKTA
FT                   TIDPSFDNKVNWIVTLNNISADRPINNPTITDTMKTGTTGAQVVKSSFKVMNETTGEDI
FT                   DSKYYDITYTDNNFTIQFKDYKATAPIKVTYSTISLMSGLVSNTATTASPDYGSLPMTY
FT                   KSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQEAT
FT                   TDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADIATSVTIENTEQTG
FT                   SVVLLKEDSATKDAIAGAEFELQNADGTKVADNLVSNADGKIEVTDLAPGDYQFVETKA
FT                   PTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNA
FT                   TGTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNV
FT                   TKENVAKTGSVVLTKLDSKSRSNLAGAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPG
FT                   DYQLVETKAPTGYDLDATPVEFTIEFNQKAPIQVTKTNTMSTGSVVLTKTDGETKALLA
FT                   NATFKLVDEDNNVTENLTTDASGKLEITNLAPGDYQLIETKAPAGYELDTVPVDVKITF
FT                   DQKETLQVTKTNLKTVVSGKVIAEFVDTKGNVLAEKEIHTGIVGDKYATKAKDIKGYKL
FT                   TKQPTNKEGVFKETEQKVTFVYEKNKAPIVVNPDKPVTPVKPTKPVDPAKKPTVKTSLP
FT                   STGDESPYGIIFTGLFASFMGLFLLRKSKKIND"
FT   regulatory      complement(164602..164607)
FT                   /gene="lmo2178"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(164772..168230)
FT                   /transl_table=11
FT                   /gene="lmo2179"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8Y590"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y590"
FT                   /protein_id="CAD00257.1"
FT                   /translation="MNHLKKLVSILICTLLIVSLLPFSVWADSQERDGTDVEEITTKEK
FT                   VTQETTSNETTSEPLKGTTVNKAINAKSFPTGNYSGDFSINSQKDVIESGQTVNYNIYL
FT                   KITGPNTRYQNAKLVINLPKNGEFNQSLNELKIAGATPSYNKTTRQLVYTYQTLNSGVV
FT                   DKVILKMTTKNGYTPNGTKLVVTGELSADNLSEKVTEQAETTVNATATTALSNDFTKVE
FT                   NSINNNPSQGDIGIWSFNLNIPKKSTGSLFMEEGKKIVIEYTLADKLDYLGVAGDTPEP
FT                   TKVEGQKLTWEIAAPTYLEQEKANSLLNKTFQIRTFFQPTIPNFATVENKAVATTNFVT
FT                   LTDSIVDTSKASVSVSASDPATIPPTIGSVYAPAHRGPVDANWGIATVTGNPDIKVYDT
FT                   AKLGFSLMLNSAMNDSPWYDFLYYDAYYNIDDNLNLDYFRSGDFYFKPNVNYPGWAQLK
FT                   KSPKYNLLVKYDGDTDWTTLKEDVELSKMYSRKDLGIPDDKHVSKVWLHFTYAPAGMYA
FT                   ADLSFFTTVKEGYVGEVRNSTQINMYGADSQDYIHYYDDTNPWPEAWKNYAGDRTAQII
FT                   PQPTGKNKFVQGSVVFDDTDGNLINIGDNSISVNLESNKASISRLKGPFEAMVLLPSGV
FT                   KMKNTEQNGFKVTVLNENYQNAGRQLLKVKWDKKTLLPAEKLTAKINVSVAKDTPSNMT
FT                   VEMFGFLQDTDFNVPEVSGTPTISDTKMEIDSNDINQNGNSEESRITSGNHYILNTSNH
FT                   LKISKKAKGNRDKEYSGLANATTNSIVSYQLSLENDSDEKIANMVLMDVLPSENDLGIT
FT                   DNSERGSKFNLALTKAVEVPKEWKDKVEVTYSTAKNPKRAGILDKHTIYPIGTEPLVDN
FT                   TEATQADWLTASEVKDWSNIYSFKIELKEGIEWIPGKSMKIQFDLKTPKKNQIDKTLLK
FT                   QQTKKEDRAAWNSFAVAVNNSQVIEPAQVGVALDDSVAPVTVQYVDQNHKQIASPETLT
FT                   GAYGEKFTAKQKKINNYSLVKIPANVSGTFNEKAQTITFIYQKVTAGRIIVNYVDKNGE
FT                   KIADSIVLNGKLNSSYTTSSKKISGYKLYQTPKNATGKFLNTSQTVTYVYERTSNLSIS
FT                   SSNKGTENVKKLAKLPHTGDSTTTNLWVIIGLFMLSGAFVIMKKR"
FT   regulatory      complement(168238..168243)
FT                   /gene="lmo2179"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(168380..168417)
FT                   /gene="lmo2180"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(168424..168900)
FT                   /transl_table=11
FT                   /gene="lmo2180"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y589"
FT                   /db_xref="InterPro:IPR008840"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y589"
FT                   /protein_id="CAD00258.1"
FT                   /translation="MKLYELTDNYLKVQEFLEENNTDAVKDTLDALTDSFHDKSENIVK
FT                   IIKSLAADAEMAGIEAKRLLKRKQALENNVQNLKNYLQTEMERMEIRKINSTLFTIQIQ
FT                   KNPPSVEIVEEALLKPFFLLQEPKIDKKRIAEILKSGEEVKGARLVESESIRIR"
FT   regulatory      complement(168907..168912)
FT                   /gene="lmo2180"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(168961..169701)
FT                   /transl_table=11
FT                   /gene="lmo2181"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y588"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR015986"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="PDB:5JCV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y588"
FT                   /protein_id="CAD00259.1"
FT                   /translation="MKIKSFLGKSLTLVVLGVFLFSGWKIGMELYENKHNQTILDDAKA
FT                   VYTKDAATTNVNGEVRDELRDLQKLNKDMVGWLTIIDTEIDYPILQSKDNDYYLHHNYK
FT                   NEKARAGSIFKDYRNTNEFLDKNTIIYGHNMKDGSMFADLRKYLDKDFLVAHPTFSYES
FT                   GLTNYEVEIFAVYETTTDFYYIETEFPETTDFEDYLQKVKQQSVYTSNVKVSGKDRIIT
FT                   LSTCDTEKDYEKGRMVIQGKLVTK"
FT   CDS_pept        complement(169705..170484)
FT                   /transl_table=11
FT                   /gene="lmo2182"
FT                   /note="similar to ferrichrome ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="GOA:Q8Y587"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y587"
FT                   /protein_id="CAD00260.1"
FT                   /translation="MEVRDVNFSYNGTDAILKNVSFTIQKNKINTIVGPNGSGKSTLLE
FT                   ILARLLSPNSGDVLLEGKSIFEWKAKEFAQNVAIVHQSNVLPNELMVKELLYFGRLPYK
FT                   NWRMTRTKEDDLAVERALMQTELTEKAEKFVDSLSGGERQRVFIATALVQDTPILLLDE
FT                   PTTFLDMYFQLEILELVKRLNQEENLTIVMILHDLNQALMYSDHLIVMKNGEVVAKGEP
FT                   EELLTTDLIAETYGVVADVLNDANNGKYIVPQRRKEF"
FT   regulatory      complement(169710..169715)
FT                   /gene="lmo2181"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(170465..171454)
FT                   /transl_table=11
FT                   /gene="lmo2183"
FT                   /note="similar to ferrichrome ABC transporter (permease)"
FT                   /db_xref="GOA:Q8Y586"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y586"
FT                   /protein_id="CAD00261.1"
FT                   /translation="MTIKQKSSFGAVIVLLIGTILWAVQAGSLSMSIPAFLSGIFSGGN
FT                   EMVDVVIDLRFPRIIIALLAGAALSVSGLLLQAVMRNPLADAGVIGISAGAKFFSFVII
FT                   LFLPELYFWLPLFSFIGGALACFLVFLFSYRSDFNPLRFIIIGIAINAVFTGLSDALSS
FT                   QVALVSSQSASSAASLAMKKWSDVETLLIYVTIGLICALLLAKWCNVLGLENKMARGFG
FT                   VPVNKTRIWLALIAVLLASITTAVVGVIAFVGLLVPHIARKLVGGNYQILVPFSILFGA
FT                   LLLLFADTIGRTLFQQMEIPASVIMLIIGGPFLIFLMRKGDFYGSKGR"
FT   regulatory      complement(170491..170496)
FT                   /gene="lmo2182"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(171444..172316)
FT                   /transl_table=11
FT                   /gene="lmo2184"
FT                   /note="similar to ferrichrome ABC transporter (binding
FT                   protein)"
FT                   /db_xref="GOA:Q7AP55"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR019957"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="PDB:5JOQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP55"
FT                   /protein_id="CAD00262.1"
FT                   /translation="MRKMAVISLVLLLFLVGCGKEEAAQKPEQKTDKEPKIVATTVAIT
FT                   EIMDKLDLPLVGIPSSSKKLPKRYADVKETGSPMGPDLEIIRMLKPDMVLSTKTLEADL
FT                   KSGFEGADLEADFLDFTSIASMQTEIKNLGAKFDRIEEATKLNKDLTSDIDQVKSNVAK
FT                   KKKPTVLILMGVPGSYLVVTEHAYIGDLVKLAGGENVIKDQKVEYLASNTEYLQSANPD
FT                   IILRAAHGMPAEVVKMFDEEFKTNDIWKHFDAVKNNRVYDLDENLFGMTASLNAPEALK
FT                   EMEKMLYDN"
FT   regulatory      complement(171463..171468)
FT                   /gene="lmo2183"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(172325..172329)
FT                   /gene="lmo2184"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(172403..174112)
FT                   /transl_table=11
FT                   /gene="lmo2185"
FT                   /db_xref="GOA:Q7AP54"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR017502"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="PDB:4MYP"
FT                   /db_xref="PDB:4NLA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AP54"
FT                   /protein_id="CAD00263.1"
FT                   /translation="MKKLWKKGLVAFLALTLIFQLIPGFASAADSRLKDGGEYQVQVNF
FT                   YKDNTGKTTKESSEADKYIDHTATIKVENGQPYMYLTITNSTWWQTMAVSKNGTRPEKP
FT                   AQADVYQDRYEDVQTVSTDAAKDTRVEKFKLSSLDDVIFSYMHIKVDAISYDHWYQVDL
FT                   TIDPSTFKVISEPAVTTPVTLSDGIYTIPFVAKKANDDSNSSMQNYFNNPAWLKVKNGK
FT                   KMVAMTVNDNKTVTALKTTLAGTLQDVKVVSEDKDANTRIVEFEVEDLNQPLAAHVNYE
FT                   APFNGSVYKGQADFRYVFDTAKATAASSYPGSDETPPVVNPGETNPPVTKPDPGTTNPP
FT                   VTTPPTTPSKPAVVDPKNLLNNHTYSIDFDVFKDGTTETSMMESYVMKPALIKVENNQP
FT                   YVYLTLTNSSWIKTFQYKVNGVWKDMEVVSGDINKNTRTVKYPVKDGTANTDVKTHVLI
FT                   EDMPGFSYDHEYTVQVKLNAATIKDITGKDVTLKEPVKKDILNTGNVASNNNAGPKLAK
FT                   PDFDDTNSVQKTASKTEKNAKTNDSSSMVWYITLFGASFLYLAYRLKRKRLS"
FT   regulatory      complement(174119..174124)
FT                   /gene="lmo2185"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(174127..174750)
FT                   /transl_table=11
FT                   /gene="lmo2186"
FT                   /db_xref="GOA:Q8Y585"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR017502"
FT                   /db_xref="InterPro:IPR019909"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y585"
FT                   /protein_id="CAD00264.1"
FT                   /translation="MKKVLVFAAFIVLFSFSFLSTGLTAQAALKDGTYSVDYTVIQGDS
FT                   DSASMANDYFDKPATVTVNGGKSTVSLQVNHSKWITGLWVEGNAVSVTSKNASSDTRKV
FT                   SFPVSTLSNPVNAKIKVDIDDDDLNYHHEYQIKLRFDEGSAKALAGAVKSSDNNTTTPA
FT                   TKSDSSNKVTNPKSSDSSQMFLYGIIFVATGAGLILLKRRAIFK"
FT   regulatory      complement(174759..174764)
FT                   /gene="lmo2186"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(174918..174943)
FT                   /gene="lmo2187"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(174961..175221)
FT                   /transl_table=11
FT                   /gene="lmo2187"
FT                   /db_xref="InterPro:IPR021464"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y584"
FT                   /protein_id="CAD00265.1"
FT                   /translation="MEFEDERLLREVLLFARSVDTKINDMSLEVIDFGNLRDYTKNEVL
FT                   LTLYWLEENGFLIRNNNIAEKRYTLTLKGELLYDRFSQIEE"
FT   regulatory      complement(175229..175234)
FT                   /gene="lmo2187"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(175467..175494)
FT                   /gene="lmo2188"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(175520..177325)
FT                   /transl_table=11
FT                   /gene="lmo2188"
FT                   /note="similar to oligoendopeptidase"
FT                   /db_xref="GOA:Q8Y583"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y583"
FT                   /protein_id="CAD00266.1"
FT                   /translation="MSKTNALPLREEVPENLTWDLTTIYPNDEAWEKAFTDLQKITEES
FT                   DQFKGRLSESSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLV
FT                   TKLMSALSYYDPEILAMDENVLKQFLDENKDLQLYDHLLEELNLSRPYILSEKEEALLA
FT                   NAGEVLGSSSNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRRDAFHG
FT                   VYSVYEGLKNTLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKSVNA
FT                   NASLLHRYVKLRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGDEYQ
FT                   AILKEAFDSRWIDVMENKGKRSGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVH
FT                   SYYTRKNQPFVYGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGT
FT                   VFRQTQFAEFEHAIHQADQQGVALTADFLTETYFDINKKYYGEAMVYDAEIGYEWSRIP
FT                   HFYMNYYVFQYATGFSAASALSAKILTEGQDAVTAYIDFLKAGSSDYPIDVLKKAGVDM
FT                   ATPNPVDDALKVFEQKLDELEELVK"
FT   regulatory      complement(177334..177338)
FT                   /gene="lmo2188"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(177398..178513)
FT                   /transl_table=11
FT                   /gene="lmo2189"
FT                   /note="similar to a putative competence protein from
FT                   streptococcus pneumoniae"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="InterPro:IPR021176"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y582"
FT                   /protein_id="CAD00267.1"
FT                   /translation="MIIIFTARNNIGETFTITKMNVERIKQEERLFCKSCASPVMIKAG
FT                   QIKIPHFAHEKTMKCAFASEGESEEHLAAKKQIMAWFCYQRIPVEIESYFPEINRQADI
FT                   FVNGKTVIEFQRSSISISEMIQRTMDYLSIGLEVHWILGQVVKKEKGRICLSAFQQAFI
FT                   QSDKKLGYHFWHYSAKREICTLYYHLTFEKGNRFFASEMKFSMKSPLREWNKKLARIIS
FT                   RHAYIKRDREIERQKICFYYAKYKKHGQFMQKLFNAGYYLHYLPKEIGVDVEEQFLVLT
FT                   PAVEWQFDLWEKFFKGLEKGDTFSVESFLESFKSVVSQILTIWLSPNESLKLGKSYLSY
FT                   LIGEGVLSTIPDNRYRVKRKMAFTNIRAAHI"
FT   regulatory      complement(178591..178624)
FT                   /gene="mecA"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(178639..179292)
FT                   /transl_table=11
FT                   /gene="mecA"
FT                   /product="competence negative regulator mecA"
FT                   /db_xref="GOA:Q9RGW9"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RGW9"
FT                   /protein_id="CAD00268.1"
FT                   /translation="MEIERINEDTIKFYISYLDLEERGFNQEDVWYDREKSEELFWDMM
FT                   DELKYEEEFSPEGPLWIQVQALKHGLEVFVTKATIGGKGEDGFDVTLSSPDELAEEKIE
FT                   KLLEENFNPVKKEALGEDDTLEFILEFRDFEDAISLSRATGLENLVTKLYSYQGKYYLN
FT                   VEFPENKYDESNIDNAVSILLEYGLESNLTGYMLAEYGKVIFDVPALKQIRKHF"
FT   regulatory      complement(179302..179307)
FT                   /gene="mecA"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(179475..179507)
FT                   /gene="lmo2191"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(179524..179919)
FT                   /transl_table=11
FT                   /gene="lmo2191"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q9RGX0"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR023731"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RGX0"
FT                   /protein_id="CAD00269.1"
FT                   /translation="MVTLYTSPSCTSCRKARAWLEEHDIPYKERNIFSEPLSLDEIKEI
FT                   LRMTEDGTDEIISTRSKTFQKLNVDLDSLPLQQLFELIQKNPGLLRRPIIIDEKRLQVG
FT                   YNEDEIRRFLPRRVRTYQLREAQKMVN"
FT   regulatory      complement(179931..179936)
FT                   /gene="lmo2191"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(180202..180229)
FT                   /gene="lmo2192"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(180238..181206)
FT                   /transl_table=11
FT                   /gene="lmo2192"
FT                   /note="similar to oligopeptide ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="GOA:Q8Y581"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y581"
FT                   /protein_id="CAD00270.1"
FT                   /translation="MTEQREKLLEIHNLKQYFNKGTASEVRAVDDISFDIYKGETLGLV
FT                   GESGCGKSTTGRTIIRLYDATGGEVIYNGKDVHARKSRKEMLEFRRKMQMIFQDPYASL
FT                   NPRMKVKDIIAEGIRIHGLAKTPEETNKQVYDLLETVGLSKEHAGRYPHEFSGGQRQRI
FT                   GIARALAVQPEFIIADEPISALDVSIQAQVVNLLRQLQKEKNLTYLFIAHDLSMVKYIS
FT                   DRIGVMYFGKLVELAPANDLYHAPLHPYTESLLSAIPLPDPNYERTRVRKTYDPTSHNY
FT                   KDGDEIKMREIAPGHFVYCSEEEEVMYKEKHAKLTAEAAAK"
FT   CDS_pept        complement(181203..182279)
FT                   /transl_table=11
FT                   /gene="lmo2193"
FT                   /note="similar to oligopeptide ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="GOA:Q7AP53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP53"
FT                   /protein_id="CAD00271.1"
FT                   /translation="MEKLLEVKDLNISFHTYAGEVKAIRGVNFDLYKGETLAIVGESGS
FT                   GKSVTTKSIMRLLPEGNSEIKSGQILFNGMDIAKAHEKQMQKIRGKDIAMIFQDPMTSL
FT                   NPTMTIGKQISEPLIKHQKISKHEAHKTALRLLQLVGIANAEERIKQYPHQFSGGMRQR
FT                   VVIAISLACNPQILIADEPTTALDVTIQAQILDLMKDLQKKIDTSIIFITHDLGVVANV
FT                   ADRVAVMYGGKIVEIGTVDEIFYNPQHPYTWGLISSMPTLDTDDEELFVIPGTPPDLLH
FT                   PPKGDAFAARNKYAMQIDLEEEPPLFKVSDTHYAATWLLHPDAPEVTPPDAVLRRQEQF
FT                   AELHPGMQAVHAKGVEVE"
FT   regulatory      complement(181216..181221)
FT                   /gene="lmo2192"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(182285..182291)
FT                   /gene="lmo2193"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(182297..183331)
FT                   /transl_table=11
FT                   /gene="lmo2194"
FT                   /note="similar to oligopeptide ABC transporter (permease)"
FT                   /db_xref="GOA:Q8Y580"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y580"
FT                   /protein_id="CAD00272.1"
FT                   /translation="MAEHKIAKERFQPAHILDAEAEKINRPSLTFLQDSWLRIRKNKAA
FT                   LVSLIVLALVIIMAIVGPYLSQNLGPEHNINRQITENASLPPKVQGFENMPFWNGHQSI
FT                   GGEDVDIYKQNNIKEGTYYWLGSDTLGRDQFARIWAGTRVSLIIAVVAALCDLVIGVAY
FT                   GLISGYVGGRVDNFMQRVLEVIGAIPNLVVVILMMLILEPGIVSIIIAIAMTSWITMAR
FT                   VVRGQVLKLKNQEFVMASMTLGESTPKILIKHLIPNISGIIIINIMFSIPSAIFFEAFL
FT                   SFIGLGLPAPAASLGVLVNDGYKTLQVLPYMILYPCIVLCIIMIAFNLIADGLRDAFDP
FT                   KMRD"
FT   CDS_pept        complement(183331..184260)
FT                   /transl_table=11
FT                   /gene="lmo2195"
FT                   /note="similar to oligopeptide ABC transporter (permease)"
FT                   /db_xref="GOA:Q8Y579"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y579"
FT                   /protein_id="CAD00273.1"
FT                   /translation="MVKYTLKRVLYMLITLFIIASVTFVLMKFLPGTPYRNQEKLSDEQ
FT                   IHMMNEKYGLNDSIPVQYFNYMTGLVKGDLGVSFQLDNRPVSEILSALIGPSVQLALEA
FT                   MAFGVIFGILLGVIAAMYQNRWPDYTSTFIAILGKSVPSFVFATVLQYWLGAKLQIFPV
FT                   AGWGTFADTILPAFALAMFPLATAARFMRTELIDVFASDYVLLAKAKGNSRTEVAVKHA
FT                   IRNALIPLITVLGPLSVALMTGSLVIENIYSIPGIGSQFVSSIQTNDYPVIMGTTILFA
FT                   VMLVFVILVVDILYGLIDPRIRVSGGRK"
FT   regulatory      complement(183341..183346)
FT                   /gene="lmo2194"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(184272..184277)
FT                   /gene="lmo2195"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(184539..186215)
FT                   /transl_table=11
FT                   /gene="lmo2196"
FT                   /note="similar to pheromone ABC transporter (binding
FT                   protein)"
FT                   /db_xref="GOA:Q7AP52"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP52"
FT                   /protein_id="CAD00274.1"
FT                   /translation="MKKSKLFLTLGLTLLLSLVLVACGGGSDSKSDKKGSDSGKASGEQ
FT                   VLNLTESALIPSADSTKADDQVGLNVVNQTNEGLYALDKDGIPAIAGAAEEPKISDDKT
FT                   VYTIKLREDAKWSNGDPVTANDYVYSWRRAVDPNTAATYSYLFDAIKNGGDIVAGKKKP
FT                   EELGIKAVDDYTLEVTLSKPTAYINSLFAFPTFFPLNEKFVTEKGEKYAQNSDNMLFNG
FT                   PFELKDWTGTNKKWTYVKNDKYWDKDKVKLKQINVQVVQDSGTGLNLYNTDKVDRTVLS
FT                   ADYAAQNKNNKDYVTVNDSSTFYIKFNQKRAGKDTVFANKNIRKAIALAIDKQSYTDTV
FT                   LKNGSKPANNLVPEGFTFDPGNKEDYTKESGKHLEYDVKEAQKAWKAGLKELGVNEITV
FT                   EFTSDDTENARKSSEFIQDQLQKNLDGLTVKLKNVPFKVRLQNDQNQDYDFSMSGWGPD
FT                   YQDPSTFLDLFVTDGAQNRMSYSNKDYDKILNDASVTYAADDQKRWDEMVKAEKILLTD
FT                   DVAIQPLYQRSTAYLQKDYIKNLQKNPFGPDYTYKETYLTK"
FT   regulatory      complement(186224..186229)
FT                   /gene="lmo2196"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      186826..186831
FT                   /gene="lmo2197"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        186839..187183
FT                   /transl_table=11
FT                   /gene="lmo2197"
FT                   /db_xref="GOA:Q8Y578"
FT                   /db_xref="InterPro:IPR025007"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y578"
FT                   /protein_id="CAD00275.1"
FT                   /translation="MFLRITIYTLIQEAIIFGILLFGKNQTVSLSNYVDISFMVALISL
FT                   LIGLFVYIMRSGFLDRVHNGFRSISRKIKREEENEFSDMPLSELVGLQYAGILFSSIFV
FT                   MLTSILCMFL"
FT   regulatory      187505..187510
FT                   /gene="trpS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        187518..188513
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="GOA:Q8Y577"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y577"
FT                   /protein_id="CAD00276.1"
FT                   /translation="MKKVIFSGIQPSGQLTLGNYIGALKQFGQFQDEYECFYCIVDEHA
FT                   ITVPQDRLKLREQTRSLAALYLAVGLDPEKSTLFIQSEVAAHAQAAWILQCNVYIGELE
FT                   RMTQFKDKSAGKAGVSAGLLTYPPLMAADILLYQTDLVPVGEDQKQHIELTRDLAERFN
FT                   KKHADIFTMPEVFIPKQGARVMSLQDPTKKMSKSDANLKNAIFLLDPPATIRKKIKSAV
FT                   TDSSGIIEYNKEEKPGVSNLLTIYSVITGETIASIEEKYVGKGYGDFKTDLAELVVSEL
FT                   EPIQERYYAYLKSEELDTILDAGAEKAARVANKTLKKMENGVGLGRKRRK"
FT   regulatory      188524..188554
FT                   /gene="trpS"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(188524..188554)
FT                   /gene="lmo2199"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(188571..188987)
FT                   /transl_table=11
FT                   /gene="lmo2199"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y576"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y576"
FT                   /protein_id="CAD00277.1"
FT                   /translation="MKKLYETTVINTGGRSGEVHSPDNVFYFDISAPTELGGDGGGGTN
FT                   PEQLFAAGYGACFNSALELVLGKAGIEAKSTVTATVSLYSDPEDNGFKIGVVLEGTIEG
FT                   QDKEKTEALLKKAHEVCPYSKATRGNIDVEIKVG"
FT   CDS_pept        complement(188971..189423)
FT                   /transl_table=11
FT                   /gene="lmo2200"
FT                   /note="similar to transcription regulator"
FT                   /db_xref="GOA:Q8Y575"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y575"
FT                   /protein_id="CAD00278.1"
FT                   /translation="MDTNTRILEEQLCFSVYNASKQFTKLYREALEPFQLTYPQYIALL
FT                   VLWEVEEQTVSELGKRLALDSGTLTPMLKRMEHLGYVTRSRHPEDERRVYIRLTEKAIK
FT                   IQPDVLKSVDNCLQLLDFAELDYTQLLTKIQSLTKQLGGIENEKII"
FT   regulatory      complement(188996..189001)
FT                   /gene="lmo2199"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(189432..189437)
FT                   /gene="lmo2200"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(189505..189531)
FT                   /gene="lmo2201"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(189545..190786)
FT                   /transl_table=11
FT                   /gene="lmo2201"
FT                   /note="similar to 3-oxoacyl-acyl-carrier protein synthase"
FT                   /db_xref="GOA:Q8Y574"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="PDB:3O04"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y574"
FT                   /protein_id="CAD00279.1"
FT                   /translation="MDKRRVVVTGVGAVTPIGNDAETSWENAKKGVNGVAKMTRLNPDD
FT                   FPVKIAAELKDFDVEKYLEKKEARKMDRFTHYAIASAEMAVQDSGLVIDDSNANRVGVW
FT                   IGSGIGGMETFETQYEIFLNRGHRRVSPFFVPMMIPDMGSGQVSIRFGAKGINSTTVTA
FT                   CATATNSIGDAFKVIERGDADAMITGGAEAPITKMSLAGFTANKALSLNPDPETACRPF
FT                   DKDRDGFIIGEGAGIVILEEYEHAKARGAKIYAEIVGYGATGDAYHITAPAPNGEGAAR
FT                   AMKMAIDDAGLTPDKVDYINAHGTSTPYNDEYETQAIKTVFGEHAKKLAISSTKSMTGH
FT                   TLGASGGIEAIFALLTIRDNIIAPTIHLKNQDEVCDLDYVPNEAREANVNVVISNSFGF
FT                   GGHNATLVFKRIED"
FT   regulatory      complement(190794..190799)
FT                   /gene="lmo2201"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(190989..191927)
FT                   /transl_table=11
FT                   /gene="lmo2202"
FT                   /note="similar to 3-oxoacyl- acyl-carrier protein synthase"
FT                   /db_xref="GOA:Q8Y573"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y573"
FT                   /protein_id="CAD00280.1"
FT                   /translation="MNAGILGVGKYVPEKIVTNFDLEKIMDTSDEWIRTRTGIEERRIA
FT                   RDDEYTHDLAYEAAKVAIKNAGLTPDDIDLFIVATVTQEATFPSVANIIQDRLGAKNAA
FT                   GMDVEAACAGFTFGVVTAAQFIKTGAYKNIVVVGADKLSKITNWDDRTTAVLFGDGAGA
FT                   VVMGPVSDDHGLLSFDLGSDGSGGKYLNLDENKKIYMNGREVFRFAVRQMGEASLRVLE
FT                   RAGLEKEDLDLLIPHQANIRIMEASRERLNLPEEKLMKTVHKYGNTSSSSIALALVDAV
FT                   EEGRIKDNDNVLLVGFGGGLTWGALIIRWGK"
FT   regulatory      complement(191935..191940)
FT                   /gene="lmo2202"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(192047..193174)
FT                   /transl_table=11
FT                   /gene="lmo2203"
FT                   /note="similar to N-acetylmuramoyl-L-alanine amidase and to
FT                   internalin B"
FT                   /db_xref="GOA:Q8Y572"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR025987"
FT                   /db_xref="InterPro:IPR038200"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y572"
FT                   /protein_id="CAD00281.1"
FT                   /translation="MDRKCQLIMKKKFTQILLASVIVSSTLVPFVQAEAAGTNQTTVSQ
FT                   AGMTLSQQQFIQSIANDAQDLQKEEKILTSVTLAQAILESNWGKSGLSTSANNLFGIKG
FT                   SYEGSSVSMGTQEFSSGKAYHTQADFRKYPDKKASLVDHAQLFVNGVSGNANLYSAVIG
FT                   ETNYKEAAYAIQDAGYATDPAYAEKLISTIENYNLDQYDQIYDTVTSTENQLAYAEIKN
FT                   ASNETIWTKPYNTEGAEKTGSVKDYKNKSLRISQKAVTEKGTWYQLQDQGKTIGWVNSN
FT                   AVEVFYTPKNETNVKLDKYITDSDQKIYAYPVEDNSKVVTNLNDYLGKELDIDRRADVK
FT                   NEYWYRIKSDDGKVIGWSKADGFAENNPNKALEVK"
FT   regulatory      complement(193186..193190)
FT                   /gene="lmo2203"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      193484..193491
FT                   /gene="lmo2204"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193497..193685
FT                   /transl_table=11
FT                   /gene="lmo2204"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q929G9"
FT                   /db_xref="InterPro:IPR021324"
FT                   /db_xref="UniProtKB/TrEMBL:Q929G9"
FT                   /protein_id="CAD00282.1"
FT                   /translation="MRYVVTVFWVFLLSLMAEFVLSSMLYVSFDMTRAIILTVGLSFFI
FT                   ILITFLMPKDSEVYDFK"
FT   regulatory      193742..193766
FT                   /gene="lmo2204"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(193742..193766)
FT                   /gene="lmo2205"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(193775..194464)
FT                   /transl_table=11
FT                   /gene="lmo2205"
FT                   /note="similar to phosphoglyceromutase 1"
FT                   /db_xref="GOA:Q8Y571"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y571"
FT                   /protein_id="CAD00283.1"
FT                   /translation="MKLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEA
FT                   GLEFDVAFTSVLTRAIKTLNYVLEESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKY
FT                   GADQVQKWRRSYDTLPPLLEENDERQAKNDRRYQLLDTHAIPSGENLKVTLERVIPYWM
FT                   DTIAPEIKEGRRVVIAAHGNSLRALVKFLEGISDDEIMDLEIPTGVPLVYELNADLKPV
FT                   NKYYLDK"
FT   regulatory      complement(194471..194476)
FT                   /gene="lmo2205"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(194555..197155)
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /note="similar to endopeptidase Clp ATP-binding chain B
FT                   (ClpB)"
FT                   /db_xref="GOA:Q8Y570"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y570"
FT                   /protein_id="CAD00284.1"
FT                   /translation="MDLQKFTQQVQQTIADAQNLAIASEHQEIDVAHVFKVLLTESDFA
FT                   KRVYDVAEVDTDALQKVIENTLEKIPVVSGSGVNYGQAMSQALFQLMRDAEKEQQQLED
FT                   DFVSTEHLILAVMDQKSNPITAELKNQHKAKKQIKEAILKIRGGKRVTSQNAEENYEAL
FT                   TKYGRDLVAEVRSGKLDPVIGRDAEIRNVIRILSRKTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRIVRKDVPEGLKDKTIISLDIGSLIAGAKYRGEFEERLKAVLQEVKQSDGQILLFIDE
FT                   IHTIVGAGKTDGAMDAGNMLKPMLARGELHCIGATTLDEYRQYIEKDAALERRFQKVLV
FT                   PEPTVEDTVSILRGLKERFEIHHGVNIHDNALVAAASLSNRYITDRFLPDKAIDLVDEA
FT                   CATIRVEIDSMPSELDEVTRKVMQLEIEEAALKEEKDPASERRLEILQRELADYKEEAN
FT                   QMKSKWESEKNEISKIREVREQIDHLRHELEEAENNYDLNKAAELRHGRIPAVEKELLE
FT                   LEAENREKTAQEDRILQEEVTENEIAEIVGRWTGIPVTKLVEGEREKLLKLADVLHQKV
FT                   IGQDDAVQLVSDAVLRARAGIKDPKRPIGSFIFLGPTGVGKTELAKALAFNMFDSEDHM
FT                   IRIDMSEYMEKHSVSRLVGAPPGYIGYEEGGQLTEAVRRNPYSIVLLDEIEKAHPDVFN
FT                   ILLQVLDDGRITDSQGRLIDFKNTVIIMTSNIGSNLLLERTEEGEISPELESDVMQILQ
FT                   SEFKPEFLNRVDDIILFKPLTLADIKGIVEKLVEELQIRLADQEITITISDDAKAFIAE
FT                   EAYDPVYGARPLKRYIVRHVETPLAREIVSGKIMPHSSVEIDLADKEFTFKVTE"
FT   regulatory      complement(197164..197169)
FT                   /gene="clpB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(197304..197981)
FT                   /transl_table=11
FT                   /gene="lmo2207"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y569"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y569"
FT                   /protein_id="CAD00285.1"
FT                   /translation="MNEINHTSERVNTEKRTEKQIIMQKILNWFVFSLLLASIGAAIGS
FT                   KLSPELYLPLVVLEVALLITAMVVRRSKTINKVVGYPVVLAFAFVTGLTLGPTLTYYFG
FT                   AGQGAAVLMAFVTATVTFTTLAFIGAKMKKDLSFLSSALFAAIIILVIFSFVGVFLPLG
FT                   SMLSTIISAGGTIIFSLYILYDFNQIMKRDVELADVPMLALNLYLDFLNLFMFLLRLFT
FT                   GRD"
FT   regulatory      complement(197989..197994)
FT                   /gene="lmo2207"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(198073..198091)
FT                   /gene="lmo2208"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(198093..198863)
FT                   /transl_table=11
FT                   /gene="lmo2208"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y568"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y568"
FT                   /protein_id="CAD00286.1"
FT                   /translation="MKPRGICFFDMDGTLLNSESKVLDTSLQALDKLRENNVIPVIATG
FT                   RTLIEISHQMKITGIESAVMMNGQMAIFEGEKVYEDVIDAGLLEQLTEEAKSQNVEVCY
FT                   YNDKRIGATASTPVVKAHYDFLGEPMPEVRPNMYKEETINMALLLLETGDDYFPERFPE
FT                   LQFVRNTPFSNDVLRKGGSKAVGISKLLEVMGYQDVPTYAFGDGMNDLEMFGAVDYAIA
FT                   MENAVPLLKEKATFVTKDNNSDGIMLGLKQFDLI"
FT   regulatory      complement(198870..198875)
FT                   /gene="lmo2208"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(198927..199712)
FT                   /transl_table=11
FT                   /gene="lmo2209"
FT                   /db_xref="GOA:Q8Y567"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y567"
FT                   /protein_id="CAD00287.1"
FT                   /translation="MIRKLTVSDNEEVMALLKPEATQNLFIIGDIENFGYESDVQDLWG
FT                   EFDSVGKLHALLLRFDTFFLPYSKDANFNAEAFSEIIATHDKYEVSGMSRVTKELEAFL
FT                   PELAEKRQDTYFCECEHVNRIPVNQDVIVRTAVAEDVGPIIKMRKHIKEFGSRDENEEL
FT                   IIRQIEKGVKRIYYIEQDQEVVAVAETSAENSFSAMITGVATSDEYRQRGFASTLLKKL
FT                   CCDVLAEGKKPCLFYDNPVAGEIYHRLGFEHTGDFVMYK"
FT   regulatory      complement(199720..199725)
FT                   /gene="lmo2209"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(199808..199830)
FT                   /gene="lmo2210"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(199833..200177)
FT                   /transl_table=11
FT                   /gene="lmo2210"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y566"
FT                   /protein_id="CAD00288.1"
FT                   /translation="MKNKAEKQRIATNLSLYMKINGYTHRTFALAVGISQNTLKALMIG
FT                   KMRNENKFQKYISQITESLALEEKFFEQPKEAITAAPITFQDTNKMHLGDEKFNAISLM
FT                   LKIGEIHYES"
FT   regulatory      complement(200187..200192)
FT                   /gene="lmo2210"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(200299..200323)
FT                   /gene="hemH"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(200334..201263)
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /note="similar to ferrochelatase"
FT                   /db_xref="GOA:Q8Y565"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y565"
FT                   /protein_id="CAD00289.1"
FT                   /translation="MTKKVGLLVMAYGTPYKDEDIERYYTDIRHGHKPSEEMIADLRGR
FT                   YHAIGGLSPLAKITEAQAYGLEKALNDSQDEVEFKAYIGLKHIEPFIEDAVEAMHKDGI
FT                   EEAISIVLAPHYSSFSVEAYNKRAKEAADKLGGPRINAINDWYKQPKFIQMWADRINET
FT                   AKQIPADELLDTVLIVSAHSLPEKIKQHNDPYPNQLQETADFIFEKVVVPHYALGWQSE
FT                   GKTGEPWLGPDVQDLTRELYGREKYKHFIYTPVGFVAEHLEVLYDNDYECKVVTDEVGA
FT                   AYHRPPMPNSDPEFLEVLRTVVWEKYSN"
FT   CDS_pept        complement(201260..202321)
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /note="similar to uroporphyrinogen III decarboxylase"
FT                   /db_xref="GOA:Q8Y564"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y564"
FT                   /protein_id="CAD00290.1"
FT                   /translation="MTKITNDLFLKAARKEQVDRIPVWYMRQAGRSQPEYRKLKEKYSL
FT                   FEITHQPEICAYVTKLPVDQYGVDAAILYKDIMTPLPGMGVDVEIKSGIGPVIHNPIRS
FT                   FQDVEKLTIFKPEIEVPYVLDTIKLLADDMLDVPLIGFAGAPFTLASYMIEGGPSKNYH
FT                   QTKSFMYREPEVWAILMEKLGRMTANYLIAQINAGASAVQLFDSWVGALSRADYAEYIR
FT                   PVIEMIVREVKAVHPTTPIIMQAVGASHLLEEWETMPLDVVGVDWRETITSARKKVPTK
FT                   AIQGNLDPSTLLAPEKCLKEANRILQEGVLEPGYIFNLGHGVFPEVPPEMLKQLTNYIH
FT                   ERSEILLKKDDIK"
FT   regulatory      complement(201271..201276)
FT                   /gene="hemH"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(202329..202334)
FT                   /gene="hemE"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      202505..202510
FT                   /gene="lmo2213"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        202518..203021
FT                   /transl_table=11
FT                   /gene="lmo2213"
FT                   /note="similar to unknown protein"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="PDB:4KIA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y563"
FT                   /protein_id="CAD00291.1"
FT                   /translation="MKKVFITTGTEHYLRQLMANYTGGNVTLLQNFSQSLLYQESTGEK
FT                   LFQEGAEYRVLQSSGSIKGFGVVVFEYIHLRDEEIPIFLQMYQRASLHFSETPGLQSTK
FT                   LTKAMNMNKFLIISFWDSEVFFHDWKKSPLSKEITNIMRKNNTQSGFSHEDIYHYPEFS
FT                   HDAK"
FT   regulatory      203028..203054
FT                   /gene="lmo2213"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(203028..203054)
FT                   /gene="lmo2214"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(203060..204283)
FT                   /transl_table=11
FT                   /gene="lmo2214"
FT                   /note="similar to ABC transporter (membrane protein)"
FT                   /db_xref="GOA:Q8Y562"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y562"
FT                   /protein_id="CAD00292.1"
FT                   /translation="MKMIFDSKALWKERFSAYTTEVMRYLRYMFNDHLLFVLVIGLGAG
FT                   IFYYAGWVKTLEPTFPVIPLMVILLTASIAVSPVATLLKKPDIVYLIVQEKAMDTYFSQ
FT                   AKIASFFMQLYVFVIVLGVCMPMYVEVTKVPYSQFFTLFIVLSMLKAWNIYFGWESMKF
FT                   EEADTTWMFIRVILNAILIYIALIAAPYISIPLVLVVLAASYYWLRTKTAKVTLRWEYL
FT                   VDKEEARMNRFYRLVNLFTDVPHLRGTVRRRSYLDFLYQPIPYAKRKTFAYLFSRTFIR
FT                   TNEYAGLYIRLTVIAVILLVFVQGFYLSIIFSLLFLYLTGFQFIPMLKHYDAQIMLRLY
FT                   PINDRYRHRSFIHFLRILLLAQALLFSVIGIAQNGTIGGMIILGINLAFVVIFTFLYAP
FT                   VRMKKMYE"
FT   CDS_pept        complement(204267..205019)
FT                   /transl_table=11
FT                   /gene="lmo2215"
FT                   /note="similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="GOA:Q8Y561"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y561"
FT                   /protein_id="CAD00293.1"
FT                   /translation="MALVEVEHLTGGYTKRPVLKDISFAIEEKQIVGLIGLNGAGKSTT
FT                   IKHITGLMHPKQGTIKINNHQLVEDTETYRKQFSYIPETPVLYEELTLKEHLELTGMAY
FT                   GISEEELHARMTPLLKEFRLEKKLNWFPAHFSKGMKQKVMIMSAFLIEPKLYIIDEPFV
FT                   GLDPLGIQSLLNWMDEMRSKGASILMSTHILATAEKYCDTFIIIHQGEIRAEGTLKDLQ
FT                   TNFEMPGASLDEIYIQLTKEEEADEDDI"
FT   regulatory      complement(204290..204295)
FT                   /gene="lmo2214"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(205027..205032)
FT                   /gene="lmo2215"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      205165..205170
FT                   /gene="lmo2216"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        205180..205602
FT                   /transl_table=11
FT                   /gene="lmo2216"
FT                   /note="similar to histidine triad (HIT) protein"
FT                   /db_xref="GOA:Q8Y560"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y560"
FT                   /protein_id="CAD00294.1"
FT                   /translation="MDDCIFCKIVRGEIPSAKVYEDDEVYAFLDLGQVTEGHTLVIPKK
FT                   HARNTFDLPDETAAELFRRVPKIARALKEALPIQGLNILNNNEEVAFQSVFHCHIHLIP
FT                   RYSKSDDFGLKWKDNADWYTQERYQEIAELIAAKVD"
FT   regulatory      205617..205622
FT                   /gene="lmo2217"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        205632..205994
FT                   /transl_table=11
FT                   /gene="lmo2217"
FT                   /note="similar to unknown protein"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y559"
FT                   /protein_id="CAD00295.1"
FT                   /translation="MNKKSLIFGILAGGAIGAAASVLFAPKSGNELRKDIVAKSGEASV
FT                   ILKELAYNANELIQSVQVLGTEGSTLLKDVSSDIMESVSKWNEEMEPEKKRLKDEIKDM
FT                   QKTISDLEKTLKKDNK"
FT   regulatory      206004..206019
FT                   /gene="lmo2217"
FT                   /regulatory_class="terminator"
FT   regulatory      206161..206166
FT                   /gene="lmo2218"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        206177..206716
FT                   /transl_table=11
FT                   /gene="lmo2218"
FT                   /db_xref="GOA:Q8Y558"
FT                   /db_xref="InterPro:IPR021683"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y558"
FT                   /protein_id="CAD00296.1"
FT                   /translation="MRCLKSINTERRDEFNRLFLKGILVWLAAVCICFLTQHLIYPDQL
FT                   TNDYQLASFLGIILIYPIHKLLHILGCFKYREGTVIQWRIHFFFLPCIKLNIKRIIPKW
FT                   HYIFSLILPFVIITTILVALMLFTPIGHSGMFLLLLSVHFGMSFSDFTHIKKLWKMPKN
FT                   CFIESAERGFSVLISD"
FT   regulatory      206815..206820
FT                   /gene="lmo2219"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        206833..207714
FT                   /transl_table=11
FT                   /gene="lmo2219"
FT                   /note="similar to post-translocation molecular chaperone"
FT                   /db_xref="GOA:Q8Y557"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023059"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y557"
FT                   /protein_id="CAD00297.1"
FT                   /translation="MKKKLILGLVMMMALFSLAACGGGGDVVKTDSGDVTKDELYDAMK
FT                   DKYGSEFVQQLTFEKILGDKYKVSDEDVDKKFNEYKSQYGDQFSAVLTQSGLTEKSFKS
FT                   QLKYNLLVQKATEANTDTSDKTLKKYYETWQPDITVSHILVADENKAKEVEQKLKDGEK
FT                   FADLAKEYSTDTATKDNGGQLAPFGPGKMDPAFEKAAYALKNKGDISAPVKTQYGYHII
FT                   QMDKPATKTTFEKDKKAVKASYLESQLTTENMQKTLKKEYKDANVKVEDKDLKDAFKDF
FT                   DGSSSSDSDSSK"
FT   regulatory      207727..207750
FT                   /gene="lmo2219"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(207727..207750)
FT                   /gene="lmo2220"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(207755..208696)
FT                   /transl_table=11
FT                   /gene="lmo2220"
FT                   /note="similar to S. aureus Cbf1 protein"
FT                   /db_xref="GOA:Q8Y556"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y556"
FT                   /protein_id="CAD00298.1"
FT                   /translation="MEKRLLDFEVGETVDLFLLIKSSVKGTASNGKPFLSLVLQDKSGE
FT                   LEAKLWDVKESDEANYGVQQIVHLMGDIQNYRGRKQLKIRQIRQATALDGVSASEFMET
FT                   APINKEEMADEITQYIFEMKNANLQRITRALLKKYQDDFYDYPAAMRHHHEFVSGLSFH
FT                   VVSMLRLAKSVADLYPSVNRDLLYAGVILHDLGKVIELSGPVSTTYTLEGNLIGHISIV
FT                   VEEVSKIADELSIDGEEVVVLKHVLLSHHGKGEWGSPKPPLVREAEILHQIDLMDASLN
FT                   MMDKVLKHTKPGEFSERVFGLDNRSFYNPTFE"
FT   regulatory      complement(208704..208709)
FT                   /gene="lmo2220"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(208741..211464)
FT                   /transl_table=11
FT                   /gene="lmo2221"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y555"
FT                   /protein_id="CAD00299.1"
FT                   /translation="MRITSIDIIGYGKWSDAHFNNIANFQVFYGENEAGKSTIMAFIHS
FT                   ILFGFPTKQQSIPRMEPKNGGPYGGRLTLEDTSFGKVIIERLKGKATGDVRIYYGDGQT
FT                   AGEEKLPEIIGEIDRNTYEAIFSFDIHGLQNIHQWKKKEFERYLLATGTTGSDALLKTA
FT                   ETLQKKLDSLYKPSGRNPLINQQLKRVKEAQQAFQNAKKQNAQYEELINEKEQATARQA
FT                   ELQIEKTTKRVELDTLETLGDLWPLYQEWKALSNKASQKKEATFPPDGIIRLEHLQLRE
FT                   KEWQNQLIQLEERKKNLISNNDYEHSAFFAKNEAEITYLIETYAAFGEREIQLKNLKQE
FT                   INFHQVDSKQTFRVWTSELEQTMARLKEKEQFHKEQQHEIQLKLKLTNDTEEKLQKKID
FT                   QIEMDMWDNRTFQQAKEKMQQKPKTFRTKTFVSFGVFAVALSLMIVFQSIWSVALVFVS
FT                   ALIVGYAIMTTWKALPTNNEQLLVFLEQKKIRQEWQQLLNEMDIIASQIAELRATENKL
FT                   NETIYQHTMELKQLFSDLGIKHNPDANWAYELAVYKKNSEKAQLAMELISKLEPLAEKQ
FT                   EVYKARLANLELPGKYTDTEEKITFLRQGLLYYRNHLTENAKLAEKLEQVTMQLDLVKQ
FT                   DLLLIKKEKADLLASANAKNEEEFRMAAIRVKEEQNWRERLVLIEAQLEPEKRIALNQY
FT                   ENQATIKEKELQLEETLRQIELEQEKIHASLAAQNHAIHKLEEGGTFAVLMQEFYSEKS
FT                   KLQQIAAEWTETKLALQILQDTMQRLQEGKLPKTLKLASEYFNHLTNGNYDKVYLQDNR
FT                   LQVESKNVVPFFPEELSQATKEQLYLAIRFALIDVIHKDFPLPIIIDDGFVHFDSARMG
FT                   QMMQLLRKRKSENQVIFFTCHQETRKYFSSEDIRML"
FT   CDS_pept        complement(211461..212696)
FT                   /transl_table=11
FT                   /gene="lmo2222"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y554"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014576"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y554"
FT                   /protein_id="CAD00300.1"
FT                   /translation="MKEIKFLHMADLHLDSPFIGLSTLPQPLFSAIQESTFQSLERITT
FT                   VAIKEAVDFVLIAGDIYDSEDQSVRAQARFAKEMKRLEVANIPVFMIHGNHDFIEKHKE
FT                   KLALPSNVHVFSEQVEVMLHKTATGVSVNIYGFSYNERHIRSSRIDEYKVQGDADFHIA
FT                   LLHGSEVSSSEEHDVYAPFRVQEISKKGFDYWALGHIHKRQLLAESPSIYYPGNIQGRN
FT                   RKESGEKGASIINLSEASTTIDFIGTSPIIWEEIIIPLPKNSEINAFYREITNVLESYQ
FT                   GRSHSYFLHIIIQMASSQKINTNDWLQMLQEEVELSNTTFVWVHKLTTEITNRSNLQTW
FT                   YESHLAGEEIRRSFEQLQDESAFYQSVEALYLESGANRYLDDLSEQERERLLENALMEL
FT                   GMTLAEVEGDEK"
FT   regulatory      complement(211475..211480)
FT                   /gene="lmo2221"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(212705..212710)
FT                   /gene="lmo2222"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(212781..212822)
FT                   /gene="lmo2223"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(212839..213192)
FT                   /transl_table=11
FT                   /gene="lmo2223"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y553"
FT                   /protein_id="CAD00301.1"
FT                   /translation="MAVNIYDLAHDLDKGIRETPEFISLQDAYREVNENADAKAKFERF
FT                   RDVQVTIQEKQMTGQEIDDETVDVAQQVAQEVQENELIVKLMEKEQAMSTIINDLNRII
FT                   MTPLQDLYNVAND"
FT   regulatory      complement(213201..213206)
FT                   /gene="lmo2223"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(213274..214407)
FT                   /transl_table=11
FT                   /gene="lmo2224"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y552"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="InterPro:IPR016991"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y552"
FT                   /protein_id="CAD00302.1"
FT                   /translation="MSVLFTILLMAVIGGFIGAMTNYIAIRMLFRPYKAIYLFNKRLPF
FT                   TPGLIPKRRDELAEHIGKVVVSHLLTEDAIRARLLDENLQKEITDTITKMFHEKMKLET
FT                   TPNELLHHFGYENAEIRSMAWIEKTLEKEINHFLSTKKTTKMSDLIPTMLESELTTKLP
FT                   HVTERITSKMTLFVASEEGKIQIKQMLQKFFEEHGKMGSMARMFINIDSFSEKIQQEGL
FT                   KLIGQEDTKNLINQLLTTEWKNFEAKELQELIPTEKQAHLAGQLTSELIQTLPHEKLFN
FT                   QPIQVILRGYEAAITEKVIPFAVERMLDFVATHSAEIVERMDLAKLVETQIATFSLPEI
FT                   EKLVVEISGRELKMITYLGGILGGFIGIIQGILAMWI"
FT   regulatory      complement(214416..214421)
FT                   /gene="lmo2224"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(214511..215878)
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /note="similar to fumarate hydratase"
FT                   /db_xref="GOA:Q8Y551"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y551"
FT                   /protein_id="CAD00303.1"
FT                   /translation="MERIERDTLGEISVDATKYWGAQTERSKRNFAIGDNPMPIEIIYA
FT                   FAQLKKATAKVNAAEGKLAEEKAIAIGQVCDQIIQGELDEHFPLVVWQTGSGTQSNMNV
FT                   NEVIAHVANLTLGEGQIHPNDDVNMSQSSNDTFPTAMHIAAYGALVTKLLPEITKMEAV
FT                   LTEKKNKYMHLVKIGRTHLQDATPLTLGQEISGWEACLTNNKNYLETSMKAILPLAIGG
FT                   TAVGTGLNASRDFGDKVAEELMKQTGYPFTSDSNKYFALTSHSPINFVHGAIRSLASDL
FT                   MKIANDIRLLASGPRSGIGELEIPANEPGSSIMPGKVNPTQCEAITMVAAQVMGNDVTI
FT                   NVAASQGNFELNVYKPVIIFNFLESIKLLADSMRSFRVHCLEGLTANEKVIETKVNDSL
FT                   MLVTALNPHIGYEKAAKIAKLAFDENTTLKEAAIKTGFVTEKEFDLWINPLKMTNL"
FT   regulatory      complement(215886..215891)
FT                   /gene="citG"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(215948..216742)
FT                   /transl_table=11
FT                   /gene="lmo2226"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y550"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y550"
FT                   /protein_id="CAD00304.1"
FT                   /translation="MTHFNALLAKEWLEQRRSLKIIWLPIVFALLGLTQPLMMYFLPEI
FT                   LKAVGTGAETEQVVALMGNQSAQEVMAQTLGSQFDQIGIIIIIVVAMACIQNDRTRGML
FT                   AFIMTRPVSAVEYVLSKWVMQCVVGLSSLLIGYVLAAYYTYFLFGELAINSLVEGFFVY
FT                   AVWFIFVISLVVFASSIFDSNAVVAMISVFIAIVLGLISGLGGWIQIFNPAYLSKNATM
FT                   LIMSGKTMDYFIPTILITAAWIILLVGLTVLMIKIKALPKTE"
FT   CDS_pept        complement(216739..217644)
FT                   /transl_table=11
FT                   /gene="lmo2227"
FT                   /note="similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="GOA:Q8Y549"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y549"
FT                   /protein_id="CAD00305.1"
FT                   /translation="MKKLEIQGLKKKYNGKWVIKGIDLTINEKECVALIGPNGAGKSTM
FT                   INMIVQILTQDEGQITLDGESAKLVREKIGFLPQYPEFYGWMSATECLHFMGKLSNMEK
FT                   TDLKARINEVLLLVGLEESANKKISTYSGGMRQRLGIAQAILHRPELLVLDEPVSALDP
FT                   IGRREMMLLLDKLKKEITILFSTHILKDAEEICDRIAIIKNGELVADKTVVQLMEEESS
FT                   PVFDVEFNGNSEAWQTLLLQNKYVEKIEKVGMVYQVYTTNQKAGSEAVLSSLLQIDGEF
FT                   IRVENRHQSLEEIFMEKVGK"
FT   regulatory      complement(216750..216755)
FT                   /gene="lmo2226"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(217644..217841)
FT                   /transl_table=11
FT                   /gene="lmo2228"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q8Y548"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y548"
FT                   /protein_id="CAD00306.1"
FT                   /translation="MDKTQIALIIPVILLYLALLLTAIIDLTKNWNTRKNPIIWLIVII
FT                   VINIFGPIAYFIFGRKEEVN"
FT   regulatory      complement(217652..217657)
FT                   /gene="lmo2227"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(217850..217855)
FT                   /gene="lmo2228"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(217909..217943)
FT                   /gene="lmo2229"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(217950..220094)
FT                   /transl_table=11
FT                   /gene="lmo2229"
FT                   /note="similar to penicillin-binding protein"
FT                   /db_xref="GOA:Q8Y547"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="PDB:3ZG7"
FT                   /db_xref="PDB:3ZG8"
FT                   /db_xref="PDB:3ZG9"
FT                   /db_xref="PDB:3ZGA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y547"
FT                   /protein_id="CAD00307.1"
FT                   /translation="MDKFKQQLIKYLKLFFGFIGKWLNKGWQKFRRFWKNKHIGKIFLL
FT                   AGLVFLLSFIIYLVIVAKSADIDALKKGLESATIIYDKDGDKAGELSSTDATFVSIDKI
FT                   SKNLQNAVVSIEDRKFYEHKGFDLKGIARAGVNLVTSGGISGGGSTITQQLAKNALLTQ
FT                   EQTFTRKAKEIFMAREIEKTYSKDEIMEMYLNRSYFGNGEWGVENASLKYFGKSAADLN
FT                   IPEAATIAGLLQAPSAYDPYQHIDKATNRRNMVLNAMVETGTISKAEGDKYKATKIVLN
FT                   DQSKDPLANKYPWYVDAVINEAVNEADITQDEIMQKGYKIYTELDQNYQTSLENVYNND
FT                   GLFPSNANDGTLVQSGAVLMDPATGGIRALVGGRGEHVFRGFNRATQMKAQPGSTMKPL
FT                   AVYTPALQSGYDVDSMLKDEKITYKGNYTPTNVGGVYSGEVPMYKAVANSINAPAVWLL
FT                   DQIGIDKGVKSVEKFGITVPEKDRTLGLALGGMSKGASPVEMATAYATFANNGAKPESH
FT                   IITKIVDPSGNTVYENVPKTKQIISETVSNEMTSMLLDVINTGTGQSAAVSGHEMAGKT
FT                   GSTQVPFDDTSGTKDQWFVGYTPNLVGAVWMGYDKTDKEHYLTTTSSAGVSSLAHYVMN
FT                   SGLQYQKSADFSTKSAAQETAAKKEEEEKEKNSGSDFWSGVKEKADEAGETIKKGADKV
FT                   KEFGGKVSDGIGNLIDSIGN"
FT   regulatory      complement(220100..220105)
FT                   /gene="lmo2229"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      220400..220406
FT                   /gene="lmo2230"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        220416..220841
FT                   /transl_table=11
FT                   /gene="lmo2230"
FT                   /note="similar to arsenate reductase"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y546"
FT                   /protein_id="CAD00308.1"
FT                   /translation="MTQKLIYFLSQTHIRSAIAEAWAKRLSLSNVKFISGSWHKSKSTP
FT                   FIAEALNEFAIEPPESLSYSPSSELLADADLIVTIYDSAHETAPKFPANIQEKIIYWDI
FT                   DDPEQEIALPQKWASYQEVCDNIALSVKNLEHVLIEA"
FT   regulatory      220850..220872
FT                   /gene="lmo2230"
FT                   /regulatory_class="terminator"
FT   regulatory      220891..220896
FT                   /gene="lmo2231"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        220906..221775
FT                   /transl_table=11
FT                   /gene="lmo2231"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y545"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y545"
FT                   /protein_id="CAD00309.1"
FT                   /translation="MDGYNDLKKAEKAAFLSIFAYLFLAVLKIVAGQLGNSDALLADGL
FT                   NNTTDIVASVALLIGLRISRIPPDADHSYGHRRTETISSLIASIIMFLVGVQVIWSSIV
FT                   HIIEKEFATPSMLTAVVALFSGVFMYAIYLYNHQLAKKLDSQAVRAAAYDNRSDAFVSF
FT                   GAFIGIIGAVLGVPWLDSVTAFLVGILIVYTAIKIFYDAAHTLTDGFDVSKLETIHDLI
FT                   ASVPDVKKVIDIKARMNGNRIWIDATIAVDPELNVVKSHEITEIVEQKIRNEYEGAFTL
FT                   VHIEPFFE"
FT   regulatory      222021..222026
FT                   /gene="lmo2232"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        222031..223335
FT                   /transl_table=11
FT                   /gene="lmo2232"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y544"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y544"
FT                   /protein_id="CAD00310.1"
FT                   /translation="MILTIKFLIIALLIAISAFFVATEFAIVKMRPSRLDQLIAEKDKR
FT                   AVLARHIYNHLNAYLSACQLGITISSLGLGWLGESTVEAALHPLFSLMELPQSAITILS
FT                   FTIAFLFITFLHVVVGELVPKTLAIDKTETVALAVARPLHIFYKVMFPFIWILNGSAVF
FT                   IARLFGLEPASEHEIAHTEDELKIIVGESYKSGEINQSEFRYVNKIFDFDERMAKEVMI
FT                   PRTEIVTVDTGSTIGELSDIMQNERYTRYPVIDGDKDHVIGVLNLKEILSAYVEHGSSP
FT                   SFSIDPYVKPIIRVIETIPIKELLFRMQRERSHIAILLDEYGGTSGLVTVEDIVEEIVG
FT                   DIRDEFDADEIPEIRKIKDGHYIVDAKLLIDEVNNILGTEIEEEEVDTIGGWFLTQNYE
FT                   VEVGDEIDYDGFIFRVKQGEPHHIEYIEIIKKTND"
FT   regulatory      223343..223370
FT                   /gene="lmo2232"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(223375..224253)
FT                   /transl_table=11
FT                   /gene="lmo2233"
FT                   /note="similar to transcriptional regulators (LysR family)"
FT                   /db_xref="GOA:Q8Y543"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y543"
FT                   /protein_id="CAD00311.1"
FT                   /translation="MNLHHLRYFVTLAHMEHYTKAAEKLLITQPSLSHAISSLEQELGI
FT                   PLFEKEGRNIGLSKAGKVFLDYVEESLDMIDAGVATTKKAANGEGQIDLAFLQTLGTSL
FT                   IPKLVQEFLQTEPEKQIDFIFHTGVSIDIIQGLKEKKFDIGICSKLENERNIHFTPIAK
FT                   QELVLIVPKSHPLAEKDWIDLIETVDYPHIAFSKKSGLRPIIDELFRKIGADYQIAYEI
FT                   EVDQVIAGMVAQNFGIAVVPNMPILNYVDVKVLPIRSPNWERFFYLAVAKNQTLTPAAE
FT                   KFKQFMLAHRI"
FT   regulatory      complement(224259..224264)
FT                   /gene="lmo2233"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      224540..224545
FT                   /gene="lmo2234"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        224554..225408
FT                   /transl_table=11
FT                   /gene="lmo2234"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y542"
FT                   /protein_id="CAD00312.1"
FT                   /translation="MTNANGNLKKCPITISSYTLGTEVSFPKRVKVAAENGFDGIGLRA
FT                   ENYVDALAAGLTDEDMLRILDEHNMKVTEVEYITQWGTAEDRTAEQQKKEQTTFHMARL
FT                   FGVKHINCGLLEKIPEEQIIVALGELCDRAEELIIGLEFMPYSGVADLQAAWRVAEACG
FT                   RDNAQLICDTWHWARANQTAESIKNVPADRIVSIQLCDVHETPYKELREESLHDRLAPG
FT                   EGYGDTVGFAKILKEHGVNPRVMGVEVISDSMVATGLEYAALKVYNATKKVLDEAWPEI
FT                   SPR"
FT   regulatory      225462..225467
FT                   /gene="lmo2235"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        225477..227402
FT                   /transl_table=11
FT                   /gene="lmo2235"
FT                   /note="similar to NADH oxidase"
FT                   /db_xref="GOA:Q8Y541"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y541"
FT                   /protein_id="CAD00313.1"
FT                   /translation="MKFNSMFSPIDIGPMKVPNRFVVSPMCNNYANTDGTLSDTSLAYY
FT                   KERALGGFGLITFEATVVDVRAKGGANKACLYSDHQIASFKRVIDVCHDAGAKISVQLQ
FT                   HAGPEGNSKVSGYPLRAASAIASAAGRNTPEAISREELYELIELYGEAALRAKKAGADA
FT                   VEVHCAHGYLVSSFLSARTNKRVDEFGGCFENRMRLPRLIIESIRKRVGHSIAILCRIN
FT                   STDGVDGGLSVQDSATVAAYLEDCGLDGLHVSRSVHIRDEYMWAPTVLHAGFSSDLVTQ
FT                   IKRAVSIPVITVGRFTEPHYAELMVREGRADLVAFGRQSLADPETPNKAAAGKLDELLP
FT                   CIACLQGCVANMYAGKPITCLVNPLLGRESEAYLPKTPSKKVVVVGGGVGGLYAGWMAG
FT                   SRGHDVTVYEASDMIGGQMRLAAYPPGKGDLTNMVRSYIKKCEQFDVEIKTNTPVTLEL
FT                   IQEVAPDAVIIATGATPLVLPIPGIEDAGLIHAVDLLDGKEKCGQKVLVVGGGMVGSET
FT                   AAFLGEAGHDVTVVELRDEVGADVISEHRKFLMHDFDEYKIKSVTNAKVTSFFEDGVTY
FT                   SLADNKEQRIDGFDSVVLAMGSRAYNPLEEAIKAIVPETYVIGDAVRARRALDATKEAL
FT                   DAVLQL"
FT   regulatory      227447..227452
FT                   /gene="lmo2236"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        227461..228330
FT                   /transl_table=11
FT                   /gene="lmo2236"
FT                   /note="similar to oxidoreductase"
FT                   /db_xref="GOA:Q8Y540"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y540"
FT                   /protein_id="CAD00314.1"
FT                   /translation="MENRISGTTRLLGLIGTPIDHSKSPIMYNYSFQKAGLDYAYLAFD
FT                   TPIQKVADTIKAIKTFNLRGANVTMPCKSEVLKHMDDLSPAARMIGAVNTIVNEDGKLT
FT                   GHITDGLGFIANLRDASVDVAGKKMTIIGAGGAATAIQVQCALDGAKEITIFNIKDAFY
FT                   DKAKQTVASIKQEVPNCIVHIYDLNDTEKLNAEITTSDILVNATLVGMHPNEHETPISD
FT                   TSVFRKELIVADIIYNPKKTQLLLDAEAAGCKTVGGLGMLLWQGAEAYKLFTGKDMPVS
FT                   EVKDLYFN"
FT   regulatory      228349..228354
FT                   /gene="lmo2237"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        228363..229571
FT                   /transl_table=11
FT                   /gene="lmo2237"
FT                   /note="similar to transport system permease protein"
FT                   /db_xref="GOA:Q8Y539"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y539"
FT                   /protein_id="CAD00315.1"
FT                   /translation="MNAKRFYPTAIALYFTYFIHGIGVSILGQYKQDFAGVWGADKLSD
FT                   GTFDVSMVIAVIAALGLGRLLTLPISGPFSDKFGRKPSALIGVGLYAVYFIGLAFAPNM
FT                   YIAYAFAFVGGAANSFLDTAVTPSVLEIFTKNGAIANMFTKFSISIGQFVLPFAIGMVA
FT                   AANMSFRTLFVITMALIVIDGLIIAFMPFPPMNNNVGGEKAKPEKMKFNATSWAIIGIG
FT                   FTCTSTFQLWLNCNQELGKLYGMADPSKIQSFYSLGTMCAILITAVLVKKFILPVRILI
FT                   LYPAIATLMLLIIYIVQTPTICLIGGFVIGYAAAGGVLQLAVSTANEFFPTNKGKITSI
FT                   VMISSSLANYIVLNVASYITKAGGIEGPKYVLLFNVAITVIGILLAIFVNMRYKNESKI
FT                   ATK"
FT   regulatory      229718..229723
FT                   /gene="lmo2238"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        229731..230921
FT                   /transl_table=11
FT                   /gene="lmo2238"
FT                   /note="similar to transport system permease protein"
FT                   /db_xref="GOA:Q8Y538"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y538"
FT                   /protein_id="CAD00316.1"
FT                   /translation="MKNKYLSTSLGLYMNYFVHGMALIIIAQNIDFLSQKWHTDLAGAA
FT                   GVVSSFGIGKLLAVFISGRLSDKFGRKLSVILGVFFYIVFLGGILLSPNTIIAYMFGIS
FT                   AGIANSFLDTGTYPALMEAYPKKAASANIIVKAFVQSGQFLLPFMIAFILANNLWYGWS
FT                   FIVLIVILLINLLYTLTRTFPPMTVGKPLDVAELAEEKKQKFHFSIDEICLILFGFVAQ
FT                   TLLYIMSQWIAKYGSEVIHMTDDASRLLVSYASVGAIICVCVTFVLGNRGVRTLHILIT
FT                   YVTMTMLISFTLFAFPSEIVCIVGAFLLGYFSAGGIIQLGLTLLAEVSARGKGFVTSLY
FT                   TIAEGIAVFIIPLIAAAISRIDIAAIFLLNAGIALFGLALLMIVFTRKKKFARDHI"
FT   regulatory      230925..230954
FT                   /gene="lmo2238"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(230925..230954)
FT                   /gene="lmo2239"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(230959..232023)
FT                   /transl_table=11
FT                   /gene="lmo2239"
FT                   /db_xref="GOA:Q8Y537"
FT                   /db_xref="InterPro:IPR023264"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y537"
FT                   /protein_id="CAD00317.1"
FT                   /translation="MSTGLLWKEWRQNAWVFIFIVIAFIGSEATTATNTVSMFNDNYKY
FT                   YQSEEFQKNNTADQQMTGNEIKNDLSLTPYDFEGNLGLFFYVFLFLGLKLTVFEKNKQM
FT                   DYFTFGLPYSKKQIFWHKMLIPLLLIFVLVPIIIFCRFWYIYQQIPGLYLPSVSDSFMY
FT                   ISSFLLLYLFSYTLAMAVGNLVGEIITAGIIAIGSIVSFLYMFPGALTNLIIGFKAFFT
FT                   GKTIVDIDGGAVMLYNAIPTPILQGTTALSEFGVLIILSIGMLTISWYAMKTASLENNG
FT                   RFLMNNKFRLPILIIGSLYVTICLSGHYASFNYDQLIPTGQVISLIIKIILILVASVIA
FT                   FWMLMYKWKTLRKH"
FT   CDS_pept        complement(232020..232898)
FT                   /transl_table=11
FT                   /gene="lmo2240"
FT                   /note="similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="GOA:Q8Y536"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y536"
FT                   /protein_id="CAD00318.1"
FT                   /translation="MKVDSLSKKIDGKLLLDKITFEVKPGEIIGIVGRNGVGKTTLFRT
FT                   IMGFYIPDAGDVYLDEPLSKNHQLKQKLFMLQDNLNCWDGYKIPTIKKFYQKTYPLFDG
FT                   DKFDNLMKQVNLAKDVKFQNYSKGMKGLFGLVLALSIGAEFILLDEPMEGLDIIAQKKI
FT                   MGILLEEVEKRKLGIIISSHRLADLDPIADYIHILQDNHIEESYHLESLREQAVKIQIA
FT                   FENKKIPHFLLENGKVINKYGRVYTILFRDMNTELYAAIKKEKPIFMDELAVTLEDLFI
FT                   YHLEEQGGEKL"
FT   regulatory      complement(232033..232038)
FT                   /gene="lmo2239"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(232888..233283)
FT                   /transl_table=11
FT                   /gene="lmo2241"
FT                   /note="similar to transcriptional regulators (GntR family)"
FT                   /db_xref="GOA:Q8Y535"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:4HAM"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y535"
FT                   /protein_id="CAD00319.1"
FT                   /translation="MFTINTKSQLPIYEQIVQKIKEQVVKGVLQEGEKILSIREFASRI
FT                   GVNPNTVSKAYQELERQEVIITVKGKGTFIANQTDKLSSPKKLAETRTKLKETILDLVY
FT                   LGVNIEEIHKLADEYSQDIIGGDVVEG"
FT   regulatory      complement(232907..232912)
FT                   /gene="lmo2240"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(233291..233297)
FT                   /gene="lmo2241"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(233375..233857)
FT                   /transl_table=11
FT                   /gene="lmo2242"
FT                   /note="similar to O6-methylguanine-DNA methyltransferase"
FT                   /db_xref="GOA:Q8Y534"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y534"
FT                   /protein_id="CAD00320.1"
FT                   /translation="MTDLYYDTLHFSDTELYFAATKMGLVYVGTKAEKLQSAKRSPEKM
FT                   NIYKEELAAYLHGELTNFTVPIDLSATPLQIEVFHALKTIPYGETRTYTEIAELINRPK
FT                   AVRAVGTTIGRNPLLFIIPCHRVIGKNGNLTGYSGGIGMKESLLKLEKANLNQFSF"
FT   regulatory      complement(233866..233871)
FT                   /gene="lmo2242"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      233989..233994
FT                   /gene="lmo2243"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        234003..234569
FT                   /transl_table=11
FT                   /gene="lmo2243"
FT                   /note="similar to methylphosphotriester-DNA
FT                   alkyltransferase and transcriptional regulator"
FT                   /db_xref="GOA:Q8Y533"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016220"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y533"
FT                   /protein_id="CAD00321.1"
FT                   /translation="MSDYYLTKKRWQAISTNDKTADGAFFYGVTSTKIFCYPSCKSRLP
FT                   KKENIVIFHSAEEAFSHGYRACKRCKSGGSALPDTEWVNNIEMYIKENFAKALTLKIIA
FT                   DDCHGSPYHLHRTFKRITMITPITYLENVRINYAKMQLTTTNQSIETIGKMAGFPNPSH
FT                   FSTTFKRHTGLSPNQFRKTIIKKLN"
FT   regulatory      234572..234577
FT                   /gene="lmo2244"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        234586..235455
FT                   /transl_table=11
FT                   /gene="lmo2244"
FT                   /note="similar to putative ribosomal large subunit
FT                   pseudouridine synthase"
FT                   /db_xref="GOA:Q8Y532"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y532"
FT                   /protein_id="CAD00322.1"
FT                   /translation="MTHVTLPILEDWEGLSLTTILQEKFHLGKKARHEIRMSQNVLLNN
FT                   KPLDDWNTPLFVGASLSLPIFLHDKIPVYEYDLEIIYEDDFLLVVNKPVDMKTHPNDSY
FT                   ETDTCANAVQYYLEKTGQDANALAVHRLDQTTSGLVLFAKNKLAIAGLSWQMENRAIHR
FT                   TYLAAVDGTWGLVMQTINKPIGEDRHHGSRRQISPYGQPAVTHVKVLENDNEKNTSLVE
FT                   CQIETGRTHQIRVHLSGIGHPIIGDTLYGGSPRANRIMLHAEKLHLNHPFKGKEMNFSA
FT                   PAGDDWVF"
FT   CDS_pept        complement(235468..235860)
FT                   /transl_table=11
FT                   /gene="lmo2245"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y531"
FT                   /protein_id="CAD00323.1"
FT                   /translation="MLHHVEIYVADLEESRLFWSWLLEELSYEFYQSWNEGFSYKYADT
FT                   YLVFVQTEEPFISEGYHRKRVGLNHLAFHGGTKERVDDFRVKLKAKGIKLLYEERYPFA
FT                   GGKNHYAVFFEDPNGIKVEICTEVTT"
FT   CDS_pept        complement(235862..236518)
FT                   /transl_table=11
FT                   /gene="lmo2246"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y530"
FT                   /protein_id="CAD00324.1"
FT                   /translation="MTDIQTLFRTNRSLTDAPPMEAYMKNQFTFLGIRAGERKKLVAAY
FT                   LKENGAPQDLLEFTIALFAEEEREFQYVAIDLLSRYGKKQPSEAIKVYEQLIVTKSWWD
FT                   TVDGLAGTVVSNHFKLYPELIPTYNEAWINGDNIWLARTAILFQLKYKEKTDVDLLFFN
FT                   CEKWLASKEFFIQKAIGWALRQYAKVDSGAVRQFVNSHSLAPLSRREALKHIGEA"
FT   regulatory      complement(235867..235872)
FT                   /gene="lmo2245"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(236515..237399)
FT                   /transl_table=11
FT                   /gene="lmo2247"
FT                   /note="similar to oxidoreductase"
FT                   /db_xref="GOA:Q8Y529"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y529"
FT                   /protein_id="CAD00325.1"
FT                   /translation="MTKTLQDRMILPGNGTIPYIGLGVFQVTEQEFIAGAVEKAIEVGY
FT                   RLFDTAAVYNNEAIVGQAIASSAVSREELFISSKVWNGDLGYDETLFAFERTLRNLKLD
FT                   YLDLYLIHWPVAGKYRDSWRAMERLHDEKLIKSIGVANFKQHHLSDLLVAANEKPVLNQ
FT                   VETHPLLPQNDLRKYLVEQNIAHAAWSPLAKGILMQNPVITEIAKKHQASVDQVILQWH
FT                   LNRNTIIFPKSITSSRIEENSRLSYFQLDASDMEKIDRLETGKRVGPDPDDLEYFLSSI
FT                   ERERAYLASENEE"
FT   regulatory      complement(236527..236533)
FT                   /gene="lmo2246"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(237408..237413)
FT                   /gene="lmo2247"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      237771..237775
FT                   /gene="lmo2248"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        237786..238406
FT                   /transl_table=11
FT                   /gene="lmo2248"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q929C7"
FT                   /protein_id="CAD00326.1"
FT                   /translation="MAFKNKKDRFASLLHDIAVNLHEGANFFATYNINSVEDLHTFSNK
FT                   IKEYETAGDSMVHKMIMELNDAFITPIEREDMLELTNRLDDVMDALDETAFSLEICQIT
FT                   HYDEYMTKFIQAIQASTVEIEKAVDLVFDKKLKDVRKLAIQIKDYESQCDDVYRESLIQ
FT                   LFQNEKDPIKLIRLREVYEKLEDIADSCQSVANTLESIVMKNA"
FT   regulatory      238406..238411
FT                   /gene="lmo2249"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        238420..239418
FT                   /transl_table=11
FT                   /gene="lmo2249"
FT                   /note="similar to low-affinity inorganic phosphate
FT                   transporter"
FT                   /db_xref="GOA:Q8Y528"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y528"
FT                   /protein_id="CAD00327.1"
FT                   /translation="MEGMFLITLVIVLAALAFDLINGFHDTANAIATSVSTKALKPRHA
FT                   IILAAVMNFVGAISFTGVAKTITKDIVNPFDLDHGELVILAALLSAIAWNLITWYFGIP
FT                   SSSSHALIGSIAGAAIASAGFAAIEYSGFTKIIIGLLVSPVLAFVVGYTIYSLFKVFLK
FT                   NLNLATTNRRFRMIQVGTAALQSYTHGTNDAQKSMGIITMALIASGFQTTDDVQLWVQV
FT                   SCAIAMAIGTSIGGWKIIKTVGGKIMKIKPVNGVAADLSSVIIIFGATFIHLPVSTTHV
FT                   ISSSILGVGTAHRVKGVKWDTAQRMIITWVITLPISATIAALIFYVLRFIL"
FT   regulatory      239428..239449
FT                   /gene="lmo2249"
FT                   /regulatory_class="terminator"
FT   regulatory      239598..239603
FT                   /gene="arpJ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        239611..241071
FT                   /transl_table=11
FT                   /gene="arpJ"
FT                   /note="similar to amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="GOA:Q8Y527"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y527"
FT                   /protein_id="CAD00328.1"
FT                   /translation="MQKHLLQKFAAILLVFIVVFSGFTSVFAADTEDQTLAKIQEKGVL
FT                   TVGLSADYPPYEFHQTIDGKDKVVGFDVSIAEKIAKDLDVKLDIKEMNFDSLLGSLKTG
FT                   KIDMIISGMSPTPERQKEVDFSDPYMFVQQRVVIRKTDKDKFTSVNDFSGVKVGAQKQT
FT                   TQEELAQNELVGSEVVSLQKVPDLILNLKSNKVDAVVLEGPVAEAYISQDKTLAMADIK
FT                   FSNGSKETAIAMPKGSTALQEKVNASIKDIQDTGLLKEYQKEANKLMFQDGSFYEKYGN
FT                   YFVTGTLITIALAAIGVLCGAILGSLLALMKLAKTRWLRWPAACYIEFVRGTPLLIQIF
FT                   IVFFGTQIIGMDVSAFVSGCIALSLNSAAYVAEIIRAGISAVNKGQMEAARSLGMTQGA
FT                   SMRYIILPQAVKNILPALGNEFVTVIKESSIVSVIGVTELMFMTGVVQGASFKPFIPLI
FT                   ITSLIYFVLTFSLSRLLGVAERRMRTSD"
FT   regulatory      241048..241053
FT                   /gene="lmo2251"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        241064..241789
FT                   /transl_table=11
FT                   /gene="lmo2251"
FT                   /note="similar to amino acid ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="GOA:Q8Y526"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y526"
FT                   /protein_id="CAD00329.1"
FT                   /translation="MINIKNLHKHFGKLEVLKGIDLEIASGEVVVVIGPSGSGKSTFLR
FT                   CLNLLEQPTTGTILFENKDLMAKQTNVNELRQKMGMVFQNFNLFPHKNVLENLMLAPMK
FT                   VKNEDSAAAKKHALSLLEKVGLADKATSYPSQLSGGQQQRVAIARALAMNPDVMLFDEP
FT                   TSALDPEMVGEVLSVMKSLAKEGMTMVVVTHEMGFAREVADRVVFMDAGVIQEQGTPEE
FT                   VFGNPQNDRTKDFLGKVLA"
FT   regulatory      241847..241852
FT                   /gene="lmo2252"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        241865..243013
FT                   /transl_table=11
FT                   /gene="lmo2252"
FT                   /note="similar to aspartate aminotransferase"
FT                   /db_xref="GOA:Q8Y525"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y525"
FT                   /protein_id="CAD00330.1"
FT                   /translation="MNHSKIAKKHQQMPVNILADIGTLAKTMPDILDLSIGDPDLITDE
FT                   SIINAAFEDVRAGHTKYTESGGDVELIDAIRGYFSRNYDLSFERSQIRATVGALHGMYL
FT                   TLQTILDDGDEVIIHEPYFSPYKDQVLNSGGTPIIIPTYEKDDFAINVDILEAAITDKT
FT                   KALILNSPNNPTGAVFSPETFEKIANLAKKYDFFILSDEVYDGFSFYEDFVPMAKFAPD
FT                   HTITFGSMSKNFAMTGWRLGYMIAPTYLNEAAKIINEGITYSAPTPSQRAAIYALNHSE
FT                   TLIPLVAETFQKRLEYIAKRVEKIPYLSLHPLKGSIYAFINISKTNMDSVSFTEYVLKE
FT                   TQVLVIPGLAFGESGDNYVRLAATQDISVLEEAFNRLAKLTF"
FT   regulatory      243020..243050
FT                   /gene="lmo2252"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(243056..243685)
FT                   /transl_table=11
FT                   /gene="lmo2253"
FT                   /note="similar to phosphoglucomutase"
FT                   /db_xref="GOA:Q8Y524"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y524"
FT                   /protein_id="CAD00331.1"
FT                   /translation="MKAVVFDFDGTMLDTENLWYTETMNYLKETYGIDLPDEVYQQIIG
FT                   TSEEPIIRYMMEATNGAFDKEAFLTTVAEACHLGQQSLGFRDGFKEFFEQVKANDYKIG
FT                   LATSSGFDWIEPTLNRLGILADFETIQTADHVDEIKPHPALYLQAVEALGVKPEEAVAI
FT                   EDSKNGALSAMQAGLKVYIVPNEATKNITFPKEATVVSSFAEINLK"
FT   regulatory      complement(243692..243697)
FT                   /gene="lmo2253"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      243841..243846
FT                   /gene="lmo2254"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        243858..245150
FT                   /transl_table=11
FT                   /gene="lmo2254"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y523"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y523"
FT                   /protein_id="CAD00332.1"
FT                   /translation="MFQLKANGTDVKTEVISGFTTFLTMVYIVVVNPAILSAAGVPFNT
FT                   VFMATIISAVIGTLWMAIFANYPIAIAPGLGMNAYFVTVVTTQKLDYSVAFAAVFVAGI
FT                   IFLLLSLTPLREKIIEAIPHNLKAGITAGIGLFIAFLGFRMTGIIVSNDSNLVGLGDLH
FT                   SKEAILAIVGLLITLILLALNVKGALFIGMIATGIIAFITGELKFTDGIVKLPPMPEFV
FT                   FTNPIHAFGDVMSYGLYAVVLSFLLITIFDTTGTMIGVAKKAGLMKGESLPNAKQALMA
FT                   DAVATSVGSMFGTTPTSAYIESSAGVATGGRTGLTTLTVAILFMVSAFFAPLVGAVSGI
FT                   SAITAPALIVVGSMMIGAVKEIDWDTLDEAFPAFLVILAMPLTSSIAIGLAFGFISYPV
FT                   LKVFTGKWRELNWFLIVIAVLFFILVAFLPH"
FT   regulatory      245160..245185
FT                   /gene="lmo2254"
FT                   /regulatory_class="terminator"
FT   CDS_pept        245260..245526
FT                   /transl_table=11
FT                   /gene="lmo2255"
FT                   /db_xref="GOA:Q8Y522"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y522"
FT                   /protein_id="CAD00333.1"
FT                   /translation="MFLKSLLAGVALAVVVFLASFLMPDYTVSTLYSIVTTIIVFASII
FT                   LSAFVSFGGRSGNPSRKSQLRWSILLLVAAIPSFIGFIVTFYF"
FT   regulatory      245535..245562
FT                   /gene="lmo2255"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(245538..245559)
FT                   /gene="lmo2256"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(245567..246088)
FT                   /transl_table=11
FT                   /gene="lmo2256"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q929B9"
FT                   /protein_id="CAD00334.1"
FT                   /translation="MTLKGKKVIALVSEDFEDLELWYPVLRLREAGASVHLVAEEAKKV
FT                   YHGKYGVPVTSDYDFDSVRAEDYDGILVPGGWSPDKLRRFDSVLNLVRAFDKAKKPIGQ
FT                   ICHAGWVLVSAGILEGVNVTSTPGIKDDMTNAGAIWHNEPVVTDGHIISSRRPPDLPEY
FT                   LPAFISALED"
FT   regulatory      complement(246097..246102)
FT                   /gene="lmo2256"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(246175..246200)
FT                   /gene="lmo2257"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(246252..246596)
FT                   /transl_table=11
FT                   /gene="lmo2257"
FT                   /note="hypothetical CDS"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y521"
FT                   /protein_id="CAD00335.1"
FT                   /translation="MKGTFNGFLFICNIVIFIQKTTIIVRQFSSFLSSSQKIYIYLLAF
FT                   FKNNSKISYRIEFYLDESFIFTNVIFMGIRPYHGYNDFWCIHLPIEWQLVRHLFRHQNH
FT                   YLFSFISLAV"
FT   regulatory      complement(246572..246591)
FT                   /gene="lmo2258"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(246593..246784)
FT                   /transl_table=11
FT                   /gene="lmo2258"
FT                   /db_xref="GOA:Q8Y520"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y520"
FT                   /protein_id="CAD00336.1"
FT                   /translation="MEERLYELEDKVQDLELEVHDLRDRIQLLEDKPDVRSSLLGHNVW
FT                   VLIPLVAIISWMVVEIFS"
FT   regulatory      complement(246792..246797)
FT                   /gene="lmo2258"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      246924..246929
FT                   /gene="lmo2259"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        246935..247285
FT                   /transl_table=11
FT                   /gene="lmo2259"
FT                   /note="similar to phosphotransferase system (PTS)
FT                   beta-glucoside-specific enzyme IIA"
FT                   /db_xref="GOA:Q8Y519"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y519"
FT                   /protein_id="CAD00337.1"
FT                   /translation="MEIQVEEAVVKLILHGGNTRKEAYKAIDFAEKYQFDEADKHLQIA
FT                   QDQFQEGHIWQTKLVSIRDSETVAHPSFLLIHGQDHLMTAQAELQLAKRIIEQYKHQQR
FT                   LEERLTKLENQA"
FT   CDS_pept        complement(247276..248151)
FT                   /transl_table=11
FT                   /gene="lmo2260"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y518"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y518"
FT                   /protein_id="CAD00338.1"
FT                   /translation="MNYEMISDYKDNKMYRDSFNRLAESTFDINFEEWYRDGFWNDKYI
FT                   CYSYIDDNKVIANVSINKMNLIYQGEDYRALQIGTVMTHPDYRGQGLAKKLLEHVIAKY
FT                   EDQYDFLYLFANDTVLDFYPKFGFERVEESSFTVDACSLKRESSNLKKLNPGNKTDFQL
FT                   ISRIVSEKTPLSNILDVRESEDLLMFYVLIALKNELYYIEELDVIVLMEQEDADLYVLD
FT                   ILSTKKLDVVEVLRYLPIKKIETIHLLFTPEKSKYIDAAHIIETEDMLFVRPNILTNEN
FT                   YFLFPATSHA"
FT   regulatory      complement(248161..248166)
FT                   /gene="lmo2260"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(248231..248539)
FT                   /transl_table=11
FT                   /gene="lmo2261"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y517"
FT                   /protein_id="CAD00339.1"
FT                   /translation="MDEQLKENLMGALEQVIDPELGIDIVNIGLVYDVELDDDGLCTVS
FT                   MTLTTMGCPLAGILTEQVQMALSDIPEVKDTNVNLVWNPPWTKDRMSRYAKIALGIR"
FT   regulatory      complement(248550..248555)
FT                   /gene="lmo2261"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(248604..249356)
FT                   /transl_table=11
FT                   /gene="lmo2262"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y516"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y516"
FT                   /protein_id="CAD00340.1"
FT                   /translation="MIQVENEQIAGIPVLHISNSENADKMLPTIIFYHGFTSQKELYLH
FT                   YGYLLAQRGFRVILPDAKLHGERLQGANPEDQATFFWDVIETNITEFPLITDELIKAGK
FT                   TDANRIGVGGVSMGAITSLGLLGLYENIKVAVSLMGSAYYVDFAKELSKYALAQGLTFP
FT                   FDVDERILALQKYDLTQNITKINNRPLLLWHGKKDDVVPFAYSEKLYQTLVEESLADNV
FT                   QFIIDDNAKHKVSVEGMLQGVSFFEKFL"
FT   regulatory      complement(249364..249369)
FT                   /gene="lmo2262"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      249464..249469
FT                   /gene="lmo2263"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        249475..250320
FT                   /transl_table=11
FT                   /gene="lmo2263"
FT                   /note="similar to unkown proteins"
FT                   /db_xref="GOA:Q8Y515"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y515"
FT                   /protein_id="CAD00341.1"
FT                   /translation="MNQTYELKEQTMSKKLIVLDLDGTTLRDDLTISSHTKNTLEKARM
FT                   AGHEVMIATGRPYRISGSYYHELGLTTPIVNFNGAVYHHPRLTTFAEGYHHAIDLQVVH
FT                   ELLDFSNGFSLDNIAAEVQDNVFLKERNNSVPETFHLGTENIVFGNIRDAIKSDATSLL
FT                   FFGKLDQLDLISKHLDESLSGVISHHTWGASAWPAVEIIKFGIHKAIGVQAAAKTLGFD
FT                   RKDIIAFGDETNDLQMLDYAGVGVAMGNAAESVKNVANVVTASNQDDGIAVYLEENLNL
FT                   "
FT   CDS_pept        complement(250398..251300)
FT                   /transl_table=11
FT                   /gene="lmo2264"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y514"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y514"
FT                   /protein_id="CAD00342.1"
FT                   /translation="MSSKIVYKEYAKKTAIAIIAALLNAIGMNFFLIPAQVYAAGLNGV
FT                   AQLGSDMLRDSMNISISTGLLVLLLNIPVAILGWLKVGKSFTVFSFLTVAFMSFFLIVI
FT                   PEVQVSNDILLNAIFGALIASVGIGLALKFGISTGGLDIVAMYITIKTGRSFGKYFLLL
FT                   NGVIIIVAGFAYDWTFALYTLISLYVQSRVIDIIHTRHQKLTVMIMTQHSETVIKAIHE
FT                   NMVRGITVVDAMGGYSKEDVAMLIMVITRYELYDITHIVGEFDSKAFINVMETSSVFGD
FT                   FRSEADQKLAMAMYKNKMM"
FT   regulatory      complement(251308..251313)
FT                   /gene="lmo2264"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(251384..251746)
FT                   /transl_table=11
FT                   /gene="lmo2265"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y513"
FT                   /db_xref="InterPro:IPR010899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y513"
FT                   /protein_id="CAD00343.1"
FT                   /translation="MWGYIHLISWVAIVVLTITALLIYSKSTKSFTMLQMINRVFYILV
FT                   ILSGIMMVKYSIEQSWILAIFKILMGIIVIGVVEMLLSYRKQQKPTGMFLMIFVIVVVI
FT                   TISLGFYLSGGYPLFN"
FT   regulatory      complement(251756..251761)
FT                   /gene="lmo2265"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(251767..252615)
FT                   /transl_table=11
FT                   /gene="lmo2266"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8Y512"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y512"
FT                   /protein_id="CAD00344.1"
FT                   /translation="MKWLSYLYEGDLAYGILTPENKIIPAGTIFSNPPATLLDFIKEKP
FT                   LVPELTGIDGHIDLAEVEIQVPFVPPNNIIAIGKNYYNHVLEMGSKEDVPEHILVFTKS
FT                   ANSLLPHNGNIELHQNITGQLDYEGELAVIIGEKVRDISEQEALSAIFGFTILNDITAR
FT                   DLQKKHKQFYLGKSLDASCPIGPFVLENNANKEPVFHIETKVNGEVRQSDSTDKFIFGL
FT                   ARIISDLSKGHTLLPGDIIATGTPSGVGNGMTPPTFLQDGDIIEITIDKIGTLTNKVRK
FT                   S"
FT   CDS_pept        complement(252616..256323)
FT                   /transl_table=11
FT                   /gene="lmo2267"
FT                   /note="similar to ATP-dependent deoxyribonuclease (subunit
FT                   A)"
FT                   /db_xref="GOA:Q8Y511"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y511"
FT                   /protein_id="CAD00345.1"
FT                   /translation="MSLNIPPKPEESLWTDDQWKAIQAKGNNVLVAAAAGSGKTAVLVT
FT                   RIIEKLIDESANLNVDELLIVTFTNASAAEMKFRIGKGLEEALGQNPDSAHLKRQVALL
FT                   NYASISTLHSFCLEIIRKYYFEADIDPSFRLIEPIESSMIRDEVLEGLLEQEYGIENNE
FT                   AFFHLVESFTGDRSDAELHSLISKLYDFSRANPDPNAWLEAMVNFYNTEEITSITELPY
FT                   FPIIKEDIELRVNQAKNYLLNAINYANENNGPAPYLATLENDLVQIQALSELNWSSWTH
FT                   LKTSIENIDFKRIPTLKNKSDYDEVYVEEAKKFRDAAKKEMKNIATDWFSREEVNCLSD
FT                   LEKMKPDIQTLSELVKKFSANFFEEKQQRGVLDFNDLEHLALKILLNDDKASEVAQNYQ
FT                   KQFKEVLIDEYQDTNMVQETILRLVTNPSEAQGNLFMVGDVKQSIYRFRLAEPTLFMTK
FT                   YQTFQQDGSGNGIRIDLSQNFRSRKEVLDATNFIFRQLMDKHIAEIDYDTAAELTLGAN
FT                   FPETNAMETELLLIDMKTEDTETEDELSPQELQKNQVESRAIAMKIREMIDNKFPIYDK
FT                   KLKQNRPIQYRDIIILSRAMTSAPDMEEAMKVQDIPFYANNNSGYFETTEVATMIALMK
FT                   VVDNPYQDIPLAAVLRSPIIGLNEEELGQIRMAKKKGYFYDALLTYKDITVSETANKIS
FT                   DFVQQLNNWRELSIRENLTSLIWQIYQETNFYEFVGGLPGGKQRQANLRALYDRANQYE
FT                   KTSFRGLFRFVRFVERLEIRGDDLGTAKTLGEKEDVVRMMTIHASKGLEFPVVIVSGLS
FT                   RKFNMRDIYSKTLLDKDYGFASSYRDVEKMIVYPTIMQQAIKQKKSREMIAEEMRVLYV
FT                   ALTRAEEKLILVATVPDFEKTSKNWLQVAKEKETILPAATRAKAKCYLDWIGNATIRHP
FT                   AFKELLCEEIIQTLATEMKLQIEIKTKEMFLTNELERAESDNWLENIKEHQPVPIQSPY
FT                   KDEIQRYMEYEYQNEAATEIRAKQSVTELKRQFSLQDSWSDTTLLKEFQKVSLDRPKFL
FT                   QKNKLSATEIGTAMHTLMQAVSLDYKPTKEDLEQLLHTMREKDILTDVQIKAINIKQIL
FT                   DFFESPLGETMLQKKDLVKREVPFSYLLPVSELYEKVDLDERVLIQGVVDSMIEEEETI
FT                   TLIDYKTDKIEGRYADWNAAEKVMKERYHIQIKLYAEAIQAISGKKVAAAYLYFFDGQH
FT                   ICQINTKEGL"
FT   regulatory      complement(252624..252629)
FT                   /gene="lmo2266"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(256325..259798)
FT                   /transl_table=11
FT                   /gene="addB"
FT                   /note="similar to ATP-dependent deoxyribonuclease (subunit
FT                   B)"
FT                   /db_xref="GOA:Q8Y510"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y510"
FT                   /protein_id="CAD00346.1"
FT                   /translation="MTLQIIAGRSGTGKTTHLMDEVGEKIKQNSKTYIFIVPDQMTFQM
FT                   ETSFLNKENLAGMLGTQIFSFSRLAWKILQETGGLSKTFLSQTGIEMVIRKAALDQKDK
FT                   LKIFSRATSRKGFYSELANLFKEMKQEEVSIEDMVKSATNLSTSVNNKVHDISLIYQKY
FT                   EELLADKFLENEDYLRLLAEKIADSDYLNQTEIVIDGFTSFSKQELTVIGELMRKCDKV
FT                   TISLTLNVPEIQHGLDEYSMFKASTEAYYALLELAKLNGTQVEENKFFLENKRAKTESL
FT                   AFLANTWGHNKFMSFKNEPQNLKIHQANNRRAEIEGIAREIRQQALNGYRYRDIAILTR
FT                   NLGDYDVLCETVMEAYNIPTFIDKKRAMAKHPFIEFIRSSLDAILFNWKYEPIFQAVKT
FT                   EFFFDITEKSSLNRRKADILENYVLENGIQNKWKWEKEGDWIYRKIRGLSTNVLPQTDE
FT                   EIHMQSIINEMRNLIVNPLSTLELNLRKAKTGMEFALALYHYLEQVNAVERLESWRQRA
FT                   EEQGYLELAREHEQAWSSISALLDEFVEVLGEETLDLDSFTEIIGTGLDALEFSLLPPS
FT                   LDQVVLSDMENAKLLDMKVIFAIGMNDGVMPLRQKDKGIFSDQDRDALRAEDSKLKPSA
FT                   KNNIGEEDLLAYKIISLPSDKLFLSYPAADEEGKVLSESNYLRKIKGQFNELNESVYLT
FT                   DPSLLSDAEQSSYIRSKQATLGLLTSQLQMYKRGYTLSSVWWDAYNSYFENEKESIMAK
FT                   QVLSSLYYENKTKPLQETTAKNLFGETIHASVSRMEKFFSCEFQHYAQYGLKLEERGHF
FT                   QLQAVDMGEIFHGAMEWISAELKRNNLDWGNLTEEECKQMAKLAMTFLAPKIQHEILLS
FT                   SKRMEYIQYKLLQIITRATTVLNEQAKSSAFRPVGLEVDFGLKGDIPPLKIPLQSDSEL
FT                   LLQGRIDRIDMAEQDDRTFLRIIDYKSSSHDLALTEVYYGLALQMLTYLDIVVTNAQKM
FT                   IGKTAEPAGVLYFHMHNQYVQAEKELSDEAIAKELQKSSKMKGLILSDPVAVSLMDMTL
FT                   EKGKASTIIPAEIKQNGELSARSRTATRAEFDKMRQFVRHKYQEAGNKILDGAVSINPY
FT                   KLKERTPCQFCSFRSFCGFDPSLTSNQYRHLANEKAETILTKMDIEGGTQ"
FT   regulatory      complement(256331..256336)
FT                   /gene="lmo2267"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(259805..259810)
FT                   /gene="addB"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(259911..259934)
FT                   /gene="lmo2269"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(259948..260184)
FT                   /transl_table=11
FT                   /gene="lmo2269"
FT                   /db_xref="InterPro:IPR014957"
FT                   /db_xref="InterPro:IPR027393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y509"
FT                   /protein_id="CAD00347.1"
FT                   /translation="MEMRDFSNSLMNQVGVLKGEKELTNVFIECFLTMLLEERKLEQLR
FT                   AEIDKALDNRNKAEFMKLTEKMNKIQQEMLAFE"
FT   regulatory      complement(260192..260197)
FT                   /gene="lmo2269"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      260421..260426
FT                   /gene="comK'"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        260435..260713
FT                   /transl_table=11
FT                   /gene="comK'"
FT                   /note="similar to competence transcription factor ComK, N
FT                   terminal part"
FT                   /db_xref="GOA:Q8Y508"
FT                   /db_xref="InterPro:IPR010461"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y508"
FT                   /protein_id="CAD00348.1"
FT                   /translation="MKKEQISTQFYEVNPHTMIIFPKKSGSIVYSEIYEVDSHYTSKFT
FT                   PFELIKTSCNFFGSSYEGRRINEIPKKNILSKGCLYFYYYIEETLFM"
FT   CDS_pept        complement(260908..261141)
FT                   /transl_table=11
FT                   /gene="lmo2271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y507"
FT                   /protein_id="CAD00349.1"
FT                   /translation="MYNLIDDILEHSIVLADALKRNWSIEVLFLKNNHHVRYKYVVPVY
FT                   IDNKKHIVSLERFDERIIDINIEDIIFCEVMT"
FT   regulatory      complement(261150..261155)
FT                   /gene="lmo2271"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      261567..261572
FT                   /gene="lmo2272"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        261582..261791
FT                   /transl_table=11
FT                   /gene="lmo2272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y506"
FT                   /protein_id="CAD00350.1"
FT                   /translation="MTKKTTSDAQLKANKAWQDKNKEHANYLKSRSAARSFIKKKATLE
FT                   DLEELEIAIKQRKTEIISLDNSPE"
FT   regulatory      261776..261808
FT                   /gene="lmo2272"
FT                   /regulatory_class="terminator"
FT   regulatory      261883..261888
FT                   /gene="lmo2273"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        261897..262274
FT                   /transl_table=11
FT                   /gene="lmo2273"
FT                   /product="protein gp30 [Bacteriophage A118]"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y505"
FT                   /protein_id="CAD00351.1"
FT                   /translation="MYNKAEIMKQAWNWFNDSNIWLSDIEWVSYTDKEKSFSVCLKAAW
FT                   SKAKEEVEESKKESKHIAKSEELKAWNWAEIKLGLRFNISDDEKFTSVKDETKMNFDLN
FT                   VWACAMKAVKLHNDLFPQTAA"
FT   regulatory      262291..262296
FT                   /gene="lmo2274"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        262306..262656
FT                   /transl_table=11
FT                   /gene="lmo2274"
FT                   /product="protein gp29 [Bacteriophage A118]"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y504"
FT                   /protein_id="CAD00352.1"
FT                   /translation="MTLTTAQKRYYDAMNEFEAITSKELEQTPEFSQDLLNDSDYLAVT
FT                   KNEAYAVALCLLDDDKLYLDETLVHSTRLDIEDETYYINFVVTNEDDFKLATDEDKEKH
FT                   DKQEVIIKSGLN"
FT   regulatory      262646..262650
FT                   /gene="lmo2275"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        262661..263110
FT                   /transl_table=11
FT                   /gene="lmo2275"
FT                   /product="Portein gp28 [Bacteriophage A118]"
FT                   /db_xref="GOA:Q8Y503"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y503"
FT                   /protein_id="CAD00353.1"
FT                   /translation="MSIKLLDEFLKKHNKTRYQLSKLTGISQNTLKDQNEKPLNKYTVS
FT                   ILRSLSLISGLSVSDVLFELEDIEKNSDDLAGFKHLLDKYKLSFPAQEFELYCLIKEFE
FT                   SANIEVLPFTFNRFENEEHVNIEKDVCKALENAITVLKEKKNELL"
FT   regulatory      263121..263126
FT                   /gene="lmo2276"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        263135..263632
FT                   /transl_table=11
FT                   /gene="lmo2276"
FT                   /note="similar to an unknown bacteriophage protein"
FT                   /db_xref="GOA:Q8Y502"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y502"
FT                   /protein_id="CAD00354.1"
FT                   /translation="MNNHVIDLTNKKFGRLTVKEFVRSENGNAVWECVCVCGNEKEVLA
FT                   QHLKRGHVQSCGCLAKENGREYAEKNLRTETAQKNALKRKLEVDAVDGTMKSALTRRLS
FT                   ARNKSGIKGVRWDEKRNKWEASITFQKKLHFLGRFEKKDDAIKARRDAEDKYFKPILDK
FT                   MN"
FT   regulatory      263643..263664
FT                   /gene="lmo2276"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(263709..264260)
FT                   /transl_table=11
FT                   /gene="lmo2277"
FT                   /db_xref="InterPro:IPR041420"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y501"
FT                   /protein_id="CAD00355.1"
FT                   /translation="MDEASAEYRFELLTLLNDFTEKFHGKSIILTTKGIGQIVISLYDD
FT                   NLPHLLGINKVVKRKTATAILTEIRNNKITLNSIMVHKDYEKISDRVKSYYFLHDVFIH
FT                   KSIQICVKVNPIDNQGDYMKLDLVFYRKDRDKCIVLGAQKTRNNNTYRLCTLHVKKTTK
FT                   EPYILSKRGKIVDIIISDTI"
FT   regulatory      complement(264269..264274)
FT                   /gene="lmo2277"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(264728..264747)
FT                   /gene="lysA"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(264754..265599)
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /product="L-alanoyl-D-glutamate peptidase"
FT                   /db_xref="GOA:Q7AP51"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP51"
FT                   /protein_id="CAD00356.1"
FT                   /translation="MTSYYYSRSLANVNKLADNTKAAARKLLDWSESNGIEVLIYETIR
FT                   TKEQQAANVASGASQTMRSYHLVGQALDFVMAKGKTVDWGAYRSDKGKKFVAKAKSLGF
FT                   EWGGDWSGFVDNPHLQFNFKGYGTDTFGKGASTSNSSKPSANANTNSLGLVDYMNLNKL
FT                   DSSFANRKKLATSYGIKNYSGTATQNTTLLAKLKAGKPHTPASKNTYYTKNPRKVKTLV
FT                   QCDLYNSVDFTEKHKTGGTYPPGTVFTISGMGKTKGGTPRLKTKSGYYLTANTKFVKKI
FT                   "
FT   CDS_pept        complement(265599..265880)
FT                   /transl_table=11
FT                   /gene="lmo2279"
FT                   /product="holin [Bacteriophage A118]"
FT                   /db_xref="GOA:Q8Y500"
FT                   /db_xref="InterPro:IPR009708"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y500"
FT                   /protein_id="CAD00357.1"
FT                   /translation="MEFGKELLVYMTFLVVVTPVFVQAIKKTELVPPKWLPTVSILIGA
FT                   ILGALATFLDGSGSLATMIWAGALAGAGGTGLFEQFTNRSKKYGEDDK"
FT   regulatory      complement(265610..265615)
FT                   /gene="lysA"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(265887..265892)
FT                   /gene="lmo2279"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(265893..266258)
FT                   /transl_table=11
FT                   /gene="lmo2280"
FT                   /product="protein gp23 [Bacteriophage A118]"
FT                   /db_xref="GOA:Q8Y4Z9"
FT                   /db_xref="InterPro:IPR018926"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Z9"
FT                   /protein_id="CAD00358.1"
FT                   /translation="MYDGLTKVFDYALAKEMFFAALFVALFIILLIITKRIWDDSKIVR
FT                   IEMKEEREKVEEEREKRNKESKEERDKFISTMNEQQRLMDRQNDMMKQQQQSIDSLSKS
FT                   VGKLAHKVDLLEHKITK"
FT   regulatory      complement(266265..266270)
FT                   /gene="lmo2280"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(266288..266446)
FT                   /transl_table=11
FT                   /gene="lmo2281"
FT                   /product="protein gp22 [Bacteriophage A118]"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Z8"
FT                   /protein_id="CAD00359.1"
FT                   /translation="MAYMIPIYVNLVMNNRKTIEEVPANLRGQVKAKVDELKQEQQQIQ
FT                   SEEIEAE"
FT   regulatory      complement(266289..266303)
FT                   /gene="lmo2281"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(266384..266398)
FT                   /gene="lmo2282"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(266451..266768)
FT                   /transl_table=11
FT                   /gene="lmo2282"
FT                   /product="protein gp21 [Bacteriophage A118]"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Z7"
FT                   /protein_id="CAD00360.1"
FT                   /translation="MNYKQFYTYDENGDYLETILVFEDEKGLINQPKNSTNIEPSIIEN
FT                   GIARAMYYPSWDGSIWKEDKKRWESENPIIPAEKTEIEKLREELLLTQEALAALFESNL
FT                   G"
FT   regulatory      complement(266452..266457)
FT                   /gene="lmo2281"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(266776..266781)
FT                   /gene="lmo2282"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(266780..267853)
FT                   /transl_table=11
FT                   /gene="lmo2283"
FT                   /product="protein gp20 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR018913"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Z6"
FT                   /protein_id="CAD00361.1"
FT                   /translation="MTNQIFKSAILDFSVSAQNAKANVPQIRFSTQDSGGTARLKFTAK
FT                   KDDNNLPLSSAAEVTLAMVLSVGKKYESSYIVNPEIINRTGGVFEYSLTDEQISHDGQA
FT                   NAELYVKYPNQTMQINRFSFVIEKAMIDDNFLPVATYYVEKWDDYEKIFNEKVEILQNE
FT                   IDDLQGQATELKNTFDSLNPDQFPQKADFENHINNTNIHVTMTDKTNWNTKENTAGSQA
FT                   KADSALNSAKAYTDSKMDSYGAWINVPLAAGYSTGDSNTPQYRLVAKQTSTGLKTFAEF
FT                   RGAIAGTFSSTANSTVGTMPAGTRTVVTEYFAVASNNGNGGRIAIPVDGKMLQVSSTDN
FT                   ANPSYISLSGISYEVGN"
FT   CDS_pept        complement(267853..268881)
FT                   /transl_table=11
FT                   /gene="lmo2284"
FT                   /product="Protein gp19 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Z5"
FT                   /protein_id="CAD00362.1"
FT                   /translation="MLNLDKWGNTLFDSNKYQQFNANMEKLEKDSLAKDVDINATNNRI
FT                   DNVVLEAGGNNITEVVDARTSKNGQVYSTLNSRLNGDYSAIASDLAESNALLQTVNEEN
FT                   KVLKSKLDELYGNSASNIEYYVSSTNGNDVTGTGAIDAPFKTIQKAVNMVPKVKVGGFI
FT                   YIFCEPGQYNEDVVVQSFSGAECFYIQPTNLATIDPTTGQTGFFVKSILFSGIMFQCVV
FT                   QGLNSMSTAVNNNSTVIQFARCWYGTVTKCRFDTNLKATNITTVQYNQSRGNCYSNYFK
FT                   NQNIIMSSEYMGHALFASTNTCEATSNVGLKAASGGILVKSGTPVLNATTAELKQAGGQ
FT                   IF"
FT   regulatory      complement(267866..267871)
FT                   /gene="lmo2283"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(268882..269907)
FT                   /transl_table=11
FT                   /gene="lmo2285"
FT                   /product="Protein gp18 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="PDB:3GS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Z4"
FT                   /protein_id="CAD00363.1"
FT                   /translation="MNSDIIVADFWKNNEEILTDFDKDSFCESWTENEMWSIEFKVAQT
FT                   PKNAHCYSFLDYESSVYFRGQEFVVKQLSHDAVGKTLSKDIRAPHIYYTCQDGRQDDAI
FT                   TGSFTLEQCLTHIFKTDNRGFSWEIIDPSNILEKVQQENFGNNNYLTLIDQLLDDYGVV
FT                   VIPDNRHLVFKPREIYGAKTENFIRYKYNTDEASFDIDTLSLKTKIKGYGKVDSNGNNY
FT                   FSPITYTSPEVEKWGIRWQEPVSDERYTVAGNMQRRLKLELQDYPATTGSVILKNDYEC
FT                   EKGDYVLFIYEPLGIDYDVQIVAYKKYPFTIKAPEITLSNNKKSIVSIMAQLAKVLKGA
FT                   K"
FT   regulatory      complement(268889..268894)
FT                   /gene="lmo2284"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(269915..269920)
FT                   /gene="lmo2285"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(269916..270734)
FT                   /transl_table=11
FT                   /gene="lmo2286"
FT                   /product="Protein gp17 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Z3"
FT                   /protein_id="CAD00364.1"
FT                   /translation="MATSLALVIEGKTYMLNELFDLEVGEVSREPPQIVNNYTEFAGSD
FT                   GARTTDSNFSMFPISILCHFRTESADLYHVKLDELLELIYQRKEYFLVHSKTPGKKYRV
FT                   HPSGVGIDRKAPGYADLTLEFDVFRGYSESLSSTLSDSEIDCDKWQFGQGLAMEDYRYT
FT                   HTKSRFIIYNGGSFDIDPREHYLAITLRGQNEGELTINNITTGDRFIYYPSLSTTDTLI
FT                   IDCATPRINGNPCGRNTNHGLISLKKGENLIEISNTSHLDTKWDFSFLYK"
FT   CDS_pept        complement(270736..276099)
FT                   /transl_table=11
FT                   /gene="lmo2287"
FT                   /product="putative tape-measure [Bacteriophage A118]"
FT                   /db_xref="GOA:Q8Y4Z2"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Z2"
FT                   /protein_id="CAD00365.1"
FT                   /translation="MSDGSVVIEISLDDKKADKQLDAFEKDLAKAGTNAGAALDKAYRE
FT                   AVSDIASQSKRLKDTFVNAFKSMGNAGSNALKASLNFIRELPSNVQAALSKLASTVKTG
FT                   FVNAAKASITAVKNLGTSIKNTAVNIKNGFFSIAKTVQSSIVSAVKISINVIKSIPGAI
FT                   KSAGISIKSALVSSLQAAKSAAISFAQTTVKVIKSIPGAAKTAATAVKNSFVVAYKAVV
FT                   VAAYMSVKGTISAVKAIPSATKSAALAVSSAMKTAFSAVASAAKTTGTTVKSALKTGFS
FT                   AVKSGAKAAGQAGISALKGLGNIAKSTGSLIKSGLVSGFNAAKAAAKGAGAGMREALKN
FT                   SVEKPAEQARFSILRLAAAFGLIAATKNVVGSAIGRVDTIDTATKSLTVLTGSAKDAQL
FT                   VMTDLTAAIDGTPIALDAVALGAKKMVAAGMKAANVKPVFTAIADAAYGVGNGSESIDQ
FT                   MTDAISALQASGVAYADDINRLVDAGVPAWQILANSTGKSVGEMKKYVSEGSLESTRAI
FT                   AMLTKGIEEGTTGMAGNTAKMAGLAKTAGNTISGSFANMKTAAVKSLANIVENLKGPII
FT                   QALDVAKNAFKQFAAVTASPEFQKKLSDLIQKIKEFIPVLIEWAPLLAKVAAGFVAFNI
FT                   ISSVFSKVAKLAGAIKSLTSSGSLLSVVANTIKGSFVKLVGTLGSTTAAFGVVVAAVGA
FT                   VIAVIYGMYTAFKENTAGIKSFLSGMWEAVKNSFGKIIDVFKQIVSALKPVGSGFKGIL
FT                   KYIGVRAWVVLGFALAAVVDVIQVLARIVLVAIKALQGLYYAIKAAFQVLQGDLKGAKK
FT                   SLEQSKDAFVDAGSAIKDAFNKDNYALTGTVEAFKQMGGEAEKTAKKTETSGKKIKDTL
FT                   KLVESTAKQTETTVSKSNQAIDTMLSGGVDQYGNKLSEKTKSFLNSAKELYSQYQESAK
FT                   KSQDAYTAAMEKAQSLEGDKRKKAIADANKTLVDETTKNNSTLLTLQSDYSNMLKTNRW
FT                   ADGQELTAQQKKFLQQQTTDIQTELAKQNQLYVEANLLRLEQGKSLNEKERNTSLEVQK
FT                   SLYEEKKKAVETGEKSLADLKKKKADASTETEKANYQIQIDEQTKKNQTLSTNLKNWAS
FT                   EMNSIIANGGTLNAQTFANGLSQLGNISDEQLSALWQNFVSTSTSIDNTLAGLAGIMGQ
FT                   RGGEGVQAFVTALQSGDYTTAALNINNDVLSTISSLPNGMFLNGESGKNQFLTAIKSGD
FT                   FQGAGKYLVDGVKMGTDSIDSEMKTKGQTGGQNFADGVKGKEGAAKSAGSAVKNKAKEG
FT                   ATDPNAFKAVGSKDSAGFNNGVMGGKGGAYSAGSSVGNSAKSGAGSVDSSGVGSDFASG
FT                   YVNGILSGMGAVGRAAASLANKALAAVQKKQDSHSPSKESKKLGGDFGTGYSLGIADKN
FT                   KAVTKAANNLVASALGTESQIKKLSSTLKDKISSAIDAGLHSKNKSSGQLKQAKALNSI
FT                   EGYIVQQTNRLAATAKKRDKVVAQLKAANTKMADLTKQSKEYAASITEKMQSYGSISNV
FT                   DPENPKSIQAEMQKRLKEIKAFQANVEKLRKKGVSKDIINDILESGVENGSSYAQALAK
FT                   SDAKTIKAINSTQNQINSASKAMGNTAANAMYSAGINAAKGLINGLNSQKKQLEKAAKS
FT                   IANTITNSVKKALKIHSPSRVAIELGKFFTGGLGNGVLAGAKGAVQSTNKMVDKVVNAA
FT                   SNMTVPTINLPKISAEKALGLKSVDLNRTITVKTIIDNKTKESSNADLIKAIQQSGDRP
FT                   IIFNVDGKDIADNTNNHLGSSTSLAFYGKGL"
FT   regulatory      complement(270741..270746)
FT                   /gene="lmo2286"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(276107..276112)
FT                   /gene="lmo2287"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(276110..276715)
FT                   /transl_table=11
FT                   /gene="lmo2288"
FT                   /product="Protein gp15 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR009660"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Z1"
FT                   /protein_id="CAD00366.1"
FT                   /translation="MLSLAFGVNDIYEYEGKEYKLDLAFDNVLRVIDLTEDNSLSDVFR
FT                   ANLAIDVLFADDMPWPRSNEEDEYANIEEKSLVLIDIFTNYIVKENDDGLLYDIDGNKM
FT                   PSATNNNDDAEEIASYSLTQDADYIYASFLQDYNIDLLDSRGKMHWYKFRALLESLRDD
FT                   TTIKTIIGIRQAELPSGKGTEKERNELIKLKNRYKLKD"
FT   CDS_pept        complement(276721..277143)
FT                   /transl_table=11
FT                   /gene="lmo2289"
FT                   /product="Protein gp14 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR018923"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Z0"
FT                   /protein_id="CAD00367.1"
FT                   /translation="MAQNNVINIQLEESYQEFQLGTELFRVGLGDEMRRKWIEADEKYK
FT                   KKLEKLNKYNIDNTDEMSSEDYFALEEDVKEALTEAYAVLLDDEEAFSKCYKQCKDILK
FT                   MYQVYDQVAESIVGSVEKQQNEIQKKYKAKMTKKAK"
FT   regulatory      complement(276724..276729)
FT                   /gene="lmo2288"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(277153..277158)
FT                   /gene="lmo2289"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(277198..277530)
FT                   /transl_table=11
FT                   /gene="lmo2290"
FT                   /product="Portein gp13 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Y9"
FT                   /protein_id="CAD00368.1"
FT                   /translation="MLQNSQRLVAASLMMKHLRLQNPEESPSSVEVDHNTITVKVGETF
FT                   TINASVLPVGASQEVTYTSSNPPKAKINSVGTGEGVAEGTANITVASKESTSINKVVQV
FT                   TVEAAD"
FT   CDS_pept        complement(277460..277894)
FT                   /transl_table=11
FT                   /gene="lmo2291"
FT                   /product="major tail shaft protein [Bacteriophage A118]"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Y8"
FT                   /protein_id="CAD00369.1"
FT                   /translation="MRIKNAKTKYSVAEIVTGAGEPDWKRLSKWITNVSDDGSDNTEEQ
FT                   GDYDGDGNEKTVVLGYSEAYTFEGTHDREDDAQNLIVAKRRTPENRGIMFKIEIPDTET
FT                   AIGKATVSEIKGSAGGGDATEFPAFGCRIAYDETPTVTKP"
FT   regulatory      complement(277536..277541)
FT                   /gene="lmo2290"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(277897..278304)
FT                   /transl_table=11
FT                   /gene="lmo2292"
FT                   /product="Portein gp11 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR024411"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Y7"
FT                   /protein_id="CAD00370.1"
FT                   /translation="MSLDFLDSVMDAIENNVDLKDMKLRTAILKPESIALLLTPNNDKQ
FT                   GYQDGSYERSFSFNLNGSSKQEMKVLNVLNAITAYFDNTELESIQSLNNSFVLEDKETT
FT                   SVPNLVSASDDGTFIYSASFKIKLYIESEEK"
FT   regulatory      complement(277905..277910)
FT                   /gene="lmo2291"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(278241..278260)
FT                   /gene="lmo2293"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(278304..278642)
FT                   /transl_table=11
FT                   /gene="lmo2293"
FT                   /product="Protein gp10 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR021080"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Y6"
FT                   /protein_id="CAD00371.1"
FT                   /translation="MPIKVRVDLSKAKGSVKKAKERGQFALINQAAADIAPYVPFLEGD
FT                   LSNQYVIMNDKEIMWTSIYARRLYNGINFNFTLTHHPLAGPKWDQRAKVDKLESWIEVA
FT                   QKAVEEGL"
FT   regulatory      complement(278312..278317)
FT                   /gene="lmo2292"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(278642..279004)
FT                   /transl_table=11
FT                   /gene="lmo2294"
FT                   /product="Protein gp9 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR019612"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Y5"
FT                   /protein_id="CAD00372.1"
FT                   /translation="MKVAKPITNAPPLPLDWLIHNISYEAYKEEDRHNQVVYEKGIEIE
FT                   HVRVDFSKSNQIAGLSDSDRYDAVIFIDAVNSMNMPNDFISRSRIFFSGKAYKIVKVIP
FT                   CYATSNSVYHWEIEVV"
FT   regulatory      complement(278650..278655)
FT                   /gene="lmo2293"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(279004..279399)
FT                   /transl_table=11
FT                   /gene="lmo2295"
FT                   /product="Protein gp8 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR013514"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Y4"
FT                   /protein_id="CAD00373.1"
FT                   /translation="MPYTTLEFYTNEYAGEHLEQDEFDKLLKHAERKIDSVTFYRIRKS
FT                   GIESFSEFIQHQIQLATCNQIEYFKEAGGTSELAVSKPDNVSIGRTSISDSNFASTATS
FT                   LNSGLIGSDVRTYLAPTGLLYSGVGVR"
FT   regulatory      complement(279014..279019)
FT                   /gene="lmo2294"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(279409..279414)
FT                   /gene="lmo2295"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(279418..280419)
FT                   /transl_table=11
FT                   /gene="lmo2296"
FT                   /note="similar to coat protein [Bacteriophage SPP1]"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Y3"
FT                   /protein_id="CAD00374.1"
FT                   /translation="MGNEITKLLDVVTPEVFNAYMDNFTSEKSAIIQSGIAVADPSVAQ
FT                   NITAGGLLVNMPFWNDLDGEDETLGDGEKGLETGKITASADIAAVMYRGRGWSVNELAA
FT                   VISGDDPLNALMGKIASWWMRREQTVLISVLNGLFAKNGALASSHLLSKPTSAISGNLV
FT                   LDAKQLLGDSADRLNLMVMHSAVYTALQKQNLIAFIPNARGEVNIPTYLGYRVVVDDGV
FT                   PSTGTGAAKVYTSYLFATGSIGRNTGNPAKLTTFETARDASKGNDQVFTRRAFTMHPYG
FT                   VKFKNAVRDANEITPTNADLAKAGNWEKVYEDKQIGIVGIQHLVEELPAGGA"
FT   CDS_pept        complement(280419..281009)
FT                   /transl_table=11
FT                   /gene="lmo2297"
FT                   /product="putative scaffolding protein [Bacteriophage
FT                   A118]"
FT                   /db_xref="GOA:Q8Y4Y2"
FT                   /db_xref="InterPro:IPR009636"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Y2"
FT                   /protein_id="CAD00375.1"
FT                   /translation="MQREYLKGLGLEDEVINKVMAENGKDVTAAKQQLSEVEAERDGLK
FT                   SQLTQRDKDIDDLKKNSGTGEELKKQIEDLQQKNKDLESDYQSEIAETKKNSAIELALA
FT                   GAKARNPKAVKALLDNDKLELTDEGLKGLDEQLGALQESDAYLFAQESEKVPKFGFSGN
FT                   PKAPAGYDGSLKENLKSDSFNLTKFLTEKGESE"
FT   regulatory      complement(280429..280434)
FT                   /gene="lmo2296"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(281017..281022)
FT                   /gene="lmo2297"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(281088..282227)
FT                   /transl_table=11
FT                   /gene="lmo2298"
FT                   /product="Protein gp4 [Bacteriophage A118]"
FT                   /db_xref="GOA:Q8Y4Y1"
FT                   /db_xref="InterPro:IPR009319"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Y1"
FT                   /protein_id="CAD00376.1"
FT                   /translation="MALTPRQLDLFVQPVVDVYTGLENELFTLIVRRLKTKKNISADNV
FT                   LAWQIEKLNQVHALDQQMLNKISKASGVSAKKLFSIVKDAGYSDLKQVDNYFSKLAEAG
FT                   AVLPLVGDGQTIVDKVMRSYFKLAESNYNRVNQTMLSQARQIYSDIIHETTQSVLAGLK
FT                   THRQALAETVTKFAENGVPALVDKANKRWTPEAYVRTVTRTTVNSVYNSVEDERMNEYD
FT                   VDLVRISQHVGARPTCSLVQGKVICLLSVEETKTKYGNKYMSIYSPELRYGYGDGVFGC
FT                   NCRHHRFPFVEGINVAPEDSELIDEEENKRVYMLSQQQRLMERDIRASKRKLSAAEELG
FT                   DELAVKKAKQAVRTKQSKLRAFVNTHKLTRQYSREQVYA"
FT   CDS_pept        complement(282228..283988)
FT                   /transl_table=11
FT                   /gene="lmo2299"
FT                   /product="putative portal protein [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR006432"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4Y0"
FT                   /protein_id="CAD00377.1"
FT                   /translation="MINQIIASVKGVMRRMGLLKALKDVKDHKKVNANDEDYKYIDMWK
FT                   RLYQGHYAEWHNLNYEHNGNPVNRRQLSMNLPKVTAKYMSKLLFNEKVKINIDDKAAEE
FT                   FVLNVLKTNGFTKNMERYIEYGEAMGGFVIKVYHDGKKNVKVSFATADCMYPLSNDSEN
FT                   VDECVIANSFHKNDKYYTLLEWNEWQDDIYTVTTELYQSDDPDELGGKVSLKLLFNDIE
FT                   PVVPLPKFTRPTFIYIKPNIANNKNLTSPLGISVYANALDTLKTLDLMFDSFYQEFKLG
FT                   KKKVLVPSSFVKTAIGLDGSTTQYFDSTDEAFFLYQGDQDADGKSVKDISVEIRSTEFI
FT                   ESINAMLRIYAMQVGLSAGTFTFDENGLKTATEVVSEKSETYQTKNSHSQLIEQGIKEM
FT                   IVSILEVGKFIEAYSGEVVELDTITVDFDDSIAQDEDTTINRYTTAKNQGMIPLKIALQ
FT                   RAWNITDAEAEAWKEEIEKDVQAEIPGNDLSGLLGDIELPDENANGTLEASAVAGETIQ
FT                   EVSLNGAQITSLVNIVQSVAKGELPYNSALEMIVAAFPFDEEKARKILADAGNGFVITE
FT                   KEKTSKKEVD"
FT   regulatory      complement(282236..282241)
FT                   /gene="lmo2298"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(283997..284002)
FT                   /gene="lmo2299"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(284001..285332)
FT                   /transl_table=11
FT                   /gene="lmo2300"
FT                   /product="putative terminase large subunit from
FT                   Bacteriophage A118"
FT                   /db_xref="GOA:Q8Y4X9"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="InterPro:IPR035412"
FT                   /db_xref="InterPro:IPR035413"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4X9"
FT                   /protein_id="CAD00378.1"
FT                   /translation="MNATIHKQLIDYQVINVTDMINPAFYDLWLSKHNHIIAKGGRSSM
FT                   KSSVISLKLVEKKMANPQSNMVCLRKVANTLYKSVYQQIKWALYEMGVADQFKFGKSPM
FT                   EIIHKEWGTGFYFSGCDDPAKLKSMKIPVGYVSDLWFEELAEFSGVTDIDVVEDTFIRE
FT                   DLPDGQEVTIYMSFNPPRNPYEWVNEYVDSKRSDDDYLIHHTTYLDDEKGFLSKQIIKK
FT                   IEKYKKNDLDYYRWMYLGEVIGLGDNVYNMNLFQPLKAIPADDRLILIDFAIDTGHQVS
FT                   ATTYLSFGLTAKRNVILLNTYYYSPANQVVKKAPSEYSKELRDFMTKVVGNYNTNVDMQ
FT                   TVDSAEGGLRNQYYKDYGVSLHPVAKGKKVDMIDFVCDLLAQGRFYYLDIPENQIFIEE
FT                   HRKYQWDVKTVNTDKPEVIKEDDHTCDAFQYYVKDNLRKLGLKY"
FT   CDS_pept        complement(285301..286095)
FT                   /transl_table=11
FT                   /gene="lmo2301"
FT                   /note="similar to putative terminase small subunit from
FT                   Bacteriophage A118"
FT                   /db_xref="GOA:Q8Y4X8"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="InterPro:IPR038713"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4X8"
FT                   /protein_id="CAD00379.1"
FT                   /translation="MKTEEKYKIFAKTYVMNGFNGKEAAISAGYSTKTAEQQASRLLRN
FT                   VKVLELIDEEMKLLSKRMQDDASKIYAELWKQVRMIDDKMAKHEEASRKLSITDARKIT
FT                   AIADINNLKAKIRRTESKIKKMDGRKADEGKFKKELLEEYDELKIQLEELEDSVSEIYE
FT                   ENSTSKRDLLWHKDWKEILSLRAQILQDLFDRSGYKETKDMQDRRVALLDAQINKLELE
FT                   AKKDCKDSGFATIIMSNVDEMQAYLDKKAGGTDERDDTQTTN"
FT   regulatory      complement(285342..285347)
FT                   /gene="lmo2300"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(286105..286110)
FT                   /gene="lmo2301"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(286141..286680)
FT                   /transl_table=11
FT                   /gene="lmo2302"
FT                   /db_xref="GOA:Q8Y4X7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4X7"
FT                   /protein_id="CAD00380.1"
FT                   /translation="MSFILEVGSLADWVSGLATVGALFWAIKLNSNENRKRLTILFRHS
FT                   FVSKKNGIIISDGKPKVFIITPVNNSKFSLEINFRQILLVPSLMDRLLFRAEPKKLSNI
FT                   EALLKQLENKANWQIIKPNLSGEPIMFDYEFIVKQIKKYADGKRFNFAIEIQFIDSTSK
FT                   IFKHKEKLELRKIKGL"
FT   regulatory      complement(286141..286156)
FT                   /gene="lmo2302"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(286687..286692)
FT                   /gene="lmo2302"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(287046..287480)
FT                   /transl_table=11
FT                   /gene="lmo2303"
FT                   /product="Protein gp66 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4X6"
FT                   /protein_id="CAD00381.1"
FT                   /translation="MGQLFNLPQVEDINYIQTVRAVRKFFKDYLMLRVMAGSRKLPTMT
FT                   TTYKLTPPNFSNEFHSKVEDAAIHNVDNVHAAQEAVKKYDAILNQLEHIHRKILFEKFI
FT                   HNLQDITIMLDIPYEERQYKREKRKAVIELATTLGIEVLN"
FT   regulatory      complement(287488..287492)
FT                   /gene="lmo2303"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(287499..287663)
FT                   /transl_table=11
FT                   /gene="lmo2304"
FT                   /product="Bacteriophage A118 gp65 protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4X5"
FT                   /protein_id="CAD00382.1"
FT                   /translation="MQIEKLNVFTRETICDGKDVEIANYNIEFEAISEESFIDTAEKVE
FT                   KIREFIENL"
FT   regulatory      complement(287670..287675)
FT                   /gene="lmo2304"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(287792..288175)
FT                   /transl_table=11
FT                   /gene="lmo2305"
FT                   /db_xref="InterPro:IPR018916"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4X4"
FT                   /protein_id="CAD00383.1"
FT                   /translation="MTVMEITKSKARQREIISYIANNDVELDELLKLQKELNQLMNENT
FT                   IEKQKTYWTKTFDRIVKKKKWAEITIREFADLRNAGLTCYAIAEHFKVSKAVVFNYTQR
FT                   NKKEYYQIFDMNEYQKNKEIWND"
FT   CDS_pept        complement(288179..288583)
FT                   /transl_table=11
FT                   /gene="lmo2306"
FT                   /note="similar to phage protein"
FT                   /db_xref="InterPro:IPR009414"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4X3"
FT                   /protein_id="CAD00384.1"
FT                   /translation="MRQSIPRSSLTRRTSTRSKYNAKKVVIDNIKFDSKAEAAYYQQLK
FT                   LLKMSGEVVSFDLQPEFVLQESFRKNGKLYRAIKYKADFLVRYSDGHEELIDIKGMLTK
FT                   EFRIKQKLFELRYMQSIKCLKLKGRNFVEV"
FT   regulatory      complement(288184..288189)
FT                   /gene="lmo2305"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(288528..288710)
FT                   /transl_table=11
FT                   /gene="lmo2307"
FT                   /product="Hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4X2"
FT                   /protein_id="CAD00385.1"
FT                   /translation="MTADTAIKKLRNRSMSIRQMANAIAEVTNYQISEIESMGDEEIEA
FT                   KYTAFVINEANEYAK"
FT   regulatory      complement(288593..288597)
FT                   /gene="lmo2306"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(288718..288723)
FT                   /gene="lmo2307"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(288729..289211)
FT                   /transl_table=11
FT                   /gene="lmo2308"
FT                   /note="similar to single-stranded DNA-binding protein"
FT                   /db_xref="GOA:Q8Y4X1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8Y4X1"
FT                   /protein_id="CAD00386.1"
FT                   /translation="MMNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQNGERE
FT                   ADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEDNDGKRVFVTEVVAESVQFLE
FT                   PKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQKSDSFASEGKPIDINEDDLPF"
FT   CDS_pept        complement(289208..289387)
FT                   /transl_table=11
FT                   /gene="lmo2309"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4X0"
FT                   /protein_id="CAD00387.1"
FT                   /translation="MKYKITYLSQEVYEVEAENEEEAIRIAEFNPMYRPDAHIKLIEDE
FT                   NLLDCELMKEREDE"
FT   regulatory      complement(289220..289225)
FT                   /gene="lmo2308"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(289395..289400)
FT                   /gene="lmo2309"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(289491..289658)
FT                   /transl_table=11
FT                   /gene="lmo2310"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4W9"
FT                   /protein_id="CAD00388.1"
FT                   /translation="MKHKIVQVGFLADKGEELIKLLDDGWKILTATYVGDNIEQMGGLV
FT                   QYVLRKEAEE"
FT   CDS_pept        complement(289655..290116)
FT                   /transl_table=11
FT                   /gene="lmo2311"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4W8"
FT                   /protein_id="CAD00389.1"
FT                   /translation="MKHGQWMLNGTDGERWGAFERFDTKEEAIIYGVELLTEYNSLDDD
FT                   ERRDYDLSDGLNMRPLDYENIYTFFVGQIEEVEFPTEVDTLLENIAQCVYDEVGECGEE
FT                   YLNDVTQEHKEQLSDLIYEWAKQRDYLPACFKIEMVEEIDIRSFEEVAE"
FT   regulatory      complement(289666..289671)
FT                   /gene="lmo2310"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(290113..290583)
FT                   /transl_table=11
FT                   /gene="lmo2312"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4W7"
FT                   /protein_id="CAD00390.1"
FT                   /translation="MKQEELDIILENHGKWLFNEGGDRADLSNADLKNTNLRFANLRLA
FT                   DLRGADLSYANLRFANLSNADLSYANLSNVNLNWVNWQHVEGLTVICVQVDTTRKNNQI
FT                   AYIKELDIWITGCFQGTLDELKASVEQTHGDNEKLRKRYYRVIDFILKEVAE"
FT   regulatory      complement(290124..290129)
FT                   /gene="lmo2311"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(290580..291023)
FT                   /transl_table=11
FT                   /gene="lmo2313"
FT                   /note="similar to a bacteriophage protein"
FT                   /db_xref="InterPro:IPR010024"
FT                   /db_xref="InterPro:IPR019096"
FT                   /db_xref="InterPro:IPR023385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4W6"
FT                   /protein_id="CAD00391.1"
FT                   /translation="MRAIGFRAFVKRKKKMLPVTDLCFNETEAVGVSGCGNAKCTLCVD
FT                   WYSFDDVVLMQYTGLKDKNGKKIFEGDVVTAFSNINKYTDSFAGDVEPTFCFTSIVYDG
FT                   ACFKTTYKGEPSYVLNQNGSSLVKHMEVIGNIHENPELLEGTE"
FT   regulatory      complement(290591..290596)
FT                   /gene="lmo2312"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(291020..291217)
FT                   /transl_table=11
FT                   /gene="lmo2314"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4W5"
FT                   /protein_id="CAD00392.1"
FT                   /translation="MELYAIVDEDLQVAKHRSKGTLAVFKDLEMLKKHAWRYKESGKLY
FT                   KIAELEPINFFSFEEAEGEA"
FT   regulatory      complement(291031..291036)
FT                   /gene="lmo2313"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(291220..291816)
FT                   /transl_table=11
FT                   /gene="lmo2315"
FT                   /note="similar to protein gp51 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR012865"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4W4"
FT                   /protein_id="CAD00393.1"
FT                   /translation="MRFKEGDKVQFIENNELIIGTIKRVNNDVGWVDLKVSDLSWFFRK
FT                   LEDVVKVKEPELIAVPRFAADWIKHCKQREYDLACLLDYEDSDMSAEMYEWLISSADNQ
FT                   ELLARAWLDGYEVEKEPLYYVRLPLSTWNDDAAELEVINMYVLLNVQSDETSITGSIIN
FT                   ENKEWRTKLTEAEIKGIPGGEIYWQFAVLVEEAEA"
FT   regulatory      complement(291225..291230)
FT                   /gene="lmo2314"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(291813..292625)
FT                   /transl_table=11
FT                   /gene="lmo2316"
FT                   /note="similar to site-specific DNA-methyltransferase"
FT                   /db_xref="GOA:Q8Y4W3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4W3"
FT                   /protein_id="CAD00394.1"
FT                   /translation="MKRILNYPGSKWGLADLIIENMPEHKSYLEPFCGSCAVFMNKQKA
FT                   TLETINDLDGRLVNLFKAMRDNPEKLQYLIMHTLYSREEYMLSQEITSDSLEDARRMAV
FT                   RLWFAVGGKTNANVGFRKNVSWNGPYNAYEWNDMYNRIGIAAARLKDAQIENVDAIKLI
FT                   EQHNDKDTLIYCDPPYVATSLASSHYQHDFSLEQHKELLKVLKNHDGKVMLSGYESELY
FT                   KQELSDWPVLKTMTKVGITSEKKSDRQEIIWCNFEPPMQLNLFKEEKA"
FT   regulatory      complement(291824..291829)
FT                   /gene="lmo2315"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(292622..293596)
FT                   /transl_table=11
FT                   /gene="lmo2317"
FT                   /note="similar to protein gp49 [Bacteriophage A118]"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR010056"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4W2"
FT                   /protein_id="CAD00395.1"
FT                   /translation="MSGIQWIKLSVNMFDDEKIKLLEKMPEGNQMLIVWIRLLALAGKT
FT                   NDKGRIYLNENVPYTEDMLATLFNRDVGIIRVTLHTLQSFGMIQKTENGLIEIENWEKH
FT                   QNVDGMERVREQTRKRVEKHREAMRQNRIASGDSKGNKECNVTSSVTVTQSNAIDIDKE
FT                   LDKDINNNNSDLNFKDFWEQNGFGMMLPVELEKLLAWVDDFAGNREIVMKALEVTSEQG
FT                   ANKRNYAYVNKILKNWESRGFKTIADVDAAEKQRQIELEQKYNKPTYNKYNKPVKEEVL
FT                   PDWFDKDQKQTKQETSTTGSSEDLEKQVAEIKAQLAARNEVQA"
FT   regulatory      complement(292633..292638)
FT                   /gene="lmo2316"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(293604..293609)
FT                   /gene="lmo2317"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(293613..294311)
FT                   /transl_table=11
FT                   /gene="lmo2318"
FT                   /db_xref="InterPro:IPR007499"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4W1"
FT                   /protein_id="CAD00396.1"
FT                   /translation="MKKSESIGAIAKAMAAIQKEVKPLEKSAANPFTDSKYTPLDKIVE
FT                   AIFKVAPGHGVSFTQWPISGDNGTIGIGTMLMHESGEWIEYDPLYMTVITNKKMSSAQE
FT                   AGGTITYAKRYVIAAVFGIVSDEDKDGNIQSSPSKYPKNNSYKSNNYNQNSNSQQQTKQ
FT                   SQQNDNLASPAQRKAIFAKASVIGEPFGHDGTFVLESYKITDTKSMSKGEASALIKKLD
FT                   AEIEAQKQVN"
FT   CDS_pept        complement(294317..294793)
FT                   /transl_table=11
FT                   /gene="lmo2319"
FT                   /note="similar to bacteriophage proteins"
FT                   /db_xref="InterPro:IPR008840"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4W0"
FT                   /protein_id="CAD00397.1"
FT                   /translation="MKLYELTQAYNQVLEMAEELDTETLQDTLDSIREPIEEKAENIIK
FT                   MVKSIDAEAEGLAKEVERLTKRKTALDAKAKNMKEYLESEMLKVDIRKIKSSLFTISIQ
FT                   KNPPSLRLEDEEKLFMFLVEQPKKLDKKAITSALKEGRDVPGAKLVQTESLRVR"
FT   regulatory      complement(294320..294325)
FT                   /gene="lmo2318"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(294790..294984)
FT                   /transl_table=11
FT                   /gene="lmo2320"
FT                   /db_xref="UniProtKB/TrEMBL:Q8Y4V9"
FT                   /protein_id="CAD00398.1"
FT                   /translation="MDNFKTIHYGFKVVIHDYDDELTPLYNLLKKQSTNLEGSKLFDEL
FT                   IDIHEKLAKKIEQREGVQA"
FT   regulatory      complement(294803..294808)
FT                   /gene="lmo2319"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(294991..294996)
FT                   /gene="lmo2320"
FT                   /regulatory_class="ribosome_binding_site"
XX
SQ   Sequence 295050 BP; 87009 A; 59864 C; 49510 G; 98667 T; 0 other;
     acgagattcg cggtaccacc cttgttgaca tgcattttaa ctgcttgccc acttcattaa        60
     tgccataacg ctggctcgcg ctaacactta ctcaagcggt tgctctttcg ggttagaact       120
     aaagagtgat ttcgattttc tagaggatag ctggtctcgc accatgcacc aactcgcttt       180
     gtatccttta tctaaaaaac ttacttgtct ctaataatcg tttttaacgt tcttcagatt       240
     cagctgattc tacttcctta atagacgcaa gttctgtcgc atctacatcg taagccatca       300
     tttgttgcca atcttcactt ttaattaaat ccatttgtgc ttccactagc atacgtaaac       360
     gctcacggaa tactttggat tgacgtttta ggtcttcaat ttcaatcgcg attttgcgcg       420
     ctttagaaag tgagtcgctt agaattcggt cagcattttt ttctgcttca cggataataa       480
     gtttggcttc tttttcagcg gaagctttca cttcttcggc agctgtttgt gccacgatta       540
     atgatttgtt taatgtttct tcaatgtttg taaaatgacc taaacgttct tcactattat       600
     ttaaagtgtc ctcaatacgc tttttctctt tgataacttg ttcataatct ttaatgattt       660
     gatcgaggaa gtcatttact tcgtcttcgt cataacctct aaaaccacgg gtaaactctt       720
     tgttatgtat atccagcggc gataatggca tatctagcac ctccatacga ctattgttta       780
     taaataccta acatacattc taccatagtt actagctttt tcctagaatt tatattaaaa       840
     atggttagat taaaaatcct gctttttcta aggcctcaat tgcttgttct aattgctctt       900
     ttgtatctgc ttcaatcgta tgcaaatgcg tgccgtctgt taggcccgac agcatagtgg       960
     caccagtcgt ctgtactttt ttaatgaatt tttcgacatc aaaccggctc ttcaaatgca      1020
     aagatgcagt aatttctccg taaatcggat ggtcaactat cacatccaca acagaaactc      1080
     cgtgatcgac taaaatattt aattcttcca ccgcttgttc tttcgtgtgc ttcacggcaa      1140
     tcacccgtcg ttcccctgca aaacttgttt ctttcgcata aatatagcct tgcggtgtag      1200
     ccataattgg ctcatttccg gcttttagta aagaaatatc ttgaacaatg acttggcgac      1260
     taacgtttgt tttgctcgca agttggtttc cggaaatagg cgtttctgct tcttttaacc      1320
     attttaaaat aagttgcctg cgtgtatttc ctaatatttt tttcatcttc tcaccttttt      1380
     cgtagtaatt tatctagttc ctttttaaaa atcagactat cgcttaattc attttctctc      1440
     ccaaatgaca atcgaataaa gcgacttgct tcttctatcg ttttcccagt agcgagtaat      1500
     gttctggacg gcgctgggtc acgtaaacta catgcgctcg ttgtcgaaat ttgaatgtcc      1560
     gcttcgttaa gtgcaagtaa tgcttcctgc ccttgcatgt tcggcaaagt gatccctaaa      1620
     ataaacggag atgtatttaa tccgccttcc accttgactt tcgctgttaa cgcttcgcaa      1680
     atcgcctttt tcaattctgc aatccgccgc gcttcttttt ctctatttcc cattatatca      1740
     taggcagctg ttgtaaaggc agcaattgct ggaacattta cagttcccgg tctaaagccg      1800
     aattcatgat gcacattcgg caaaggaacc tgcataggaa catctggctt tataaaaagt      1860
     agtcccgctc cttttggacc ataaatttta tgcgaggaaa tactaaagct agtcacgtca      1920
     tctaacgtta gatctaattt tccaaaagat tgaacgatat ctgtatgaaa atacacgccc      1980
     gcttgtttag caatatgcgc taattctcta attggctgaa tgctaccaat ttcagaattc      2040
     acatgctgaa taatgactag tccggtatct ggtgaaatca tatcgctgag cacagctgga      2100
     tccactctac caaatgcatc gactggtaaa agcctaagcc aacatgctcc tgcttcttca      2160
     agtgcttcta gttgctgcca aacagaagca tgctccaatg gacttacgag tacttctttc      2220
     ttcttggtcg aatgtagtag tgtttggatt gcgatttgat tgctttctgt gccaccgctt      2280
     gtaaacataa ttccacgact tggcacatgt aaaatttccg caaaacttcc ccgacatttt      2340
     tctaatagag ccgcagattt cgttccggca tcgtgtaaac tttccgaatt agcgaagaat      2400
     tctctggatg cactcataaa aacttctaaa gctgcctcgc tcattttcgt tgtggcagcg      2460
     tgatcaaagt aaatcatttt ttacctctcc cccaaaattt tatacttgaa tttcatttcg      2520
     ttttgtgtga ttatagatga caagacaact gtatattcac ttagaagtat acaattaatc      2580
     gaacctacta tgcaagaggt gaaaaggatg ataaaagagc gagtaattat cgttgggagc      2640
     ggcatttctg gttgcacggc tgcccttcgt ttaatgcagg actatgatgt gacaataatc      2700
     acaaaaggct acaaagaaga aagtaattcg atgctcgcgc aaggcggagt ggcagcggca      2760
     gtgtcaaaaa acgatacccc gaaaaaacat tttagcgata cttttcaagc cggttgtttt      2820
     cataataaag ttctagcagt aaatcaactc gttactcacg gaccaatggt tatccaaaaa      2880
     ttaatcgcag aagggatggc ttttgacgaa caagacggtg aacttgcgct tggtttagaa      2940
     ggcgcccacc aattgccacg aattttacat actggcggtg atcaaaccgg caaatttctt      3000
     actacttttt tacaagaaaa attaacagac attcactggc aagagcaaaa aatggctatc      3060
     gaaattataa aacagaatga ttcggctatc ggcgtgcatt gtttagataa agaaaatcga      3120
     ctacatactt attacggaga acatattatt ttagcaagcg gcggacttgg acaacttttt      3180
     ccagttacga cgaatgcggc gacaatttcc ggtgatggtt tagcactggc ttaccgggct      3240
     ggtgctaagc taaccgacat ggaatttatc caatttcatc ccactttact ttttctaaac      3300
     gggcgttgtc atgggcttat ttcagaagcg gtccgcggtg aaggggccaa acttattcgc      3360
     gcagatggtt cggcgataat gactgatgtt cacccgagag ctgatcttgc gccgcgcgat      3420
     attgttgctg cgacgctatt tgcagaaatt caagatggga atgaggtttt ccttgatatc      3480
     acggcaattc ctaattttga aaaacgtttt ccgggaatta cagctaattt ggatgcacat      3540
     cacatcccat ttcgtgaaac aaagcggatc ccagttcatc ccggcgcaca ttttttaatg      3600
     ggtggtattc gtaccgacct atctggtaaa acgaacattc ccggtttgta cgccattggt      3660
     gaggttgcaa atgcaggagt gcacggcgct aatcgtctcg ccagcaattc ccttcttgaa      3720
     acgctcgtct ttggtgaaaa agtggctgaa tacattcgca cgcaaaaaat aaatccaata      3780
     gaccatccag aaatccctct ttcgaaccaa atccaaacgc cccatttacc agataaacaa      3840
     ttacttcaag agaaaatctg ggaaacgctt ggcatcacaa gaaaaccaga aaaaatcacc      3900
     gaatttcttc actggcttac tgatttcgat tacgcaaatc acactcgaaa aacagcggaa      3960
     attagccaca tgcttatcac cgcaaaacta atcgccgaaa gcgcgctcaa acgaacagaa      4020
     agtcttggtg cacatcgaat tttaaaagga gtaattaaat gaattccata cttatgaatc      4080
     aagcaattca agcattttta ctagaagata ttggtcagta tgacttaagt gcaggaactg      4140
     tttttccccg tgacacaatg ggagaaggtg ttttcctagc aaaagaaaca ggtattcttt      4200
     gtggcatttc catcccgccg aaagtttatg aactgctcgg tggaaatata caatttgaag      4260
     cttataaaaa agatggtgac tgggttcaaa aaggcgatat tatcgcggct gttaaggctc      4320
     cagttcgcac gttactttcc ggtgagcgag ttattttaaa tttaatgcaa cgaatgagtg      4380
     gtatcgctag ccaaactaat tttgctatca aacaactgga tgattccgct attcggattt      4440
     gtgacacgcg gaaaacagca cccggtcttc gcgccttcga taaatacgcc gtacagaccg      4500
     gtggcggctt taatcaccgt aatggtctat acgatggcgt tatgttaaaa gacaaccaca      4560
     tcgccttctc tggaggtatt acaagtgctg tatctactgt acggggaaaa cttggccata      4620
     tggtaaaaat cgaagtggaa acagaaactg ctgaacaagt aaaagaagcc gttcaagccg      4680
     gcgcagatat cataatgttt gataatcgca caccggaaga aatcaagcaa ctcgttaagc      4740
     tagttccacc gcacattact acagaaattt ccggtaatgt cactttagaa aatattcatc      4800
     gttataaggg ttctggagca aattacattt ctttaggctc cttaacgcat tccgttcgtg      4860
     cgtttgacat cagttttaat agcaaaggag gaataaaggc atgaatttac tagaaacggt      4920
     cgaacaagat acaatgccaa ctcattataa gcaaatgacg caggtcgaaa tgattgctcg      4980
     tgtgacggaa attaaagccc agcttggcga gaatctcttt attccctgtc accattatca      5040
     aaaagatgag gtcgttccat ttgccgatgc gattggcgat tctttacaat tagcgcaaat      5100
     tgctgcacaa aataaaaaag ccaaacatat cgttttttgc ggtgttcatt ttatggcaga      5160
     aacagcggat atgcttacga caagcgagca gattgttact ttgccagata tgcgcgctgg      5220
     ttgttcgatg gcagatatgg cggacattca tcagctaaca aatgcttggc caaaactgca      5280
     aacccttttc ggcgatacga ttttacctgt cacttacatt aattccactg ctgcgataaa      5340
     atccttcgtt ggcgaacatg gtggtactac ggtgacatct agtaacgcaa caaaaattgt      5400
     ctcatgggcg ctcgaacaaa aagagcggat tttctttctt cctgaccagc atctaggtcg      5460
     aaacacggct tttgaactag gtattcccct cgaacatatg gcaatttgga acccgataaa      5520
     aaatgaacta gaatatgagg ggaatttgga tgattgtaaa gtcattcttt ggaagggcta      5580
     ctgctctgtt caccaacatt tcacagtcaa aaatatcgag aacattcgta aaaatcatcc      5640
     taatatgcgg attattgttc atccagaatg cacgcatgaa gttgtttctt tagcagatga      5700
     ttccggctcg acgaaaaaaa ttgtaactga aataaacaat gcagcgccag gtacagaatg      5760
     ggcagttgga acagaagcta atttagttgg tcgcattatc caagagaatc cagataaaaa      5820
     aatcgtctcg ctaaatccgt ttatgtgccc ttgtatgacc atgaatcgaa ttgatttacc      5880
     acatttactt tggacactag aagctatcca aaacggcgaa aaacgaaacc aaatcaaagt      5940
     cgatgaacag acaaccaaat ttgccttaaa agccttagaa agaatgcttc aattaagcta      6000
     ataaaaaaaa cgaaagcaac aactgctttc gtttcagctc tataatttat aaaagcttct      6060
     atttgtcaat ctaaatttta atctgtagaa cttactcgag tatatgctac tatcatgact      6120
     aaaaagcaac tcttttcaca accaattaat atccacccta gctatacatt gaaaaaagtg      6180
     tatttacaat gatggttttg ggtatatttt gggtataccc tttttttaca tttttgcttg      6240
     cccttgattt aaataaacaa attctcctta aataaaaact aggttgccca tcttttttct      6300
     caagtgggca acctagtttt attatatttt agctattttt ttgcttttta agtcgaaaga      6360
     ataaaacaaa agatagacac acggtgatga aaccaaatat gctatacaac acactatccc      6420
     aaagattatc cccagtagtt ggtagtttta aatttcccgc tactatcggt tgttcctgat      6480
     gtgttgcttt tatttttaaa gttccggatt gtttcgtggg tgtttgctgt gtacttggtg      6540
     tgtttgggtt agctggtgct ggtacgacag gtttaatcgg tgttattggt ggcgctggaa      6600
     caactgttgc ttttacagtc accttaatcg taacagaatc tccggcaaaa ctataggtta      6660
     ccggataaac gcctgctttc gtagtgtcta ccgaaccgtc tactttcacc tcatcgaagg      6720
     gaaccgcgac accgagtgaa tctactgcac tatcaaaatt gtcctttgca ctccatgtat      6780
     ctcctacatt cattgtagaa tcatgtgctt taatcgaagc tggtatggtt ttgtacacat      6840
     acgttactgt ttgtgcattg gttttgaaaa caccactcgc gttcgtcggc aatttgcttt      6900
     catccaatgt gtaaccagca aattctttcg ctttcgtttg gtatggatca tctacattac      6960
     cagttaagtt atcggaagct gttaatattt ttccctcttc atttagatat ttcacggtaa      7020
     ctggtgctgc agcgacacta ttttttgtat atacatagat cactgtttga ggctcctctg      7080
     taaaagtccc ctgggcattc gtaggtgttt gtgtcaacgt atagccatct atcgttttag      7140
     gcgttgaagc ataagcatct ccttcattac cagaaaggat atctggtgtg gctaacgtat      7200
     ctccattact atccaggtat tgcacggtaa catccgctcc ttttagtggt gcggtaactt      7260
     taattggaac tctcactttt gcaaaaggat tagagttcgt cgataaggtg cttttaatcg      7320
     tgatataacc atcccccacg tctgtcgcta cgccgttagt gagtatatta gcagaagtcc      7380
     catcatcata atacataaat tcatgttgac taaaaagagg tatattagat ttcaatccta      7440
     gatttgtttt atcaggagtt aattgtttga agtcagtatt taaaggaacc tctatagttc      7500
     ctcctgtata agtcaattga tcttgttttt ggagataatc tattgttggg ttatcataaa      7560
     attccaacat gtttccccca ctattaaaat tgtccaaata attagctgga atatcagaag      7620
     caatttgatt accagcaaga gacataccta atttcccatc atgcattgct ttccagttag      7680
     ttgttaaaat actatcggga atagtaacta acttttgatt acttacatcc aaaaccttta      7740
     aatgagaagc tagcgtagta atttctgtgg gtatctctgt aatattaccc ctactgatat      7800
     ataagacttc taatttaggt aattggaata tcaccatggg aaactcctgt aaattattct      7860
     catctacatt taaagtgact aattctttta aactccctac actctctggc acttctgtaa      7920
     tagtgccata gttagcttct aaagcagtta agttcttata atccgatatt ttatttggga      7980
     ttgaatctgc accaaataca tgtatttttt ggatggtttc caaatcagct agagtaatgt      8040
     cttgcctatt tttggataaa atcttttcgg tttcggcaat aaaaggctcg ttaccatcta      8100
     gctcctgttc aatccatgaa gtggaggctg cctgtgcctc taacatttgg aaaggaagta      8160
     ctgtcatgaa caataccaac aacaggagat atacaaattt ctttttcact gtagtgccac      8220
     gtccttagtt ttatttttat acttctaatt atactctttg cctaaaaaat aaaatcctaa      8280
     aaacagacta ttaattactc tacttcgtcg ttattgtgtc ttgtcatata ttgcctgtca      8340
     gcttcagata tgtccttttt tcacacatcg taaaacactt aatatacctc gctaatgact      8400
     atagttttta tcataaaaac agccagaaaa ttaattcctg gctgtttttt actatattta      8460
     cttttcctac ataccccagt ttcctgggtc tcctatgttc taattaaccg taagtaccca      8520
     atcatatacg caaccttctt gagtaatagg gtatgcatca ttgaattgaa cgttgaaatt      8580
     gtatacaccc ggactaagtt ctgatgtgtc aagagtaata gattctgtat ccgcattggt      8640
     agtagttaca acttctaccg gaatatctgc tgaataacta ccaagcactg taggattaac      8700
     caacatatta atctctgcca attggaagta aataggtagt tggattgtac acgtttcccc      8760
     ttgcttaatt atttgatctg gcacggtccc agattgattt tcaataaaaa tcgaatttaa      8820
     cacattggat gggagttcat ttaagtgatt ataatctaga tttaaattat tcaaattgga      8880
     taaattggta aagttggtca tggtattcgt taaattgtta aagcttaaat ttaattcagc      8940
     taagttagtt aagttttgaa aatcaggaag attggttaat tgattgtgac ttaaatctaa      9000
     cgtagataac ttgggtatag tatgaaaatc tggcacatca tcacttgtaa tcatcatgtc      9060
     ggccatatat aactggctta agtcaggcat gccagtgaaa tccgggattg ctccgattaa      9120
     gttgcttccg ctcatggtaa tggtgaccat ttcaggataa ttttggtagt ctggaagaga      9180
     taagtttcta gttacccctt caggtggagt attaaagaat aatgtgttta gatgtggaat      9240
     agtagaaata tcagggaact ccgttagatc ttctccaaat tccataacgc taacaatatt      9300
     gacgttgtta aacatggcac gctctagtaa ttgcatggaa tcattcgtaa ttgtttctgt      9360
     ttcaaatcct aagccagtta atgcatccaa atcatcttgg tcaataacgt cattcacaga      9420
     gtctttgttc aagtttttag ccatatcttt ggctaatcct tcatctggaa agacatcaat      9480
     aattggagca ggtagtggat ataaatcgga tgcagctttt gcttttagat ctccaccagt      9540
     tatggttaat aataagacag ttaacaacaa tgttgtactt aaacccgtta atattttttt      9600
     caatgaattc aatcctttct ttttaaagtg attaaatcat aacatgtaaa tccacaagta      9660
     tttttttata catcagattt gaacattaac taactttttt caatcttaca taacctatcc      9720
     tagtatattg ataagtaaga tacaaaatag acgcaaaaga agagaagaca caaaaatcat      9780
     cttctcttct ttttatttca aatcattaaa ggtttttcac cgaatctaac tcaatgctat      9840
     tgagttagat tggatggaag gtctttgtgc ttgaattttg tattttgaaa caaaaaatat      9900
     cttcttctgc aatggctaat tattcatatt attataaagg cctccaataa aacgctattt      9960
     ataatttgat attacagtct gaaacgaaag cagcagctgc tttcgttttt attttaaata     10020
     gccaatttcg atccgaattt tatctttttt cgttctgccg ccagtcgata gtacttttac     10080
     tcgaccatac ccgcgagcag acaatacatc ttcttcctca cattcaaaat ctgggttttc     10140
     cactgttttc cagtttactt tcactagtcc cgcagttacc aattgtttcg ccttctgtct     10200
     agaaatatga tgcgcattac taataatcac atcaagtcgc atactagaaa cagttaagcc     10260
     catctcttcc caaataaccg gcgcatacac agcattagtt aattccgttt cctctaacat     10320
     cacatttact ttaccgattt tttcaagttg taatgtcaaa taatccttca ttgtactttc     10380
     tactaataac tgccattcgg taccattatt taaaatatct ccaaaaatat cgcgcttcat     10440
     tccaagcgac attagtgttc caaggatttt ttgatgtgtg agggtcgtga attttaccgg     10500
     gtagcgtata tgaaataaag caatctcaaa atccgcttct gttggcgtat aataatctgg     10560
     ataaatcagt gcgcgccgtc gctccgcgtg cgccactcca ccaaaaaact gtacattgat     10620
     ctcatcataa ccgccgataa cagtttcagt aataaaacgc tgtctcggat ccaagaaatc     10680
     cgtaagttgt ggcgtgtatt cattctcaac ttgcatcgta atccctaaaa tcttatcaat     10740
     aaatgcgtat tcttctgcgc gaaaatgctg ataaattcca tccatcataa tttctccctt     10800
     tcaatccgtg ccgagtcttt agccctatta taccatgaaa acaactgcta ccaggctaat     10860
     cttgcttatt aataaaaaaa gccacccatt taaaaacggg cgcgcttttt aaaataacat     10920
     tggaatgacg tacacttgaa ttaaacctgt caaaactctc atcgcatatt ggaaaatgaa     10980
     ataagccaca agggacgaaa tatcaaacat accaatcggc ggaataatcc ttctaaaagg     11040
     ctctaaaata ggttcaaaaa tacgtgctaa aaattggccg atttttgatt ctcttgcacc     11100
     gggaaaccag ctcatcaaga aataaataaa cattagtgtt ggcaaccatc tgataataaa     11160
     taaaacgatt tccaccactt gatataaaat actttgcaat ctagctcaca cctctacttc     11220
     atcacataaa gttttgttca tcgagcattt cggaaataga gccatccact tccacattgt     11280
     ctggagtaca taagaaaata ttattgccaa cgcgttgaat atctccaccc aatgcataca     11340
     ctgtaccgct caagaaatcg acaatacgtg tcgcttgatc atggctaata cgttgcaagt     11400
     tcacaacgac agatttatat tctttcaaat aatccgcaag ttcttgtgct tcagcataca     11460
     cacgcggttc agcaagtacc atacgactag aaaactgagc tccctgcata ctaaccacct     11520
     ttgcatcatc ttcttctact gcataaaaac gatttttatt tggtttttct ttcttcgttt     11580
     tcttttgcat aggttctggt tccctcgcta cttcctcttc ataatattcc tcttcttcat     11640
     ctaagaaaaa gaatgactta aatttattcg atagtcccat ttgttacacc tccatattat     11700
     cgtcattcac caaagctctt cctattcgta taaatgttgc accttctgta atcgcaattc     11760
     cgtagtcatt tgtcatcccc atagataact ctgtacatgg aatatttttt aactgaagcg     11820
     catgaatttc ttgctgcaat tgctttaact catgaaatac gtgatgcagc tctatgtcgc     11880
     tatttgtaat aggtgccatt gtcattaagc caacaatctc aataaacgta aaattcgctt     11940
     cttgtaaaaa agatagcgct tcttctttgg aaaaaccatg tttactttcc tcgccagaaa     12000
     tatttacttg aaggaaacat ttcactggtt tagtagcacg cttttcgatt tcctttgcta     12060
     gcgatgatcg atcaagcgaa tgcaaataat cgatttgtgg taacacatct tttactttgc     12120
     gcgtttgcaa agagccaatg taatgccaac aaatgtcgtc tttatctgca agttcgactg     12180
     ttttttctag gaaaacatcg gcacgatttt caccaaagtg gcgaatacct aaatcataaa     12240
     gctccgtgat tccagttaca tcaatcgttt tcgtaacagc taccaatgtt acatcttccg     12300
     actgacgatt actttcttca caggcatgct cgatttgtgc agttactttt tgtaaattag     12360
     cttgttttgt cattttttat caccttatat aattcccgaa gtgctttatt taaaacgctt     12420
     cttgttataa tcagataccc ggtcacttgg caatgcttca aaagtggccg ggtgaaattg     12480
     tcttataagt attatccgcg acggttacgg ttacggataa atgctggtac atcaacatct     12540
     gaactatttt gttgtggttc agcttgttgt tcatgaactg gtgcatttgc ttgttgtggt     12600
     gcattttgcg cataatcatt ttgttgttcg tcctgtacag cataattagg acgatttact     12660
     tgaatagatt gatttggacg gcgatttgct tgcgcttgtt gttgcgcttg ctttgcttca     12720
     tcaaaacctg ttgcaataac agttacaatc agttcatctt ttaattcgtc attaataaca     12780
     gaaccgaaaa tcatatttac atcttcatca gatgcgcttg atacgatttc tgctgcttct     12840
     tgtacttcat aaaggcttag gttagatccg cctgtaatat tcattagcac accttttgca     12900
     ccatcaacag aagtttcaag aagtggagaa gagatagctt ttttcgcagc ttcagcagca     12960
     cggttttcac cagttgcaat accgattccc ataagggcag aaccgcgatt agtcataatt     13020
     gttttcacat cggcaaagtc taagttaatt aaaccaggaa cggcaatcaa atcagaaatc     13080
     ccttgtacac cttgacgtaa aacattatct gcttcacgga aagcttcaag catcggtgta     13140
     tttttatcca caatttgaag taaacggtca ttaggaataa caattaacgt atccaccgct     13200
     tctttcattg cttctgttcc agttaaggct tgtttcgtac gttttggtcc ttcaaaacca     13260
     aatggtcgag taacaacacc tactgttaaa gcgcccattt cttttgcgat ttgagcgata     13320
     acaggtgcag ccccagttcc agttccgccg cccattccag cagttacgaa taccatatca     13380
     gagcctttta aagcttcttc aatttgttcg cggctttctt ctgcagcttt tttaccaatt     13440
     tcaggtacag ctcccgcacc taaaccacgc gttaattttg taccgatttg taattttgtt     13500
     tctgcttttg ctaagttaag tgcttgagcg tctgtattaa cggagataaa ttctactcct     13560
     tgaacaccat gctcaatcat acggtttaca gcattgttcc cgccaccgcc aacaccgatt     13620
     actttaattg ttgccaaact ttctgaacta gtgtcaaatt ctaacatatt attgcctcct     13680
     atttgccgat ttatacgata cgattttctt gctgacctat cagctattca cttttattca     13740
     aaaaatgcgc cgaaaaaatt cttcattttc gttgatactt tttcgtcatc tgatttcttt     13800
     tgttttggtt taggttgttt ttgttttggt gcttcgtcgt cgtaacgagg ttcgtttgcc     13860
     gaactgctta cgtcgcgtcc ttctaattca gccatttgat aagcatattt aattaagcct     13920
     actgcggttg taaaggaagg ttcccgaaca ccaatataat caggaatcgc tagtctaaca     13980
     tgcgctgcta aggtttttcc agccaaatca attgcccctg gaatagccat cgaaccacca     14040
     gttagtacat aacctcctgg aagatgcgtt ttaccgacac gagtaagttc ttccactact     14100
     aattggaaaa tttcttccat acgcgcttcg ataatatctg ctacttctac ttgtgtaaaa     14160
     tgttgttttt ggtcactacc gataacatca atagcaaaaa cttcatctgg agaagcatca     14220
     tcataaaatg catagccatg atccaattta acgcgatcgg catttgcagt agaagtgttt     14280
     agtccaagtg ataagtcttt ggtgatatta tctccaccaa ctggaatgac accagtataa     14340
     gttagtcgtc cttgctcaaa cacactaaca gttgtagttc ctgcaccaac attcacgagt     14400
     gctgttccaa attctttatc atcttctgac aaggaaatag atgcctccgc aagtggttgt     14460
     aaagcaatat cagaaatttc aagtcctgca cgttccacac aacgtaacgt attatgtaaa     14520
     attgtttttg aaccagtgat taatgtacct tccatttcta gacgaacacc aatcattcca     14580
     cgtggatctg taattccagt taatccatct acaacaaatt gatctggaat agtgttaata     14640
     atttctcttt caggagatag aggaacaact tgagcggcat ccattacatt ccagacatct     14700
     tcatctgtaa tttcacggtt ttcgctacct actgccacaa ttcctcggca agcttctaaa     14760
     tgcacttgac tcgatactac cccaactatt acttgagaaa tttcaacgcc aaccattctt     14820
     tctgcttgtt caattgcctt tttaatggat tctacagtct tgtctatgtc gataataatc     14880
     ccttttttta ttccggaaga ttcgacattc ccaacaccga taatattgag tctatcgtca     14940
     gccatttctg cgatgattac tttcacagaa gctgttccaa tgtctaaact tacataaatt     15000
     tcgctatcac ccatttatcg gcacctcctt ttattctagt catttaacat gtatttattt     15060
     cattttttta taccgagcaa aagccggttt tttaactttt ttgaaaaagc tatgaaattt     15120
     ctttatttta tggcgtcagt gtagaatgat tgcccattct gcctaacata caaaatcact     15180
     tatttacagt ctacactaag aaagaaggta ataaaagcac aaagaacatt ttttggcaaa     15240
     ttcttaagat atttttttca tttcattcaa aaagcgaaca agtgttggca taccttagct     15300
     taaggtcatc attttgttac ctttttgaaa catctgttat ctataaattc gccaaaaaat     15360
     tagcgagaag aaaaaaagta ttattcattt gtttctttct tctctttagc tgcttcttcg     15420
     gttgcttttt tctccgcatt ctgttgataa taactttgga aataagaacc tacttcaata     15480
     tcaataaccc ctttttgtcc tttcgccagt tgagcgacaa ttgctggata atgttgcatt     15540
     ttctcagcaa aggtactaat atctgcggaa acctggttac catcgttcat atataattta     15600
     atatggtttt tatcactttt tgttggacta taaatcactt ccgagataga actaacaaca     15660
     tcttttggta acttattaat ttggtctacc attttctcaa gcgttttacc gtttttaaaa     15720
     ttttgaaata gcaaatcatt tccaattggg aattgtcttg gttgatctgt tagcataatg     15780
     ccgctttcta gcacatcata gtatttacca tcttgttgtt gataacctat cgttttaaat     15840
     tcggtgatat tgatttgaac atcatttaac ccttctttag aaacggtagc atctttaata     15900
     agggtatttt ttttgagggc atcttcggtt ttcccattac ttatcccgat gacaaactca     15960
     ccaatttcaa gtccactttc ttttcttact tcattctcag taagttgctt attgccactt     16020
     acagcaattt tatctaactt actgagtggg gagaggaaat aaagcgtaat ggcgatcaaa     16080
     atcacaaaaa ttccgattaa aatggctagg tgtcttacta attttttttt gcggtatttt     16140
     ttgagttctg gtatgcgatt ttcaatggaa attactcgtt tattttcagc cattttattc     16200
     gctcctttct gcgatttatt tcataatgct aaggactgct tctactaatt tcgctgctgc     16260
     atctgggcgc cccatttgtt tagcacttag cttcatacta tttaatttcg cctcgtcatt     16320
     caaaatcgaa tcaactgtcg ccattaaatc ggtatttttt aattctgctt ctgtaattac     16380
     gatagctgca ttattttttt ctaaagcgcg agcgttattt tcttggtggt tcgctgtcac     16440
     gtatggacta ggtatcaaaa tacttggaac cccaagcgct gtaagttctg caagtgtagt     16500
     cgctcctgct cttgaaacaa ctagcgttac agcgtttaaa attttcggca tatcataaat     16560
     aaatggttga acactaatat gattacccaa attcaactca gctaaagaat cttttatttt     16620
     ttcatagtgt acatcgcctg ttacataaag tagctgaaaa tcccgattat tccattctgg     16680
     caaaacagct tctacagctt cattcacgcc gcgagctcct ctactgcctc caaaaacaag     16740
     cacagttggc ttccctgaaa caagcccgta agcttcaagc gcaccttctg agtccacacc     16800
     tacaacttca gaagcacgtg gattaccagt gaaaacgatt ttttcagatg caaaagaatc     16860
     acttacttct tcaaaacaaa tagctacttt atctgtgtag cgacttaaaa atttattcgt     16920
     taatccagca acactatttt gttcgtggat taaagtagga attttaagtt ttgcggctgc     16980
     ataaacgact ggaccacaaa cataaccacc tgttccgata acgacatccg gtttaaaatc     17040
     gcgcaaaatt tgtttgcttt tttttgcacc acttagaaag cgcatcactg ttttaatatt     17100
     ttctaaagat aatgaacgtt taaaacctgt aatttcaata gcttcaaaag gaataccctc     17160
     acgtttaacg atacccgctt ctaagccttt ttctgttccg atatataaga attccgcttc     17220
     aggatgactt ttttttaatt ctctgatgag ggcaagcgct ggataaacat gtccgccagt     17280
     accaccacca cttattgcta ctttcatttt tccacctctt ctattagctc gccgattgcg     17340
     tccatatatg cattcccgcg aacttcaaat gtccggtatt gatcccaact cgcacatgct     17400
     ggtgaaagta agataatatc tcctggcgct gattcgcgat aagcaacagg aactgccgct     17460
     tcgacattat ccacgtaatg tacttcaatg ccagcgattt tcccgacacg accaatttta     17520
     tctgctgttt cgccaaagac gattaacgtt tttacatttt tgaaaaatgg tagtaattcg     17580
     tcaaatgaat taccacggtc caaaccacca gcgagtaaca caactggatt tttaaaccct     17640
     tttaatgcac tttgagttgc aaggatattc gttgcttttg aatcgttata gaatttacga     17700
     ccttgccatt ctacaacaaa ttgtgtccgg tgctctacac ctttaaatgt ttctaatacg     17760
     tgcatgattt cttcgtttgt aacacctaat gtctttgcta ctgctacgga agcaagtacg     17820
     ttttctaagt tatgttctcc aggaagtaaa atattgtcac gctccccaat cacttcgtcg     17880
     ttgaacataa tattgccatt ttgcacgtag cttccttgac caagacgttg cgttgttgaa     17940
     aaaggaataa cttgcgcttt tgtttgtttt gttaaatttt taagctcttc ttgatcccag     18000
     ttaattacta ggaaatcatc cgctatttga tttttttgga tgtgccattt tgcttggacg     18060
     tattcgctac ggtctgtatg gtagtctaaa tgtgcctcat aaatattcgt aataacggaa     18120
     atatgtggtt taaacgtttc tacgcccatt aattggaacg aagatagttc catcgaaata     18180
     tattgatcac ttgttgcatt ttcagcaaca gcggatgctg gaaaaccaat gttccctgct     18240
     agtaaagaac tattttcttt atgtgtattt aacatatggt gaataatcgt tgttgtcgtt     18300
     gttttaccat ttgttcctgt gattccaaca atcggtgcct cagaaatttg gtaagctaat     18360
     tccacttccg taatgactgg aattttaagt tttaacgctt tttcaatcat tgggttattg     18420
     tacggaattc cggggttttt tataacaagc tcaaatccct catccaaaag ttcaattggg     18480
     tgcgaaccgc aaataacttt aataccttgc tcaagtaaac cttgcgcttc tggattctcg     18540
     ctaaaaggtt tttgatcatt aacagttaca aatgctccca gtttatgcat aattgttgcc     18600
     gcgctaacac cacttcttgc aagacccaag acaagtactt ttttgtgatg gtacatttca     18660
     atttttttca tttcctttgg ttcccccatt tatctcaaaa ttggcggtcg aatttatgat     18720
     tttcacaaaa acgacggaaa gcgccaacca gattctgtaa aaaacagcta actagagacg     18780
     cttttgccgt aaaaagatta cggcgcatta tttaaaaaat gactacacag acagagataa     18840
     ttgctccgac taatccgatt ccccagaacg ttaaaacaac acgccattcg gaccagccac     18900
     caagttcaaa gtgatgatga attggtgtca tacggaagat tcgtttccct ccagttgcct     18960
     taaaataaaa tacttgcaat ataacagatg ctgtttcaat aacgaaaata attccgatta     19020
     aaagtaacag ccattcttga tgtactaaaa tagaaattgc tgcgatactt ccaccgagtg     19080
     caagcgaacc ggtatctccc atgaagattt tcgctggatt tttattaaat agtagaaatc     19140
     caagcattcc acccacaatc gcaaaacaga aaatcgcgac atccatttgt tcttggtaaa     19200
     atgcaatgac accaaaagca gaaaaagcaa tgacagaaag gccagagaca agaccgtcta     19260
     aaccatctgt taaattaact gcattggaga aaccaaccaa ccagaacaaa ataaagataa     19320
     caaagaacca accaagatcc acttctatat tcgtaaatgg aatattaagc gtctcggcaa     19380
     aatcattaaa atgatacaca agatagaata aaatcgaaat caccacttgg cctaaaaact     19440
     tctgctttga agtaaggcct agattacgtt tttgaactac tttgatatag tcatctagga     19500
     aacctaatgc gccaaataat gccagcgcga taaatagtag ccacgttgcc gcactaactt     19560
     caccactgat gaacgaaaag actaagaagc taataagcat agcggtaatg aaaacaacag     19620
     cacccattgt cggtgttcct gatttctttt catgcatttt cgggccttca tctctaatac     19680
     tttggccgaa ttttaatttc accaagaatg gtataaatag tgggacacct atcaccgtaa     19740
     tgataaaagc cactgcaaat gttgatacta acatgtataa agacacaata aattctcccc     19800
     aatctgtttg tcaaagcact tcacttcata ttttatgcga gtccgagttt tttttcaata     19860
     gctattcgag cttctactcg atcatcgaaa tcaataacct cgtcaccaac cacttgataa     19920
     tcttcatgac cttttccagc aatcagaata acatcccctg cttctgcttg atttactgca     19980
     aaacgaatcg catctcggcg gttttcatga acaacgtaag catcactttc tggaacacct     20040
     tgaatcatat cttcaataat cgcacgtgga ttttcactac gcggattatc tgatgtaaaa     20100
     ataggatttg ttgcataatc tacagcgatt ttcgccattt gtggacgttt tcctttatca     20160
     cgatccccgc cacaaccaac aacgacaaaa acgcgttttt ctgcaaattc atcaattgtt     20220
     tctaatacat ttagcaagcc gtctggagta tgagcgtaat caactataac aggaaactct     20280
     tgtcctgcat gtacaagttc aaaacgtcct ttgacacccg gtatgctttc cactgtttta     20340
     attgcttttt ccatagggat atgtagcgca aaacttgttg caatcgcagc caatacgtta     20400
     taaacactaa agttcccaat catttttatt tttaatgtga aattaccaac tggtgtccct     20460
     aaatcaaatg tggaaccatg gctagtaatt ttgatattac ttgcttggaa gtcagcttct     20520
     tgttttatcc caaaagtgat aatgtgagcg gctgttgctt tttgcatacg cacactttcc     20580
     gcgtcatccg cgtttaatac agcaattttt ggattacttg tatggtagct gttgcctagt     20640
     tgggcaaaca ataagctttt tgcattggca tattcttcca ttgtatggtg ataatccaaa     20700
     tgatcttgag acaaattcat aaacacagcg acatcatagt ctgaaccgta tacgcgacct     20760
     tgaacgagtg catgcgagga gacttccatc acagctgtgc ttactccgct gagtaacatg     20820
     tcccggaatg tttcttgtaa agttaggctg tctggcgttg tattttttgt ttctaaaatt     20880
     tggtcgccaa ttttacgata catcgtgcca atcaaacctg tttgctcacc attttcgcga     20940
     acgatttgtt ccactaagtg gctcacggtc gtcttaccat tcgtcccagt aatcccaacg     21000
     agttttaacg cttgggtcgg agatccataa aagtaatcgg ctaacatcgc catggcacgt     21060
     tttgaatctc ttacatatat gacaggaatt gatacatcca cttgtttttc tgcaataatt     21120
     gctactgctc ctagttctac tgcacgagac gcaaacttgt gtccatccac tacttctccg     21180
     tctatacaaa taaacaatgt ccctggtttt acttttctac tatcttgggc gatatggcta     21240
     atttcaattg tttcacttac ctcgccagta aaaaccggga tagcttgcat tagttcattt     21300
     aacttcattc ttgccatctc ctcaaactta ttctttctgt tatttttgct aaaaccaaaa     21360
     agaattcttt tctatcttag caaaaacaac aaactatatc taccacgaca aaagacacag     21420
     attgcattta aagttagaag tatgccactt tataaagctg acatacttct atcttcctat     21480
     tattaattga gcaaatcacc gataccggca ttctcttgga tgtcagttgc ttttttattt     21540
     ttttccgctg tatcttgatc gtgattttga ttaaatgcac ttatttcttc tggtggcgcg     21600
     agggttattt tcattttcgt ttcactatta ataacgctac ccgcagatac gctttggctc     21660
     ttcacgtaac catttccact aaactcaaat ggaataccag ttatttcaga aacttttaac     21720
     gcatcgtctt tcgaccaagt taccatgtca ggggcagtca tgtcaccatc tgtcattaaa     21780
     ataacttttt gaccttgcat gatttcggcg ttcgcttgtg gaagttgttg gacaattttt     21840
     ttgccattac caactacaat tggttccaac cctttatcct tcactatttt tttagcttca     21900
     tctacttttt ttcctgctag gactggtact ttttcagaag ctagtttttc tgcatcgcct     21960
     ggtttgatgt tcatatattg cagactattt ttcattacag gattaaaaac ttccgagact     22020
     gcttctccgc cagtctgact gccggacaat tgcggttgtt gcattgtcac atagataact     22080
     aattccggat tatccgccgg tgccattcct aagaaagaga atatataatt atctgctcca     22140
     gtcatatact tacctgtttt gggatctgga atttgtgatg taccggtttt accagctaca     22200
     tcgtatccag gaatcgcgta taatttacca gtaccatgtt cgccgctaat aacgtttttt     22260
     aattcatcac gcgtcttctt cgctgtttct gcactaattg gttttccagc aatttttgtt     22320
     ttagtgtcgg tttcttcgcc tgtgtttgga tctttgacac ttgaaacaac atatggttct     22380
     ttcatcgtgc cgtcacttgc gatagccgaa gcagcttgaa tcatttgcat cattgaaacg     22440
     gttgtccctt gtccgaaaac ggttgttact ttctcaattg gatagttata caaaattttc     22500
     ccgcttgttt cattaggtaa agcaatacct gttttcttac caaaaccaaa tttgtctaaa     22560
     tatgttttaa aagtatcggt tcccattttg tttaagagtt tggcaaatgc aacgttacta     22620
     gagcgttcta ctccttcacg atacgtaata gagccccaac cgtttccgtt gttatggtca     22680
     tggattgcga tatctcctac tttataagaa cccgattgat aatattcatt ggcattataa     22740
     gcgttcgtat caattgcaga tgcaagagaa ataattttca ttactgatcc tggctcataa     22800
     gcatactcaa caggtaaatc ttgccaaatg ctggagctgt ttccggtaat agtagatcga     22860
     tcagcagggt tgaaggaagg acgttgacta atagctaaaa tttcacctgt tttcggatca     22920
     gctacaactg ccatcatgtt tttcggttta tactttgcat caacagttgt catcgtatct     22980
     tctaaaaagg tttgaatttt tttatctagt gttagcgtaa tatctttgcc gtcttttgct     23040
     tccgttactt tgtttttaga attaggcaaa atataaccca ttctgtctgt actgtaatca     23100
     attttgccat ttttgcctgt caaaatatca ttataacggg attcaatacc cattttacct     23160
     tctagaacgg tagcattctt ttcttcttct tgttgcgcaa aaccaattaa ttgtgttgca     23220
     aatgttccat taggatagaa acgttctgat tgacgagtaa attcaatacc tggtaaattt     23280
     tccttgtcaa ttttcgcttt cgtttctgta gaaatgtttt ttccagcagc gccgaattcg     23340
     acttggtatt ttcctttttc gtggagctta tctagaatgt cagattcatc cataggaata     23400
     tacttggcaa ggattcgagc tgttttttct tcatcaacaa cacgcattgg attcttcgtt     23460
     gttttggaaa gtttatcgct aactactgct gcaaccgtgt aagaagccgt atcctccgct     23520
     agcacttctc ctttacgatc taaaatggag ccacgctttg cttcgagaac actgcttttc     23580
     aaatgttgtt tagatgcttt tgctgcaaga ggtaccccat ttgcttctcc cgtaatttgc     23640
     aaataaagaa aacggccaga aaccaagaga aagagaattg tgaaaaagat aaaaagcaca     23700
     agagctcccc ttctcatgtt acctatacgc cgtttcattg accatctacc actttcacat     23760
     tatcgccatc aagttttagc cctttttctt tagcgatttt caaaatacgt tcatatctcc     23820
     ctaaatcttt tacttctact tttaagtctt catttgattt ttgttgttcg agaattttgg     23880
     tttcttttgt ttgaatttct tggttcactg tgtaaatttg cgcttgtacg ctaattatac     23940
     gaaaagcaac aactaaaaca atcgcaagcg caatcgtgat gattactttt tctccaagtg     24000
     tcatttgacc acgttttagg atttgttttt tgggttgttc cgcttctcta tgtactctat     24060
     ttggctcgag attcgattta taggcgacat tgctcacatt ttttcaactc ctgctatttg     24120
     ataatttttt cgatcacgcg taattttgca gaacgtgctc ggttgttttg ctccagttct     24180
     tcttcacttg gtacgattgg ttttcttgtc gcaagtttga aatctggttt atattcatct     24240
     ggaatgacag gaagacctgg tggtaaatct ggtccttttg tcgcttcttg gaataattgc     24300
     ttggttatgc ggtcttctaa agaatgaaac gtaatcacgc taattctgcc gcctggtttt     24360
     attaaagtta aggctttttc aagcgaatct tctactgcgc cgagttcgtc attaacagca     24420
     attcggatgg cttgaaaagt gcgttttcct ggatgtccac cttttcttct tgctggcgct     24480
     ggaatagctg ttttaataat atctactagt tcgccagtag tttcaattgg tttcacttcg     24540
     cgacgacgtt cgatttcacg agcaatttgt ttcgaaaatt tttcttcgcc atattggaaa     24600
     aagatacgaa ttaaatcttg gtaagaccat tcattgacaa ctgtttttgc tgtcaattct     24660
     tgttcttgat ccattcgcat atccagtgca gcatcttggt gataactaaa accacgttct     24720
     ctctcgtcta gttgagggga agaaacgcct agatcataca aaatcccatc aaccgcttct     24780
     ataccacgct catttaatgc ttctttcata tcgcgaaaat tggctttaat aaaagtcact     24840
     ttatcgctat aatctgctag tttaattttt gcattatcaa tcgctgtttg atcttggtca     24900
     aatgcaaata aatgcccttt ttcattaagc ttatttagta aatactcgga gtgacctgcg     24960
     ccgccaagtg ttgcatcgac atagattccg tctggtttta cttcaagcat atcgactgtt     25020
     tcatgtagta gtacggtttc gtgcttaaac atgcatttcc ccccttaaat atcaaagcca     25080
     atcatatttt cggctaaatc agcaaaagat tcttctgcct cattaaagac atcatcccac     25140
     tctgatttac tccaaatttc aatacgactt gaaactccaa taattactgt ttctttttcc     25200
     aaatccgcat actgtagtaa gttggatgga atattaatcc gaccttgttt gtctagttca     25260
     cattcagacg caccggaaaa gaagaaacgt gtaaaggaac gagcatcttt cttagtaagt     25320
     ggtaaggttt ggagcttttc ttcaagcttt ttccattcct cttgtggata agcaaataaa     25380
     cacttatcaa gtcctcgggt tataacaaaa ttatccccca aaagctcacg gaatttagct     25440
     ggcacaatta atctgccctt tatatcgatg ttgtgttgat attctcccat gaacattaga     25500
     cttcacccac tttcatacat accactttac cacatctccc cacttcgcac caccgaaaac     25560
     ctaaaaaagt gcaaaaaaaa atcattccag ccaaagcata gaatgattaa acccttattt     25620
     aaagccattt tttcctaatt caattctaaa aaaacaatgt ggggcttggt ggagggattc     25680
     cccactttga accaaaattc attttactaa cactttttcc caaccagatt ttaatgccac     25740
     cgctgagaac actatactta aaataccaag aataatcgtg aaagctccca tgccatattt     25800
     gccaataaat ggtgcaaata ctaaacttac agaaccaatc attttaccaa tttggaaaat     25860
     aataccatta aacgccatgt aggccccacg cttgtcatca tcaacaattg ccgctaaaat     25920
     agtttggcgt gttggtacat aaagtaattc accaatcgaa agcaccatcg ttgccaaaag     25980
     taaaacagct agattatttg cgaaggcgca aactgcaaac ccaagtgcaa acaaagtaaa     26040
     ccctacatac ataataggtt gctgcgccct tttagtcaca aatctcgcaa ttggtacggt     26100
     aaaaagtaca ataaataaag tattcacagc ggttaacaca ctcactattt gtactccatt     26160
     gagcgaaata tttccaagtg gccccaaatg cacaagtaac gctttcacat cttctgctaa     26220
     acgaaccgaa atgtagttgc tccgttgaaa ctcaatcgac atgatagcaa ttccaccaat     26280
     agtatataga agaaaacgat aatcatgtaa tacttgtcca taatttttaa gcattcccat     26340
     tagtccatat gaccctttgt gcggcatttc tttttgctgc aacgtctcgg aaattaagct     26400
     tatagtaagc cacgccgtaa caaatgacat gataaaaagg acaactaata gcggaaacag     26460
     ataatctaca aaaaaccacc cccccaccat aattccaatc atgatcgata aattattcgc     26520
     ccaataacta acggaataca taaatgaacg gttctctagg gtacttacat caatcaacat     26580
     cgcttctcca gctggattaa tcaacccctg agctacccca ataataagta acattacaaa     26640
     agttatccac ggagaatgaa acatgggaga attgcatagc accatcccaa gaaacgcaaa     26700
     cactttaagc agttctccgg tgaccattaa tttcttacgt ccaataatat ccgctagatg     26760
     tccaccgtac atgccagcaa gaaattgcgc taatacatta atcatcaaga gaaagccagc     26820
     gacactacta ttaatctcca ttgaaaaata aattgccata aaaggaaaaa tcattgaacc     26880
     aattacttta ctcaaaaact gaattaatat ccgtgcgcga atattcgggt gtaactctct     26940
     aaacatgaca ttccctccat ttgcaatttt tctgacttct ctgctagtat aaaagggata     27000
     cataaatata aaaagggtat tcattttcat atattgtccc cttttagaac ggagctgtgc     27060
     tatggataaa gattatttca ctatgcgcgc gcatttatac aatataacta ccgatttaga     27120
     agtgcctttc aaattaaatg atgtggcaaa tatttggttt tgtacgacta aaaatgccaa     27180
     gcgtaaattg caacaatatc aggcgaaaaa aatgcttact tatcttcctg gattaggccg     27240
     tggaaatgtt tcacggatta ttttccctaa acagttagaa ctagaggttc ttgacgtttt     27300
     ggaacaaagt ttggctgaag atgcatttag caatatttta tttttgctac aattgcctat     27360
     ccctaaaagc tggttcacaa gtatttctac cgaaattcaa caaatgttcg gtttgcaagt     27420
     aacagagaat caacaagaag ttctgcgctc tatcgttcgt cgcaagctca ctaccttaga     27480
     tccacttcaa acttctgtat ccatggaagc ttttctcatc acccaaatta gtgactctct     27540
     cgtcaaatat gatgaaaaga aaaagagaat tatacctcat atagcacacc actggaaagt     27600
     ttctgatgat tttacggaat ggacatttta tttacgaaaa agtgttttat ttcatcatgg     27660
     acgcacgctt gatagtgagg atgtaaagta caccttgatg cgttctatgc aagcagaatc     27720
     ggtttctttc tggcaattac aggatattca atccatctac tgtcctaata aattcacgct     27780
     ctccattcag ttaaaaaaaa ctgacccttt tttcattcgt tatttatgca cagcgaatat     27840
     ggctatttta ccgcgtgata ttatttttga tgaatataaa tggatttcta ctggtccctt     27900
     tcgagttgca gagcggaatg acgagcgctt gatcttagaa gcctttgatg gatattttct     27960
     cgagagaccg attcttgatc gagtagaatt ttggaccgtc caaactggaa acaatttaaa     28020
     aaccattcca atgcagttca cttccgttga ttacgaggaa aatcccgcct atgtggaacg     28080
     tcgtaaacct ggtgttggcg ttaattttat ttgtttcaat acgcaccgaa atggcacccc     28140
     gcaacatccg gcatttcgag aggcaatcta ccatctcatc gattgtcaaa aagcaagtga     28200
     tcaacatttc gaaaactatg gtacagtcgc atctaactat taccctgaaa aatcccttcc     28260
     acctaaaaaa catcctgaga aaatcactac tttattaaaa acagcaaact accaaggtga     28320
     aaaagttgtt tttggaacta cccaacaccc taccgctgta aaagagtcaa aatggatcca     28380
     agagcaagct gtcaaattcg gaattaacct agaaagaaaa atcatttcgc atcaggaagc     28440
     ttcctattcc aatgttccag cagaagaaac cgacttcatg atgatgggag aaatcccagc     28500
     atcagatgac gaaatggcct atttagattt tttaaataac ccctatctgt tgccgcaaca     28560
     acttttcaat caagtaatta tcaaagaact tacggaaaaa ctggttgcat ttaaaaaaga     28620
     gaaagacgcc tccaaaagag acgccttaca aacgagtatt gatagctggc taacagaaaa     28680
     tcattattta atttacttgc atcatccgga aaaaagccaa tcgcttcatt caatgataaa     28740
     aggaattgca gaaaatcctt atggttattt tgatttaagc aaagtgtgga ttgaaacaag     28800
     cccgcttaaa acattaaaac cagactataa acaatcccat agaggtaaag cgccacatac     28860
     aataaagcaa aaatgaagaa gcacaggcgc cagtatccac gaaggatttt tcggaattga     28920
     atctcgcctt ctttctttgc agccgtaaca acaattacaa tacctaaaat aaataaaaat     28980
     aataaaatat ataataagaa cgagcgatta aatagcacaa tcatgaaaaa atgaacagca     29040
     ataatcaaga aaatagtaga taagtcagcg gctaacataa ttctccgctg gcttttcttc     29100
     agtttgaaac tggaaaaaaa catcgtcaaa ataaatacca caactggtaa aataataatt     29160
     attgctgttg aattagttaa ccaatcaaac atcactttct ccttccaacc ctttaattag     29220
     atgatataac gcatgaagcg taggaagtga ctcccctttt tctaaaattg gcagcacgat     29280
     tccatcaatt tctgtcattc gattattcat tcggtcaaga gccatcgaag aaaaattagt     29340
     agctgtcact tggcagatta cttccacttt ttctaaagca ttttctactg gcaaaaccgt     29400
     ttgtatttct tttacaatcg tctttaataa ttcgtgccat tctttatttt caagaagctt     29460
     tccattttgg acttgaagaa cagctgtgag tggattaatt actgcattaa taaataattt     29520
     ttcatttata atgtctaagt aactagcatg cttttcaact ggaaaatctg gatttgaatc     29580
     taatattttt attacagcct catttaactc gccttggtaa atactatact ttgttcggcc     29640
     atgaccacgc caaatgactg ttgtatcatc ttcccgcccc gccccgtgtt cgctaatacc     29700
     tagtaaaata gttcgtttat taccgagtag cggcatgcta tctaaatgcg ccgctccgtt     29760
     ttggatgaat aataacggca ctcgttcagg tatcgaccgt aacagtggca aaatggtttt     29820
     tagtgagtat tgtttaactg cgataattaa taattcttgt tctgataact tttcagcatc     29880
     tgttattact gtggcttgta tatgtatatt ttttaattcg gaattatctt ttaaagaaag     29940
     tcctttttga tttaataaat cgctttgttc ttttctccgc gtaaaaagag taagttcaga     30000
     tatattggca aaatttgctg cgtataaaag ccccatcgct cctgctccaa taattcctac     30060
     ttttagttgg ttcgccattt agttcagctc catattggtt aatgctttta ttttatcaga     30120
     agtagcattc ttttgcactt ctgtacgcaa acaaaaacct cgaaagaccc atggcgtctt     30180
     tcgaggttcg tcttcaacag gtgaaacgtc acctattttt agcaatatta gctgtttgct     30240
     acatctttgc catcatattg tccacattct gggcatacgt gatgggaaag tctgtattcg     30300
     ccgcaattcg agcattcgtt catgcccgga agttgaagtt taacgtgtgt acgacgctta     30360
     cgctttttgg cttttgaagt tcttctaaaa ggtactgcca tttccttaca cctccttgac     30420
     gataactaag tacttgtatc gttaatctaa gaaaaataaa ttccttaata tattccagct     30480
     tcacggggag tttagtcttc ttttttctca tcgaaaaaat tggctaatcc cgcaagacga     30540
     ggatccactt ttggttcttt tgctatttgt tctagtagat tgccttcttc tgttttcatt     30600
     tcccattctt tgcctcgtgg aaggttactc atttcgagtg cgtcttcact gaaaacttgc     30660
     atcggaattt caacaagtaa aagttcttct actacagggg ttaaatcgac catatcctgt     30720
     tccatcacat gccaagattc atctagaact tgttctttgg atttcacaaa ggtttccgtc     30780
     gcatgcactt cataaggata aataacatcc tcaagcgtac gagcacatgg aagtgtccac     30840
     tcgcctctca tagtcaggtt agcggtaact tcttctgggt gtacaataag ttccccagtt     30900
     atttgtacgg ggcttgcatc acgaacgtct atattgttct cttgaaagaa cttttttagg     30960
     tcagcttttt cattaatcgt gaagttgctg tcacgatatt ttttcaattg actgatagac     31020
     catttcatcc tacatcactc caagcgcaac acaaaatatt atagcttttt taaaggcttt     31080
     tgtcaatggt ttttcgggga ccaaaactac cggttgaatt ttatgctaaa atagattatc     31140
     taaaggaggg aaccgaaatg aaagcaactg gaattgtggt ggaatataac ccttttcata     31200
     atgggcacaa actacattta aataaagcgc gcgagttaac tcaagcagat gtggtgattg     31260
     cggtaatgag tggctcgttt gtacagcgcg gcgaaccagc aattattcca aaatgggaac     31320
     gtgcgaagat ggcgctctcg gctggtgttg acatggttgt tgaactccct gtctcgttcg     31380
     cgacacaaca tgcgacgatt tttgcagaag aagcagttcg tattttagat gccattcata     31440
     tagatacgct gttttttggc agtgaacatg gagttgcgga agattttaca tttgctgcga     31500
     aaaaagtagt cgaaaacgaa gcccgttttg atgaagcgat tcagctggca ttagtcgata     31560
     agaaaacttc ttatgctaga gcttatacag aagcttttaa aaagttgttc ggccagaact     31620
     tgctggatat cacgaaacct aataacattc tcggtttcca ctacgccctt gccgtccaga     31680
     aacaaaaccc gtccatttcc cttcaaacca ttcctcgtga acatgcagga taccatgacg     31740
     aggaagcgag ccatgaccaa atcgcaagtg cgaccgcgat tcgaaaatta atacttgctg     31800
     ggaagttaga agaagctagc cactatctcc ctgcttcttc tatagatatt ttacgcaatt     31860
     atgaggggcc atttttatcg tggacagatt attggtcatt cctgcaatac cggttaattc     31920
     aagccagcac agaagaactg gaaggaattc gcggcgttag tgaaggaatt caaaaccgga     31980
     tgcagcaagc agcgactaaa gcgcaaaact tctctgattt tatagaatta accaaaacaa     32040
     agcgatacag taatgcacga ttacaacgaa ctgctttaca aattttattg aatgcaaaga     32100
     gcaaagctag ctccccttac atccgaatac ttggcatgaa taaaacgggg caaaaatatt     32160
     tgtcgcttca taagaagaat atttctcttc ctattgttac gactgtttcc aaagcaccac     32220
     ctgggctttt agaggaagaa ttacgtgcaa cgaacattta tacgctcgta aaaaaattag     32280
     aaaattatca agctggcgac tttcatattc caccaatttt aaccttgtaa tctttacaag     32340
     gtttttggtt gacttttatg gagctatttt gctaagatgt ttgtccgact caaaaaacag     32400
     gaggtatgtg tatggtacaa gaatatattc gattaagagg agcgcgtgaa aacaatctcc     32460
     aaaatatttc gctagatatc cccaaacgaa aaatcactat ttttactggt gtatctggtt     32520
     ccggtaaatc ttctattgta tttgaaacta ttgccacgga atcgcaaaga cagttaaacg     32580
     aaacatacag cgcctatctt cgtaatttcc ttccgaagta tacgcagccg gacgcagatt     32640
     caattgaaaa cctctccacc tctgttatta ttgatcaaaa acgacttggc ggtaattccc     32700
     gctccaccct tggtaccatt acggatatta attcgatttt gcgattactt ttctcgcgtg     32760
     tcggcaagcc tagtatcggg acagcaaatt tattttcttt taacgaccct gctggtatgt     32820
     gtcctgattg tcacggtgtt ggtcaaaaag tttcggttga tttagtcaaa ttacttgatc     32880
     caaataaatc gctcaaagaa ggcgccatct tatttccgac gttttcggta gattcatggt     32940
     actggaattc ctatgcttat tccggctttt ttgatgtgaa taaaaaaata aaagattata     33000
     ctgacgaaga atacgatatg ttgttacatg ggaaagatat taaagttttc ctagaaacac     33060
     ccatgggaag catgaacgct acatatgaag ggctgattcc aaaattcaat cgtttgtata     33120
     ttcaaaaaga aggcgaaatg tctgcctcta ctaaaaaacg cgtggataaa ttcacccata     33180
     ttgcgccttg tacaacatgt gaaggcacga gactttccgc acaagcatta tcttgtaaaa     33240
     taaatggcgc aaatatcgcc gacttcacag cgatgcaatt agatgaatta aaagatacga     33300
     ttgcgcgtat tgatgaccct atcgctactc caatggtcaa aagtgtcaca gagcgattgc     33360
     aacatttgat tgatattggt cttggttata tgacacttga ccgccaaact gcttctcttt     33420
     ctggtggtga atcgcaacgt gtcaagatga ttcgtcattt gaatagtagc ttgactgatc     33480
     tgctttacat tttcgatgaa ccgagtattg gtcttcatcc acgggatgtt catcgcctaa     33540
     atgaattact tgtaaaattg cgagacaaag gcaatacgat tctcgttgtg gaacatgacc     33600
     cagatgtgat caaaattgcc gaccatgttg tcgatgtcgg tccgcacgca gggaaacatg     33660
     gcggtgagat tcagttcgtc ggaagttaca cagatttgct gaaatcggac acattgactg     33720
     gtcagttcct caatcgccat ttaccgatca atagcaaacc acgacaacca aaaggctttt     33780
     taacaacaga aaaaagtagt cgtttcaatt taaaaaacat tcaagccaac attccaaaag     33840
     aagtccttac cgtgataact ggcgtggctg gttcaggtaa gagcaccttg attcattctg     33900
     tttttctaaa agaatatcca gacgcaatag tgattgacca atcagccgca catgccaata     33960
     tccgctccaa tcccgccacc tataccggca taatggaccc aattcgaaaa gcatttggaa     34020
     aagaaaatga tgttagtcca tcgctcttta gttacaattc caaaggcgct tgcgaaaact     34080
     gtaaaggact tggtttcacg acaatggatt tggcttttat ggattcgatt cgtacacctt     34140
     gcgaagtctg ccatggcaag cgattccagg attctgtttt gcaatataaa ctgaatggta     34200
     aatccattag tgatgtgtta gagctaactg tctcagaagc actcgatttc tttacggaca     34260
     aaaaaatctt gaagaaaatt gaggcaatgg aagaagtagg aattggttat gtcacgcttg     34320
     gccaagcact tagcacctta tcaggcgggg aatgccaacg tttaaaactc gccaatgagc     34380
     ttcataaaaa agggtcgatt tatatcatgg atgaacctac aactggtcta catatgtcag     34440
     acatcgaaca tattttgacg atcattcaca cacttgtaaa taaaggaaat acggttattg     34500
     tgatagaaca taatgtcgat attattcgaa atgctgactg gattattgac cttggtcctg     34560
     aaggcggaag tgctggtgga caaattattt ttgaaggtgc cccacttgat ttacttgaaa     34620
     accaacaatc attgactgcg aaatatctct aaactaaaaa gccgttttgt ctatagcaga     34680
     caaaacggct ttttttattg tagttttttt aaataatcca cagcatcttg gaaagtttta     34740
     actggaacga ttttcatgtt ggtgtcaatg tctttcgctg ttttgactgc tgtatcgtaa     34800
     ttactttcga tacttggatc gctttttttc atttcttcag tgattggatc atttggagca     34860
     aagaaaatct tcgcgccact tttatctgct gcaacaacct tttgatcaat tccgccgatt     34920
     ctacccacgg ttccatccgg atcaatcgta ccagttccgg cgattttttt gccatctgta     34980
     agatcatttt tttggaaacg actgtaaatt tctaaactaa acattaaacc agcagaaggt     35040
     ccgccgattt tttcagagtc gattttcacg gttggatctg cggtgatttt ttcatcatcc     35100
     acaagcgtga taccgattcc tggagtacct tttttgtcaa ttgctgttaa tttgatatcg     35160
     gcttgttcat ttttgtcgcc atgtttatag ttgattttga ctgtgtctcc cactttttta     35220
     ctgtggatat aatcaataaa ttcttggctt gatttaaacg cattcccatc aatttctgtg     35280
     attaggtcgc cagcgtgaag gacatcggct gctggaacat catcttttac gcttaatacg     35340
     tatacgccat cataagtgac tttgacttct tgtccggctg ctttataagc cacttgaatg     35400
     gcattatttt tggattcgtt catcatttgc atttggcgaa cattgtattc ttcgtcgctt     35460
     tcattctcgt atttgatctc gctatctttt tctagctcat ggtatggcaa aaatttagcg     35520
     gtcatatatg tataaatatt tgcttttccc attgcaatcg tcactagact gagcgaaccg     35580
     tcttttttat ttggatggtt atcaaccgta acgagtggtg caagttcttc ggtcccacca     35640
     ggttttgaaa tataatacgg aactggaata aaaaagcccg ctataataat aattaacagc     35700
     actatcgccg ttattttttt ccactcttta cgcatttttt gtccatctcc tacttacttg     35760
     aattttgctt gtactgcttt gttcacgatt tctggcacaa gttcgctgat atcgccttga     35820
     tactgcgcca cttcttttac catactggaa cttaaaaaag aatatttcgt attagtcatg     35880
     acaaaaaaag tttcgatatc cgcatttagc gttcggttca tcgaagcaat ttgcatctcg     35940
     tattcaaaat cactcaccgc tcgaagtccc ctgacaattg ccgtagcccc gcgcgtagca     36000
     gcataatcaa cagtcaatcc actcgcactt tccacttgta catttggcaa atgagcggtt     36060
     acttgtctaa tcatttccat tcgctcctct atcgtgaaaa gtggtttttt ggatgaattg     36120
     tttaaaacag aaacatataa cacatcaaaa atcttcgctg cacgttcaat aatatctaag     36180
     tgaccattcg taatcggatc aaatgtcccg ggaataacgg caattttgtc acccatttct     36240
     acgcctcctg aaattcaaat atagataaaa cagtaattcc ataagaaact gatttgattt     36300
     tctcgaattt accgattgta tctggcatga ttgcttcttt gtcatgctcg caaataattc     36360
     ttccattttc gttaactaat tctaattttt ctaaagttcc tattaatttt tctaattgtt     36420
     gctttttata tggtggatct aagaagataa ggtcgaattt ccactcattt ttatggagta     36480
     atttgagtgc tcgttcggca tcatttctat atacttccgc gcgctctgta aaatggcatc     36540
     cttctaagtt ttgtcggatt gttttaattg cgagcgctgc ttggtcaata aaaacagctc     36600
     gttctgctcc tctgctcaac gcttcgattc caagcccacc actgccagca aataaatcaa     36660
     gcaccatatc cccgtcaaaa aagggaccga taatcgaaaa taaggattct tttactttat     36720
     ctgtagttgg tctcgtattg tttcctggaa cagcttttaa agcgtgtcct tttcgttctc     36780
     ctgcaatgac tctcatgttt ttgcacaacc tttacttcaa tgtctttttt actttatcac     36840
     aaatagaagc aaaaaaacag caagactagt tgaaatagtc ttgccgtttt ggttagatac     36900
     tgatttgcac atcttcgttt ttgtgttcgt acatcatttc ttttttggat tcgtattctg     36960
     tttttaagaa cggacggaaa gacatttcca cgcgtttcac ataatgaaaa cgagaaactt     37020
     tgttagagat atcttctact tcggccatat cacaatataa caccgcatat tttaacttac     37080
     gcgatacata atgcacgttt ccaaatcgct tcaaagatct aacttgtttg agatgattca     37140
     tccaaacgac gatagcttgt ctatcatttt ccattgttta agccccttct ttttaggata     37200
     agctttacgc tgaacaaccg cagcctcccc cgctgccaca tccacctgta gaacaagcag     37260
     attttgtttc aaaaaacgga ttaccagttg gtactttgat attctctgaa actgcacttg     37320
     cgagaagcag actgatttca tccaagagag attgtaaatc catctctgca cggcgaaaag     37380
     ctgccacatt ttggtccatg tcaacttcgc gtttataggc acgagtcttt ctggttactt     37440
     ctttatagtc aggatgatac cggccgaacc gctgtacttc ctcgtattgt tcttttattc     37500
     gtatgaattg acgaatattt ttttgtgaag tagcgtcatt tagcaacgct tctttagcaa     37560
     gtttgtaatt ttgcgcttcc tcggagttta gaatcatgct agcaagctca tctgataaat     37620
     cgagtagcgc catattttcc attgtagcga gcaatctagc cacctccata taacttactt     37680
     ttttattata ccatagaact attatttaat aataaaattt tgcgtatagt attttcgata     37740
     tgttcctgca cccatatacg tatatgaacc atctagtaga ttttctctat gccctttaga     37800
     gttgagccaa ccttccactg ccgctgcgct atcgacatag ttataggcga tattttcacc     37860
     agctttagta tatttgacgt cccctttact aagtcgtttg cttagatctc cttgcgtggg     37920
     tgaagtgtgg tcaaaataat catttttctt catatcaaca ctgtgtccat atgcaactcg     37980
     cgcaacagat tcatcccaag ccacttcttc tattccgtat cgatcacgaa taacattagt     38040
     gatttctagt acttgtttac tagaagcatc atcaatcgca ttccaatctg ctggcgacaa     38100
     cttttcttca taaatttcac cttggtaaga taattcatac ggacgcattt tgacgaagga     38160
     taatttattg aggtaacgaa cactaatcag ttttgattta aatttatcga aatttagttg     38220
     cgcataaacg ccacttccaa tattaacgat tggacgggca tttaagtctt cttcagaaag     38280
     ttcgaattta taatagctgt ctttgtaatt aaaggatatt tccgattgta agttggcatc     38340
     ggtaaatact ttctcagtgg acatcccaat tgtatatggc atgacattta agtcttgtcc     38400
     tagcgcataa atggtttgca cgatattttt tgctacgccg acttgcatgt agcttgttcc     38460
     tggttgactg taaatgtaat tatcgtaacc gtacgctgtt ttgtctacac gcaccgggtc     38520
     accaaactct ttctttaatt cgcttacgtt tttattaata aatcttgcca agctggaact     38580
     atcttgcact tgtttcggat tttcattcgt tgttttttta ttatcaggaa aattagattt     38640
     tgtcgctgta tcttcggctg tatttttctc tactgattta ctaaaaaaaa gatctgtgtt     38700
     gtatccaatg aacaggcaaa tgattaatag cacagctact cgcattataa acttcacatt     38760
     ttgccctcct cggcattatt ttgttttctt gatgtaacat tcattttacc aatactatta     38820
     tcatttgaaa agctttaaaa atcataaaaa aacaattata aggaaacgcg tattgcacgc     38880
     ttcttcataa ttgttttttc tttttatagg aaaatcgaaa taactaccat tgctacgaat     38940
     aaaattgtca tgtagtttaa tgagtatacg aacatccatt tagcccattt gatactatct     39000
     tccatcttaa agccgtaaat actaagtgct aaccacccga tattaagtaa tgttgctaaa     39060
     ataacatata caatacctaa atcaaacata aagaatggca ggatagttaa taaaatcacc     39120
     cagaaaaaca tgcttttctt tgtgcgttca atgcctttta ctactggcaa cattggaatt     39180
     ccagcagcgg cgtattcctc tttccgttta atcgcgatgg cataaaaatg aggtggttgc     39240
     caacaaaaca tcacgagaaa cagcataatt ggcacaatac taaatgttgg ttcgactgca     39300
     aaccaaccaa ttaatggcgg tacagcacct gaaaaactac caattactgt gttactaact     39360
     agttttcttt ttgcataaag cgaataaacg actacataca aaaagacccc aataacgcca     39420
     agaactcctg cttgccaagt tgtcataaat aacataattg taccgacaac acctagcaca     39480
     agcgcgacca ttagcgctcg cttaccagaa attttcccgg tcattgttgg tctgtttttt     39540
     gttctttcca taattccgtc aatatcacgg tcgatgacat tgttaaaagc gcccgaagca     39600
     gcgacaataa gtgctgaacc gacgatagta aaaaatatca cgtctacatt ttgaataaaa     39660
     gaaattccat ttaactgaaa ggctaaccac attcctgtaa aagcagtaat cgtattggaa     39720
     ttcacgatac caattttcac aagctcggta aaatcacgga cagtaaatct actcgccgat     39780
     aactccccag tcttttctat ctgattcact ttttctcccc ctaacacttg ctgatataaa     39840
     ccagtgattg cgaactgata gatatcctat acccttatta tgtgaaaaat acgcaccttt     39900
     tgtcaataaa tcggctttag tcttgtacgc tttacttctt caaataaaca cgctacaatt     39960
     agtttgatgt gtactcatga acttatacat ataaacaaat tatagtaaaa atctcacacg     40020
     catctaaagg agagattggt agataatgaa aaaattcttg aaagtttggt ctgtactaac     40080
     gattatttgt atgacggtcg ttgtgtttgg cggagcgctc gtaacgaaaa ctggttcagc     40140
     tgatggttgt ggtaatagtt ggcccctttg taatggacag ctagttcgtt taacagatgt     40200
     tactccggaa aaattaattg aattcatgca ccgaatgacg acgggaatca gttcgatttt     40260
     tgttattgtt ttagcgattt gtgcttggat ttatatgaaa aaccgtcgcg aaacaaaacc     40320
     acttgcaatt attgctgttc tgtttctaat tattcaagcg ttaatgggaa tggcggctgt     40380
     tgtttgggga caaaatccgt acatcatggc gctgcacttt gggatttcga tcatttgtta     40440
     tgcttcgatt gtattgcttg ccttgatgat ttttgaggta gaccgaaaat tcgatgctag     40500
     aaacctcgtg atggggacga aattacgcgt taatatttat gcgctcacga tttacacgta     40560
     cttagctgtt tatactggcg cacttgtacg acatgaaaaa gcaagtatgg ctgttccggt     40620
     ttggcctttt gaaaatgggc actttataat gcctacttct gtacaagatt atgtgcagta     40680
     cttccaccgg ttagccgcat ttattttaat tgtttggtta ttatatgtta cttggcttgt     40740
     gttcagagat tatagaagat atcgcgtact tacttttagc atggtgttgt cacttgtgtt     40800
     tattgctctt caagccgtta ctggggcgct ttctgtttat acaggagtga acttgtatat     40860
     cgcgcttgcc catagcttaa tcattacgat gttgttcgca ctactttgct acttatgctt     40920
     actggcatcg agaagtaaaa gtaatcgact acgaattaaa taacgaacac ggctggcaac     40980
     tttttgttgt cagctttttt atttgtttac agcttttgtg cggttttgtg ctaaaataag     41040
     tgagagtata agtcaaacga ggtggataaa ttggataaaa caaagagaaa aatgatttat     41100
     gagactttta tgcttattct catattactt tcccttgccc tattaccgta cagaaacaac     41160
     tttacattta ttttaaattg gattatttgg gtgattttta cgcttgatta tctggttcga     41220
     ctttaccggg ctgataataa atggcattat gtaaaaacgc atccgtttca actcattgcg     41280
     attattccat tttatggtgg atttagagcg gctcggattg ttagttttgt tcatctttta     41340
     agtattaccg cgatgggaag acgctatatt gtaccgattt atagcttttt ccgttctaat     41400
     ggtttaaatc gatttttaat gatttttgtt ttacttgtga ttataattcc tgttccgatg     41460
     gtatttatcg aacccgaaat aaacaattat cctgatgcgc tttggtgggc gattgtgact     41520
     gcgacaacag ttgggtacgg ggatattgtt cctgtcacgc caattggacg gattttggca     41580
     tcgattatga tgctgttcgg gatagcattt atcgggatga ttactagtac gataacaaac     41640
     tttttccgcg ccaaaaagcc tactaattct agtacgcaaa gagcgaataa gattacccaa     41700
     ttaatttcag aaacaccaga cttaaccaaa gaagaaattg ctgtagtaga gcaatttttg     41760
     acactaagga aaaaagaatt agctgatgaa aacacaaaaa gtgatagcga atgatgctat     41820
     cactttttta tttgtttttc gacttggtca cggtaacgtt cggataaggc ttcgactgcc     41880
     aaaatccgct ccaagtcttc ttttgttcct tttttatgca atactttttc atgacaaaag     41940
     gctactgtta cgccgtgtga ttcttggtga atttgtttga tttcatccgt tgcatgtata     42000
     atgccaggag taatcgttcg gcacagatat ccagtaagtc cggttttgtg gattgcttta     42060
     tagagattgg ggattccatt gaacttttca attgtactac atggatttcg agcttccgtt     42120
     atttggataa cggtttcgcc aatctgaaat ttatcaccaa tttgaacaga gctttccaac     42180
     atattcgtag tgatgagatt ttcaccaaaa gcagttactt gtagctcttc gccaaacatt     42240
     tctgtccatt tcgcgtaatg ttcgtatgga taaatacaaa ccgtacgatc cggcccaccg     42300
     tgatatttca aattatgcgg tgcgtcattt tcaaaaccgg tagtggttag ataggcagat     42360
     tgtacaagct ttttttcgat ccccgtcatc atccgtttgt tatttgaaag gttaagttct     42420
     ttcggcttgc caactgctaa atgcatgatt ttccgttcca tctgcttact cctttgaagt     42480
     tatttttttc ggcttaaaat agcaagaata cccgtgataa gcgcaataac gctgatagct     42540
     actgcggtcc ataataaaat cgtattatca ccactgctgc ttgtatcccc tgctgtgttc     42600
     tctgctcctg ccactacctc tccgtgcgag ccagttgctg atttagaaga ctctttgacg     42660
     atttttgttg tagcatgtgg tgtttcagaa tcttctgccc caacccattc gacgatggaa     42720
     ccatcttcat aatattgata ggcattccaa gggacttctc cttcttcact tggattttta     42780
     gcaataaaac taaatcgctg aaattgacct ttttcaattc cgctgccttc tgtttgccat     42840
     gttactgttc cgttcttctt atctatcgtc gttgtccagc ctggaactgg ttcatacgat     42900
     tcgaacgata caccctttgt cacttttaaa acgatttttt tagatgctgc atctttttct     42960
     gatggaactt tcatcgtgta ggtttcccag gagtctacgg tcgattcgct tggtaatact     43020
     gagacatgcg cgctcgcttg aaatggaatg ataaagacag ctaataatac gacgatggag     43080
     ctcataattt ttttcattgt tttctccttt actgtgtaat attggtcgta aatgtttgat     43140
     ttatatcggt aaaatctttt gttaaaccat ggaccgtgat ttcccacttg ccggtttgat     43200
     taaaatatag cccctctgca aaatattgcg tatcatttgc aagtttggct tggaaagttg     43260
     atttttcatc tgttttagta gattttgttg taatcgtcac ttgttcaaaa tctgttttag     43320
     cagaaccatc tgctgaagta aaagtgatga taaactggtt ttgtccaacg gttgctggtt     43380
     ccactcgcaa attaattttt gctttttcgc cttccgctgc aattgtttcg tcaaatgctt     43440
     tcggagcaga cggtggcggt gtttgtacat tggttaaaac acttgcaacg acaaggataa     43500
     tggttccaat gataagctca attaaaatgg ttttgaatgg caattgttga tttttaagtt     43560
     tgatataaat gtaatgtcct agccctaata gtgccattag tataaataag ccgattttga     43620
     aaagaagaat tttgccgtag ttggttgtaa ataaattggc catttgcccg atgttcatga     43680
     ctgccattaa taagccgctg actaatatcg aagcgaccgc aatgattgct acgatggcaa     43740
     agcgaatcca tactttgcgc gcttttccgg ttcgcggtaa tacgaataag agtactaaaa     43800
     ttccgccaac ccaaacgctt gccgcaatca tatggagcat atcagcggtg atacttacta     43860
     ttttatcggc acttgctgcg gcgtgtccat tctgagcctt tgcaaaaatc aaatatccga     43920
     ttaatgcact ctcggtcaga agcgcgaacc agccccattg tttcttttta aagaacatca     43980
     tgacggtaaa aatggcaagt agaagccata cgacaaattc actgatccaa atataacctg     44040
     ttttcgtagt caagaaagca gctaacttac taggtccaaa actttcactg atggagacgc     44100
     ctgttgtgat acttgtttgt acgaaaagtt gtattaagag agccacacct aaaagggcga     44160
     gcgctatcca agttactttt ttcaaatgtc cagaaatttt ttctgatatc tgttcttttc     44220
     gtggataaag tcctaaccca aaaacaagca caccgataaa caacgaaaaa cctatgtata     44280
     aaatggcttt ttgaatcgaa ctaatttgca agtccgctcc acttgaggga acttccgatg     44340
     cttggaacgt cgctttcgta tcgcctaact taaaagaaat gatccccgta accgcatgtc     44400
     catccgctga cacaacacgc catgaaacag aatagacatc tgctttcaaa tcagctggta     44460
     aagacgcttc aaccatatga ttattctttt tagaaacaga ggttttgccg gtttccactt     44520
     gcttcccact tgaatctttg acttctatta aagggaaatc cgcttcaatt tcttcattaa     44580
     aaacaagcgt tactttttcg ggcgcggttt gaatatgtga ttgatcggcc ggattcgaat     44640
     tttccaaata agcatgcgct gaaacatgct gaactggcac gattagtaga tatagtataa     44700
     tgagaaaaaa actgaccctt ttcaataatt tcatttgcta ctcctttttc gaacgaacgg     44760
     ttttactctt tttaacttat catgtgcaac aattgaatgg aaataatcgg ctcatttcct     44820
     attgcaaatg atgctaagat tatggcatag tgatagaaaa ggaggtttta tctatgcttc     44880
     gttatatcga attgtttttc atgtttgcct ttgttacgct catcacgatg tggattcaag     44940
     cactcttggc aaaatggcaa cctactattc ttcgttcttt ctggcttcga acactcacat     45000
     ttattattat tggctacgca ttaatggcgc caacgctata cataggcagt ttattgctaa     45060
     aataagttca gttgctttca catcgcagtt agatgtttta tactggatag tgggaggtga     45120
     attttcatga aaaaaatgtt agtagaattt agagatttcg cattaaaagg gaatgtccta     45180
     gaccttgctg tagcggtagt tatcggggct gctttcggta aaattgtttc atctttagta     45240
     gataacatca ttatgccact tgtcggtgta cttcttggtg gtcttgattt tacagattta     45300
     agtttcaaag ttggtaaatc cgttattcaa tacggtgctt tcatccagtc catcgttgac     45360
     tttatcatca tcgcttttgc catttttatt ttcgtcaaag tacttactag ttttattaag     45420
     aaaaaagagc aaacggtgga agaaactcca gtacctccaa ctgaggaata cttaaaagaa     45480
     attcgtgatt tattaaaaga acaacagaaa taaccgaaaa aaatccttct ttttatagaa     45540
     ggatttttta tttacattcg tgcttataaa ttatgttttc taaagctaaa aagttaggct     45600
     atctatctcc cttaatttca gggggggaaa ataacctaac taaattctat ttcaccgttg     45660
     ctgttttttt aattgtatcg ctaaaaacat ttccactgcc gcgacaacta aaaagataat     45720
     ttgtaaaata aatacgtagc cgataatcag taattgtaca atcatccaaa cagctaatac     45780
     ggccgccgct gcgaacataa cttctttggt tcttggtaat ttttttagta aataaattag     45840
     agctgctaaa tggaataatc caacaaatac gaataaaaat atgcctggta ctaaataatc     45900
     cacaaacggt gaaccatcaa gtaatccggt tgaaagtgac agcaatccac cacttggcat     45960
     gaaaaccatg gataagccac cataaattgc tcctattgct gtaaaaccaa ctattataat     46020
     actacttata cgtgtccagt tcatggcgtt ctcctagtcg tttttctagt agtataccac     46080
     gaaaactttc attctgccgc ttttcttcgt tttatttttt tgattaaatc gatcagtacg     46140
     aaaaccgcaa tgccgcatgc gacaactgta gtgagatacc aagctggacc agattctgcg     46200
     cgaactccta accaataagt cactgttttc gggttgaaaa atgcaaagca aattgcacaa     46260
     aatgcaataa ttcgaccaat aatggaattt tctctcatag caagtgcatc tccttttctt     46320
     ttattataac aaggaatagg aaatgataac ttagcttttc ggtcccaaaa ttgtttttca     46380
     tctaacaagt tttggttttt cctcacaaaa aaactatgac aagggaattc cctgtcacag     46440
     cctcacagtt atttgttaac aatgtttagt cgttgctcat tgacgagtgg ataaatagct     46500
     agttctttgc tctctaaatc ctcttggtgc atatccacac cagtaatttg actgtttccg     46560
     tatgttctat aataataaat tcctttatcg atattgcaac acgaggaata aatagtatgc     46620
     tcgtattttc ccccaccaac atcacaaaga cctttttgtt gttccaccga gcctaaaata     46680
     tggaaaaatt ggctaatact ttctgattca gaatcacctg aaacagaatt caatttggta     46740
     aaagttgctt tcacaaaacg agacatagaa gataaatcac caggtaagcc aattccgccc     46800
     atcccacgac tataagcatc caaatcaatc tctttggaaa aattattttc tggggtttca     46860
     ctcgaaagaa cgcgataatt gtttaaatta aatagttggt aatcaaatgt tggattattt     46920
     gttaacacgc caacaggatt atcataaatg tgaagtccat ctttcacaca ttccactaca     46980
     atagattctg tttgatcagc catcaaccaa tgtaatggag acagcggtaa attttcacta     47040
     aaactaatat tcacgagatt gattctctga agtaatcttc ttgcttcttt tacagtagcg     47100
     cattgaccaa gaatccacgg aataaattca aagggggtca cattgtcctt accttctgca     47160
     aaatccttgt aatccgcatt tcctgagaaa ttgagtcctg ccatactaag gcctttttca     47220
     ttggtagcat cgtaatacaa cgggtagttt tccatcacag cagcaatacc aataagtgca     47280
     taatgcttct ctatatcctc taccttgcga aaatggaacg ggtaattttt cggcgtaaca     47340
     accacaactt ctttgtaaga aagttcataa tcgaaattcc ttccaaaata gtgatccttc     47400
     gttgtataag ttattgacgt acacattaaa aatccctcct caaatttttc accttacatg     47460
     tataccagta ccctcggagt ttggagtaaa acataatttg tggttttttt cacaaaaaaa     47520
     tgggcagttt attacctcat acaatatgat ttggctcctt taaaaatttt taaatgtaca     47580
     ctcgtctatt aacctcttga aaaaaattct gttattaaat cacaataaaa aagatccctg     47640
     gaaaaatcca gagatctttt aaaaatgtcc gctgatgtta ctcttacatc atgccgccca     47700
     tgccacccat tcccatatca ggaacagctg ctgggccgtt ttcgtctggt ttgtctgcta     47760
     cgactgcttc tgtagttaat agaagcgctg caacagatga tgcattttgt agagcggaac     47820
     gtgttacttt agttggatcc acaatacctg catcaatcat gtttacccat tcgccgtttg     47880
     ctgcattgaa accaacacca actgcttcgt gtttcaagcg ttcaacgata accgaacctt     47940
     caagtccagc gttatgtgcg atttggcgaa ctggttcttc tagagaacga agcacaatgt     48000
     tgatacctgt ttctacgtcg ccttctgctt caagtgctgc tactttattg taaatactta     48060
     caagggcagt accaccacca gctacgatac cttcttctac agctgcgcga gtagagttaa     48120
     gtgcatcttc aatacgtaat ttacgttctt ttagctctgt ttcagttgca gcgccgactt     48180
     taacaacagc tactccacct gcaagttttg ctaaccgttc ttgtaatttt tctctatcaa     48240
     attcagaagt agtttcttcc atttgcgcac ggatttggtt tacgcgagcg ctaatttgtg     48300
     tggaatcgcc tgctccttct acgattgttg tatcatcttt tgttacgact actttgttag     48360
     ctgttccaag ttgatcaaca gtagctgttt ttagttctaa tcctaggtct tctgtaatga     48420
     cttgtccgcc tgttaaaata gcaatatctt ctagcattgc tttacgacga tcaccgaaac     48480
     caggagcttt cacggctact acgttaaatg ttccgcgaag tttgtttagt acaagagttg     48540
     cttgagcttc cccttcaaca tcttccgcaa tgattaacat tggacgacct tgttgaacga     48600
     cttgttctaa aactggtaag atttcttgaa tattgttgat ttttttgtct gtaattaaaa     48660
     tgtatggttt ttcaagaaca gcttccattt tatcggaatc agttaccatg taagggctag     48720
     tgtagccgcg gtcgaattgc ataccttcta ctacgtctaa ttctgttgca aaacctttgg     48780
     attcttcaat agtgataacg ccgtcgttac caacgcgttc cattgcttct gcgattaatt     48840
     taccaacttc ttcatcacca gaagaaatag cagcaacttg agcgatagac tctttgcttt     48900
     caattggttt agaaatagct tttaattctt cgatagctgt tgctacggct ttttcgatac     48960
     cgcggcgaac gcctactggg tttgctccag ctgttacatt ttttaagcct tcttgaatca     49020
     ttgcttgcgc taaaacggta gctgttgtag ttccgtcccc agcaacatca ttggttttag     49080
     aagcaacttc agatacaagt tttgctccca tattttcaaa tgggtcttct aattcaattt     49140
     cttttgcaat tgttacccca tcatttgtaa ttaacggaga accgaatttc ttctctaaaa     49200
     caacattacg accttttggg ccaagcgtta cttttactgc gtttgctagt tggtcgacac     49260
     cacgtaacat ggcacgacga gcatcttcac taaatttaat atcttttgcc attttatatt     49320
     tccctccgat tatttctttt tttaaaatta tttagtaatt gctaaaatgt cactttcacg     49380
     taaaatcaga tagtcagttc cttcatacgt cacttctgtt ccagagtatt ttgcaaagat     49440
     aactgtgtca ccttctgcaa cttcaagtgg ttcttttgtt ccgttatcta gcacacgacc     49500
     tgaaccgact gcaacaattt tccctgattg cggtttttct ttggcagagt ctggtaatac     49560
     aatcccactc gctgtttttt cctctgcttc aagtacttca attacaacac gatctcctaa     49620
     tggttttaac aatgtaaatg acctcctctg atataattac ttttttcatt ttagcactcg     49680
     acacatcaga gtgctaatac agttattatg ataccaaact gaataaaaaa tgcaagcaaa     49740
     aacgtttaaa aaaatagaag aattcttatt tgcggtaaag cttcataacg agtacaataa     49800
     gaagagctat ttccgcttgt ttgaagcaat ttagccaatg tttgtttata gaaaggatgc     49860
     gtattttttg gctaagcgtt atattacgat tgttttagtt tatttgttat tacttttttc     49920
     tgcatctgct gggattccta ttattcaaca tgttctactt agtacaacat ccctttcaat     49980
     agaggatgct gcatcttatg gaatggttat ttggtcgata ttctctaatc ttttatcact     50040
     tgcgattatt attccaatgc tttatagaaa accgaaagaa aataaaatcg aactcggtga     50100
     aaaaacgaaa ccgcttctaa gtattgtttg gattgtcgga ggcgtcattg ggttatatgc     50160
     ggcacaaatt gtttgtagta ttatcattac gctgatttct ggagatttaa gtaactctgc     50220
     aaatacggag ttactagttg atttgactaa agctgcacct attttcttaa ttttcatttc     50280
     cattttaggt ccaattttag aagaacttgt atttcgaaaa gtggtttttg gtgggctaag     50340
     taatgtgatg aatattcatg tggctgcggt tattagttcg cttttctttg gattacttca     50400
     cggagatatt tctttcttac ttacttattt tgtcatcgga ctaattcttt gtttccttta     50460
     tacgaaaaca aaacggattg tcgtttcgat gggcgcgcat attttaatga atacgattgt     50520
     tttgctgttg agtctaggaa ttattggggg ataatatgaa aaattcatta atgaagcaaa     50580
     gttttttata ttttgcgctg ggtcttgtat ttgtatattt tgttgttgtt cgtgtggctg     50640
     attatggtta tgatgtgctt gcatatatac taattatcat gacattaatg gattttggca     50700
     ttggcatcgg tctgattatc actggattta aaaggcgtaa aaaaacctgt agaaagtaag     50760
     tttagcttac cttctacagg tttttttatt ctgttttcgc tggataattt tccaggaaat     50820
     agattaacgt ttgtaattcc gttgtaaggt cgatatggtg cacacgaact tgttttggaa     50880
     cactgatacg agctggggta aaatttaaaa tacctttaac atccgcttca attaaacgat     50940
     ctaccgttac ttgtgcttca tcagctggaa ctgtcagaat aactacttcc acaccgtttt     51000
     cacgaacaat ttcttccata tcattcaagt gataaattgg aatgtcttgt tgaacactac     51060
     ctactttcgc tggatccaca tcaaatgcag caacgatttt gatattatta tttttcatga     51120
     aattataatg taataatgct gtaccaaggt tacctacacc gattagtgca acatttgtct     51180
     gtttgtcctg gctaagtgtt ttgctgaaaa agtcgagtat gtaagaaacg ttatacccgt     51240
     atcctttctt acctaatgcg ccaaagtacg aaaaatctcg tcgaatagtc gctgaatcaa     51300
     ctttcaccgc ttcacttaat tccgcagatg atactcgttc cttacctgac tcatctaggt     51360
     atttcaagta acgatgatat aatggtaagc gttttgctgt cgcttgtgga attttagttg     51420
     tttcctccat catgccttct gtcccttctt cttttaaatt ttttctgaag ttgaagctat     51480
     tgtgaactgt acttcctttc acatgcttgc ttatatacta taaacatttc acaaggaatg     51540
     cacaaacttt ttgctcataa ctttcaagta aggttttgtc ccgcaaaata tccggtgcag     51600
     tcctcttttt atattctacg ctaaaatcac aaataatgcg agtgtattca caatcttttt     51660
     tattcaagct gtcttggcta tctcattgcg attacttagc ttttaagata aactagtagg     51720
     gagaacgttc gaggagagag attatgatat tattacaagt tcagcaaatt tctaaattct     51780
     tcggtgcaga agttatttta gataatatta aattagaagt aaaaacaggt gatcgaatcg     51840
     ctctagttgg gcgaaatggt gcaggaaaat ctactttact taaaatcatt gccggcaaaa     51900
     tgagttatga tggcggaact atttccaaac caaaaagtgt ggaaattggc tatttggctc     51960
     aaaataccgg tctagaatct tccaaaacca tttgggatga aatgctaagt gtgtttgatt     52020
     cactgcgaaa aatggaagct gatttgcgca aaatggagct tcgtctcggc gaaccggaac     52080
     tctataatga tccagaaaaa taccaagcac tgatgacgga ttatgatacg ttacaacata     52140
     cttttaaaga aagtggcggc tatacttatg aagcagaaat ccgttctgtt ttaaatggat     52200
     tgcgttttta tccagaagat tatgaagtag aaatcgcttc tctaagtggt ggccaaaaaa     52260
     cgcggcttgc tttagccaaa ttactacttg ctaaacaaga tattcttgtt cttgatgaac     52320
     caactaacca tttagatatc gaaacactag cgtggctcga aacctattta caaaattatc     52380
     atggttcgtt actcatcgta tcccatgacc gctacttcct tgataaagtc gtgaatcaag     52440
     tatacgaaat tagccgaacc aaaatcgatt actacaaagg aaattacagt tccttcgtga     52500
     atcaaaaaca agcgaaacta gaacaaatgt ggaaagagtt cgataaacaa caaaaacaga     52560
     ttgccaaact agaagatttt gttgctagaa atatcgtccg cgcatcgaca acgaagcgcg     52620
     ctcagagtag aagaaaacaa ttagaaaaaa tggatgtgct tggtcgcccg caaggtgatg     52680
     aaaaagcagc gcattttggt ttccaatttg aaaaacaaac gggtaaagat gttttaatgg     52740
     tagatcaact aagcattggt tacgcgaaag ataaacgcat tgcttccaac ctaacgttcg     52800
     aaatgaaacg ccaagatagc cttgcccttg ttggtccaaa cggaatcggc aagtctactc     52860
     tgcttaaaac acttattcgc gatattccag ctctaagtgg cgaattccac ttcggcgctg     52920
     gcgtgaaaat tggttactat gatcaagaac aagccaaact gacatccaac aaaaccgtat     52980
     taatggaact atgggacgat tatccagagc tgaatgaagt gaacgtccgt acaacactag     53040
     gtaatttcct tttttcagat gatgatgtac taaaaaatgt ccaatcttta agcggtggcg     53100
     aaaaagcgcg ccttgctctt gctaagctca ctttacttga agccaatgta cttatccttg     53160
     atgagccaac caaccattta gatattgaaa gtaaagaagt tttagaagca gctttaattg     53220
     attttgaagg cacgattctc ttcgtttccc atgaccgcta ttttattaac aggattgctt     53280
     ctaaaatcgt cgaactagcg cccgaaaaag caaccgtttt ccttggagat tacgattatt     53340
     atcaagaaaa attagcagaa gaaaaagaac tggcacgact tgatgccgag gaccgacgca     53400
     aaaaaggcga acaagttgaa gcaaccgcct ccgtcagaaa attaaactac caagaagaaa     53460
     aagaacaaca aaaactactt cgccaaagaa aacgaaaact agaagaaata gaaaaatcca     53520
     tggaagaaac ggacgaaaag attgccgaac tcgaacttca attaacgaat ccagaagttt     53580
     tccaagacca tgaaaaagcc cttgaaatca ctcaagagct agacgccgta aaagctgacg     53640
     gagagaaatt aatggaagaa tgggaacaaa taagcgaaga actggaatcc atataatcta     53700
     cataaaaaag gagcaaacaa tgaaaaagat tttaattatt tctagttcga ttatcgttgg     53760
     tttacttgtt attattacca tttgtgctag tttttactta tatagctatg ctttagcgcg     53820
     cgacaattca agtatgaacg acacagcaac aacagacgaa acaactgaca cagccaaact     53880
     tgcaaagaaa aatcgtgaag caaatgtcgc atggatggaa aagcaaaacc tcataaaatg     53940
     gacagaaact tcagcagata atttgaaact cgttgctaat tatttaccag cagatatccc     54000
     ttctaacacg accattattt tagctcacgg ctatcgtggg aaaagtggaa aagtcgagat     54060
     ggctggtctc gctagaatgt atcatgaaaa attcggctat aatgtcttaa tgcctgatgc     54120
     tagagcgcac ggtgaaagtg aaggagataa tattggattt ggttggcctg aacgcaaaga     54180
     ttatgtgcag tggattgacc aagtaatcga caaaaatggt actgacactc aaatcgcact     54240
     gcatggcgtt tccatgggta gctccaccgt tcttatgacc agcggcgaaa aactaccaaa     54300
     acaagtaaaa agtattatcg cggattgtgg ctatacctcg atggatgccg aactttctta     54360
     tcaattaaaa gccatgttcc acttaccaaa atttccgata atcccaacag ctagtctgat     54420
     taataaattc aaagaaggtt tcttttttag cgaagcaagt gcggttgatg cggtcgctaa     54480
     aacagactta cccattttct acatccacgg tgatgctgat gcattcgtcc ctacttatat     54540
     ggtagacgaa ctttatgacg ctacaaatag ctataaagaa aaatggattg tcaaaggtgc     54600
     agaacacggc caagcattca cggtagatcc aaaaacatat gaagaaaaag tacgccaatt     54660
     tttaaataaa acaatgtaaa aaacagctat tctctaagaa ctagatgcta tcagtaggaa     54720
     ggaaaaaatt ggcaaataat aagtaaatgt gttactatat aaatgaaaag agagccatgc     54780
     gtcaacatga ctctctcgca aacaccattt aagatggtga cagcctttta tatgatttat     54840
     ttaaaaacca ctagctgtca ggcttatgag tggtttttat tttttgtcat ttttgctgtt     54900
     catgattgtt acgattaaga ctgcaaaagc aatcatcagc gtaagactct cgaaaacagt     54960
     cacacgttta tcctttccag gtaacgccta aaaaataaca taagcaccac caactttctg     55020
     gatgaaaaag gccggtgcac caccataaac ttatttgcat cacaattata gcatgcaagt     55080
     atctttagaa aaagagttgg cgcgaaagtt gtattttaga ggcataatcg gaaaattggc     55140
     ctaatataaa tagactgcag tgaaagtaat ggtccacttt cactgcagtc cgaagcgtgc     55200
     ggaacgaaaa atcgcacgct ttttatatat cttccagcaa taatcccgga ttcgcattca     55260
     tatcaaaacc actacgtttt ccttgtaaga aactcactgt ccctgcagca gcaatcattg     55320
     cggcattgtc tccgcataag gctaacggcg gaataatcaa ttcggtctcc ggaagttcta     55380
     gttttacttc ttgaataagt cgttctcgta aaccttgatt cgccgccacg cctccagcaa     55440
     gaagcagttg tttcacatca tattgtttag ctgcgcgaat cgttttactt actaaaacat     55500
     ccacaacgct tgcttgaaaa ctcgccgcca tatcgtttgg attcggctcc tcaccacgct     55560
     gtcttaaatt atgaagcgtg ttaataaagg aagacttcaa tccactaaaa ctaaaatcaa     55620
     acgaaccctc atccatcatc gcccttggaa aatgaaaagt gtcttcgccg tctttggcaa     55680
     gtttatcaat ttgcacgccg cccggataag cgagaccaag tgtgcgcgct actttatcat     55740
     aagcttcacc agctgcatcg tcccttgtct ccccgataat ttcaaactca ttgtccgctt     55800
     tcattaaaac tagttccgta tgaccgccgc tgacaactaa tgagagtagc ggaaatttaa     55860
     attcagtttc aaaacgattt gcataaatat ggcctgcaat atggtgtaca ccgactaaag     55920
     gtaaattgtg cataaaagct agcgttttag ccgcattcac tccgataagt agagctccaa     55980
     ctagacctgg cccttctgtc acagctaccc cgtctaaatc atccattgtc acattcgctt     56040
     gttttaaggc ctcttcaatc acaagtgtaa tttgctccac gtggtgtctc gaggcgattt     56100
     cgggaactac cccgccaaat cgtttatggc tctcaatttg cgaagccacg acactcgata     56160
     taatttcatt gccatttttt acaacagaag cagctgtttc atcgcagcta gattctatcc     56220
     caagaattaa tgtatttttt ttcataagtc cacccacatc actagcgcat cttctttcgt     56280
     atccggataa tagtttttcc gaatggcgcc gtcttgaaat cctaattttt tataaagtcc     56340
     ttgagcaaca tcattggata cgcgaacttc taatgtcatc cgaacaactc cacgctcttt     56400
     cgcaactcga atcatttctc gcaaaagtgc ctcaccgtaa tgattccctt gataatctgg     56460
     atgaatcgca atattcgtaa tatgcccttc atctaaaacg agccaaacac ctgcatagcc     56520
     taccacttgt tccttatata tcgcaagtaa ataataggcg tattggttaa taataaattc     56580
     attccgaaaa gctgcttccg tccaaggtac tgtaaatgct gcattttcga cattcataat     56640
     acttttcaag tcagtcacgg ttgcttcccg aaataataag gcttcttcca aactcactcg     56700
     gaacccctcg attccaacca tttactctcc gcttctgcca gttttaaata atcaggaaca     56760
     aaattgtctg ctggttctcc atctaaattc tctgccagtt ttacgagaga actagctcgt     56820
     gagtaagtat aatctgcctg cgcaaaaacc gcccgctcac caaggacttc cgtcacagtc     56880
     acacaaattt gttctgttaa ggttcctacg aataaaatga gctcctcgct aggcgcgaat     56940
     tgttctagta attcagttaa cgcaatatgc ccgtccgcga taacactctg cattttgccc     57000
     tcggtcactt gataaacacc cgcgtacaca tttccacggc gcgcatccat taaagcgaca     57060
     acttttccag gaaagtacaa accgttctct gctaaaagtg ccaaagaaga aatcccgaca     57120
     atcggaatcc ccgcatccca agccattgtc ttcgctaccg ttacaccaat acgaagtccc     57180
     gtgtaagacc ctggaccttt tgctacagca attttttcta agtcagtagg ttttactcca     57240
     cattcttcca ttaaaacagc aatcgctgga agcaaccgta cactatgatt ttttcttaaa     57300
     ttcgttgtat attcgccgat aacgacaccc tcattaaaaa gcgctatcgt catcgtatca     57360
     gaagacgtat ccatcccaag tatcattttc caaaaacctc catcgcaagt tgctcgtacc     57420
     tttgtccaac tggcttcaca actatcttac gcgtattctc atctatatga aaaagcttga     57480
     tttccaagta ttcttctggt aaatcctcac gaacaaactg cgcccattca accacgctca     57540
     cacccgctcc gtaaaaatat tcctccagac caagttcatc agccgaagta tcttccaaac     57600
     ggtacacatc catatggtaa agcggcaagc gccctttctt atactcgcga ataatagtga     57660
     aggtcgggct tttaatcatt tgcggaatca aaaggccttc acctagacct tttgtaaaag     57720
     tagttttacc cgcaccaaga tcaccctcaa gtaaaatcac atccccagca gttaaatttt     57780
     ctccaagttg ttttgcgaga agtcttgtct ctctttcact tgtcattatc aattcgaatt     57840
     ccattacctc acccgtccat cattttctct acatatcata ccacaaagac gcgccaaaat     57900
     aaaaatcaaa aaaacgcaac gacctaagtc gctgcgtctt tcgattgatt aataattagt     57960
     tccacttata tccatatcgc catacatttt tcttgtaata tcagtaatta ttttatttag     58020
     ctcttcgcta gaaataactt catcttttgt agggaaatct tcaattggaa caaattcttc     58080
     tgcttttgtt ttcaccgtaa agctaataga ctcaggagca ctcgcatcgg atttatcttc     58140
     tatttttgtt tgaagagtaa gtgtatctaa gctattctct tttcctgatt tcacagtaag     58200
     tttattacta atcaagtacg ttttattttc ttttaattct ttcgcagcat ctgttaaact     58260
     cgatttcatt tctgcatacg tggaatcaaa atctgttact gcatctgaac cttggctttc     58320
     tgcaataact ttaaaatctg cttttacttt ttcatcatcc attagtttag ctacttggtt     58380
     cattaagtta gcaatatcgg cgtttttaat tgtaacgcta acagtgccat catccgcttc     58440
     tttaaaacga tctttttcta agccagtgaa ataagtatcg attaatttta ttgctttttt     58500
     atttagatct ttcgaggctg cctcgatttc ttttgtattt acagctgttt ttgcctcagg     58560
     ttggtctgtt aatgaacttg tcaattcttc agtactaaga tatttatttt ttaaatctgg     58620
     gtaatcggtg ttaattttag accacatgcc accagtcgct tggtctaaat aactaagtaa     58680
     agaagcatca ggctctacaa tagttttaag tggaatatag gcattccctg ttttactatc     58740
     tactaaaaaa tctaaatcca ttgaaattgg cagtaagtta ttcgtcgatg ttacattgaa     58800
     ttttgcttct gatttgtttg cttttttgtc agtggacgtt gttacagaaa gcttaatgtc     58860
     ttttaaaatc cccatcgttt gagcacttgg gtcagtgcta gaaacattta tatcgtttac     58920
     agcaaaagaa gttgtatatg tatattgatc aggcacattc atcccatttt tcattgtttg     58980
     aacaaattta ccttgtggtg tttttgctgc tttttcttcc gcactttccc cacaagcact     59040
     aattactaat actaaagcta acaaaattga taataaaatc ccttttttca tcattctcct     59100
     cctaggtgat taatacatta aaactaacac actttaaggt ctgaaaacaa gagaatttac     59160
     aatagttcat cagtctgaca caaattccta taaaaaaagc gttcctttta gaaaggcacg     59220
     cttttatttt ggagtcactt ttaaagatgt agcattttca gatacttttc caggggcggg     59280
     tgaagtaata tttgaacctt gtgggaatac agctctaaca gtatcttcct ctttgatgtc     59340
     agcaagtttc attgcttttc cagtggtcgc atttgttacg gctgtattgc tactcactgt     59400
     aatcatgact tcacttgcgt aatcgttttt ttcaccattc cacgttaatg tcccattgac     59460
     tgtcaactca ttattattct ctaacaaact agtatccgtt attgttccgt caaggactaa     59520
     agcaggcact tctgcttgat tacaacctgc taaaaatagt accactagta aaaccggcaa     59580
     tattaccttt ttaaaacctg tcatcactct ctcgtcctct ctgaagctta tcgttctttc     59640
     tagcatagca tttagcagaa atacaggcaa ttgttttctt gtttcttaaa caattcttat     59700
     acaccaagca tcataccgag aaaagccgct attaagccaa acacatacgt aaaacctaga     59760
     taagaaaata acacacgata attcgtcttc cattttaatt ccatactttc cactttaaac     59820
     gtagaaaaag tcgtatatcc tcccataaat cccgtaccta aaaaaagttg ccaaaccggt     59880
     ccaagagcag aggaaacaag aaaacctaat aaaaatgaac cagtaatatt aataaaaaaa     59940
     gtcgcagaag gaaagtttgt tttccatttg cttttgacca atacagaaat tccatatcgt     60000
     agcatcgcac caagagccgc tccaaaacct acaagtaaga aattaaccaa cacgatgctc     60060
     acctcgattc aaaagcttat tgctaagcat ccggccaaac ttcaccataa taagccctcc     60120
     aatgaaacta gctagcacat agctaactgc aaataaccat gcgccacttt gcactagttg     60180
     aattgtatct acactaaaag ccgagaaagt cgtaaaggcg ccaataaacc ccgtcccaat     60240
     cccgttcaaa agcaccaatg aaacacgtga tttttccgcc aaaaatcgca taagaaaagc     60300
     caataaaaaa caacctatta aattaactgc taatgtcgca gaaggaaaat ccccgccacc     60360
     aagccacaaa ttcattgcat atcggcacat accacctaat gcaccaaaaa ctcctacata     60420
     taaaaaatac atctccaaga ccccacttca caaaaaaact accctgaaat atttgcattc     60480
     cgggcagtcg cctttgtcct atttctacta tactataacg caaaacattc caattattca     60540
     actcaccgga agtcgaagga tggtcttcat tttttctgga tccgccttgc gcggatcact     60600
     caaataaatt tcgtggtgtt tacgaactgc tcctgtatca ttatgaagcc cctctgtttc     60660
     catgaattgg tgtaattccg cgaccgtttt cacttcttca ctaaaaggac caatatgcat     60720
     catttgcaca cattcccctt cttcaaaacg aaccaatttc acacgactcg tatcgacatc     60780
     cggctttttc ttctgagcaa cctctttagc ccattccaac acttcttctg tgacaaaatc     60840
     tggttgtcta agaatggatg tccaaagcca cgcatctctg tcctttaaat caaacttctc     60900
     ttcagaccac caaaaccctt ccagcggcgg tacaacaaaa tccgcgtaac cattcagacg     60960
     cgtctcgccc atcttgctca ttttaatcgt gtacgcaatc gcataaagag actgcactgc     61020
     cttttgatac tcctcaccgt ccggatcacc tttaccatcc accatcaaaa aattcatttc     61080
     cggaacaaaa atacgctctg gcttcctttt aggcgcgtag aatttcttct cttctttttt     61140
     aaaatcaatt ttcttttcag tcatttgaat tcctcctcgt tcatccaatt cggcactatc     61200
     ttttgaaaat tatcgtgact agctgccgtc tttactgcat aatccatcaa ctttttaaaa     61260
     ttacgagatt cattttttgc cgcccaacta acagccgaag taatatgcat cgccgtgtaa     61320
     agcgcataaa gattccaaaa atccgtaact tcttctttat caatatagcc taaaatattt     61380
     cctcgtgcaa aaggtatact gacctctgtt gtaaaaaagc cgattttagc taaatcaaat     61440
     aaaggatcac cgaactctag ccgattaaaa tctattagcc ccacaaactt tttgttgttt     61500
     aaaataatat tcgctggatg aaaatctcca tgctgtaaac aaatcggtct attttttaat     61560
     ctagctatat tcttataaac aaacttttca gtgtctgtta aaaaagaagc tgttatttct     61620
     aattctttta attcctccac ttttcgttta aatttagctg tttgaaaatc caaccagttc     61680
     atttttggta tatctagcgg tattttatga acttctcgta aaatttcccc tgccgaaaaa     61740
     ccagctttaa actgttctga atgagataaa tgagtcatgc cactttctgc gtcttctcct     61800
     cgcaaataac taataatcat atagccttct ctttcgataa aaccgaaatc atatgctttt     61860
     ggaacaaatg gagtttgaga atctaatgct tggattattt taaattcttg cttccgttct     61920
     tgaagtaagt ctatgggaaa aacacgaaca aggtaagttt catccacctg gtatttccta     61980
     tcaacagaaa aacctttttt tatttccgaa attactttcg cattatgcaa catttttaat     62040
     tgtgtcacat ccataattag ctctccctcc tataaattcg ctattctcca ttatacaaga     62100
     atacgcttac ttttttccaa ttatctacgt agaatttgtt gacaaaatac tggaatcaat     62160
     attataatta gttttgctac gcatacgcgg tcgtggcgga atcggcagac gcgctaggtt     62220
     gagggcctag tggggtaaaa cccgtggagg ttcaagtcct ctcggccgca tcaattaaaa     62280
     aattccaagg ttagaagcta accttggaat ttttttgtat ctttaatatc ttctataaac     62340
     aaataacccg ctagctacga caataagcaa tcctgtaaaa atcgttgagc tacttgaact     62400
     atcgcccgtt tgcggtagag cggtaatttt tgtcgtttct ccacttacct tcaccactgt     62460
     actccccttt gttggagttg gttttagagg taccattatt ttattatcac taaaagtaat     62520
     attaatagtt ttttgaggat taaatggtat cgttacgcga atttcattgg ctgatttttc     62580
     ataaccaggt ggtgctgtta cttccgttat gacataagtt ccgggttgta agttttcagc     62640
     aagtgcataa cctttactat ttgtagttac tttttttaat gtcgttccat ctattgactt     62700
     tacgtcgaaa acggcatttg ctagaccttt tttattcgct tcatcttgtt taaaaatagt     62760
     aattgatcct gttttctcag cgttttgaaa agtgagtttg acaggatttg tatcgccgta     62820
     cgtgatagta aatttcttgg gtgttgtgtt tttctgatat ccaaggggtg ctgtaacttc     62880
     ggttgctgta taattccctg gtggcagtcc ttctgcagtt cctgtcccat tttgattagt     62940
     tgttattttt gctacttctg attgagaatt atctttaatt gcgtaaaccg ctccactcag     63000
     tgccttatct cctgaaagtt tttgaatttc cactttacca ttcgtcgtta ttcccgcatc     63060
     tatatcaaaa ttctcacttt ttaaattagg tacatttact gaagcaatac cagttttatc     63120
     tggtttagaa ttaaggctct tgtcattacc ttgatttgct tttgaaaaaa taaaatcatt     63180
     attcggtagg ctaaatttca cttgatagtc ccctggcaaa acatctgtga ataaataaga     63240
     gccgatatta tttgtggtcg cactttcttt aaacgtacca tctttcgtta ataaatctac     63300
     ctttacgcca ggagcaggtt cttcgctatc ttgctgaata ccatccccat taaaatcata     63360
     ccaaacaaca tcgccaattt ttgcaccgtt tacattaata tataactgaa catcatctaa     63420
     aaaatttccg cttgtaagtg aaccatttgc agttgaaatt gggttaaaag ttagtcttgt     63480
     gatagtttgt ccagctggaa ccgtataatt cccttcaaaa ctcccccacg tttccccatt     63540
     agaaactctc gatacctccg tttgactttc gggtgaacca ataagcaaat cggctgtgtc     63600
     tacaccagta cgacctcgat gcgaaaactt ccatgttaaa ttcgaacctg ggattgtccg     63660
     aatatcctga taaactggtc caataccatc tgaatttaat tcaataaagt tatttcccga     63720
     aaaagcaggc acattatatc cattaccatt ttgccatact tctatatttc cagttggatt     63780
     agttgtgccc caggcatcta caccagcttg attaaccatc catacatttg ttgtaccagc     63840
     attttgaccg taatctgtga tatcaacatc ttcaaaatca ttatttttaa tagcccattt     63900
     taactgccag ccatttgaag atgttggaga agcttgcact ttttcagaag tacttccaat     63960
     aataagcaac accattagaa tgaaaaaact acctattaat tttctttgca taccttcccc     64020
     tcccttttcc ctgggcctaa catcattaaa tacccataaa acagcaaaag aaaacagcca     64080
     gtgttgcaac cagctgcttt tttgtttatg acaaaatatc gtatgccatt ttatattttg     64140
     ttgatttggc gaagtgttta cttgcatgct ttttgactcg ttcaattaat actgggtcat     64200
     ttgacgcatc aatctttttc aataatttta tcattttctt ttcataactt acttgctcat     64260
     cctgttgata taaaagcaat atttcggtgt attccatgaa gtaattcagt tcttgcactc     64320
     gctcaactac tttattcatt agccccatta atgaagttgc ttcttcaaca aaaccttttt     64380
     ccgcaaaaat aaccatcagt tctgttataa caaggtaatc gttgttgtta aagcttatat     64440
     tagtcgtttt gtaggccatt atttctttat acaaacaggt tattttttca taaaatagcg     64500
     tctcatttcc ctcaatattt tcaatttctg ccatttttaa ctgaacgacg aaataataga     64560
     tttttttagc ttctggatat ttggaaaagt acttttgtgc ttgtttaaat ctgtattttg     64620
     cctcaccaat aaagccaatt tgaaaataaa tgtaaccgta gaaatagaga atagagacaa     64680
     aacgttcctg ctcttcatcc tttattaaat cccacgcttg ctggatatgt ccaagtgcgg     64740
     gttcataaat actttggcaa atataattaa tgcagatgca cacatgaaaa acagtaagaa     64800
     aatttttatt atcagtgaga gcaacgcact tctcccagta ctccactgct aattgataat     64860
     tacacgttgc atgagaatgt tttactgcct gaccgtaata atagtaggaa agcaattgga     64920
     gcgggaaagc attttccact cgtttttctg cgttctttaa atatttagct tccacttctt     64980
     ccgctcttga aaatttccaa gtcttataat aaaatgccac ctgtaaacaa taaaagctaa     65040
     gttcgacagc tggtgattcg tgctgtagct ctacattttc atctattttc tttaatctac     65100
     tttctatttc tttaggatta gaacaaacca atagttcaaa aatctcatcc aattctttca     65160
     aaagtgctct attctcttca tcttcgctca tcaataacac ttcttccggt atttctaacc     65220
     ttcttgctat gtgtatcaac gtttccaaag aagcaacttt aataccattt tctatatttg     65280
     ctaaataagg aacagagata attccttgcg ctacgtcttt taatgtcagc tgtttctctt     65340
     tacgaatatt tttaattcgc aaaccgatta agttcatgat gtcaccgccg tcttttcaat     65400
     attttcctct taattataaa catttcgaaa tggaaaacaa ccactttttc cagctacttt     65460
     tttgctttcc tttttatatt ttctaaaaaa gcttgttaaa taagcttgtt taaactacta     65520
     acctaaagcg ttcgccctta catagaaaac gttttagatc aaaaaaagca tgattgctct     65580
     tggacctaaa acgttttgtt atatttgctc ctgtatagct attttgaaaa aagcttcact     65640
     aatttgtcat aatcatcgct gtggattttt tgttgtccgg cataggtgaa ataaaaattt     65700
     tccttttgaa ttcctaaatt ccacctaata ccgacatttt attacttttt agtttgctcc     65760
     cacatgcaaa ctattccgtt aataaaacaa caagttttat agactctttc ccttatcgaa     65820
     tctataaatt ttctctacac attccctttt aaaacctgtc tacgcaaaaa cggaaacgta     65880
     gatttttatt ttaccattca aattcaatta atctctaaaa aggaaaattt atcccacttc     65940
     cgctttttta agtctatttt tagtcttaat ttcctaaaaa gacgaagata tcatctatct     66000
     tcgtctcgtt tttatttaaa taaaatatgt tttttcttca tatagaatac aatggatgct     66060
     gctacaatca tttctgaaat cggaattgct agccaaacgc ccgggatacc aatgattggt     66120
     ggcaatacta ataagaaaat taccatgaag ataatttcac gtgaaatcgt aatccatgta     66180
     gccattttta ctttgtctga tgtttggaag taagtcatca taacaaagtt gaagcccatg     66240
     aaaagataag cagtatagaa taatttgata ccattgcttg ctaactctct aatttccacg     66300
     ctaaagttac cgaacattga aacgagcaaa ttagaaccaa agaagccaac aagtaaaaag     66360
     ccgaccccgg tgctaaatgc tacaacaatc gcaattttca atgtttccaa ttctttttgt     66420
     ctagctttcg cacccctgta atagctaata agtggctgaa tcgcagaacc cattccaagg     66480
     aacaacatca aaatcacact atgcgtataa ttgaggacag agaacgccgc cacgccagca     66540
     gtcccagcaa tagccgcaat cgaaatatta taacctaacg taaatacaga tacaccaact     66600
     tctgccaaaa agctcggtaa gccaatcgcc aatgttttct tgaaaaaagc tttgttccag     66660
     tccactttga caaatttcaa gcgactcgat tttttgaaga aatgggtagt taaaatgagt     66720
     acaccgataa tgattgctat catcgtagca agagcagagc ctgtcacacc ccattcgaac     66780
     acaaatagga ataaatagtt caaaataaca ttactgattg ccgttacaat aagcgcaatc     66840
     atcgataaat taggatcgcc atcattacgt acaaaaatac ttaaaatatt ttctagtgta     66900
     agcgcaaatc caaatacgag caggatattc atatactcaa gcacataacc aatcgtatca     66960
     tcattcgcac ctaaaaaata agctaatggc actttaaaaa taaacgctat aattccaata     67020
     ataacagtga ttgaaacaac ggctagaatc gcattggtga aaatcgtttg tgctttagcg     67080
     acatttttct ctccaattgc aaaggaaaac tgggtcgccg cgccaattcc aatccagata     67140
     gaaatcgctg taaaaatcgt aaataccggc accgctatat ttatcccagc aagcgctact     67200
     ccgcctagct tatgcccaac aaaaattcca tcaatcacaa tatttaaaga cattaacaac     67260
     attcccacta aggaaggaat taaatatcta aaatagattt ttttaactga atctgtttct     67320
     aaaatttcca tattttttgc catactacac ctctaattca aagcttttag cgtaattcct     67380
     ctccagaata tttgccataa agccgtgatt ttcttttccg ttctttccgg gtcattcacg     67440
     tacacaatgt ctacgataac tgcatcaaga attcccatgt atgcttcttt catcgtttcc     67500
     acatcttgca ttgggattaa cttttgttcc atccaattgc taaataaatc agtaaattca     67560
     tgttccattt gcagcacgtt ctcggtaata tctgcttgga ccacttcata caaatgcttt     67620
     ggcggataaa acccgtaacg taaccaaaat tgatatgcct cgtcagtatc gtataattcc     67680
     ttcacaccaa aaagtaaact agacaaaaca agatctggtc tggataagtc actatctcga     67740
     agttttgccc ggtagtaatc tatttctgtt gatttagcgt ccttcataat ggataaaaac     67800
     aaatcatctt tatctttaaa atgagaatag atggattgtt tcttcagccc caccacacca     67860
     gcaatatcag caagcgatgt tccttcaaaa ccattattag caaaaagtgt cagtgcagct     67920
     tgtttgattt cttcttttct catcattcca ctcctctcac aaaaactgac gaccgttcgt     67980
     aagtcatttt ctcatgaaaa aaattctttg tcaacaaaaa aatccactct tttaaaagag     68040
     tggattcatg gatttatttt tcttctaaaa attcgctaat caattcgtat gtctcatcgg     68100
     tcgcttctga attagttgtc atgaagccat gtggaacttt ttcaaaacgt ttggcaaata     68160
     cttccacgcc ggcatctttt aatttcttcg catatgcttc cccttgatct ctaagtggat     68220
     caaattcagc agtcgcaata aatgttttcg gtagtccgac taaatctttg ctacgtattg     68280
     gtgcaacgag tggatcgtat ttacgatcgc ttgcattcgc aatatataat ttaaagaatt     68340
     tatctaatga ttctttcgta agcacgtagc cttctgcaaa ttcatccatt gacggatata     68400
     gaacagatgc atcacggcta aaaatatcag ttgctggata aagtaagatt tgagcagtaa     68460
     tatttggttt tcctttggat ttagcgattt gtgtaacaac ggtcgctaag tttccgccta     68520
     cgctatctcc cgcaacgata atgtctgatg atttagctcg taagctagta cggtgatttt     68580
     gtacccaaag tagcgccgca tatgcatcct ccactgccgc tgggaaagga ttttctggag     68640
     caagtcggta atcaacagtg acaacacgag cacccgtagt ttgtacaagt tttctagcaa     68700
     tcgcgtcatg cgtttgcaag ccacctaaaa caaatccgcc accatgataa taaacgataa     68760
     tttcgaaagg tccgtcttct tgtggcgtat aaatccgaat cggaattttg ccagctggac     68820
     catcaatttt tttgttttca acatcgccaa tttcgatatc ttttgctgaa ggtaatgctt     68880
     ttgttgctag tctcatatat ttatatcgcg aatctacgtc ggataatggt gacgtgtttt     68940
     tcacaaattc ctgtgaagcc ttatctaaat tctcaagaac ctcaggatta taatcttttt     69000
     tcccaaccgc ttttttgtaa ataaagaaaa cgattaataa tggaagtaga ataatcccag     69060
     caaaaccgat agcgatccat tttattgtat ttttcacatt cgctcaactc cttcaatata     69120
     acttcattaa caagtatagc agttttacga acaggaacca atttattact atttgaaatg     69180
     attattttta tttagaaatg tatttttaag cataattatg aataaacgaa aataaaaagg     69240
     ttgatatcta aaagcatcgg tgttaatata aatacaaatg tttgtatatt tatgaatagg     69300
     ggatgtttaa aatggcgaaa gaaaaaatcg tattagctta ctcaggtggg ttagatactt     69360
     ctgtggcaat tcagtggtta gtagaatcag gttatgaagt tattgcatgt tgcttggatg     69420
     ttggtgaagg caaaaattta gattttatta aagaaaaagc cattactgtc ggagcaagtg     69480
     aatcctacac gattgatgcg aaagaagaat ttgccgagga ttttgcgtta attgctcttc     69540
     aagcccatgc ttattatgaa ggaaaatatc cacttatttc agctttaagc cgtccgttaa     69600
     ttgcgaaaaa attagtagaa gtcgctcgtc aagaaggcgc ttctgctatc gctcatggtt     69660
     gtactggtaa aggaaatgac caagttcggt ttgaagtagc gattcatgca cttgctcctg     69720
     atttaaaagt cgtttctcct gtccgtgatt ggaaatggtc tagagaagaa gaaatcaatt     69780
     acgccaaaga acatgacatc cctgtcccaa ttgatctaga taatcccttc tcgattgacc     69840
     aaaacttgtg gggtagaagt aatgaatgtg gtgtgcttga aaacccatgg acaacaccgc     69900
     cagaggcagc ttacgactta acagtgagtt tagaagatgc accagacaca gcagatattg     69960
     ttgaaatcac ctttgatgct ggtattccta tttctcttaa tggagaaaat atgagcctag     70020
     ctaatttaat tcttacttta aatgaaattg ctggaaaaca tggtgttggt agaattgatc     70080
     atatcgaaaa tcgtttagtt ggtattaaat cacgtgaagt atacgaatgt ccggccgcag     70140
     tcactttgat tacagcacat aaggaattag aagatttaac ctttgttcgt gaagtggcac     70200
     atttcaaacc tatcatcgaa caaaaaatca gtgaaacaat ttacaatggc ctatggttct     70260
     ctcctttaac agaagcatta gttgccttct taaaatctac acaaaaattc gtgaacggca     70320
     ccatccgcgt caaattattt aaaggtcatg ccattgtaga gggaagaaaa tcgccaaatt     70380
     cactttatga tgaaaactta gcaacttaca cgtcttccga tacatttgac caagatgcag     70440
     cagttggttt catcaagctt tggggattac caacaaaagt gaacgcagaa gttaattcaa     70500
     aagtgacaat aacaaccgag gtgtaaaaaa tggaaaaact atggggcgga cgttttcaag     70560
     ggaaaagtga agcatggatt gatgattttg gagcttcgat ttcttttgat caaaaaatgg     70620
     caaaagaaga tttggcgggt agcttagcgc acgtcgccat gctcggcaaa tgcgggatca     70680
     ttcctgcttc agaagcagct gaaattacgg ccggattaaa aatcctccaa gaaaaattag     70740
     cgtttggtga gctcgaattc agcactgtta acgaagatat tcatctaaat atcgaaaaac     70800
     tattgcacga ggaaattggt tctgttgctg gaaaacttca tacggcgcgt agtcgaaatg     70860
     atcaagttgc gacagacatg catttatatt taaaacaagc cgtggcggaa attattcagt     70920
     cgctaaaaca tttacgtgta gtgcttgttc aaaaagcaga gttgcatgtt gaaacaatta     70980
     tgcctggcta tacacattta caacacgctc agcccctgtc ttttgcccat catttgcttg     71040
     cttactttgg aatgtttacg cgggatttgg agcgtttgga agaaagtgtc aagcggattg     71100
     atatttcacc gctcggttct gcagcgcttg ctgggacgac atttccaatt gaccgggctt     71160
     atagcgccga attacttggc ttttctgctg tttatgaaaa tagtttggac ggcgtgagtg     71220
     atcgtgattt tattattgag tttcttagta acagttctat cttgatgatg catttatcgc     71280
     gtttttgtga ggaattgata ctttggacga gtcatgagtt tcaatttgtc gaattaacgg     71340
     acgctttttc gacaggaagt tcgattatgc cgcaaaagaa aaacccagat atggccgagt     71400
     taattcgcgg aaaaactggt cgggtttacg gaaacctttt cggcatgcta acggttttaa     71460
     aagggttgcc gctcgcttat aataaagatt tacaagaaga taaggaaggc atgtttgata     71520
     cgcttgagac ggttcagaca agcttagata tattcgcggg aatgattgaa acgatgaagg     71580
     tcaatacaga aataatggaa gaatcgacgc aaaaagattt ttccaatgcg acggaactag     71640
     cagattattt agcgaaaaaa ggcgttccat ttagagaagc gcatgagatt gttgggaaat     71700
     tggtgcttga atgtacgcaa aatgggattt atttgcaaga tgtagcgctt agccactatc     71760
     aggaaataaa tccacttatt gaggaagata tttacgtggt gctttcctct aaaactgccg     71820
     tgcaaaaaag aaattcttac ggcgggactg gatttgatca aattaaagtc gctctcgaaa     71880
     acgcgaaaaa aactttgtaa aactaactgg gatgctgaat ggcgttccag ttttttgctg     71940
     atttctcccc ctttttcctc ttagctgatt tgtcagagca ctactttttt tgttactatt     72000
     aaaaagaatg ttaccttttt gctaacatgg ggaaatacat acagagaaaa taaagggaag     72060
     tgatgtattg aaaaaattaa caaatgtctt ttggggatcg ggttttctag ttttattagc     72120
     agttttattt ggggcttttt tgccagagca atttgagact tttacaaacc atatccaaaa     72180
     atttctaaca agtaattttg gttggtatta tttaatcgtt gtagcgatta ttattatctt     72240
     ctgcttgttt ttagttttaa gtccgattgg ctcgattcga ctcggaaaac cgggtgaaga     72300
     acctggttat agtaataaat cttggtttgc gatgttgttt agtgctggaa tgggaattgg     72360
     cctcgttttc tggggtgcag ctgagccgtt atctcattat gcggtccaag ctcccggagg     72420
     tgaagttggc acgcaagcag ctatgaaaga tgcgcttcgt tattcattct tccactgggg     72480
     aatttctgct tggtcgattt atgcgattgt cgctttagca ttagcttact tcaaattcag     72540
     gaaaaatgca cctggcttaa taagcgccac actatacccc attttaggca aacatgcgaa     72600
     aggtcctatt ggacaattga ttgatatcat tgctgttttt gcgacagtca tcggtgttgc     72660
     aacgacactc ggtcttggcg ctcaacaaat taatggtggt cttacatact tgtttggcgt     72720
     tccaaacaat tttactgtcc aatttacgat tattgttatt gtcactattt tatttatgtt     72780
     atcggctatg tccggacttg ataaagggat tcagctttta agtaatgtaa atatttatgt     72840
     tgctggtgtt ttattagttt taacacttat tcttggacct actctattca ttatgaataa     72900
     cttcaccaat tcatttggtg actacttaca aaatatcatc caaatgagtt ttcagacagc     72960
     acctgatgcg cctgatgcac gaaaatggat tgactcatgg actatttttt attgggcttg     73020
     gtggctttct tggtcaccgt tcgtcggaat tttcattgcc agaatttcac gcggtagaac     73080
     gattcgccaa ttcttacttg gtgtaatcgt gcttcccgct ttagtcagtg tgttttggtt     73140
     tgccgtattt ggcggttcgg cgatttttgt cgaacaacat ggtaattctg gtctttcaag     73200
     tttagcgaca gaacaggtac tctttggggt ctttaatgaa ttcccaggtg gcatgatgtt     73260
     atcgattgtt gcgatgattt taattgcagt cttctttatt acttcagctg actcagccac     73320
     atttgttctc ggtatgcaaa cgacgggcgg atctttaaat ccaccgaact ccgtcaaagt     73380
     aacatgggga ttactccaag cgggaatagc aagtgtgcta ctctatgcag gcggactgac     73440
     agcgcttcaa aatgcgtcga ttatagcagc ctttccgttt tctatcgtca tcatcttaat     73500
     gattgtttcc ttattcgttt cgttaacgag ggaacaagaa aagctaggat tatacgttcg     73560
     accgaaaaaa tcacaacgtt ctcaactata ataaaaaggg atgaaaatct acaactagat     73620
     tttcatccct tttttcatcc ttttttctgc tttgccgcga ctatttcgcg atagctacga     73680
     gtttgtttag gatatttttt tcgaaagaaa tgttgcgaaa caactgctaa cacgagagaa     73740
     atggcggtaa ttggaataga gcttttaaat ataccgacca tcagtagtaa agcactggca     73800
     aataacgttg cattaaaaag gaatttttcc attagttact cctccaaatt ataatttaat     73860
     tcgcggtcat gagctaattt ttttatacct aaagcatcga atactaacgc tttttcagca     73920
     atgtaggcat tgtattcaat acgctctagc atgtcgtatg ctttatgaag tgatgtatct     73980
     aatacgacaa taccatgttt atttaataag cttgcacttg gaacggcttt atcccctagc     74040
     tcgataacgt gtttacgaac gatttccgca agttcggaac tagtcgctgg cgcaaaagca     74100
     agggttggaa tttgaccgat tttttgcgtt gcttctgtta aattcggtaa ctccatacca     74160
     agtgttgcaa ataacatcga ttctttcgga tgagcatgaa gaacacagcc gatatttgga     74220
     ttttctacgt aacaagcacg gtgtaagtta atttctctag taactcttcc gtctccttcc     74280
     actacttcat tgttattatc cactacaagg atttcatatg gggaaagatc gcaaagtttt     74340
     gcttgactca taagtgtagg tgtcataata atgtgctcac tattcatgcg cacacttaca     74400
     tttcctccag ctgcattcgt ttcaaaacgg tcaaacattg tcttcactat tttcgctaaa     74460
     tcttcacgtt ctttttggta taacatatta tctctcctcc aattgtataa tacttacttg     74520
     attcttgagt tttccagcag cttctaaatc aaagctcgaa ctgtcttgtt gcatgacttt     74580
     gctagcggaa caacctgtcg cgacttttaa cgtttctgta atcggcatat tcatcgcaag     74640
     tcctgcaata aatgccccaa caaacacatc gccagccccg gtatcatttc gttcctgaac     74700
     ttttggtgga ataacttgat acaatttgcc attatgcgcg caaattgacc cttttgctcc     74760
     aagcgaaacg accagatagg ggattttttc ggctaatttg cggacatttt cttctagtga     74820
     attggtcttc tcatccaaaa tagcaatgac ttcatcttca tttggtttaa tgaaatcaac     74880
     acccatttcg accgctaagt ttaaatattc accagaatta tcacatccga gaaacgcgcc     74940
     tgttgctttg acagttctta gtagttcttt aaaatcagat aatgtataat gaggaggcgg     75000
     ggatccagca atcaccacca tatcctcttt tttaactttt ttagcgattt gttttaaaag     75060
     gttcactttg ttggtctgac ttacggtaaa accagcttct ggtatcatcg tgctgccatt     75120
     cgtgtcatca ctcaagacga cgaagcattc tcttgtggaa gttccagctt ctacaaggaa     75180
     atcatggttg atatgttttt cttttagaat ggcatatagt ttgtcgagat tgtctgatcc     75240
     cgcaattcca agtgcttcat ttttaattcc gaatttcgat aatactcctg aaacatgaag     75300
     cccctttccc ccgcaatcaa attccgtttt tttgacacga ttagtcttcc ttttttccaa     75360
     ctctccttga ataaaaagca accggtcaat ggctggattt aatgttatcg tgtaaatcat     75420
     ctcatcactc ctatttctta agagctagct ttttctagtt caattgttcg ttttttcatc     75480
     attttcacgt aaaatactag taatactacc caaattgcga caaaaataaa tcctaaaata     75540
     gtgaactgac ttgcttcagc aaagatataa cggaacactg gatattcaag cgtactccat     75600
     gtaatttgtt gcccagcttt tagcgaaatt gcgccggttg aatgcgctaa atccgtaata     75660
     gttccagcga agaaagtaga tacatataag aaaattggtg ttgtaattgt tccaagaata     75720
     atcatgcgga ttaagttccc accagttaca attagcgccg gtgcacacaa ggaaatattt     75780
     aatattccgg caaacggtaa tacgccattt cctggtaaaa taagcgcgaa aataagtgta     75840
     actggaacca tcagaacgat cgctacccac acttcactac atcccgctaa aatcggccaa     75900
     tctaagccaa taaacaattc acggttttta aatttacgtt tcatgaactc agaaatacca     75960
     tcagatagtg gtgaaagagc ttgcataaat agttttgcaa ccatcgggaa aagggttaat     76020
     gctgcagcag cttgcatggc tagcatcagt gttttagcta catcataacc agcagcaacc     76080
     cctagaagtc caccgattat aaagcccatc acatggtttt ctgcaaaaat accaatttta     76140
     tcttttaacg cattggcatc catatctttc cgaagtgctg gaattttttt cagtaaccag     76200
     tcaagcggca ttaagaaaat acagaaaatc atcatgccgt gagaaacggt tacacctgga     76260
     attccattta actcttgaat ttgacgttgg ttagcatcac atagaattag ttctgtaaca     76320
     atttgaattc cggcaacaat aaatgctaag taaacatttt gtgttacacc gataataagt     76380
     acggctgtta aaattttgcc ccaaacgttc catagatcga cgttcaaggt tttcgtttta     76440
     ttgataacga gcataatggc gttaatacca agttgtagcg ggaacatcaa gaaggcaaat     76500
     ggccatgccc aagcaagtgt tgccattgat gtccatcctc catctaagat gcttaaatta     76560
     atccctgttc tttcagcaag tccttgtgca gctggcgtta atgcttcaat cataaagcca     76620
     ataacgatat tcattccaag gaaagctacc cctagaataa tccccgcact cactgcatct     76680
     cttactttca ttcgtacaat tagaccaata ataatcatta gtgctggaac aaaaacggca     76740
     gctccaaggt tcaaaataaa ctgtataact gattgtaatg actccatttt ttcacgctcc     76800
     ctgttttatc tggtttattt taaggcgtta agtaattttt ctgtttcttc gtccatgccc     76860
     atgcctgtta agaaagcaat accattcaat gttggaatat cgaattcttt atttgctttt     76920
     gtaattgcca catatacatc acttgtctta atatgttgct ctaaagactt aatatccact     76980
     gcttctactg ttgcgcgaac ccctttttct tttaaaatac gttctacttt tgatgccact     77040
     gtttgacttg ttgctacacc tgatccacat gctacgataa cttttttcat tgtaatcact     77100
     ctccaaattg tttttttagg aaatcacata aagtattgct atcatttatt tcttttattt     77160
     gttccacaaa gtctgcttcc ataaattttt ccatgatact tgaaagcagt ggaacttgat     77220
     cttggggatt tttgattcct aacatgaaaa ttacttcgac atcaatccac ttatctaccg     77280
     ttcccatttg aacaaaagga atcggtgtag aaagtttatt tacgagtaca aaaggacgtt     77340
     ttacataaat cgtgtctgta tgaggaattg cgattttgat gccattcatc tcgagtccag     77400
     taggaaaaac tacttctcgg cttgttaccg cttctctaaa agtcggctct acatactgct     77460
     ctttctctaa tatcttactc gtgtattcaa aaagttctgc ctgactctcg tatcttgaat     77520
     ttatcagggt taactctttt tgaaacaaat catggtaatc cacgcgacgc tcaccccctt     77580
     tcaaggattt caacgatttt ctttttgtta gtagaagcga gaattcccac taatttctca     77640
     ggcttcaaga aaatttcgtt caattttagt aataatggta tatgtttgtt ttgttcagat     77700
     ggtgctaagg caatcatgat tttgaccgct tcatcctcag gggtttttgt gttcgctttc     77760
     attatcatca actgaatatc ttgctcaatt accccgtttg cgggtttggc atgtggcaaa     77820
     taaatattcg gcccaatcat catctgctca taattttgat agaatatttc ttcacaagta     77880
     tgaatgtaac tagcatccac cgttcctcgt tctaacattg gtgcaaacgc cgccgaaacc     77940
     agttgctccc actcaagtgg catttctaag aagtgaacct gctcttccgt aattcgcatt     78000
     tgttctggtt cttttttctc cacaggctgc tcttttttgt taaaaaatga ctctactttg     78060
     gcttgcacta atcgaatatt ttcttcgggg atttcatctt ttagcatagc gagtagttct     78120
     ttggttttct tatgactgtc catttcaata gctttatcaa cttgttctct aaggatttgt     78180
     cggctgtctt tacttaaaat cgacggaatt acaaaaatgg tggcgtcgct ttgaactgga     78240
     acagtcgtaa aaataaaatc aatatcgcgg gcgaccgtat ttaattgccg caccgcataa     78300
     gcaccttgaa aatcaatatt cggaaacatc attttcaagt tttctagcag taatttagaa     78360
     atggatgtac cacttttaca aaggacgact gcgcggaaaa tcggctgttc cgtttcctcg     78420
     atttgataca tccacccaag aactatcatc gaaagataca caatttcctc ttctgaccac     78480
     ttgtgaccaa ccaatttttc aaaaggtttg gaggcttttt ctacaatgtt aaatgtcggg     78540
     gtatattctt taataaactg ttttttaagt ggattattga tttgaaatcc tagaatcgtc     78600
     cggtaaattg ctggtctgac atgtaaaatt actttttctt taaattcatt tttcttcatg     78660
     atttccgtcg caaaatacat ttctagtaaa cgaatgaact cgtcgactgc gtaggcgatt     78720
     tcttcactgt ctgagaaatg aagcgccgac tcgactaagt tcgaagcgag gacttgtaac     78780
     gataagtaca acaaatcgtt ttcacttaaa aaatcataac cccaaaacat ttctttcatt     78840
     atcgggaact cacgggtatt tttgatgtca tacatttcaa ttttaaatgt ccatttcttg     78900
     tttgttactt tggatcgttt gatgatgccg tggagaatat agggcaattc ttccatctgc     78960
     tcatctgtaa aggtaatttg aagcttactt tcaacctttt caagccgttt ttttagtaaa     79020
     aatacttcgc tcacagtaat cagcttcttt tcatcaagta cgaattttcc gtatggggtc     79080
     tgaacgactt cgcgaatgag ttctgctagt aaattacgaa tcagaaattc tgaaccagaa     79140
     acagcgtagc catctttccg cgagtaatcg agctgaattt caaactcatg cagactctct     79200
     ttgatacttt taacatctgt aagcatggtg tttttactta cataaacata gtccgcaagc     79260
     gcgccgagtg acatataatg attatgtagc agtaatttaa tcatgataag tttgcgacga     79320
     atatttacct cataaaacga aaacagctgt tgttcttccg cagttaaaag ccggtaacaa     79380
     gcttccctac atacatctgt aacaaaaatc atgtcatggt caatcaaaat tggttctgac     79440
     tttagtagat ggtttatttg tgtaatctgt gcgccaattg cttcttttga tactttaaaa     79500
     ttcttggaaa catttctaag attcacttgt cgattcaaga gcagataagt aattaattcc     79560
     ttacaattct gttccatcta ctttcccctc ccttacatta atagtaaatg ataaccctta     79620
     cataaaaatg atgattcatc acaaattcgc ttttggaaga aagagttatt gtgatgagtt     79680
     atattttagg attactttct attatagagg agaaggattt ttaggggaat atcaaaaaag     79740
     tgcgagatag cgttaaatca cgcttcctcg cacttttttg atactaatat ttgttttatt     79800
     atttcagcta cacgtctcgc ttccttcttt tcaagacgtg cataagttac gcgaataaca     79860
     gcttctttta caccaaataa aaatcccggc atcacgagca gatcattcgc taaaaatata     79920
     tcgaaatcac gaaccgaacg aaattcgact ggcaatttca cccataaatg aaaaccacct     79980
     tttggcttaa taaatgttac ttcactcggt aaaatggctt cgaatgcttc gattagatca     80040
     tctcgacgct gttccaatac gtggtgcaat tgcagcaaat gtgccttgta accggccgta     80100
     tttaaaacac tatttgctag tacttgcggg aaaatgctta aaccaaaatc catctcttgt     80160
     ctggcaagtg caagccgttc aataactgct gtcggaccaa tcagccaacc aattcgtgta     80220
     gtagatccca tgatctttga gagcgatcca atatataaaa cattatctgt atccaatcgt     80280
     ttcagcggtg ccggaatttg gttatccagc gcacccagtt ctgaaaatgg atcatcctct     80340
     acaataggga tttgcaaatg agcacaaatt ttcacgagtt cttttcgtcg tttcaaactc     80400
     atcactagtc cagttggatt ttgaaatgtt ggattaacaa agaccatttt tacgcgatgt     80460
     ttatgatata aatcacgtaa ttccgaaata accacgccgt cttcatccat tggtaacgca     80520
     aaaatccgca agccggctga ctgaaacaac gatagcgaat aaaagtatga cggtgactca     80580
     attgccacag catcccccgg ttttaataaa cattgtgtaa ttaaaaagag cgcttgttgt     80640
     gcacccgatg taatgaaaat ttgttcagat cgcgtttgta agccataagc ttctttcatc     80700
     tgcttttgaa tcgtttcacg cagtggtttg tagccagctt cgtcctcctg ttgttcttca     80760
     gcaataaaag actgccagga aagactcggt gtttccattt tcggcgtcat ttcaagcggt     80820
     aattccccgc ttgcagcatc aatcacgtta tccgaattgg cacgttccat tactcccgct     80880
     tggcgaatat aaggaactgc tggcgtaaaa ccaccttgcg ttaaataatg ccgccaattg     80940
     gttgactgcc ccgcaaaaag tccccatttt tccgcattaa ccgttgttcc actaccttgt     81000
     ttgcgaatga taacagcccg cgccgtcagt tcatcgagcg ctcgcacaac cgtcgaacga     81060
     ttcacaccaa acatctccgc caactgtctt tctggaggca atttttcttc tggcaaaagt     81120
     tcaccattca taattttcgt ttcgattaaa tcaacaattt gtaagtaaat cggtaaactc     81180
     gaatttccag ttagtcgcca catccgttca ttcctcctat ataaattgga tggagaaaac     81240
     aacatccaat tggctgtttt tacgaaatga cttttagctt atcataatag tcaggtaatt     81300
     tcaattaact ttgatggagg ttattaatat ggagaaaaaa gttggtacag atcgtgtaaa     81360
     acgtggtatg gcgcaaatgc aaaaaggtgg cgtcattatg gatgtagtta atgccgaaca     81420
     agcaaagatt gcggaagaag ctggtgctgt tgcagttatg gcgcttgaac gggttccttc     81480
     tgatattcgc gcagccggtg gtgtcgctcg tatggctgat cctcgtattg tggaagaagt     81540
     aatgaaagct gtatctatcc ctgttatggc aaaagcacgt attggtcata ttacagaagc     81600
     tcgcgtcctt gaagcaatgg gcgtggatta tattgacgaa agtgaagtat taactcccgc     81660
     tgatgatgaa ttccatttac taaaatcaga tttcaccgtt cctttcgtat gtggttgccg     81720
     agatatcggt gaagcgctcc gccgtatcgg tgaaggtgct gccatgctcc gtacaaaagg     81780
     agaacctgga acaggcaata tcgtcgaagc agtccgtcac atgcgccaag taaacggcca     81840
     aatccgccaa atcgcaggca tgacagatga tgaattaatg gttgctgcta aaaacttcgg     81900
     tgctccatat gaattaatca aagaaattaa aacacttggc aaacttccgg tcgttaattt     81960
     tgccgctggt ggcgttgcga ctcccgctga tgctgcacta atgatggaac ttggagcaga     82020
     cggtgttttc gttggatcag gtattttcaa atccgataac cctgccaaat ttgccagtgc     82080
     gattgttcaa gccactacct actacacaga ctatgaatta atcggaaaac tttccaaaga     82140
     gctaggttcc ccgatgaaag gaatcgaaat gtctcgcctt aacccagaag acagaatgca     82200
     agatcggagt ttttaatatg aaaaaaattg gtgtccttgc aattcaaggt gcagtggatg     82260
     aacatatcca aatgattgaa tcagccggtg ctcttgcttt taaagtaaaa cattcaaatg     82320
     atttagctgg gcttgacgga cttgttttgc ctggtgggga aagcacaacg atgcgcaaga     82380
     ttatgaaacg ttatgattta atggaaccag ttaaagcatt tgcaagtaaa gggaaagcta     82440
     tttttggaac ttgtgctggg cttgtccttt tgtcaaaaga aattgaaggt ggcgaagaga     82500
     gcctaggctt gattgaagct accgcgatcc gtaatggttt tggtaggcag aaagagagtt     82560
     ttgaagccga attaaacgtc gaagcatttg gtgaacctgc gtttgaagct atatttatcc     82620
     gcgcaccata cttaattgaa ccgagtaatg aggtagctgt gttagcaaca gttgaaaatc     82680
     gaatcgtagc agctaaacaa gctaatattt tagttaccgc attccatcct gaacttacta     82740
     acgacaatcg ctggatgaat tacttcctcg aaaaaatggt ataaaaaaag cagtagacaa     82800
     tttagtctac tgcttttgca tattatttat tcactgcttg cgctgctgta atcaacgtta     82860
     agttataaac gtcatctgta ttacaaccac gagataaatc attaactggt gcatttaagc     82920
     cttgtaaaat tggtccaact gcttcaaagt tacctaaacg ttgggcaatt ttgtagccaa     82980
     tgtttcctgc ttctaagctt gggaagataa atacatttgc gtcccctttg ataacggatc     83040
     ctggtgcttt tttctccgca acagttggaa caaatgctgc gtcaaattgg aattcaccat     83100
     caagcgttaa ttcaggtgct ttttcttttg caagagcagt tgcttctacg actttttctg     83160
     tttcatcgga ttttgcagaa ccttttgtag agaaacttag cattgcaaca cgtgggtcaa     83220
     tgccgaagat ttctgctgtt tccgcactaa caatcgcatt ttccgctaag tctgctgcaa     83280
     ctggtgcaat attgatagct acatcactga ataagtagcg ttcttcaccg cgaaccataa     83340
     tcatcgcgcc ggcaacttta cttacgcctg gttttgtttt aataatttgt agtgctggac     83400
     gtacagtgtc gccagtagag tgagccgcgc cacttacaag accttctgct tttcctgtgt     83460
     atacaagcat tgtgccgaaa tagtttggat caactagcat tttacgcgca gcttcttctg     83520
     ttgctttacc tttacgacgt tctacaaatg cagccactaa ttcatcaaaa agtggatcgg     83580
     tcgcaggttc atgaatagcg attccttcaa cagaaacacc aatttctttt gcttttgctt     83640
     caatctccgc tttatttcca agtaagattg gttttacgat attttctttt tgcagacgtg     83700
     cagctgctcc aacaatacgt tcatctgttc cttcaggtag tacgatgcgc acgtttttcc     83760
     cagtaacttg tcctttgatt gtagtaaata aatcactcat gtgttaattg cctccattaa     83820
     tatacatatt atagttacca ttttactata aaaaagaaca acttgacaga aaaaaagtga     83880
     ttaaaaacag ctccagcact tatttccgtg tatcaataca gaggtaaaaa ggcatgccac     83940
     ttaggcaaaa gacggctatg ctcttaagaa atttttttgc tgttataccc tactattttg     84000
     ctattctaac agcaatttca aaaaaacact tcatattaag gtctgttcgt gataaaatga     84060
     acatagttga taatgattat catgttcatt acataacata aaaggaggcc tgctagctta     84120
     tgcaattaaa tgaaactgct gtcggtgaaa aagttcgcat ctcagaatta aaaattgaga     84180
     acgccatgct taaacgtcgc ttacttgcac ttggttgcga cgaaggttgt gatatttgta     84240
     tcaaacaaaa aggactattt ggtggtccct gtacttttga aacaaaaggg caatatatca     84300
     gcattagaca atgtgatgct tgcgccatta tggtggaacg cagatgagtc aaaatacata     84360
     ttgcttactc ggaaacccaa ataccgggaa aacttcctta tttaatgcat taacaggctc     84420
     ttatgaatat gtaggaaact ggagcggagt taccgttgaa aagaaagtcg gtacgttgcg     84480
     ctctaaaaca ggaaaattaa ttgatttacc tggaatttat gacttaaacc cgatttctcg     84540
     tgatgaaaca gttgtcacta gatttttatt agaagaaaaa tttgattgta tgttaaatat     84600
     tgtcgattca tcgcaaattg aacgaaattt aaatttaacg attcagctcc ttgagttcgg     84660
     cgcacctgtt gtgatgggtc ttaatatgat tgacgttgcc gctggtcgtg gcattcattt     84720
     aaacatccaa aacttagcaa aaaaactgcg cattccgatt ttgccagtcg tcgctcgttc     84780
     tgggaaaggt accgatgata tattaactac tttatcggaa aaacatgtgg caccggcgat     84840
     tccgcttgtt ttaccatacg gagaacccgc ggagaaagct atcgcagaaa tccaagcttt     84900
     aactaaagat attatcccta ctaagcaatc tcggtggctc gcagttcaat ttctttctaa     84960
     aaatgaagtc acagaagaat ttttaacgac tagccctatg tttgaacaat tgaaagatat     85020
     acgctcagat ttagaaattg cgcttgccgg caaattagaa aatcactttc accaagttcg     85080
     cgtgaattac attcatgata tttgtttgac ttcagtcgaa tacacgcgca attcggatat     85140
     tccactatcc gataaactcg ataaaatttt cacgcataag tttttcggga ttccgatttt     85200
     ccttggtatt atgtggttaa ttttccaaat aacctttact tgggttggcg caccgctgtc     85260
     cgatttgctc gatggtttta tcggtggctc gctgacagat tgggtgactt ccttcttaac     85320
     aaccatcggc gcatctggat ttattactga tttggttgca gatggtatca tcgctggtgt     85380
     tggtggcgtg ctcgtctttg ttcctcaaat cttggttatt ttcttcttca tttctgtctt     85440
     agaagattcc ggatacatgg ctagaattgc ggttgttatg gaccgcgtaa tggaaatttt     85500
     cggcttaaat ggaaaagcat ttattcccat gattatcggt tttggttgta atgttcctgg     85560
     aattatggca gctcggtcga ttgaagaatc caaagaacgt acattaacca ttctcgtatc     85620
     accattcatg tcttgttctg cgcgccttcc cgtatacgct cttttcgttg gggtattttt     85680
     tgaaaaatat caagcgcttg tcgttctatc actatacgtg attggtattt taatggcact     85740
     tatcgtcact aaaattttat caaaaacttt acttaaaaaa gataattccg tatttgtcgt     85800
     cgaactaccg ccctaccgct tgccatcgct taaaacttta tggcgtagca catgggaaaa     85860
     aggaaaagga ttcttgcgta aagcgggaac attcattttc gcaggttctg tgatcatttg     85920
     gttactaaac tacgctggtc catcaggact cgacgtacca atgggtgaaa gtttcttagc     85980
     aattatcggt ggcatgctcg ctccactact cgttccgcta ggttttggaa cttggcaagc     86040
     gggagcgaca cttattcctg gttttctagc aaaagaagtg gtagtttcta cgatggcaat     86100
     tatttatgct gttggagaaa gctccatggg aagtatcgtt agcacctttt atacaccact     86160
     ttcggcttat tgctttatgt tgttcatctt gctttacatc ccatgtttag cgacagttgc     86220
     cgccattcgt aaagaaacta gttcttggaa atggaccgca tttgccgtcg cctatccact     86280
     cattacagcc tacgtattag tatttctcgt ttatcaaatc ggaagtctat tcgtttaaga     86340
     aaggatgttt ttcgtgagta ttatcgttaa tttattactt ggcggtgcaa tttttggcta     86400
     caccatctat gctattatca aatttgtcaa acgtagtaaa cagggaaaat gcggtggttg     86460
     cgaacttgaa aaagcctgta attgcgagtc agacgaacat acgaatttgg atcatatata     86520
     taaatagcaa aaaagagccc tttccaaggc tcttttttat ttcaactccg gttttatcgt     86580
     taccgcaaca atttcatatg gatttcctaa cctcggaaat gctttttgat gaaggcttcc     86640
     cgcaccaagt cccgctgaaa ttatcattgt cttcccattt ttcgaatgct ctccgtatac     86700
     atactccggc aaaatggtcc gctgcggccc tggagcaatc gcgccaatat ttgtatatgg     86760
     tatacgcaca atcccaccat gcgtatgtcc acttaaggtt aaatcaaaat cattctccac     86820
     ataaagctta aaataatccg gcatatgcga caatagaact tgataatact gcgagtcttg     86880
     ctgcgtttgt atctccgcta aacctttctt ataataggaa tagtcataat ctaagttcgc     86940
     actactccgc aatccagaca tctgaaattt ctgccctccc acgtcgatag tagccgtttt     87000
     atcttctaag ttaaccacac ccattttttc taaaaaaggc ttgtagtcgt cttcataggc     87060
     atttttaaca tcatattcat ggttcccagg cgaaaaataa accggcgcaa tcttcgtaag     87120
     ctttttaata agctctttag gaacactatc cccttgccta tcaaaaagat ctccagtaat     87180
     cgcaatcaca tctggattta aattttccac tttatgtaac aatttttcat tcttatcgcc     87240
     aaattcacta aaatgcaaat ccgataattg cacaagttta atttcttttt caattttagt     87300
     agaactgact tcatattttt tcaccgtcaa cctagtccca agaaaccacc ccacgactaa     87360
     aagtacaatg ataatactga tcgctataat ccacttcatc tttaaagaca ttttttcacc     87420
     tctatgttgc tgttcccatt tattatcaat attttgtcat cctttaaacg ttatccctat     87480
     cattataacc tagattaagc gctgactcaa aatgcacgaa aaaatcaccc caagtctaat     87540
     aaaagaagaa aacggaaaaa acatcgggtt gacataaact tgataaggta tataattaac     87600
     ttataaaaac ttattaaaat ataaaataaa cttaaaataa attatctaag gtggcgaata     87660
     ttatgaacca aaaagaaaga atagtggagg aactgaagct gctagaaaac atgaaaacta     87720
     tctctcagga agaactcatg cagatttttt ccatttcaaa agatacagca aggcgcgaca     87780
     ttttaaaatt agtcgaaagc ggactcgcag aacgctatcc aggcggagtg tcactaccag     87840
     ttttaaaacc tcaaatagaa agctatacaa gcagattagt gaaacaaagt gaacagaaac     87900
     agaaaattgc ttatgtggct ggtaaagtga taaaagatca tatgactatc tatttagatg     87960
     tttcgaccac tgttcatttt ttggcttcag gccttgagca aaatgattta gtagtagtaa     88020
     ctaattctat ggacaatgcc atagcggcat ctcagaaaga agataacaaa gtatacttgc     88080
     tcggtggttt cttcaacttc caatcgcgcg tattatcagg cgaacccgtt ttaggccaac     88140
     ttcaacaatt caacttcgat gttgctttta ttggaggagc tgggctaaca gaagaaggtg     88200
     tcttttattc agaacttaca gatgtctata tgaaacaaga gattatcaga aattctgaaa     88260
     aagtatacct attagttgat agtacgaaag tgaataaaaa gacagcattc aaaattgatt     88320
     tttctggaat tgatgccgta ataacagatg aacccttgcc aaaagattta atgcagcacc     88380
     ttatttctaa agaagtagaa gttatatctt tgaaaggatt gtgaaaataa tggccgttat     88440
     caaaaatgtg aaaatttaca aagaaaatga attaatcgat gcagtagtta ttacagaagg     88500
     aaatttgata aaagaagttt gttcaactac tcctgaaaag tattcagatg agccaacttt     88560
     tgatggaaat ggacgattgc taattcccgg aatgattgac gttcatattc atggggcaaa     88620
     aaattatgat atgatggatg gttcaacaga aagcattcaa gctgtatcta tggcttgtgc     88680
     ggaaacagga tgtactagtt ttttagtcac ctcggttagt tcttctttgg aagacttaat     88740
     tcaaatgatt agacaaacaa aaaaagtgat aggaaaagag aaaggtgcca aaattgcagg     88800
     aattcactta gaaggcccct accttaatat cgaaaaaaag ggcatgcaaa acccagccca     88860
     tttaagacac cctgacctaa aagaaatgaa aaagattttc gatgaagcag atggtcttat     88920
     taaaatggta accattgctc cagagttgcc cggaggtatc gaactcattg acttcttgaa     88980
     aaaaagaggc gtagttgttg caattgccca ctccaatgca acttatgaag aggcgcaaga     89040
     tgcctttgaa aaaggcgcat cgcatataac tcattgcttt aatgctatgc cggcaatcca     89100
     tcatagggca ccagggcttg tagcagcggc tttagaaaat gattcgataa gtgtccaagc     89160
     catcgtagac ggggtccacc ttcatcctgg gattgtgcgt ctcattcata aaattaaagg     89220
     acccgataaa atggttctca caaccgatgc ccttcaagct atgggagttg gcgacggcga     89280
     gtatattttt ggcggtcacc aagtaacggt tacagaagga gtggcacgct tacaagacgg     89340
     gacattagct tcaagtaccg tgacgatgaa taaatcttta agattaagta atgaatttgg     89400
     tattaacttg caagacacta tacaaatggc aacaagtaca cccgcagata ttttaggcat     89460
     gaaaaatttg ggccgaattg aaaaaggtta tagcgctgac ttggttttac ttgataaaaa     89520
     attcgaggtt ctaagtacgt ggattaacgg tgaaaaatac taaattggct ggatcaatat     89580
     tatcaaagga gtggattata acttatgccg ttattcaaac acgaaggaat tgattttaac     89640
     tatgaaatac aaggagaagg tatccccttt ttgtttcttc atggactagg tgataattta     89700
     aaatttgctt ttgaaacatt taataatgat gaaaaaatcc aactaatttc attggatcaa     89760
     agaggtcatg ggaaaagcgg acatgattcc agaaaactta gctacgaaag attggcaagt     89820
     gatgcattag cgttaatgga ttatttagga atacagcgtt tttatatcgg aggattatct     89880
     atgggggctg gtgtggcagt gaatttggca gtccatgcgg aaaataaagt gatgggactt     89940
     atattactta ggagttctgc gacagatgag ccgatgaaaa aagaagtgat agaatggttt     90000
     agtaccgtaa gtatgtattt acctaaaaaa aatggctcac agttatttga gcaagatcca     90060
     atatttccat cgataaaaga tacctatcct aaagcaattg atacttttaa gcgatatttt     90120
     gaagatgacg cctctgttaa ttactataaa aaatttatcg acattcctag agatagacca     90180
     ataaaatgca aaagcgaatt aactaattta acgattccca cacttatact tgcaaataac     90240
     tatgatgtga ttcacccgat agaatacagt ttattttatg cacgtaatat gaaaaaggcc     90300
     agttattatg aactcacccc taagactgtt gatgcagaga aacataaaat cgaaatagat     90360
     acctatataa atacattcat cctaagcaac tcaaaaaagt aatctacaat tccatagaaa     90420
     taaaaaagca gcaatcttgt atatgccatt gttggaaatg gctttataca aagatttctg     90480
     cttatttgtt attttacagg tggcgtagaa acaatcgctg tgatttggcc agttatttcc     90540
     caagatttca cttcatttgg taaaacgaaa tgatcccctt ttttaatagc ctgttcgtcg     90600
     ccatcaatcg taagaaccgc ttccccatct aaaatactca ctaacgtgta aggcgctttg     90660
     gctacgaatt cagccttgcc atccacatcc catttataaa cgctaaagaa gtcattcgaa     90720
     acaaaagtcg tttctgtcaa accgccacga gtttcagtat gaatatctaa cttcgcatcc     90780
     acatgcgggg cagtcgtaac gtcaatagct ttatctaaat gaagttcgcg caagtttcct     90840
     tctgcgtctt tacgatcata gtcatataca cgataagtag tatcagagct ttgttgtgtt     90900
     tcaagcacta acgtccccgt acctaacgca tgaattgtac cgcttggaac ataataaaat     90960
     tcacctggtt taattgccac tttacgaagc aatttatccc attcgccgtt ttttgcccaa     91020
     gtagcgaact cttctctgct agctgctttg tgaccatata ttaattccgc accaggagca     91080
     cagtcaataa tataccagca ttccgttttg ccaagttcgc cgttttcatg tactttcgca     91140
     tattcgtcat ttggatgaac ttgtacagaa aggtccgtat tcgcatccaa aattttcgtt     91200
     aatagcggga aaactgcttc tttcggatta ccaaaaagtg caggattttc ttgccataat     91260
     tcagctaatg ttttgccttt atattcgccg tttttgatta cggaaggacc attcggatga     91320
     gcggaaatcg cccagtcttc ccccgtagta ttagacggga tatcgtaacc aaaataatca     91380
     tgtaatttcg ttccacccca aattcggtct tgaaaaacag ggtttaaaaa taatgcttct     91440
     gtcattataa aattacctcc attccagcgt ttttgctggg ttttgtcaat taaaagtata     91500
     tactaataat ggcgaagatg ctagttattt cccgcctaaa aaacctcttt cttttatttg     91560
     ttcggttaaa tttgggtaat aaggtctgtc ataaaatttg gctaaccgtt cggtataaga     91620
     aacaaagcct tctcgctctg aaaacggaat aatctcttgg tcatatgctt ctagtaaagg     91680
     catgacatct gtttggtacg tctcttcaaa ataaactgct tcttttggca aacgaggttt     91740
     tacaggcgct tcgacatccg gaacgccaat acaaagtccg acaaccggca tgacgaattc     91800
     tggtaaattt agaaatccag cggttgccgt aatatttcta cgcaagccgc caatacaaat     91860
     cgtcccgtaa tcaagcgact cagcagctgt taaagcattt tgcatacaaa gcccgatgtc     91920
     tgttgccgca accattagta aatcttcttc cccagcaatt tggaaacttt taccgtgcat     91980
     gtcactcgca acttttacac ggtgaaaatc tgccacaaaa caaagaaaaa cagaacattc     92040
     tgctatgtaa ggttgatttc cgcaaagttc ggccatttta tttttacgtt cttggtcttt     92100
     aatcgcaata atggaatagt gttgaccgtt aatccacgac ggggccgctt gagctgctcg     92160
     gataatcgca tctagttttt cttccggaat ctcgacccct tttttatatt tacgaaaaga     92220
     gcgatgattt cttagcaaag ttaatacgtc attcatcttt atgcctccta gatttatcat     92280
     ttagttaaag tatagcttgt ttttaagcaa ttgttaatgt tttctcttgt atttctgcca     92340
     gatattttct acacttaaag aaaaagaggt gaaaagatgt gcgccaacaa caaatagatt     92400
     ttaaatggct tgaagaaaac ttcctgactg cgaatgaagc cgcgacttac ttaggcatat     92460
     ctaagcaagc actcctttcc ttagcgaaac gcgatgtact tccctttacg aaaaaaggaa     92520
     atatggttct tttccaccga atggacattg aacttcggct tgaaaaacaa caaagcttgc     92580
     gcgaaaaata ccgtccattt gaaacatgaa tttcacaaac agcgaaacgg acgaactact     92640
     ttccatatgt tacactttag ttagtgatat tctaaacaag gagtgataca taatgaatga     92700
     agcagtaaaa acgttagacg gttggttttg tttacatgat tttcgttcga ttgattgggc     92760
     tgcatggcgt gaattaaatc caggtaatca ggaacttatg ttaaatgaac taagccattt     92820
     tttaagcgat atggaaatta ctaaaaatat cggtgaagga gaacatacca tttacagcat     92880
     tcttggtcaa aaagcagatt tagtattctt cactttgcgt gattcccttg aagcgctaaa     92940
     tgaagtcgaa aatcgtttta ataaattagc gattgccgat tacttattac caacttattc     93000
     ctatatatct gtggtggaac tgagcaacta tcttgcgtct cacatggctg gcggtgacga     93060
     tccttatcaa aataaaggtg ttcgcgcgag actctatcct gcacttccgc ctaaaaagca     93120
     tatttgtttc tacccaatga gtaaaaaaag ggatggcgct gataattggt acatgcttcc     93180
     aatggaagaa cgccaacaac ttattcgcga ccacggcttg attggcagaa gctatgctgg     93240
     caaagtacaa caaatcattg gtggctccat tggatttgat gattatgaat ggggcgtcac     93300
     tttgttctct gatgatgcac tggagttcaa acgcatcgta acggaaatgc gctttgatga     93360
     agcaagtgct cgttatgccg aatttggctc tttctttatt ggaaacctgt tactatccga     93420
     gcaactttct aaattattta ctatttaata taagtaaaaa ctggaattca atctaacaaa     93480
     tgactgattt tgttagctgg attccagttt ttttatttca ctaaactaac aattttgtaa     93540
     ggatatctac cataaatgtc atttgatacg atggaacgag tcctatatac acgatagaat     93600
     gatacatata ctaaccgaat ctagttttat aaggagagaa aataatggag acagttttac     93660
     aagcaaaaaa tgtgagaaaa atatacggta gcaagggaaa tgtctacact gcactagaaa     93720
     atatcagtat cgatattaaa gaaggtgaat ttactggaat tatgggacca tctggggctg     93780
     gtaaatccac gttactaaat gtcttatcta ctattgataa accgacttct ggtcagattg     93840
     tgatttccgg acaagaactc gaaaacatga atgaacaaca aatgtccact ttccgacgtg     93900
     acaaactagg ttttatattc caagattaca acttactaga cacattaact atccgtgaaa     93960
     atattatcct tcctctcgca ctagcgaaac gcccagtaaa agaaatggaa gagaaattag     94020
     caattatcag tgaaaaattc ggtattacag aaatccttga taaatatcca agcgagattt     94080
     caggtggtca aaagcaacgt actgcagctt ccagagcaat tattacatcc ccaagtttaa     94140
     tttttgccga tgagccaacc ggtgcacttg attctaaatc agctaccaat ttacttgaaa     94200
     gcctacgtga cttaaatgaa caagataaat caacgatcat gatggtaaca catgatgctt     94260
     ttgcagcaag tttctgtaaa cgaattttat ttattaaaga cggagaatta tacacagaaa     94320
     tctatcgtgg aactaaaacg cgtaaggagt tcttccaaaa aattctagac gtccttgcaa     94380
     aactgggggg cgactcagat gacgttattt gatttagcta agaaaaatat tcgacataat     94440
     tttgtccatt actttttata ttttgcatct atgattttca gtattatgat ttattttaca     94500
     ttccttgttc tttcgaaaga tccatctgtt gtagctagaa ttgaccaatc ggctaaatta     94560
     tctactgcat tttcaagctc atcagtcatt ctacttattt ttgtagcgat ttttatcctt     94620
     tattccaata atttctttac ccgaaaaaga aaaaaagaaa ttggtcttta ttctttactc     94680
     ggccttcgta aaaaagaaat tggtcgcatg ttgttttatg aaaattttat tatgggactt     94740
     ggcgcattaa tcatcggtat tattgccggt acattacttt ccaagctttt tgtaaccatt     94800
     ttacttaact taattaatct tgatagtatt ggtggttttg ccttttcatg ggcagcagta     94860
     atacaaacga gtattgtctt tattatcatc acgttattta catcgtttac tggttaccgt     94920
     attatttacc gcaccacttt acttgattta ttccactcag aatcaaaacg cgaaaaaagt     94980
     ccaaaacctt ctttcatctt agcgttactt tcgattttat taattggttt aggctatttt     95040
     atcgctggac aaccacttga ttctaaaggc tctatttggg cacaacttgg cttttctatt     95100
     ggggcactag ttattttagc ttcggtaatc attggtactg cacttttcat tacctttttc     95160
     ttaccgtacc tactaacaaa acttagaaat aacaaacgta ttttctataa aggtagtaat     95220
     attatctcga cctcgcaatt agcctttaga atatcatcca atgcgaaaac cttgatcatt     95280
     atttctattt taagtgcaac aaccctttct gctataggta caataagcag tgtgtattat     95340
     caagcaaata catccgcaag cacgtccgct ccatctagct ttgaatatga aatacctaaa     95400
     gatagtgaaa caaacaataa aatcatcgaa actgcagaaa gtgaccctga tcatccagta     95460
     gagtttaaac aaaaaagcac ttactatatc gttaaagcag agggagctcg tccagacttt     95520
     gtagaatacg atataaacga gggttttcca gttatttccg aatctgatta taattctctc     95580
     gtaaaagaac aaggaacacc tgaaaaagca gctagcctca aaggaaacga agcacaaatg     95640
     gtactaacta ttacttatga tgaggatgct caaaaagaaa tggttggtga aaaattcaca     95700
     cttgcttcgc cgaataaacc aaatattaag attaaatctg tcgttcaaaa ctcaccaata     95760
     agtactattc caggcttact cgtacttcca gacagccaag tagctaagat agcagcagat     95820
     tcttcaattg ctgctcacag tgtcgaatcc atttcagtta aagatgcgaa acaagcacaa     95880
     gcattagata agaagatgcg tgctgttatt ccaaaagata cgaatttcat ttcttatact     95940
     aagatgtacc aagaaattat tactgtcact ggagttcttc tctttatcgg tatgttcatt     96000
     ggttttgtgt tcttagcagc aacaggaagc attatctact tcaagcagct aacagaagcg     96060
     tataacgata ttggtacttt tgatatcttg aaaaaaattg gtcttacacg tagagacatt     96120
     cgtaaagtcc ttgctaaaca gctattagtt gtattcttaa ttccgctaat cattggtatc     96180
     gcccatagta gttttgcact tctcggactt tcacatatgt tagcacttga tttaactttg     96240
     ccagttgtta tttctactgg agtttataca ttaatgtata ttgtttacta ttttgttacc     96300
     ttaaatagtt acacaaatat cgttttcggc aaaaaataat aaaaagaagc cctctaacct     96360
     taattagagg gcttcttttt attatttttt cgcaatatac ccaaagatac tagatagaaa     96420
     agcagaagct cccatgagga actgcatacc aaacacttct cgttcattac taccaaatgt     96480
     aatagataaa ttttctttag caaaatcaat ccaatttgtc acggataaat aatttgtcag     96540
     taaaataaaa gctgcaccca ttaaaatacc aactaataga tacgaaactt tacgccaaga     96600
     aaagattacc actagaagaa atatgacagc cataaagcat gcaaaatatc catctaatgc     96660
     tgttgtaaat aaataacctt ctttaatatt gtccgaatgt aattgtctaa aaatagttac     96720
     tgcagcaaaa accgatgtca ctgcaccaag aagcgagaaa acacctgcag cataacgcca     96780
     tttcgttttc cacgcttgat ctgcttgtat ttcttttgct tgaaatattg gtccaataag     96840
     taatgcaatt aatactaaaa gtcccaaaat acataataaa gttcctgacc attcaaacgg     96900
     ctgtgtgtac tctaattttg aaagaactcg gagctgataa taatataccg aaaatccttg     96960
     gaataaaacg aaacacataa cgccaataat acttgcaagg cgaaaacttt cttttctcat     97020
     aaaggcaaaa ccaataataa aaagtcctac accaaaaaat aataacatcc aataattcca     97080
     tacaaagaca aaactatttt cttctgcatt aaaataacca ataaccgcac taataaaact     97140
     atataattgc gtaataccaa gagcgattag caaactaccg catattcctc tccatttact     97200
     aggcaattcg cccacttcct tcctatttat gccttgccat gttaccctaa gagtgaggtg     97260
     ataaaaatga actggaccat ttgggataaa agtcaaaaag tcccgtacac tctgctttta     97320
     gaggccgatc ctagtgaaaa acaaattgca aaatacttgg ataaatccca tgtttttcaa     97380
     ttaatgcacg atgatattgt tatcggcatc atttgtctat tcccactaaa taatgaccaa     97440
     ctcgaaataa tgaatattgc tgtttcttca gattacagaa atcaaggtat tggtaaaaaa     97500
     ctactcgaaa aagcttttga ttatgcaatt cataaacact ttataaaaat catcgttaaa     97560
     actggaaatt ctagtattga ccaacttgcc ttttatcaaa aaaatggttt tcggatgcag     97620
     catattattc caaattattt tactgaaaat tatcctaatc aaacaattac cgaaaacggc     97680
     attgtttgct tagatcaaat cattctatta aaagaaataa aatcctgatg aaatttatca     97740
     tcaggatttt ttgtttgttg ttttaatcgt taagtgccat ttctgaacga acaaccgctg     97800
     aaatacgttc acaatattcg tctgtttctt ctttcgtagc agcttctacc atcactctca     97860
     ctaatggttc tgtaccagat gggcgaacaa gaactcgacc attaccagcc atttcagctt     97920
     ctacttcatc gattacttta cttactttcg gattatccgt tacatggttt ttatcactta     97980
     cacgaatatt ttctaatttt tgcgggaatg ttttcatttc agccgcaagc tcagataatt     98040
     ttttcccagt tgctttcatc acgttgatta attggattcc tgaaagaagt ccatcaccag     98100
     ttgtattatg atctaagaaa ataatgtggc cagattgttc tccgccaaga ttataattac     98160
     cttcacgcat agcttcaact acataacggt caccaacagc agtttgtaca tcttcaattt     98220
     caagctcttt caagcctttg tagaaaccta gattactcat gacagtggat acaatcgtgt     98280
     tgttatttaa taagccttgt tcacgtaaat atttcgcgca aataaacata attttatctc     98340
     catcgacaat ttgaccaatt tcgtcaatcg caataacacg gtcgccgtcg ccatcaaaag     98400
     ctaaaccaac atctgctttt ttatctaaaa caaaggccgc tagtgcttct ggatgtgtag     98460
     atccaacgcc atcattgata tttaaaccgt ttggagaagc tcccatcgaa ctaatatccg     98520
     catctaaatc tgcaaataaa tgcgttgcaa gacctgaagt tgcaccattc gcacaatcaa     98580
     gtgcaatgtg atagccatta aaatcatttt cgattgtttg ttttaagtat tgaatatatt     98640
     tttgtttacc ttcaaaataa tcgctaaccg tcccaagccc ttcaccactt ggtcgaggta     98700
     gcgtatcttc tgctgtatca agaagttgtt caatttcttc ttcctgatca tcggacaatt     98760
     taaagccatc agaaccaaaa aatttaatac cgttatcatc tactggatta tggctggcgg     98820
     agatcattac gctggcagaa gcgccttgtg cttttgttaa ataagctaca cctggtgtgg     98880
     agataactcc tagacgcatt acttcaatcc ctacagaaac aagtcctgca attaaagcgg     98940
     attcaagcat ttctccagat atacgtgtat cccgagctac aagtacacgt ggatgttccc     99000
     ctacatgacg ggttaaaaca tacccaccca ttctacctaa tctgaatgca agttctggtg     99060
     ttaattcaga gtttgcaaca cctctaactc catccgtacc gaaatattta cccatttcat     99120
     tactctcctt ctaagtcatt cattatctaa atgatttttg tttgtcattt catcattact     99180
     ttgtcaaata ctggttctat ctttactaat ctcaaccata catttgttat tatacctttt     99240
     ttaagagaaa atttcatctc tctgcaataa aacgttggta ttacttgctt tttcactatt     99300
     ctatgtataa aaagttcttt gccaaaaagg aggagtatga gactagcgcc ccacactcct     99360
     tattttatgt gcttttggaa ggtacttcaa tggatgcctc tttatccgta ataatgaaat     99420
     cagcttgtct agggttaata acataggcaa cattgtccgg taagccattc aattctagtg     99480
     gaatactgta acttcctgct ttgcttttac tcagattggc aatcacactc aagtctttcg     99540
     ccgcaattcc gtctactgtt ttcttctctc cagttatcgt cacagatact tttccatttg     99600
     caggagttat catttgtgca tcaaaagtat ttttcaaccc actcatgtac acttgcatat     99660
     tagaaaacga cttggatatt tttgtattgt tatctcctga atcatcagtg ttgttatccg     99720
     ttgtatctgt gtcttggtta ttactatctg aggttgttgg attgttattt gcttcagact     99780
     tttttacggt cttaatcttc acctctatcg tcgttggttg gactgatttg gctccagttg     99840
     gaactgggac agtcacttct ttgacggtat ctgctttgat tttagaaaca tcaattggaa     99900
     tttcaatttc tttaattttt tcaaggaccg catcatcacc gacaactacc acttctgact     99960
     tatcgggagt catgctagaa atttcaatat cactttccgg cgtgccttct tgcttaattt    100020
     tcactggaac tgacttgccg actttttcaa ctggcacggt cacttccact tcttgcggat    100080
     ttacttctac atctagcttg ttcaaattgc tatcaaaaac agagacggtg gccttatcgg    100140
     taaattcgga tttatgtttg ccatcacttt cgagtgttgc ttttacataa gcaatttgtt    100200
     cgatagtatc ttttgcacca gtaatagaga cttttttagg atcaatgatt ggtgttccag    100260
     cttgataacc atctgcaacg actgatttgc tcaattctac atcaacagag aattttttcg    100320
     ttactttttc ttgtacattt acgttgactg ttgctggatt cacttttact tttaggcggt    100380
     cagatacatc tttcacttgt agttttactt cttgcgtgcc aatggaggca tttttcaaat    100440
     ctgcgtatac ggtaaagtct tgttgagctt tagcagattg aacgatgctt cgaggccctg    100500
     aaagcgttac agtaacggtt tctggaatac ccgaaatata taaattcgtt ttatcataat    100560
     atactttgac tgggacattc tcgatgactt ctgaatcact agaagacgtc gtagaaaaag    100620
     tcgtggcgtt attattattt gcattaactg atgtaaaaag gatggctgcg agtagtaagg    100680
     ctataattcg aatcgaccat ttattattta aaattcgatc catcattcgc ttttgcctcc    100740
     tttccattta gaaaagatag aaggtttctt tgcagttact gtgactagtt ctttaagaag    100800
     aattttatgt aactcttctt cagacacatc acggaaaagt tctccacctt tagttaggga    100860
     aattccgcca gtctcttcag aaactacaat cgtaatacta tctgtcactt cactaatccc    100920
     aagtgcagcc cggtgacgcg ttccaagttc tttggataag aacgggctat ctgaaagtgg    100980
     caagtaactt gctgccgatg caatttcgtt tcctttaata ataactgctc catcatgaag    101040
     cggtgtattc ggaataaaaa tattaattaa taattgagaa gaaatttttg catttaacgg    101100
     aatacctgtt tcaatataat cgtccatgcc tgtatcgcgt gccactgaaa tcagtgcccc    101160
     aattcgacgt tttgccatat attgggtgga tttttcgata gactcgatta aatgatgctg    101220
     ttcacgctca attcttgatc cataacgagt aaaaatatta cctcgtccaa gcgtttctaa    101280
     agcacggcgt aattccggtt ggaagataat tataattgca aggaatcccc aagtaagcat    101340
     ctgatccgta atccattcta ctgtttggag accaaaaaat ccgcttaata gtttgactgc    101400
     aatgataata aaaatgcctt ttagtaattg tactgctttt gtacctcgga ttaacatgat    101460
     cactttataa attacaaacc atacgacaag aatatctaca atatttgcta gataatgcaa    101520
     tatcgacata ttggaaaaat ccatcacttc acctccgtgc ctcttgaaaa ccatttataa    101580
     tcacatggtt cactttcttt attatagcat aagagtgcag gtggaaaaag caatcgtcac    101640
     gccaaaaatt ggaaagattt gttaaagaaa aaacttgttg gaaacatgtg ttatcgtttc    101700
     caacaagtac tattgtcctt atatttctac tattaccgct gtttctagca aataattttt    101760
     cttatacatt tctaaattaa tagcttctcc atggcataat tttacagtta cttgtccaac    101820
     ttccactttc acttctaaca aacgatcacg gaagttaatt ttgaatcggt aattatccca    101880
     accatttggt aagaatggtg caaagcttaa cttaccagat gttactcgca taccagcaaa    101940
     gccttgaacg atggataacc agcttcctgc catagaggta atgtgcagtc cgtcttctgt    102000
     atcgttgtta atattgtcaa gatctagtct tgcagttcgc ttgtaaagtt ctactgcttt    102060
     atcatattta ccaagttctg aagctaacac cgcgtgaaca gctggtgata agctagattc    102120
     gtgtactgtt agtggctcat aaaattcaaa gttgcgttgt ttcgtatcaa agtcaaagtc    102180
     atcatagaat aaatataaac cttgaagtac atcggcttgt ttaatgaagc aagaacgtaa    102240
     aattttatcc caagaccaat tttggttaat tggcatatct tctggtttta atgtatccgt    102300
     ggaacgcaat tctttatcta aaaaagtatc gtgttgcaca aaaatctgcc atttttcatc    102360
     aaaaggataa tacatgcgat gctcgatatc ttcccatttt gcgatttcgt actcggtcac    102420
     gcctaaacgt tttttcgctt ctgcatctaa attctctagc gtataacgaa tcgtccaagc    102480
     ggcaatatag tttgtatacc agttattgct gacgttatta tcgtattcgt ttggtcctgt    102540
     tacaccgtga atcatgtatt tatctaaacg gtcagataaa tgcacacggt cggcccaaaa    102600
     acgagtgatt tcggttaata cttcgattcc atctgttttt aaatacgaat catcgccagt    102660
     gtagtttgta taattataaa tcgcataagc aattgcgcca ttacggtgaa tttcttcaaa    102720
     tgtaatttcc cattcattat gacactcgac tccggtaaaa gttaccatcg gatacagtgc    102780
     gccatctagg ccgattttct gcgcgttaat tttcgctcca tccaattgat catggcgata    102840
     tttgagtaaa ttatggctta cagatttgtc cgtcagcgat aaatacattg gtagtgcaaa    102900
     tgcttctgta tcccagtatg tcgcaccgcc atatttttca ccagtaaatc ctttagggcc    102960
     aatatttagt ctggcatctt cgccgtaata agtcgcaaat aattggaaaa tgttaaagcg    103020
     gattccttgt tgagcggaat catctccaga aacttccaca tctgctttgt cccagcgttc    103080
     gcgccagccc gcaacatgcg ctgttaatag ttcttcgtat gtttttattt ctaagctttg    103140
     taagattttt tctccagccg gaagaatgtc ctcttcctca aaatcacgag atgttgtaat    103200
     gactacacgt ttttcgattt tagctacttc attttcttgc aaatcgaatt gaaaatgatt    103260
     ttcggtataa agagcttttg tttggtttgt ttcgtttgcc gcattggtct tattttccat    103320
     caccgcagaa acagtaaaac gtggcgttcc gaagttattt ggaatagttt ttgttacaag    103380
     tgaaccacga cttgctgatg aagctttttc gacttcttgc cagaacattt cttcatagtt    103440
     ggcatcttcg ttttgcacat taccatctaa aaaggacgtt aattccactt ttgcggagct    103500
     taatgcttcc acttggtagt gaataaccgc aagttctttc gttgcaacac taaggaatcg    103560
     ttccgcagaa atccggaatg ttttattatt tttaactacc gtgaattgtc gtcttaaaac    103620
     gcctttttcc atatctaatt ctagttcaaa atcgcttact tcatctacaa ataaatcgag    103680
     tttttcacca tcaagacgta cttcaattcc gataaagtta aggccgttaa tgactttacc    103740
     gaaataatct gggtagccat ttttccacca gccaactctt gttttatctg gaaaccacac    103800
     gcctgcataa taagttccaa tatggccgtc gccggaatat ccttcttcaa aattcccgcg    103860
     catccccatg taaccattac cgagtgaagt taggctttct tgcaaacgtt tattttcttt    103920
     atctagtttg gttgtccgta atgtccatgg ttcgatttca aataattgct tctgtgccat    103980
     actaaaacct cctaattagc gactagcagc catacttttt tcactagtct tataaaatct    104040
     tgttttcaaa aatgtccatg ctatcattaa caccattccg agcgactgaa cagccataat    104100
     aatcgtaata tcaaagtaga taaagccgat aatacatgcc gcaatcaccg gaattcccag    104160
     tgcatttagc gttaaattta ctgattcttt aaaagaagca atgcttgaaa aactgctccg    104220
     ttttgtcatc caaatgaaaa gtgtcgtaaa tacggttaac atgagtgagc taacgaaaat    104280
     aatagaacca atcatcagca ccatcgatag gaaaacaaat gcttggtttt ccaaatacca    104340
     ctgcgccgac acccaatcaa cgagcgactc gcctgacgtt atttcgctta aggtagcatc    104400
     ttttggatag cttacttcaa aattgtaacc actcgcatct gtaagcgtca tttcttggtc    104460
     tttgaaatta attacattct tcgctccact aagttctgct ttcgttaaat tcacaccagc    104520
     aacaccattc actgtttttt caacgatgtg cgcattttta tcggttaacg ccccgttttc    104580
     gagcgtcagc ccactaattt ttgacgccaa ttgatccgtg cccagcgtcg ccatttttgg    104640
     cattaaactt ggtaaatcaa agcttgactg attggcaaag tgcgcggaaa caggaagcaa    104700
     taggagcgca tttaagaaaa taaacacgat gaccatttgc cagaatttca gtactttccg    104760
     accttcgaaa atcgctgttg gtccaagcgt gctttttaca tattgaatga taaacggaat    104820
     ttttttcatt ggtatcacag cctttttaaa aatcaattat ccttttgttc caccggcagt    104880
     taagccagaa acaaaattct tttgtaagaa gaagaacagt aaacaaattg gtagcgcggc    104940
     taaaatggca cccgctgcga ataaggctac tttttgttgt tgtgggttgg cgataaacgt    105000
     ttgaagtcct accgcaatcg ttaagttttc tggggttcta agtaggaatt tcgcaagtag    105060
     gaagtcccca aacggtccca taaacgccca taaagcttga accgcaatca tcggtctaac    105120
     aagtggcaag atgatttgag cgaaaatccg gaaatgtcct gcgccatcaa gtttggcgga    105180
     ttcatccaga tcacgcggca cagtatcaaa gtaccctttc atcagccatg tgttcattgg    105240
     aatcccacca ccgatgtaaa tcaatgttaa gaaccaatat tgatcaagtg cacctagtag    105300
     cattgctaac acgtagaaag ctgttagggc tgccattgtt ggcaccattt gaataataag    105360
     gaagaaaatt aagctatttt tacgaccttt aaaacggtaa cggctatatg tataaccggc    105420
     aagtgtcaca atcgttactt gcataatcat cgttacaacc gcgataatca gtgtattttt    105480
     gtaccaatca agatataacg tttcattaaa taatcttgta aagttattca gcgtccagct    105540
     atccgaccac tcaagcgtaa acgccgcgat attccctggt ttgaaggcag aagatgcagt    105600
     tattagaatc ggatacaaaa taataatcgt tagcacggtt aaaaacaaat acgtgaaaaa    105660
     ctgtgttaaa aactttgttg tccgctgatc tttcataaag tctctcattt acatcatctc    105720
     ctcgttccca aaggcatttg tcttcttaaa ggcaatcatc gaaactgtaa taacgataat    105780
     ggagataaga agcgtcacag cagcggctac agcgtattgt ggcgaagtac ctgttgttaa    105840
     tttataaatc catgaaatta agatatcggt tgatcctgcg cctgctccga cacttccggg    105900
     accaccttca ttgaataagt atattatcga aaagttattg aagttaaatg tatattgcgt    105960
     aataaatacc ggtgcggtta caaataaaat catcggtaat gtaattttgc ggaaacgttg    106020
     aatcgcactt gctccatcaa ttctagctgc ttcgtatagt tcaccaggaa tcgcttgaag    106080
     caccccagta accataacgt aaatatacgg aaaaccaagc caaccttgaa tactaatcag    106140
     cgctactttt gtccagaaag gatctgtttt ccaagcaatc gcattgatat caatgaacgg    106200
     aagatggttt aatagcggga taacttgtga attaatcgcc ccgatactat cgttaaacat    106260
     attagaaaaa ctcataatcg taataaaagc tggtaccgcc caaggaagta agaaaactac    106320
     tccaaaaaga cgtttccctt taataaagct ttggttggca acaatcgctg taaatacccc    106380
     aacgacaatt tgtaaagaag tcgcacagat cgtccaaatc agtgtccacg agaatacgct    106440
     gaggaacgtg tcccgatacg aacttaggaa gaaaatatta aagaagttct taaacccaac    106500
     ccagtcaatt aagttcgctg gcggaatatg gtaaaaatca tagttcgtaa atgccatgaa    106560
     aagcgttaca agaactggga aaataatcac aaaagtcatc actaggtaag cgggtagtgt    106620
     aagtaaatac gggaaacctt tgtcgagcat attttttata atagcaagag cggaacggtt    106680
     aacagtttca cctaggttcc actgcatagc cacgcgtctt gcatcgaaaa tatttataaa    106740
     ccaaaagcct ataaatagta atgtcacaat taattgtaaa gtaccttcaa tcattaaaaa    106800
     taaggaatgg tctacacctg gcacagatcc aagtgttaca aggccaatca gtgcattcag    106860
     cccaactgca aaaaattcta tgataaacaa agcaaatagt gcgaaaaaga caatcccttt    106920
     aaaattttgc ttattataaa attgaccaag tcccggaatg attgataaca aagtcgcttg    106980
     acgaacattt ttaatttgtt tttgttctag tttcattttg ttaccctcaa ttctagatat    107040
     agattcacta gctaagttaa aaaaatggcg gggcgcgcta cctttgcccc gccaattccc    107100
     tattatttag tatatttttg cgttacattg tcttcaatta cttttactgc atcatccgct    107160
     gattgttgcg gtgttttcga accagaagct gcatcaaaca ttaagttttc ggcacctgtc    107220
     caaacttccg acatttctgg aatattaggc attggttgcg catttttgta ttgttcgata    107280
     acagcattag ttaactcatc atttttcgat ttcgctgtat cacgagcttt taagttagcc    107340
     ggtacttcat ttgtcatatc atataaagtt tcttggtttt tttggttagt tacataatcc    107400
     aaccattttt gagctacatc tttattttta gaatagttac ttacaaccca acctttaccg    107460
     cctgcaaaag gagaatactc tttgccattg ttaagtgtcg ggatttttgc tacgccgtaa    107520
     ttaatttttg cttctttgta atttgctgct gaccatggac cgcctagaat agctgctgct    107580
     ttacctttaa caaattgatc ttggataaag tcatctgcac tcttattgtc ttgcatacct    107640
     tttggccata catcttggaa ccattttgtt gcataagtaa ttccttcaac cgaaccttta    107700
     ttgtttaaac cgatgtcttt tggatttgta ccttcatcgc cgaatacata accaccgtat    107760
     cctgcaagta gtccgtaaga gaagtagaaa tcagtccatt ttgctaagaa accagtattt    107820
     tttccttttt cagaagtgaa ggcaaaacga gaatctttgg aaagtgtttc taaatcttta    107880
     aatgttgctg gagctttgtc gagtaaatct ttattatagt aaagtactag agtttcaata    107940
     atagctggag caccataaat tttatcgtca attgttactt gtttttggtc tttttcatcg    108000
     taatcatctt tatttcctag ttttacttct gccaaatgcc cttgctgacc taggcttccg    108060
     attctatcaa atgcggacat cattacgtct ggagcagttc cagcaggccc gtcaagcgga    108120
     agagcttcta atgtttcaaa catatctttt tcgacaactt ttacttttac gtcattatct    108180
     ttttcaaaat caccttttat tttgttcacg tagtctttgt agcctgcgtc aacggaaaca    108240
     gttaatgttt tttcatcaga tgagcccgat ttgctagtat cttttccgcc accacatgct    108300
     gccaagctta aagccattac taaaaccgcc gaaactattc ccactttttt gaaacgcttc    108360
     atttactttt cctcctcttt atgaaaaaag tcgctcttta ctgtctgatt tataagtccc    108420
     tttctttttt caattctttt ttaaagtttg tgaattaggt taacctatgc atttattata    108480
     tgctgatttc gaaagcgttt acaaggagat ttcacatgtt accgataaca acatttttcc    108540
     ggtaaacatg tgaaaaattc ctttgcgcta ttgatttagc tgttttcttt aataacaaga    108600
     aatccttttg ccgggatagt tagattatca gatacagctt ggttattcca aatatctatc    108660
     gcggtattag caaatgaaat tgtgaaatcc tgatcttttt tcgtttgatt gaaaaggaaa    108720
     tgtagttttt caccatttaa ttctttagaa aatgcagtaa tgcccgtttc gctgcttgcc    108780
     tctaaccaag ttaactcacc ggatgtgata atagcttgat tatcttttct tagagcgatt    108840
     agttgttttg taaatgctag catatcttga ttttgttttg cttcgtccca ttccatacac    108900
     ttacggcaac ctgggtcatt tccgccgtcc atgccgattt ctgttccata ataaatacac    108960
     ggcgaaccag tgtgcgcgaa catgaaggca agcgcttgtt tcactttatc ctcatcgtta    109020
     ttagcacgtg ttaaaatacg cgctgtatca tggctatcaa gcatgttaaa catcacttca    109080
     ttcacttgat ttgggtagcg catatattgt tcattaatgc cagaaaccat ttgctctggg    109140
     gtaatttttt cttcaataaa gttctcaata atcgtttgtg taaatggata attcattacg    109200
     gcgtggaatt catctccaag tagccaaatc catgaatcat gccaaatttc accaagaata    109260
     taaatgtctt ctttttccgc ttgagccgcc ttcttaaact ctttccaaaa agcgtgatcc    109320
     acttcattag caacgtctaa acgccaaccg tcaatatcaa actcacgaat ccagtaagtc    109380
     gcaatatcca gtaaatactt ctgaacttct gggttagccg tatttaattt tggcatatgc    109440
     gttgtgaaag caaatgtatc ataagaaagt gttggttctc cttcgatatt gccattttca    109500
     ttttgacgaa ctgggaaact atgaatatgg aaccagtcgc gatacgctga tttttcttct    109560
     ttttcaacaa catcttgcca ctctggagaa gtatccccaa tatgattgaa caccgcatct    109620
     agcataatgc gaataccacg tttatgcgct tctttaacta attttctaaa agtttccttg    109680
     tctccaaagt gcggatcaat ttttttataa tcaattgtgt cgtatttgtg gttggtcggt    109740
     gcttcaaaaa caggcgttaa ataaacccca ttgataccaa gctctgctaa ataatctaag    109800
     tgctcgataa tcccttcaat atctccacca aaaaagtctg ttgtattcgg atctttactc    109860
     ccccacggca aggtattttc cggagaaata gctggattac cattcgcaaa acgttctggg    109920
     aaaatttggt accaaatggt atttctaacc cattcaggtg cctcaaatgt atctactgca    109980
     tggataaacg gaaatttaaa gtaataatcc atcgtagcta aattcgcctc ggtcggctca    110040
     aaaaaaccac gtccgccata aaatgttgtt tctccttcag tatcggttaa taaaaatcca    110100
     tattgaaggc gtctatgttc tggtgtaatt gcaaaaaacc aataatcatg ctcttctgtt    110160
     tctgcgattt tgcgcattgt atacgattca ctttgccatt ttccatcttt ccataagtaa    110220
     gggtcggcag caattagagt aaccttgcta atatccaagc gtttagttct aatccgaata    110280
     tgtagtgttt tagcgtcata actatatgca tagctactcg ccggttgatg gtaaatccct    110340
     gctttttcca ttttctctcc tcctatatca cctatcgttc tatttcaaat tagcatttcc    110400
     attaaagcgt ttgcaacctt ttctcgctcg ttaacggtaa caagattttt taactattta    110460
     acattctttc aacatattat agaagaaagc ctattctctc ttctccttta aagtgacaaa    110520
     ttagtaactt tactgattta aagtaaagag ctataataac tcatggacta atgaaatctt    110580
     tcgaaaaaag gtctaaaagg aggataaaat ggaaaatact ttaagcttta aaaaacaagg    110640
     gtattggtta ttttccagcg caatcattat tggtgttctt tttcttcttt tgccacacat    110700
     catttccaat attggagtgt tagaatttat aggtgctttt tttaatgccc tatgtatggg    110760
     ggttattgct tttatcatac taaaggcaga attccttgat tggtttaaac attttagttt    110820
     caaatggata attattggtg ctcctgcatt aattattatc agctctattt tcaacattgc    110880
     gtgggcttac ttcgcaggca gtactactga aaacggcatc aacagtgttc ttacatggac    110940
     ctacgttttt accagtattc catttatgtt acttggcgaa gaattgctat caattagctt    111000
     actatacgcc gcttggaaaa aatggaactg gaaattctgg caagcttcct tgctctgctc    111060
     tttactattt gcgacgtggc atctgacttc ctatgatttt aatttcttac aatgtatcat    111120
     tacattagca ccagctagac tcattttgaa ctacttattt aagaaaacaa actcggtttg    111180
     ggttactttc atcgttcact tcatttttga tttcattgca tttttgccaa ttttactcaa    111240
     ataaaaaaac gctaggaata cagattccta gcgtttttat tactcttctt ttccagttgt    111300
     agaggctctt atcagtaatt caggagtaaa taataggttt ccttgaggtt ttccatgatc    111360
     attaattttc gcaagtaaca tcttcgcgag ttcttccccc atctcgacga ccggagaacg    111420
     aacagttgta atttttggcg atgaaatcct atctaagaaa accccatcaa accctgttac    111480
     agcaatgttt tcgccaaatc gacgaccaaa agcagcggcg gcacgaacaa cccctatggc    111540
     aattcgatct gatgcgcaaa caatcgcaat tttttccgag ttataacgta gtaattcaaa    111600
     tgctttttct tccgcgatac tggaactatt cgcaataaaa tagctctccg gttccaaacc    111660
     atgttctttc actacttctt cataaccttc taggcgcgat ttcataaact gttcatctaa    111720
     taaattaatt cccaaaaaga cgattcgcga aaaaccgatc tctaccatat gctctgttgc    111780
     gagcgcagtt ccttttttat tatctacatc aatagaatca tagccacgtt tattttcacc    111840
     ataaaaaata actggtttat caatatctaa aagtcctaaa tcataatctt tgtcgcgtat    111900
     ccccgtaaca ataagcccgt cataagctcc gatatttctg gacctttgtg taacgagttg    111960
     caaagaataa taatacttat ctaactcacg actaatcccg gtcagtaagt tcatgtaata    112020
     tggttcaact gtatcaattt cttctaaaat caaaaacttt atgacttgtg tcctattttg    112080
     aacaagcgcc ctagcagcat aatttggtac atactctaag gcttccattg cactataaac    112140
     aagcattttc agttcatctg agacttgatc tggatgatta ataacccgtg aaactgtcat    112200
     tttggagaca tttgcccgtt tcgcaacatc tgctaaagtc gccatctcca acctcctcca    112260
     ttcataatct tccttattgt accatctttt acgcaaaaaa aaataagaat taatccacaa    112320
     aaaaagcatt ctctctaaaa gtccgaaaat gctttgttta ttatgattat gtaatgagtc    112380
     attttatagt gtttgccact ttttttgaga gactctgcgt tccttcgttt gttgataagt    112440
     tttgataacc aatctaatta actgatgagc accgccaata gtaattccaa tagcgatagc    112500
     aacaagcgta gttgtcagaa aactaataaa tggaaaacta gatgcattca ttgcagcaat    112560
     tcctaatata aaaataataa tagtaggtag tacataatac ctaatgtcct gctcctgcat    112620
     tccaagcgcc cctttaccaa aataataact cccatcaact actgaaatta taacgcgaaa    112680
     actggctttt ttcaaggctt ggatggattt ccatgctcct ctttaaaaac gttaaatggc    112740
     tctatatagc gctttctata gacacgcaaa atccactcat tatgaattca tcaaaaagaa    112800
     aaatttgtta ccactttgta acattactta agtccattta cttatataat gtaatactta    112860
     tatttattca attttataga taagtattaa ttcttatttc cattttttca agttttattg    112920
     cctatctttt tatagcatat acaaaaaaag tgtgctcttt tttctatcca tacattattt    112980
     ttaaaattgt gtaaaaaact tgattcgagc agttttttta attttctagg aaaacttggc    113040
     atttaaaatg cctttttcat ctaaaggaaa tttagttttt cgatgaatat tcttctttga    113100
     aatcaaaatt tccacttttt acaaataaat aaacaaccgt tatgattaca tcgttccatt    113160
     ataaaaacgg aagagctccc cctcttcccc cgaaggtctc ttccgttttt tctcttgtta    113220
     ttcttttaaa tgataaggat atgtggaaac tactacatcc cttttcatta gaagtcttgt    113280
     gcgaatcaat agacttgttt gattatgaag gacattttgc caaccttttc tagggatgaa    113340
     ttgcggtatt aaaaccgtga gcgaataatt gtcttgatct gctttttgtt tagctgtatc    113400
     aataaatttc attaatggat ctgagataga tcgatacgga gaaaacagat tagccatacg    113460
     cacttcagga tgcaccctat tccatctctc tacaaattct ttttcctgtt ttttatcaat    113520
     agaaatatga acagcaatga ctgtatcacc aatagactta gcatattgta atgcaccctc    113580
     tacaactttg gtggtatcag acacacaaat aatgacggca ttccctttaa agtccggcaa    113640
     gtccattgtt tcgtcaattc taagttgtgg tccaactttc cggtaatgat gtcttgtacg    113700
     atggaaaaca taaatcataa ttggcataaa gacaaatact ggccaaacag attcaattcg    113760
     agttaagaat aatactaata atactgtaaa tgaaattgat gctccaagta aattagccga    113820
     taatgatttt ttccaacctt tagggcgctg tttccaccat tttactatca tccccgtttg    113880
     agacaacgta aacggtatga acactccgac agagtataat ggaatcagta gttccgtttt    113940
     ccctttaaac aaaataatta gtaggataga acccaccgct aaagtaataa ttccattaga    114000
     gtagccaagt ctatctcctc ttgctaaata cattcttggc atgaatttat cttttgccaa    114060
     gttaaatgct aacatcggga atgcagaaaa tccggtatta gctgctaaaa ccaaaataag    114120
     tgccgtagtg gcttgaataa aataaaacat gaagtttctg ccaaatacat tttcagcaat    114180
     ttgagaaagc accgttacct ttagctccgg aacagttcca taaacaaaag caagtactgt    114240
     tattcctaca aagaagaaac caagcaagcc tgccattaat gttaatgttt ttgcggcatt    114300
     ttttggtcgt ggctctttaa ataaaggaac agcatttgag atagcttcga taccagttaa    114360
     agaagctgac ccagatgcaa atgctcttag taaaagaaaa atggttacac cctgtacgtg    114420
     agtccctact gcagctgttt catgacttgc atccatacca gttaatactt taaataaacc    114480
     tgtaaatata agagctataa tagaaaaaac aaataaatat actggtattg caagtaaact    114540
     agctgattca gtaattcctc tcagattgat aatcgttact ccaatgacaa gaactacagc    114600
     tataggcact gcaaacggat ataatgatgg aacagcagaa acgatcgcat ctgtcccaga    114660
     ggatacactt acagcaactg taagcatata atctactagt aaagatccac ctgcgattaa    114720
     accggcatta ttccccaaat tctctcttga aacaatataa gctcccccac catgcggata    114780
     tgagtatata atttgtttgt aagatagatt aagagcaaac aaaagaacaa gtacacaaag    114840
     cgcaattggt aatgaatacc acatagcggc agcactaaca gttacaagta ccaataagat    114900
     ctgttctgta ccatacgcaa tagaagaaag tgcatctgat gacagaactg ctaaagcttt    114960
     taatttcccc agtttttggt ctccagcttc tgatgttttc agagggcggc cgattaatag    115020
     tctttttagc ggcgaagcca ttgtattccc tacctttttt atttgatttt taactaactt    115080
     caagttgacc agacacatta tagcacagct gattttagat tgtaatacta atttgtatta    115140
     ttttagctga gtaattactt ttcaagtgaa taattgttca taatgcttgt tttcatgtct    115200
     ttaaaaagtg gaagtttatt tcacacgcct ttcaatatac atacccatta ataagataaa    115260
     taacccgttt tccaaactta tattttcaga aaaaaaagaa tttaatttgg gtatttacaa    115320
     atgacatctt ttttttatat aatagtttct agcggtaaaa aacttttatc atacggcccg    115380
     ttggtcaagc ggttaagaca ccgccctttc acggcggtaa cacgggttcg aatcccgtac    115440
     gggtcacttt ttaatcaaaa ataataactt caaaaatatt tttcactttt tttgaaaaaa    115500
     agctggtaaa attgattaaa atgttatatc atgtattagt atctgttttg aagaattaat    115560
     tatgcaagag atttcgattt gccagcagtg agagcgattc ttcgccgact tagctcaatc    115620
     tggtagagca actgaatcgt aatcagtagg ttgcgggttc aattcctgca gtcggcattt    115680
     tatagcggag gggtagcgaa gtggctaaac gcggcggact gtaaatccgc tccttcgggt    115740
     tcggtggttc gaatccactc ccctccacca ttttctatta ttgggctata gccaagcggt    115800
     aaggcaacgg attttgattc cgtcatgcgc tggttcgaat ccagctagcc cagtcatatt    115860
     tagagccgtt agctcagttg gtagagcatc tgacttttaa tcagagggtc gctggttcga    115920
     acccagcacg gctcatcctt tatgaaacaa gcgaagaaaa tactttgctt gtttttttat    115980
     ggtgtgaatt attttttccc tataaaaaaa gataaactat aaattaaata gtttatcttt    116040
     tactcaagta taattaaatc gtagttactt ctggttctat ttttccatat ttatccaaca    116100
     aaacaaaaga cttagaattt tctgctaaaa aacctgcttc aaccaatttt ctacaaagat    116160
     gagtgactga acgtaccgat aggttagaat aattagcaat aattttcttt gtgaaacatt    116220
     ttggaatgcg tagcacacct tccttttcat ttccaaaata tcttcccagc tgctctagag    116280
     actctttcaa acgattttct ccattaccac gcattaaatt acatttttca attaaaacat    116340
     tttcgtgatt tcgattatta agatataaat agagccaccc ctcttgcatc ccaataatcg    116400
     agcaaattat atcttcttta tcaaattcgt atgctgtaat tgtttcgata actctagcag    116460
     tgtataggtt tgcttctgcc ataaaataat cattcaatcc agcaatttgg tttgatccta    116520
     aaaaacttat aacattttta ttcttctcta atgaaactat ccctttttca ataaaataaa    116580
     cctttgtatt tattgtatct tctgttagta aaatcatgtt gcttggtatt cttgtttttt    116640
     tataagggat tctgttatca attaaagttt gcaagaagca tgtataacca aattcttctt    116700
     ccaaaatttt tttactatac aaatcttcaa atacggattg catttattgt catctcattt    116760
     ctattttgtg ttgttagcaa atagttttat aatgcaatga gtggcttctt acaagtgatg    116820
     atactaccaa acacttttaa aaggaaccca acaaaaaaac aaaacttcct gctttaacca    116880
     actatttttg acttttttgt cacaattgaa ttttattcac tttataaatt attgtataag    116940
     tttcttttga tacttctatt ataagacgaa gcacatttca tctacttttc taccaaaaaa    117000
     tttcatataa tagtttagta aaaacagtac cttcctaact acctttttag aagaataacc    117060
     tctatttttt agtgattatc gctatatttt gtattatttg tgaaagttat taattcgtgc    117120
     ttttattctt cctcgcttat gtttacgcag aaatgttctg ctagaagaat aagttttatg    117180
     cgcttatatt gcgggaaact aatggcatag gggggattgg tatgtattta aaagaaacgt    117240
     tagatcaatt tgcttcgata gataatattc ttaaactgct caagaaaaat ccgagtttta    117300
     ataagcactg tattcaagag cggctcccac aaaaaacaat catcacatcc aataaacaac    117360
     gaaaacatat ctatataata gaagaaggtt ttatgaaact aatatttgat gacaacaaac    117420
     cgcgtgattt ttcttatatt ttgtctaaag gagcgtttcc ctttttgcca gtttatatag    117480
     aggatatacc tgaacacaca atgatggttg ctcttacaga tattgtatgg tggaaaatcg    117540
     atattggttt ctttaagagc atgatggaga ttgaagatcc gcgaaattat ctcatgctcc    117600
     atcaattagc ggaaactaga agaagatttt acactatcgc ttatcaagaa aagttgactt    117660
     cacgtgaaag tatttattac tctttaagta cactaattga atttggctta cgtatctctg    117720
     aaaaagtagt agaacttcca gaatttttaa cctatcaaat acttgcggat catgctaata    117780
     cttctaaaag ctacacgtct aaagttctag gccatttacg tgaagatggc attttggaat    117840
     cacaaaaaaa gccttggcgc attaacgatg tccagaagct tcaaaaatta atagagatga    117900
     atgtaccact tgtaaagata caaaaaaaac taagagccga cttgcactct tagttttttt    117960
     atttagatta gttcacttcg ccaagctgta gtttttgctt gttggtattt ttctacttga    118020
     ccaatagact caaaaagtcc catcttatac ttcaccactt ctttcgccgc atcaatacag    118080
     tctgggtaga ttgcgtttgc atcccaaagt tctgttgtac ttagaatttc acgacatttc    118140
     ttataaaagg cgtatttgta atcgctggaa atatttactt tttgaattcc aatttcgaca    118200
     gccgcagcaa tttctgcatc tggatttgca gaaccaccgt gaagtacaag cggaatattc    118260
     actaaagctt ttatttcttt taagatatct agccgtaatt ttggctcttt atctttagga    118320
     taaatcccgt gtgctgtccc aatcgcaaca gctagcgtat ctacccccgt acggctgata    118380
     tattcttctg cttcttcggg ttttgtatag ataatctcac tgacgccgcc ttcaatactg    118440
     ttaccagttt tcccgatagt cccgagctct ccttcaactg aaacccccag tttatgacag    118500
     acatctacaa cctcctttgt aactcgaata ttttcttcaa aaggaagtaa agagccatca    118560
     atcatcactg aactaaaacc acaacgcacc gctcgcatca catctcccat attgtcacca    118620
     tgatctaaat gaaggacaaa tggaacagga ctatttttaa ttcttgcaag gacatattgg    118680
     aaaaaatcat ctttcgtaaa atctaattct gttggatgca cagcaataat tgctggagca    118740
     ttgttttttt cagcttcttc tactaccacc cgtaaaaagt tactgtctgc tacattaaat    118800
     gctcccaccg cgaatttgtt ttctttagct acttctaata attgtttcat atttactaac    118860
     atattttcat ttctcctttt aaagtgattt tccggttgaa ccggataagt gaatataata    118920
     tttaacagct tttgtgccgg cttttatcgt ttcatgaatt aagtccacat agttaacggc    118980
     cggactttct tttaagttag tttttatttg atttacttgc gctttcatga agtcggagcc    119040
     aacattgatt ttattgattc ctagtcgaac ggattctcga atgttttccg ccccgcaacc    119100
     agaacctccg tgcaaaacga gcggcatgtt tgtcgcggat ttgatttctc tgacaatatc    119160
     aaactgaaaa gctggtgtaa aaccttctgg ataatcacca tgggaagaac cataagaaat    119220
     tgctaaagcg tcaatccctg ttcgtttagc aaaatcgatg gccactttgg gatcagtata    119280
     catttcttga ttagtgtaat tatctcctgt caccgcgcca atattaccaa cttccgcctc    119340
     gacactcgca tgataaacct ccgcaaactc gaccattttt ttcgtaattg caacgttttc    119400
     ttcataagga aaactagacg catccatcat cacactagaa aaaccatccg ctaagcactg    119460
     cttcactatc gctacatcat gcccgtgatc caaattaatc gctacctcga cactcgcttc    119520
     ttctgccatt tttataatgg gttttgtcaa aaaacgactc cctagatgac ttgtcaaatg    119580
     gtcttgaagt aaatcaatga taattggcgc acgaagttct tgagcagcat caatgaccgc    119640
     acgagccgtt tccagattaa aacaattaat tgccattact gcataatgct ccttgttcgc    119700
     acgttctaac atacctttca tggaaacata catttcaaaa tctcctcacc ttatgaaatt    119760
     ttaattccag acagatcaac ttcatcttcc tcttctaatc cttggtcagc aatgagctct    119820
     tcttctttag taggttctcg tttcaagatg agtaacatgg ctgctgtgac acaagtacca    119880
     attaataatg ctaaacagaa taagagtggt tcattcattg ctgggacgat aaacattccg    119940
     cctgatggaa ctggtgagcc aattccccaa gtcatactaa gacctccgcc gactgccgca    120000
     ccaagtgtac aagaaataat aacgcgaatg gggtcgaccg ccgcaatggg aataacacct    120060
     tctgtaatca tacaaatccc catcgggaaa gcaattttga tattgtcttc ttctgacttc    120120
     gtgtattttt tctttttaat taatttggaa actacccatg aaagggtcac cccaaatggc    120180
     ggaaccatcg aagcaagaat ttttactgct tctggttctt tgacgccttc aagaagaagc    120240
     ccatctgcga ataaggaagc cactttattt acaggtccac caaagtcaaa tgccgccata    120300
     gctccaagta cagctccgaa aacaaagcgc atactgcctt gcataccttg taagaagctt    120360
     gtcatcgcct ccgtggccca aacgattgga acccctacaa caaagtacat cagaagcccg    120420
     acgactaaac tactaattag cggaataatc atcatcggca ttaaaccttg cgcccattta    120480
     ggcactttta aatatttcac aagaataagt acaaaataac cgactaagta tccaccgagc    120540
     attccgccta agaacccagc gccaatcgaa ttggcgataa gccccatgag taatcccggc    120600
     gcaattcctg gcctgtctgc tatcgaatag gcaatcgccc ctgcaataac tggtgcaagc    120660
     agtcccatac caagcacacc gagagagaca agagcatcag gaatggagta cggtgctttg    120720
     tagttttcaa taacttgtcc atttgttaaa tttccaatgg caataagtaa ccccgaggca    120780
     acaactaacg gtaacatata cgaaatcgct gtaagtgcat gttttttgat ttgcagtttt    120840
     ttcatcatac cggttcactc cctagttatt tatttctttg tctattttat taataatttg    120900
     ttttggtgct ttaatcgcta gatccgttgg aatttcgaca actcgttttc ctttaaaacg    120960
     atccttccca ctaattttaa tatcggcagc aataataact acatcggcat ttttcacttg    121020
     ttctgctgaa agttcgtctt cgataccaat tgttccttgt gtttcaatat gaacgttgtg    121080
     accaagtgct aaccctgctt ttgttagttt ttctttagca atatacgtat gtgcgattcc    121140
     cgacgtacaa gctgctattc cgataatatt catcccaaac tcctcctaat cctgattttt    121200
     ggctaacaac ttaataaaat cttcttttgt ctgtacagtt tgaaattgac caatcacctc    121260
     atcgtctgcc agtaagattg ctactttttg aagtaattta atatgagttg ttgtagcatc    121320
     tgaatttttc actgcgaaaa gaataataat atttacaggt ttatcatcaa gcgactccca    121380
     ctcaacgagg tttttagttc ttccaacggc aatggatgta ctcgtaacac ttgtcgactt    121440
     cccgtgtgga atagcgactc cttcccctag tcccgtttta ccttcttctt cgcgatataa    121500
     tacatctgct ataaaagcat ctttgtctgc tactgcccca gtttcaacaa gtaaatctgt    121560
     taactcttca atgacttcta atttacttgt agcttgtaag tctaaattta caagtgctgg    121620
     gcttattact ttgctaatat ctaattcttg gatatccatg gattcgcctc ctataaactt    121680
     tccatcaatt tttttaccat tattttatct ttctcggtaa acatcgcact tacaagtaac    121740
     gacgggattt cttttgtgct ttctgtatta attgttgtta gaataaaatc aatattctga    121800
     tagtcatgta agctattttt gaatcttgta gatgataaaa cgtctactat ttctacatct    121860
     ggaaaagctt tttgaacctt tactttcaaa agttctgacg tcccaatgcc gctcgaacac    121920
     ataatgataa ttcgtttgac taacggtgaa gcttcgatat gtttcgcgaa atatatagtg    121980
     atatagccaa cttcatcatc agaaatggta tttaactcaa aggtttttgc tgcatcacgt    122040
     gcagtttctt tgatgatttc aaatagtttg ccatactcta atttgatgtc gcttaacaaa    122100
     ttatttttta tattaatttg atgattcatt cggttgacca ttggtttcat atggctcaat    122160
     agctcgatct ttaattgctt tttattaatc ggcatattaa ttttagcagc cacttgttca    122220
     atataaaaat cagtcatctc ttccacaatc ggtaaaattt tacctggaac taattcgatt    122280
     tcatggttaa aacgagaaga aatcaagtat tgtaaaaaat ggaaagtctc tcgcttcggt    122340
     agcttcattt ttaaatattg ttcaattgca tcaatggctt ctacagcaag cgtatgcaat    122400
     ttttcatttg tgacgatata atcatcatca ctttctttaa aatcttctac ctccccttga    122460
     cggaaacggt tgattaaaat atacaaatgc gaaaagatat taatatcata cggatacgga    122520
     atgctaatca tcagcttgtt ctcaatcaac tccatttgcc gcacaataaa ctgaacgtcg    122580
     gctttattga gatcactgta ttctgttttc aaatcatcat aggtcgataa atccaagttg    122640
     ttaatcactt cattaatggc ggtccggatg ttttcttcag tgccaacaac ccgtatttct    122700
     ttttgccttt tttcaagagc caaatcatat ttctcgatgg cttgatttaa aagagagaaa    122760
     tcatttttga ttgaattata cccaacataa taatcttcat acagctctgt tacattcaag    122820
     tactttggtg atttaaacaa tacttgcagc aagatttttt cacgtctttc tgtcggtgta    122880
     tagccaaaaa tatcacctgt cgtttctaat ttcgcttgta tgtaagcttt gtaatctaac    122940
     ttaaaaccac gccccttttc agaaatgatg atatcctttc ttccagttgt ctcattgatg    123000
     tttttaatct tgcgataaat cgttttagag gaaacgtcta gaatttcagc taattgcttt    123060
     gctgtcaaaa aatcgttttt cgttaagaac aagttaatta atgcatgctc cgatttggtt    123120
     agaagcattt catcacctcc ctctacgctc tattatacac aaataaaaga aaacggttac    123180
     aacaagttat gtccactaca ctagacaatt ttttggctga gtttgtgaaa aaagtaatca    123240
     tcatagctct ttacttttag caagacaatc ctccaataaa accgtataat aaaaacaggg    123300
     aacaattaga aaggggtgct cgtgtgacgc ttgaactaca taatgttacg aagaaatttg    123360
     gaacaaaagt cgctgtcaat gatttatcgt ttcgggtaga accaggaaaa atactcggat    123420
     taattggtca aaatggcgct ggtaaaacaa ctacttttcg ccttattttg cattttttag    123480
     aagctacttc tggaaaaatc acttgggacg gcaaagaagt aagcaaaatc gatccaaata    123540
     ttatcggcta tttacccgaa gaacgtggtt tatatccaaa tgtcacaatt gaagaacaat    123600
     taatattttt tgctgaatta aaaggatatc caaaacaaaa aataaaggca gaaattgata    123660
     gctggctaga acgcgctgaa attgtcggta aaaaaacaga cttaatcaaa acactatcca    123720
     aaggaaatca acaaaaaatc cagcttttaa gtacaattat ccaccaacca aaactagtta    123780
     tcttagatga accattcagc ggtttagacc cagtcaatgc agaaattttg aaaaagtttg    123840
     tatttgactt acgcgcttct ggggcagcta ttattttttc cagtcatcgg atggaaaatg    123900
     tggaggagct ttgcgactcg ctattaatgt taaaaaaagg aaatgtggtc ctccaaggaa    123960
     cgactgaatc tgtaaaatct gtttttggtc gtaaacgtat tttgattgaa tccagccaca    124020
     gtgcagcaga actcgctact ttacctggtg tattaaatgt ccaaacccac cgtgatggcg    124080
     ttctacagct tgaaattgcg catgaaagcg acgcagagaa aatttttgac tatgtaacaa    124140
     aagatggttt catccaaaca ttcagtctcc aagctccaac actggaagaa attttcaaat    124200
     ggaaggctgg tgagttgaat gagtaaattt tgggtgataa cgaagcaagt ttacaaaaga    124260
     cgtgtgaaaa caaaatcatt tttaatttca ctactttttc ccgttttaat cgctgcgctc    124320
     attgctggta ttccgaaaat ggtcgactat tttgactcaa gtagcgatat tacaaagctt    124380
     gcggtacttg cagaagatcc tgtttttgcc aaatccttgg ctgctgataa aaatcatttc    124440
     aaagtaaata cggacattaa agacaaaaaa tccgcccagt ccgctctgaa agacggtaag    124500
     atagacggat ttgtcacgat tacacagaaa gatgattcag taagtgccgt ttatacaacg    124560
     caagaaacag ctggtcaaga tattattaca cgtttaacca aagaccttac agctaccaaa    124620
     attgctgaaa aagcagccgc ctataaaatc accaatgaac aattgcaatc tatcacgtct    124680
     cctgtttcgg tcaccaatga tttagaatcc aacaatcagt taacaaacca cgaaaaagat    124740
     gtgatgagtg ctgctgtcct gattttaaca ctaattattt ttattttcgt gatgagttat    124800
     gcaaacattg ttgcttctga aatagctaca gaaaaaggca cgcgcatcat ggaagtcatt    124860
     ttatccagcg tttctgcaac aactcactta tttgccaaat tgactgcgat aatttttatg    124920
     cttttaacac aaattgggtt ttacatcatt tgtggcgcta tcgtcctaat tgctggtaga    124980
     aatactgaaa tggtacaaaa cgtcttagat caaattgctg ttttcccagc ctactacctt    125040
     gtgctaaatt tactatttgt tattttaggt ttgttgttat acattttact cgcagccatg    125100
     attggttcga tggtcccgaa tgtggaaact gtggctcagt ttatttatcc gatgacgatt    125160
     cttgctatta ttggttactg gggttccatc gcagcagcta atgccccaga taagatgctt    125220
     gttatcattg gttcttatat tccgacattc tcaccaatga tgatgctagc acgaatggac    125280
     ttactttctg tttcaactat cggtatcttt agttcactcg ccattttact tgtgagtgtt    125340
     gtcggcgcat ttttcctcac tgtccgcctt taccaaggaa atgtgctact ttacagtaat    125400
     gacggtctat ggaaaacttg gaaaacatca ctatcttatg caaaaagaaa ataaagaaag    125460
     ttggtacatt atgcaaatca gactatctaa acgagaagat gccgcttcaa tgattgaatt    125520
     agaacattta gtttggacac caggaacaac gcctggcgat atccattttg atagcgaggc    125580
     agaattttta cttaaaagtc cgcccggttc caaaattgtt gtcgtgacgg atgataaagt    125640
     agttgggatt cttggttata agtcccctat cccactcgca tcaaataaac acgtcgcaga    125700
     aattgatatc gctgtgcatc cagactatca acgcgcgggc attggtcaac ttttaatgga    125760
     caaaatgaag gaagtagcgc gcgaaaaagg ctacattaaa atcgccttac gagttttatc    125820
     catcaaccaa aaagccattc gtttttatga aaaaaatggc tttaaacagg aagggctcct    125880
     cgaaaaagaa ttcattattc aaggcgaatt tgttgatgat attctaatgg cttatttcct    125940
     ctgacaaaag gcctggctta aaattcaaac tatgacttta taatcatttt actaataaag    126000
     cgtttacatt tatttagaat ggttatatat atagtacaac gaacaaataa aaggtgatgc    126060
     gaatgaaaca aacttggtgt acaagctgat tttttctcag ctttgtcata tgccggcaaa    126120
     cgtctggtga aggattttag tgtcaagcaa ctacagttag cttacaggag gaaggcgagg    126180
     agtatacgcc gcgtcaagga ctttacgcta acttagttgt aggaagacgg aatttcgtta    126240
     cgtcgctcgt ttatcaatat tttttatcct cactacattg gtaaataagc gaataaagta    126300
     tcgtatcatt catggccact atttaagcaa gttacgggcg ctcatttatt cgtaagttag    126360
     aatatcttga gaagtaagta gcaagacaaa gaattcgcct acttgtttga aaatgcctca    126420
     ccgttttccg aatgttgtat gtttattcag aaacatccag acatagtccg gcccatcaga    126480
     tgagtggcaa gacaagctca tccgaaaaga aaaaccccgc gtgacgaaat cgtcattcgg    126540
     ggttttttga ttctgaaaac aagatagaga tatttttatc gtaaaactgt tgaatgactg    126600
     tgtgacattt ttcaaattcc ttcgcttcta aatgcgttac taattcctcc aaggcctgcg    126660
     aaacatctat tgtaaaagcc tcgaaaaata acttttcatt cttttctttc atatttcgca    126720
     gtgtctggct tagtatatca atgttcttct ccattgccgg catttctgta tagtgaatca    126780
     tacaagcata aaagtttttc acatgattaa taaagacttc tgtgtcatgc tctcgagcag    126840
     ctagttttat ataaactaac tcctttctta agcatgttgc gcataattct gcgtcttgtt    126900
     cttgtagttt ttgtacagca taatttaaat gaaaaaaagc taactttaat cgtgattttt    126960
     cgcgatgctc ggcttcacta ttcactgcga ctgaaaaacc gctctctccg atgttcttgc    127020
     atagtatacc actcttatgt aaacaatgga gcgcactaaa agctactcgt ttgctgacct    127080
     gaaatcgttt catgatgtct tctatgtcca ctttctcgcc attttccaaa gtattggcca    127140
     ttatctcatt cttgatttct ccataaatcg gatctgcaac aaatccactt ttttccataa    127200
     ttcgaacctc tttaattttt attgctttca atgttatatt ttacacgaaa aatctctatt    127260
     tagatatggc tttttgcgaa aaaatgtgtc cattacgtta caaaaacaat tgtattgtta    127320
     taacaaaaat agacaataga ttgtaatgac aaacaatgat tatagtgtta tatttatatt    127380
     gtaataacaa tataaacaag gagtgattgt tttgagtacg tacgatttag cacctgaagt    127440
     gaaaattcat caatttgatg gtgcttgggc tggttataaa gatattgccg gagagctact    127500
     aacagccatc caaaagaaga acaatgaaca tattatcgtt gctattgaat gttaccctgg    127560
     aacgcgaaat gaagaaattg ttgccgaact acttccatta ctacctgtcg aaaaagcggt    127620
     tttcgcggat gagtgggcat taaataacga agaagtaaca aataaagtcc aatctcactt    127680
     aacagatgac cgtgtgttcg gcattatgtc ccactatgaa gtgagcgact tttatccagc    127740
     agaaaaactt gctgaaattc aagcagaaat ttcggctagt aaggggttag ttgtaattta    127800
     cgggactggc gcaacagtta tagcaccaaa tccagacatc cttatttatg ccgatttagc    127860
     gcgctgggag attcagtgcc gttaccgcag agaaaataaa cctaactgga aagcagacaa    127920
     tgcgaatgaa gatgcgcttc gtaaattcaa acgaggttac ttttttgaat ggcgcatggc    127980
     tgaccgccaa aagaaaaaac tttatcaaca aatagatttc ttacttgata caaataaaaa    128040
     aaatgaacca aaaatggtac gcggggaaga ttaccgaaat ggtttaaaac aagtttcgaa    128100
     agctcctttt agagtagttc cttactttga tgcaagtgta tggggtggcc agtggatgaa    128160
     aaacaacttc ggacttgacc ctactgctga caattatggt tgggcatttg atggtgttcc    128220
     tgaagaaaat agtttataca tgcgatttgg ggatattcgg attgaagtcc cgtctaccaa    128280
     tgtagtaaac catttcccaa atgaattact tggaccaaaa gtacatagcc gtttcggtac    128340
     ggaattcccg attcgttttg actatctcga tacagtgggc ggtggtaatt taagccttca    128400
     agtccatcca ttagtagagt acgcgcaaga taagtttggc attcattata cccaagatga    128460
     aagttactat attttagaag cagatagtga ctctaccgtt taccttggaa caaaagaagg    128520
     cacaacaaaa gaagcaatta tggcagatct agaaaaagcc gctgaaggaa attaccgttt    128580
     tcccgatgaa aaatacatta acgtcttccc agtgaaaaag cacgatcata ttttaattcc    128640
     agctgggacg attcattgcg gtggtccaag taccgtcgtc ctagaaataa gtgccacccc    128700
     ttatattttc acttttaaat tatgggactg ggaacgcact ggactcgacg gcatgcctcg    128760
     ccctgttcat ttagagcacg gcagagaaaa tttacaactt gaccgcgata ccaaatgggt    128820
     aaatgacaac ttaataaacc aatttgaaac attacacgaa gataacgatt caaaagtaga    128880
     gcgcaccggg ctacatgaat tagagtttat cgaaacacaa cgccactggt ttaaagaaac    128940
     tgttaccgtc cacacaaacg atagcgtcaa tatgctcaat ttggtagaag gaacaagtgc    129000
     tgtcgttgaa agtattgacg actctttcgc accatttgaa gtgcattacg gagaaacatt    129060
     tatcgtccct gcaatcgtcg gaacttatca aattagaaat acaaacgcta gtgaaaaagt    129120
     agctgttatt caagcatttg tacgtaactt atagtaaaag aaagcctatc aagattgttg    129180
     ataggctttc ttttattcaa aatcaatata atatcgataa tgctttccta cataaaagca    129240
     ttcactgtat tctctaaaat cactttcttt ttgtttcgtc atccgtactc tttttaaaat    129300
     tggttcctgc ttatcgattg ctaaagcttc ctgaacttca cgatttggta gcatagcttc    129360
     aatatattcc ttttcttgat taacgacaat cccaaatcct ttcaaatatt cataaaaaga    129420
     accgtaataa tcttctgctt gaagggaata cgcttgtcga taaggaatcg cactgataaa    129480
     aagagcaaac gccaagtctt tcgtgcctcg tagccgctta acttgtaaaa ccttatcccc    129540
     aactgcaagc cccaactgca acgcaatttt tttatcagca ttgatcactt ctacttctgc    129600
     atgtagcgta gccgcttttt taccaagttc tttcatctca ttcgtaaaac tgcgcaccaa    129660
     agtaaaatgc tcatcctctg cttcttccca gtcacgtaca aaagtacctt tcgcacgctc    129720
     tctataaagt agattctcac gaacgagttc atcaattgct ttccgaacgg taattctact    129780
     aacgttgtat aactcacata aatccagctc tggtggaatt ttatctccgg ttttccaaat    129840
     tcctgattgg attttttccc gtaagtcatc cgctatttgt gcataaagtg gcgacgcatc    129900
     attcatctta tttaattttc taaccatttt aggtcttccc tttcaaattg tattattgtc    129960
     atcacaataa atcatagcat aagcttattc aaaattccaa tataaaaagt agagcgataa    130020
     agctctactt tttatactat tctactgtag ctcaatagtt aaatcaccag ttttcaagcg    130080
     ttccttttta ataagaaacg gtctgacaac aagtgcaata acacctggca agacaactgc    130140
     taccaaaata aaagcagcaa gtgtgctgaa tccataattt gctattaaat aaagtggtgc    130200
     aacaaaggca cataacccga gaccagcgac ttcactcgcg gcttggatat ggaacaccat    130260
     cacgccaaga ggtccagcaa tcagtgttgt tagtagtggt actaacataa ggctaggctt    130320
     tctaataata ttaggtgttt gtaattttgg tgtacagata agttgggcaa aaaatgcacc    130380
     ccagttatta tcccgataac ttaataccgc aaatgacaca aattgtaccg agcagccaat    130440
     caatgcggca gcacttgctg ttggatcaag ttgaagcgca atcgcgagcg cagcagatga    130500
     agctggacta agtatcagta acccaaacac aaaagcaata atcatcgatg aaatcagcgg    130560
     tgaaccacca attaatgaac taattccaag gcttacagaa gctaaaatcg gtgccattat    130620
     ctttgcaaat aaaataccac taagtccacc agctaaaagt gaaacaccgg gaatcaaaat    130680
     catatcaaat ttcgtctttc cagtgactcg cttcccagtc caaaccgcca caataacagc    130740
     caaaatagct ccgactggtt ctccgctagt aatagcaact ccgccaccag ctaacgtcgc    130800
     cactgccccg cctccaataa cagcagaggc tgccgcactt atcgtcacaa gcgtgtttgc    130860
     gtgcaagcac atcgcaatac caacaccaat tcccggaatt aacatcgttt taccaattgc    130920
     gccaaccgtt gcaagaaatg aaatccctgt catctgccca attgtttgca aaagaagtcc    130980
     aattccaagc gttacaagaa ccgcattcgc aattcccata gaagccttat aggaacgatc    131040
     tataaaatat tctttcattg cttctccctt tctaaaatgt attctttctc attgtaagca    131100
     ctagttaatt aaaaagctag ttttatttac tgattttcct ttaaaaatgt taaaaaagtt    131160
     tcagcaattc gattctcaag cctttgtctg tttttcagta ccgaaaactt ccgcattaag    131220
     ctcccagact cattaaaggt ctgcattttc cccgctgtaa tttctgtttg aacaacacac    131280
     ttagaaataa cagtgtagcc catcccttca agaaccattt gtttgaccgc catattactc    131340
     caggcaacaa ctttttcagc aacattccag ccattagtac ttaatacatg atccaaatat    131400
     tcacgcgttc ccgaaccttc ttctcgcgca atccaagtcg ctccttgctc aatttctgta    131460
     agcgaaccgt ctgctcgacc aacgatacac atttcatcat ccgaaaaagc acttatctct    131520
     aaatctttct tactcacctg gccttcaatt agccctgtgt ccacttgaag aagttcaact    131580
     ttgtcagcaa ttttcgcggt attttcaatg ataagttcta ttgtaatatc cggataaagg    131640
     gcatgaaatt tcgcaatcac ttctggcaga taatactctc ctatcgtaaa actagcacca    131700
     attcgaagtc gaccttttaa atgatggtga tataaactta tttcatcttc cacttgttta    131760
     tatagtcctt ctaattgctt ggcacggtgg tataaaattt ctcctgttgc tgttaaaata    131820
     aacttcttag cttgtctgta aataagctct gtttcgtaaa gctcttctaa tttctttaat    131880
     tgcaacgata cagcgggttg cgaaatgtgt aattcttcag ctgcttttgt aaaactttgc    131940
     aattctacta ctcggatata tgttcttaat gcctcatcca tcgtaacacc tccataaaaa    132000
     taacttatca ataatataat taatataaat tttactaata aaatcaggaa tggtaaagta    132060
     aaagtataaa agaaaggggg atgaacatga gtcaaatttt atttaaaacg aagacatttt    132120
     ggtatggtat tgcgcttact ttctgtattg ctaccttatc ttatttttta gcgaagttac    132180
     catttttaat gattctcgga caacttgtaa ctgctatttt aattggtatt atcattcgtg    132240
     cacttttccc agttccggat aaatggttta ctggtattca attttccaac aaggtaattc    132300
     ttcgtgccgg gattatttta cttggtttcc gcttgaactt agttgatatt tatcatgctg    132360
     gatggcgcgt atttctaatt gctgccttat gccttagctt tggtattact attgtttatt    132420
     tcttagccaa actttttgga gtggataaga aactagctat tttggtcgct tgcggtacgg    132480
     ggatttgtgg tgctgctgca gtagttgcga tttctccaca agtaaaagct gataacaacc    132540
     aaacggctgt ggctgctacg attattgcac tacttggaac tattttcact gttatctata    132600
     cgttgattta tccaattcta ccacttggac cagatggtta tggtattttt gcaggggcta    132660
     cacttcatga aattgcccac gttattgcag ctgcagatcc aggcggctca tcagctgttg    132720
     atatggcggt tatcgttaaa ttaacacgtg tagccttact tgttccagtc tgctttgttg    132780
     tcgcaaaaat ggttaatgct gggactaaaa atcgcttttc atgggctgaa cttcctgtac    132840
     catggtttat tttcggcttt ttagcaacta gtgcaattaa tagctttgga attattccaa    132900
     catctgtaac tgattttctt gtcatctgcg catattttct cattgctatg tcaatgggcg    132960
     gactcggttt aaatgtccac ttgccatcgt tcggaaaaat gggtggaaaa ccttttgctg    133020
     cggcgttaat cggttctgtt ttcctctcag tatttggtct tgctttagta cttttgtttc    133080
     atttagcagg ttaagatgtc ctcgtcacct cgatttatga tacaatagca aacacgaggt    133140
     gactatttca tgacgaaagc aatttggact tgccgagcgt tcttactcgg atactttctt    133200
     gtgctgcatt tcactgcaga tacttacact tttctaattt taaatgtcgg gcttgcttat    133260
     atacctttcg aaatagcagt atttctcaca aaaaagcctc gcgtctggtg gattttttgg    133320
     ccactaggga ttgtttggct agtatttttc ccaaatgcac cgtatctttt aactgattta    133380
     cttcatttac aacgtttaga aatttacgga gcagaaggag tactttcaac agcaccttgg    133440
     ttatggcgac atttcactta tattatcgtc ggtgtgttct ttggattatt tattggattc    133500
     tggtctttcg caaaaatgct tgctgaaata agaagacgat ttaattggac tagtttacta    133560
     agttatcaat tacttttgat tggcttaata ttattatcta gttatgcgat atacattgga    133620
     cggttctctc gcttacattc catccattta cttacgcagc caattgattc attgcaaatt    133680
     atgtttagtg tttttcactg gccattttgg aattttgtgt tttacttttc gattatccaa    133740
     tatgtaattt atacgctatt tagcaggttt tctagctcac taaaaaacta aaaacgtttg    133800
     tattttagga aaatttattt tcttaaatac aaacgttttt ttaatcgata tggagcttac    133860
     ttcgctctgt tgaaaaacct tgaggataac gacgctttaa tttctcgata tttaattctg    133920
     ctactgtttc catgcttata tctgcccatt tagcaatttg tgatacgtac caaagtacat    133980
     ctcctagctc ttttgttaga gactccttat ctaaatcatg tccatgaaaa gcatatttct    134040
     taatcaaatc ggcaacttca ccggcctctc cagtaatacc aagtccgtaa tttgttagtg    134100
     cctgttcgtg tgttgcagca gttctattcg ctaaaatttg atactcttta aaatccatat    134160
     gttttcctcc ttgcttctct cactttctta ctataacaga taattttttt cctttgcagt    134220
     cttgactatt tccaacttat gcgaactgat gctctatcaa tgcatttcat ctttaaaaat    134280
     tttttatctt taaagtctta tttttttcag ataattccta tataatagag ataagatttc    134340
     tgaaaggagt tttcaaatga aactagctgg cttagtgtta cttctgattg gtttgattgg    134400
     ttttggcttt tcatttagca ttaccggact tatcggtttt ggtgtatgta tcatttctat    134460
     tattttagtt atagcaggaa tttttacaat gattcgttca aaaaaacgcc gtaaacgttc    134520
     ttattcttat taaaataaaa gctgctttat catcatttgg taaagcagct ttttttattt    134580
     ttttggccaa gttctcctac gattttctgc taatttcatt cgaacaagtt cctcgccgtc    134640
     cgcccccata ctctctgcaa tttgaagcgc atagataagc acatcagcta cttcttttaa    134700
     aagttcttca cgattttctt ttaacgctat ttcatctgtt ttccactgaa agcattcaag    134760
     taattctgct gcttcaagtg acaatgaaat tgccaaatct tttggatgat tgtattgatc    134820
     tagccaatca cgctctttta gaaaagcagt aatttcagct tgtagttgtt tcactgtttt    134880
     aactccttta gaagaattta tttgtgaaaa atatcgcaag gactcgtaaa aaaaatgagc    134940
     accaagccgc ctatttacaa ggaggcctgc tactcattaa attacgcgtt taatgaaact    135000
     gcttcttcaa ttttgtttgg tggaataaat ccatttaaac ggtggatctc ttcgccgcct    135060
     ttgtaaagta caagtgttgg cgtttgttgt acatcacggt caaaaaagaa gttttcgccc    135120
     atttcttcta attttacttt taatactttc actttgcttg cgatttcaga gtttttgaat    135180
     tcagcaaaag aaagatcaag cattttacaa ttaggacaat tatctttcca atagtctaca    135240
     tatactaatt cttccccatt aatatgagct tggaactctt caggtgattt aatttcaata    135300
     cttgtcattt gattccactc cttagcgcta aaattttcct gacccaattg tctatgtcag    135360
     ccacatcttg ctcggtgtgt ggcatttgtt ctatttttaa ggttgggtag cttgttccga    135420
     aatattttgc cattcggtcg acagctccgc aataaaaatc cataccccat tgtgtttccc    135480
     cagtgccaaa aatggctaca ttcttgggct ttacggctag ttccgcgata aaatctttca    135540
     tatctggcgg tgttcttccg tagtcgactg tccatgcccc caacacgtac aagtcaaaat    135600
     cctcatcaag cggatactcg gctaaaggag atacgcgaaa ggacacaact tcatgccctt    135660
     cgcttattag tatctcttca atttcatcag ctaccatttt tgtgttgccg cttagagaat    135720
     cataggctaa caagattctc ataaatcgtc gaatccgtta tccatgttcg tttttttata    135780
     gcttgaattg cgcatttcga aaaagtcggt ttttgtttct gtaaagttat ctgcataggc    135840
     tttaatccat gtcattgtgt tgtcactatg tcctggataa agttctggaa taccaagcat    135900
     tcctagcatt ttgttggcac gatatttcac gtagtcaacc atttcttcca catctatacc    135960
     ttcaatacct tgtaaaactt cttcggacca ttctgtttca agttcaacag cgtgacggaa    136020
     agcttcatgt gtatattcca ctagctcttc tgtttgtaat tctgggtttt ccccaaggat    136080
     tgctcggatt acttcagaga taaattttga gtgagctaat tcatcgcgat tgataaagct    136140
     gatgattttt cctgttccag tcattttatt ttgacgaacc aggttgtaga agtaagcaaa    136200
     gccactgtag aaattaattc cttctaaaat agaagattga attaatgctt ttacaagtgt    136260
     ttcacccgtt ttattattca tgaaatcatc atatgcgtcc atgattggct cattacgctt    136320
     gataattgtc ggatgcgttc ttgcaagttc aaagacacga ttttgttctt gtaaatttgt    136380
     aatagaagca agtacatacg agtaactctc attatgaatt acttcttgtt gtgcgataat    136440
     tgctgcgttt gcatggactg ctggatcggt aatatattcc gcaatgttat aaataaagcg    136500
     tgtttgcgga gaatccagtg ttgcaagtaa gccaataatc gcatcaaaag catatttttc    136560
     ttgttcagaa agagcgggat attgttttgc atcgcttttc atgtctactt catctggaat    136620
     ccagtagtta gtagaaagtt ctttatacgc acggtagaaa gaaggatacg ggatgtcgtt    136680
     ccaatttaaa atcccactag tttctccgtt tatgattgaa gtagaacgat taggaaataa    136740
     aggttctaaa attttaatac gtgtcagttg ttctttttgg ttagccatct aggcaagccc    136800
     tccctttctt attgtgttat tgataaaatg ttttagagat ttatcagctt gagcaccatt    136860
     cgcactcttc tacatcgata tcgttggagc ggacatagta agttgttttt agtccttcat    136920
     tccaagcagt catgtgtagt tcaagtaatt tacttgcttt gataccactt ggcacataga    136980
     agttaaagct tagtgattgg tctacgtgac gttgacgacg accgttttga cgaacgcttg    137040
     cgaattggtc tactttgtaa gcaccttttt cgtagtacgg gtatgtgctt aagtttaagt    137100
     ctggtgcaat tactggacga cgatagtctt ttttctcttc atagtagaaa gcactgtaaa    137160
     ttgggtcgat tgaagcagtg gatccagcaa tttgagctgt actcatattt ggcgctacag    137220
     caacaaggta cgcattacgt aagccttttt ctgctacttc tttcgctaat tcttgccatt    137280
     caggtgaatt atagttgcga cgcgcgaaat attctcctgt attccagtca ctgcctttga    137340
     agactttgta agcacctttt tcttgcgcta atttgttact agcgcgaata gctaaatagt    137400
     taatttgttc atataattca tcggcatatt tctccgcttc ttctgagtcc caagcgatat    137460
     ttttaagagc aagcaggtga tgccaaccaa atgttccaag accgatagaa cggtattttt    137520
     ggtttgtaat agttgcttgt ggtactggga gttcgtttaa gtcgataacg ttatctaaca    137580
     tacgtacttc tacttcgatt aaacgttcta aagtaccttc ttccgcaaca accgcacgac    137640
     ctaagtttac agaagataag ttacatacaa caaaatctcc cgcttgtttt gtaatgacga    137700
     tttgatctcc agaaataatt tcttggatca tttttgttgg gctcatattt tgcatgattt    137760
     ctgtacataa gttactagaa tataccatgc cttcatgttt attagggttc attctgttta    137820
     cttcatcacg gtaaaacatg aatggattcc ctgtttctaa ttgactcatc ataatacgtt    137880
     tcatgatatc aatagcttta acaatttttt tgctaattgt ttcatctgca actaattctt    137940
     catatttttc acggaaagta ccttcgcctt ttgattcatc gtagaaatct tgtaggtacc    138000
     agcctttttt cgcttttact tcatgtggat cgaataaata ccactcgcca cgacgctcta    138060
     cagcttccat gaaaatatca ggaatacaaa cagccgtaaa tacatcatgt gcgcgtaaac    138120
     gttgatctcc attgtttaaa cgtaaatcaa ggaaagactc gatatcttta tggaaaacat    138180
     ctaaataaac tgcaattgcg cctttacgtt gacctagttg gtccacgctc actgccgtat    138240
     tgtttaattg tttaatccaa ggaataacac caccacttgc accttttacg ccacggatag    138300
     cagctcctgt tgaacgaacg taaccaagat atgcaccaac accgccaccg tgcttagaaa    138360
     ctctagcgac gtctgtattg ctgtcataaa taccttgtaa gctatcatct actgtatcaa    138420
     tgaaacagct agacaattga ccgccaactt ttccagcatt tgcaagtgtc ggtgttgcaa    138480
     cggtcatata taaattactt aaagcccagt aagcttcttc tactagtttc atccgttttt    138540
     cttttggttc attttgcatt aaataaagtg cgatagttaa ccaacgttct tgtggcaact    138600
     catacacatt acgttcagag tcagtcgcta agtaacgcgt cgcaagtaaa tacaaaccat    138660
     tatacgtaaa taatttatct ttctcagggt caattaattt ccctgctgca atcaaatctt    138720
     ctttagaata attttttaga atattgccag aataaatacc acgttcgcct aggctctctt    138780
     gtagtccaac gtacgaacca tatttatcat catcattata gaaacgattt ttacttgctt    138840
     ttttatataa tttatttaaa taaaggcgtg ctgcgaaatg ttcccattca ggaatatgaa    138900
     tatctgtacg agcttctgct tccctaatta aataatcgac taattcgtca gccgcgtaat    138960
     cttccttctt ctctacaaaa ttaaaaacct tacgtttgta atcctctaaa tcaagtttcg    139020
     gaaattcttc atggattttc tctaaatatc catccaatcg gcttttgtca aaaggtagct    139080
     ttctgtttcc cccgtctttt actatgtaag ttgtcatttg caatccccat ttcatccttt    139140
     tttcctcgtt gtaaaaatat ctgattcatt ttgcgctttt cattcgtccg ctgaactatt    139200
     tgtggtcgtt ccatggagca aaaaaattaa cttttaaagg agcaaattcc cctgataaaa    139260
     gttaaaaggc gatgaagcaa tatttcgctt tcgatactat atatagtata actttttcat    139320
     tgtgaatgca agatatagta ctctggtttt attacgaaaa gtgtccaaac aatgattaca    139380
     actaggtttt cggcaaataa aaaaattttt tccgacactt gtgtgttttc gagcatattt    139440
     caagtataaa aatgctacta cttctagtgc ctattttttc gctagtttct atatttagta    139500
     gttaaaaaaa ggatgttttg taacttcaca atcttttaaa ctcacttttg tcacctttct    139560
     gacaaaaatg taagattaac gctggatttt gttagttaac aaacgggata attttgtcat    139620
     tccattgtaa acttaatgta ataaaacaaa tcaagaaagg atgagggaga aatgtttact    139680
     aaaaaaagag gtttaatgtt attagccgca gttcttctaa ctgtttgcgc gatttgggag    139740
     tatgcgatgc caactgacgc cgcagtaaaa tcctattacg taaaagtaga agacgcaggg    139800
     aaacccgttc aaaaaaatca attcaaaggg ttcaaatatg tatcaaatgt ttatgatgac    139860
     aaaggaaaac aaaagcaact aactttctac tcagaaaaag aattaactaa gaacgagcaa    139920
     ttcaaagtac ttgtcggcga gaacaaaatg gttgttaatt ataaaaaaat aaaaaacgta    139980
     ccagataaaa ttaaatattt agctgaaaaa taaaaaacgc tttgttatag cctgataaaa    140040
     ggctaaacaa agcgtttctg ttttttatta aggtgtaaca atattgaaga caggattaaa    140100
     ttcatctaac aaggaagcaa actccccaaa tttcttcacg tctccttcta gtttagctgt    140160
     ttggtcagca aatgctgctt caaagctttt cacaccaccg aagatatgat taaatgtatc    140220
     acgagtagta gttaaagtta aatcagcttt atcgtctact tcaccttcac gataaataag    140280
     tactgaatta tttacaagta aatgataatt ctcatcaaca tctgttaatt tccagttcat    140340
     ggagatacgt ttaccaatgg atctttcccc atttaaacga atacccatgt aatctaaaat    140400
     caagttaaac ggcataccct ccacaatatc cagtgtaaca ccagaaataa cttcatctgg    140460
     gacagaattt ctcagttcat ccgcaccagc taaaaataca ttacgccatg gtccagactc    140520
     agattgatag ccaagttgtt ctaacgcatc tgcaagaaga gctcttgctt ctccgttttc    140580
     tccatctgcg aaaaccgcat gtttgacaac ttccgcaacc cagcgatatt cacccgcttc    140640
     ataggataca cgcgcttttt tcaatacttc atcaacgcca cccataaact caacgtattt    140700
     tttcgcaaca tcttctggag gtagcggata aaggtcagca ggatttccgt cataccaccc    140760
     aagataaaat tgataaatcg ctttaacatc atggttaagc gtaccgtagt agcctcgtaa    140820
     ataccatttt tcttctagtg caggagggaa tttcacagct tcagctactt caatagcagt    140880
     taatccttta ttaataaaat gaagcgtttg gtcatgcata tatttataag cgtcacgttg    140940
     gtgaataagc atatcattaa tttcttcatt cccccacgtt ggccagtgat gttgaccgat    141000
     acaaacttca tatttatcgc caaaggcacg aattgctttg tcaatatctt tccaccactc    141060
     ataagcgtca cgaatttgcg caccacgtaa tgttaaaatg ttatgcaagt tatgaacggc    141120
     atcttctgcg atattaagta gtttaaattg tgggaaatac atcatatgtt ctgaaggagc    141180
     ttctgtattt ggagccatca agaattccac ttcaatccca tcaacaacac gtttttcgtg    141240
     atcaaacgtg atagtatcat ttggagcaag caaggacata tgacctttag aagctgtttt    141300
     accaagacca gcatctactt gacctaattc cccgcgtgac aagcggctac catacatata    141360
     ttctgcacga cgaatcatcg cgtttccagc aaaaatattt tcactgaccg cagcttccat    141420
     aaatccttct ggcccaataa gtgccacttt tccagaggct acatcttctt tgctaataag    141480
     acccgctaca ccgccgtaat gatcggcatg ggaatgggta taaataatcg ccttaatagg    141540
     tttttttgga cgatgctcat agtatagatc aagcgccgca cgagcagttt caaccgacat    141600
     taatgtatcc gtaattacaa gaccagtatc gccttccata atcgtagtat tcgacatatc    141660
     aaacccacgt acttgataaa cgcggtccgt tactttgaat aaaccatttg tcatattaag    141720
     ctgagcgata cgccacaaac ttgggttaac agaatcaggt gcttctcctt caataaactt    141780
     ataatcctcc aaatcccaaa ctgcatggcc atcttcagta tctactttta catgatccca    141840
     agttccaata aaaccttttt tagcatcatc aaaatctttc gtgttctcaa atggtaaaga    141900
     tttttttact ttctcattca ctttctttgt aaattcggac gcttcttttg gtaagacttt    141960
     ttttgtcatt atcggtttcc tcctgcacgt ttattttcac atactttctt tttatacctc    142020
     cataaaatta ttcaaaacct tttgctatta ttagaccaaa aaaagaggct tgaaaaatcc    142080
     aagcctcttt tttaacttat tcggataatt tctttttagc gtcaccggtt ttatcttcta    142140
     cttcgccttt agctttttga gctttacctt caacttgttt gcctttgtca tctgttgctt    142200
     tcccgaattt gtcttttgcg tcacctacta ctttatcttt caatcctttt gctttgtcct    142260
     tcataccttt atcttcgctc attgatattg cctcctaatt agaatatttt ctaatgaaga    142320
     attctttatc tccatagtag tgttttccac aatatagaaa gctaaaacat cttttttaaa    142380
     tagaatggat agttcgattt gtctcagccg cttcaaatat ggcttcaatc aattttaaaa    142440
     cttggtaaac ttcttcattt tgaacgatgg gttcactcgt attatttaaa acatcgataa    142500
     aattgttata gaaagaagga gctaatttgg cgggcgctgg aagtgataat gtattggttg    142560
     cttcttcgct tggtggtgcc attgtttttg ttagaccttg accagctttg attggtgttg    142620
     gctcagacgt tttagcaagc gcagttggtt ggacgatttc tccgcttaaa tcccaatcgt    142680
     ggataattcc agttccttct gtgcctttga cgtaccagcg aggtaattta atgaaattgg    142740
     ttgttccaac ttcgatttga gcagtaatgc cattctcaaa agtaatgaat gttacaaagc    142800
     catcatctac ttcatctcca agcgcaaagc ttagattagc agatacagat ttcacgttac    142860
     tatcgactag gaataacaat tggtcaagta gatgcacacc ccaatcaagt accatcccgc    142920
     cgccatgtgc tttcaaatga cgccaatctc ctggaatacc atttgctccg tggacacgtg    142980
     attccaggtg gaacatttcg ccaatcgttt tttgttcaaa aatttctttt ataattagga    143040
     aatcttcgtc ccaacgccta ttttgatgaa ccatgaaatg tttatttact tttttagcaa    143100
     catccataat tgctagtaaa tcttcgcttg tcatcgtcac tggtttctcg caaacaacat    143160
     gcttacctgc ttcaagtgca gtaattgcca gttctttatg gctatcattc ggtgtcgcga    143220
     taagaacggc atctactttt tcatccgcta aaaccgcttc aaagctttca taaattttca    143280
     aacctttttc agcagcggct tcgcgttttt cttctagaat gtcgaatacg ccatgaactt    143340
     ctaaattatc agcagccgat gcaagcgtta catgatagct tcccatccct ccgtaaccaa    143400
     caattactaa ttgatatttt ttcatcctaa gacacccttt cttatcgtta agcccaccac    143460
     atatccagtg gtttatcttt aattaaaatc gattgtaagt ttgtaacagc acggtcgaag    143520
     ccttcatcaa tcgacattaa tggatcttcg tgttcaatgc tgactacata atcataaccg    143580
     tatgttctaa gcgcgctcat aatatccgac cactcggtta aactatgacc acaagctacc    143640
     gaacggaatg tccaacttct cgtttgtaca tcgccatatg gttgcatatc cgttagaccg    143700
     tacatattga tattatcttg atctaaatac gtatctttgg catggaaatg atggattgct    143760
     ccagcttttc ctaagatttt gatagcgcca actgggtcga ttccttgcca ccataaatga    143820
     cttgggtcta aattgactcc aatagaatca tttgtttctt cccgcaattt taaaatagta    143880
     tatggggtat ggcataagaa accgccgtgc aattcgatac caattttaac gccactggct    143940
     gctgcaagtt caccaatttc tttccagtaa ggaattaatt ttgtttccca ctgccacgtt    144000
     ttaatatcgc tataaacagt tggccatgga ataaccggcc agtttggcgc tttggcatca    144060
     tcactatcac cagctgttcc agaaaatgta ttaactaccg gaacattcat taatgaagct    144120
     agtttaattg atttacgtaa aatttcatcg gacgctgccg cttcttcttt atttggagag    144180
     attggattat catgacaact aaatgcgcta atcgttaatc cccggctagt aaatttttct    144240
     aagtattctt tgcgtgctgc ttcgcttgcc aaaagttcgt ccgttgggca gtgatgattc    144300
     ccagggtttc ctcctgtgcc aatttctaca gcatcaagac ccgctgcttt cactttatct    144360
     aacatttctt ctaatgataa attagcaaat aatggtgtaa aaacgcctaa tttcattttt    144420
     atttcctccc tattttttca agtggttggt gatttccgta tgccggataa ttcttccgac    144480
     cttccgcgca ccaatgtacg ccgttaataa ttacttgctg aatatccgga tggtgatagg    144540
     ttggataaga ttcgtggcct ggttggaaat agaaaatccg accatttcct cgtttgtacg    144600
     taatcccact gcggaaaact tcgccgcctt caaaccaacc taagaaaatt agttcatcag    144660
     gggtcgggat atcaaaatgc tcgccgtaca tttcttcctc gtccaactca ataaattcgc    144720
     cgatgccttt tgcaattgga tgcgtcgggt caactaccca aaggcgttct ctttcatttg    144780
     cttcgcgcca ttttaaatca cagcttgttc ccattagacg cataaagatt ttcgacatat    144840
     gaccagaatg tagtacgaca agtcccatgc cttctaacac acgtttttgt acacgatcga    144900
     caattttatc ttccacgcgg tcatgaccca tatgtcccca ccaaatcagt acatccgtat    144960
     tcgccaatac ttcttcggta agtccgtgtt caggctcttc taaagtagcc gttcccgcct    145020
     caattcctgc tttttctaga aagctagcga tttgcccatg aattccgtct ggataaattg    145080
     ccaacacagc atcatcttct ttttcatgta aaaattcgtt ccacactgtt acacgtgtca    145140
     tattagttct cctccaatac attcgctaaa tacgtataac ctttggccac gctcgttagc    145200
     ggatcttgcg taaatgcttc ttgttcaata atcagccatt ttgttccaga atgaagcgcc    145260
     gttttaacga aacctggcac atccaaaaca ccttcaccga taatagtgct ttccttgttt    145320
     gctctcgatt tatccttaat atgaataagt ggtacccggt tacgatattt ttcgataaaa    145380
     ggaataactc caattcccgc atactcaatc cagtaagtgt ctaattccgc aaccatttct    145440
     ggtacatttt tgagtaaact gtccaaaata atttcgtcat ctaatttatc taattcatgg    145500
     gcatgattat gatagccaaa atgcatccca gcttgttgaa ccgtttttgt gatttcaaga    145560
     agtttttcac taaatgcaag ccattcttgc tttgttttaa agtctgcata tgggcaaata    145620
     atgtattcat ttcccaattc gcgttcaaac agaatgacat tttctaaatc tacctcaagc    145680
     tgttctttac taatatgcga tccggctact tctagtccga gttcagccaa tttcgcttta    145740
     atttcactgg cagatttgcc gtaataacca gcaaactcca cgccgtcata acccatttcc    145800
     gccacttttt ctaacgttcc aaagaaatca tcttcacaag cttccttaac actccacaac    145860
     tgtaacgcaa tttttgcttt cataaaggca cttcctcctt aattaaaata aactggctgt    145920
     cctgttttcg atgattcata aatagcttct aagatttgtg ttacaacaag tgcttgttct    145980
     ggtttaacaa caggatctgt atttttttca attgcttcta accattgttc tgcttcgatt    146040
     aatgctggat catcacctgt tccgtcgtaa aaatcaacgc cacctgcttc taattgaatt    146100
     ttcttttcat acatttggct gtgcgcttcg ccgttaattc gtaaaccgtc ttccatatcc    146160
     gcgccgcctt ctgttcccga tagagacgtc cttgcttcac cgacatcaag tgtgttaagc    146220
     gtccaacttg cttctaatac tatcgtcgcg ccgttttcca ttgtgataaa accaaatgcg    146280
     gaatcttcta cagtaaattt atttgggtcc catgagcccc atgcatttgc tgcattttct    146340
     tttttagcaa gtttatgata actgtttcct actacatatt tcggtttata attgtccatc    146400
     atccaaagcg ttaaatcaag cgcatgtgtt ccaatatcaa taagaggtcc gccgccctgc    146460
     gcttcttcat ctaaaaacac accccaagtt gggactgcac gacgacgaat cgcttttgct    146520
     tttgcataat agatatcacc taattcgccg ttctcgcaaa cttggtgcaa ataatccgag    146580
     tctttgcgga atctattttg gtaaccgatt gttaattttt tgcccgtacg ttctgcagct    146640
     tcaatcatac ttttcgcttc ttcggttgtt tttgccattg gtttttcaca cataacatgt    146700
     tttccggctt ccattgctgc aatagaaatc tccgcatgag aaatatttgg tgtacacaca    146760
     tggatgacat cgatggattt atcttggagt aattctacat agtttgtgta tacgcttgca    146820
     ttttcactac caaattcttt tgctgcggct tcggcttttt ctaaaacgat atcgcaaaaa    146880
     gcaaccattt ctgctttctc agcttttaat aaacttggca tatgcttccc gtttgcaatg    146940
     cctccacaac caataattcc aacttttaat gtcataataa aaaacctcca atagttttga    147000
     tagttacatc atacaaaact actcgaggta aatcttccta ttttattgct taattattcc    147060
     cgtatattgt ctttctgtat tttaatggcg cgactcccat tgctcgtttg aaggcatgat    147120
     gaaaagtttt tacactacta aagccagcta gttcagccac ttctgttaca gggaacgcct    147180
     catttaacaa catccatttt gctttgttca gccggtaatc atttaaaaaa gtcacaaacg    147240
     tcattccggt atttcgcttg aaaaatttcg tgaaatagta tgtgctaaaa ccagtgtagt    147300
     tcgcgacttc ttgtaagctg acaggttctt gataatgttt ctcgacatag gaaaaaattt    147360
     gatctaattt atgtagtgtt tcttgagatt ttaagactgc atcttctgaa atcacactat    147420
     caggttgagt ttttatttga gggatttccc ggtatatcaa gccgataatc gccagtaggt    147480
     ctgcttttag aatataatgc tttccaggtt tttccccgct tgactcagaa tggatattca    147540
     taattaaaga ttgcatttta gcaaccgttt cttctggcca ttccctgctc aaatgtgcca    147600
     tttctgtaag catttcgcgt aatgtttgca ttttgtcatc catttgcatt tcttcttgaa    147660
     ataaacttaa atcaaattgg ataacgatac gttcactact cggcgaagct aaaaaataat    147720
     gcacatctcc gccatttatt acttgaatct ctccttcttt taattgaatt ggcatatcat    147780
     taatgccaag attaaggctg ccttttagcg cataaataat ttcaatctct ttatgccaat    147840
     gtggataaac aagaacttct ccttcattaa caaacgaacg aaaagggaaa gctttattta    147900
     attctggaat ttccaagtat tcactcatag cggaactcct ttttttcttt cattttagca    147960
     taaaaaagaa gacagccgtt aaactatctt cataagatta taaaattaat gattcatagg    148020
     gaatttcatt aaaaagtttt tctacattta taacaacagg tattttagta tttagtaagt    148080
     aaccttcttt ttttagttca ctaagagtta agctaagata ctctcttgta atacccatga    148140
     atttagataa aaatgtagta gataattctt gcgggatttg aatgttatct ccattggaaa    148200
     taccgtattc ataaccaatt gcagcaatta aatgttttac gcggtctttc accttaagcg    148260
     tattaagcag acatcgacgt tgcagtatca taatttcttt tttcgcttga taaagcataa    148320
     attcttctat actaacatgt ttttcaacca taaaaatgaa aaaatctcta tctactgccg    148380
     tgatgacact agaacttggc gagagtaatt gagcaccgat attgcgtttt aaatctgaag    148440
     acataaaaga tgaaaaatta catacatccc catgttttag caattggtcg tacccaatat    148500
     agtcatctat ttgtgttcct ttcataacaa tacctttttc aacaaaatag atacctgtta    148560
     caaaatctac atcaaaaagt tcatttttag aaagtttaat actcatacta tgtttagcaa    148620
     aatctccaga cttcttacaa aaatgaagtg gattggtcaa aatttcatgt tgtcgttttt    148680
     ctaatgtgtt cattgcgaac tcctcctcta aagtataata tcacacaatg aaaacacccc    148740
     agagaaggaa tacgctgaat aaaataacgt tacaatcatt aaaaaagaaa tttttcacta    148800
     tttgttcatt aaaactaact ttttttatgc caaaaacatc taaataagta ctttttgtga    148860
     cattttttct ctgctttttt tagataatat tttaactttt ccaccttttt taacgtaaaa    148920
     atcaatatat attaagtttt gttctttaaa gtgtgtctat tttcttaatg acccacggtt    148980
     tgtgactatc gtcgagaatt ccttcttttc gtagtttcag tacaataata ttcgtatatt    149040
     ctcgagtagt attcgcatat tgggctaaaa tagaattatt gatttcatca ggcaaaatga    149100
     attctttatc cttcgttact cttcccatat aaagcccaat ctcttttaag catgctctaa    149160
     tacgaagttc tttcttcata aaattacgtt tactagcttt aaaataaact tttcttgtat    149220
     aaagtaagtt agataataga tatttcgctt tttgacctga ttcgtccaaa acacgttcca    149280
     caaaatcagg atcaagtacc caacaatgaa cttctgtcag gctgcgcagt acagactctt    149340
     ctggttcttc cttaataata ggaattaaat taattgctat ttcgccacct acaaagctaa    149400
     taatccctga atctccgtat tcattttgaa ggcaataaga gaagtatcca ctttctacta    149460
     aatagatctt gaaacctttc gaattattca ttttaatttc tttacctcta ggaataattt    149520
     cttgataaca ataatcatga aaggtgtaat ctttttttag taattgtagt agtgcttttg    149580
     gcgttgtttc tttaaaaatt tcctcatctg aatgcatttt ccaacatcct ttccatttga    149640
     ttacaaaaaa actgcagaat aaatgcttct gcaagttctt ttttagttaa agtatgggtt    149700
     tgtcttcttt tcatgaccga tggtagttac atcaccatga cctgaatagg ctgggaaatc    149760
     atctggaagt acaaacagtt gtgttttaat actgtttatt aacatatcaa aatctcctgt    149820
     atataaatct gtacggccga tactaccttt aaacaaagcg tctccaacta cgacaaattc    149880
     gtcgaaaata aaactaacgc ttccgataga atgccctggt gtcggtacta ctttaaaacg    149940
     aaaaccttct atattatatt cacctaacgt aaattcattt tctgcaggtt gcgctatgat    150000
     tgctttacca gctatgtgcg cagataaatt taattctgga ttggatagcc attcttgctc    150060
     taatgggcta acatatactg gaatattata tgttttgcgg atctcttcta aagcaccaat    150120
     atgatcatag tgacaatgag ttaataaaac tgccactggt tttacttcga gttttgcaat    150180
     ttccgcttca attttacttg cttcatcgcc tgggtcaaca attaatgcta cattatcttg    150240
     ataaatgata taacaatttt cttggattat tcctgtcatg attcgtttga tttttgtcat    150300
     ttcacttccg cctttcttca cattcaccat tatacctaaa atactacctt acttccatca    150360
     atattccttg tttgtattca cttccgagat atactacaat gaagaaagaa gtttaaaagg    150420
     aggaataaaa atgactgcaa aaatgttaca tacatgtatc cgcgtaaaaa acctaacaga    150480
     atcaattact ttttatgaaa aagcattagg acttaaagaa gttcgccgca aggacttccc    150540
     ggatttcgaa tttacgttag tttatatggc gtttgaagaa ggcggttttg aactagaatt    150600
     aacgtacaac tacgaccaaa aagaagccta cgatttagga aatggttacg gtcacttagc    150660
     ggttggtgtt ctggacgtac gtgctttatt aaaagaacac caagaagctg gttttactgt    150720
     gacagattta aaaggactac ctggcgaaga cccattctat tatttcttaa cagatccaga    150780
     tggttataaa acagaaatca ttcaagatgg cgctttataa gtagaagaag gactggagaa    150840
     gcttaatggg aaaatatttt gttataattt tgatcgcact agcaattaat ggaatcagta    150900
     ttttattcca taatgatata gcaagcctta tcgctgtcat cattacagct gtactactta    150960
     tttatttgat ggtggactta acaaaaatgt atcgacgtaa atagaaaaag agtcagcaga    151020
     atcctgtgga ttttgctgac tcttttttat tattgaatca ctaaattgct tgcaacttgt    151080
     ttagattctt tcataaggtt ttcgataata tcactagtgg aacgaatttc agttaacata    151140
     ccacaaattt gtccagccat aacagaacca ttctcaacgt caccttcatg gactgctttt    151200
     ctaagagagc caagtgttaa ttcctctaat ttgtctctgg aggcattttc gttttctagt    151260
     tctacatatt tttgaatcat tgggttttta atacttctaa ctggcgcacc attgcgacga    151320
     cctgttacag tcgtgcttgt atccgttgcg tcaagtaccg cttgtttaaa gctagctgga    151380
     accggacatt cctcagcaac aaggaaaagt gtgccgattt ggacaccact tgcgcctaat    151440
     gcataaacag ctgccattcc gtgaccatcg gcaattcccc ctgctgcaat gacaggaatg    151500
     ttcactgctg aaacaacttg acgaacgagt gccatagtgg ttgtttcacc gacatgacca    151560
     cccgcttctg taccttctgc aacaacagca tcgacaccga tttcttccat tttttgagct    151620
     atttttacag atgggataac agcaatcact ttaattccag ctgctttaaa cttttccatg    151680
     aatggtttag gcgttcctgc cccagttgta acaactcgca catcttcttc aataatgaca    151740
     tcgacaagtt caggacaatt tggcatcatc agcataatat ttacagcgaa aggtttcgtt    151800
     gtcttttctt tacaaagacg aatttgttct cgtaacgcgt ctgctgacat tcctccagat    151860
     gcgataatcc ctagaccacc tgcatttgat actgctgaag ctaattcata tgtggcaatt    151920
     tgtgccattg ccccttgtaa aattggatat ttaatttgta gcatttcagt taaactcatt    151980
     ttcttttctc ctctctattt ttacgccaat tctttagttg gttgtttttt ctcacgtaat    152040
     ttataaacaa tattaataca aagtcctaca gccgcaagcg cgatagctat ataaaaagct    152100
     tgtgtgaagt ccccgccatt ttgaccagca atttgcgctg ccatttttgg agcaaagaag    152160
     gcagccgtag aataaccaat aaaaacgatt ccgtagttga ctccttggtt tttcggaccg    152220
     taattttcca taacgatgga tgggaaaacg cccattgttc cgccaaagca aagtccaagt    152280
     ccaatgattc cgataacaaa cccaacaaca gattgaagcg ttgtaagtgc tagtaaagac    152340
     agagcaatca ctgtataaat aatcattaat gtattagatc tacctagacg gtcagatacc    152400
     gcgccccaaa ctactcgacc taaacagttg cttagtgaat aaatactaac ataagcagca    152460
     gctgatgcag ccgtcaagcc aaacatattt tggccaatta aggatgcatt agaagcaatc    152520
     atcagaccgg agaatgcgcc aatacctagc attaaaagaa tcagataaaa agtaactgtt    152580
     cgaaccattc cagtccaagg tacatttacc ataccagcta cattgttagc aggtggcgtc    152640
     caaccttttg gtgtataacc tgctggtgcg acacgaataa gaaaactaca tccaataaca    152700
     actgcgatat aaacggcccc cataatttta aatgctgtca ttacgttata cgtttcaatt    152760
     aagtagttag caatcggtgc agcaataatt gtcgctccgc ccattccagc tgtaataagt    152820
     cctgaagcaa gtccacgttt atctgggaaa agtcgaattg tgttgctaag acaccctgaa    152880
     tatgcaaaac cttgtccaag cccagcaagg acaccataag ataagtaaag cattgtagtg    152940
     gaggtagcaa atcctgttaa cgcaaaacca agcccgaata gtatacctcc aattaaaata    153000
     gcccattttg ctttcccttt atccgttaaa atcccaccta aaatagttgg aatcggtcca    153060
     atcgccgcat taattgtaaa tgccatcaca acttgcggga ttgtccagcc atgagcggca    153120
     cttaacggtc cagcaaatac actaaatgca tatactgccc ccgtacaaag tagaacacca    153180
     acagaaccaa ttaagactcc ccaacggttt atttcttttg tcatatagat actccctctc    153240
     gcgtttgttt ttcaataata gcttttaagc cgccccattc ttcgctaaac ataccgccat    153300
     ccattacttt taaatcgctc gcaataatgg gttcgaattc catttgtcca agaatatctt    153360
     tttctaaatc aatccctggt gcgatttctg ttagaaccat tttgccattt tctaagcgaa    153420
     atacagcacg ttctgtcaca tagaggattg tttgattggt cgtagaagca tattcgccac    153480
     taaatgtgat ttgttgaact tgtttgataa actttttagc ttttccttct tgtaaaattt    153540
     ctaatttccc ggcagctaca cgcgttttta atccacctgc tgtaaatgtt ccggcaaaga    153600
     ttaatttctt cgctgattga gaaatattaa taaatccacc acagccagca actcttgatc    153660
     caaacttgct gacattcaca ttacccgatt cgtctgtttg tgccaaacca agtacggata    153720
     aatcgagtcc gccaccatcg taaaaatcga actgcgaatg atgatcgaca atagcttcac    153780
     tgttataagc atgaccgaaa tctgctaaac ctgctggaac accgccaaca gaaccagctt    153840
     ccgttgttag tattaattga tcactcacgc cctcttccgc tgctacagtt gatacattca    153900
     ccggaattcc tacacctaaa tttaaaattg tttgtggttc tagttctgct gctgaacgac    153960
     gcgcaattac tttacggtca tctaacggaa gtggctcaat atctccaagc ggaacttgaa    154020
     tgtgcccaga aaaagctgga ttgtactgcg tattttcagt ttggaaatga ttttctggtt    154080
     ctgaaataat aatatgatca actaaaattc ctggaactct tacatcttta ggattaagcg    154140
     atcctttttt cgcaacagat tctacttgtg cgataacaat tccgcctgaa tttcgaactg    154200
     cctgtgcaat tggtaatact tccatatgta agccttcttt ttctaaagtt aagttaccga    154260
     attcatccgc tacagttccc cgaataagtg ctacttgaat tggaaaactt ggatagaata    154320
     gccattcttc gttgtggatc gtcaatagct ctactaagtt atctttggaa cttgcagaca    154380
     tttttgcccc ttcaatgcgt ggatctacaa atgttcccat gccaattttt gtaatcactc    154440
     ctggcctctt agcagcaatt tcacgataca gttgtgtaat aacaccttgt ggcagattgt    154500
     atgcttcaca tttgtcttct tcaattaatt tcgccatttt gggagaagcg attgcaattc    154560
     caccaatcca gcgtttaatc aatccttcat gtccccagtg gctcattcct ttttcccgac    154620
     gatcaccaag cgcactagca tgcataactg taagattacg cggagcccct tcttctaaaa    154680
     aacgcttttc aaccgcaata gccatttctt cattaacaca agctaaaccg aaaccactaa    154740
     aagcaacagt atcgccatcc tttaataatt ttgctgcttc actagctttt attacttttg    154800
     acaaattcct cactccttat tgttcaatta ttcacatata tttgtaatga tacgcagttc    154860
     tttataaagc aacttccgtg ccaacatgaa aaatggctct ataacacact ttataatata    154920
     aaacattatt tattgtcgca aaaaagagac gtcaaaatgg ttgtttttac aaacaggagt    154980
     cgcgaaaacg caacaaaaaa ggtctaatcg caacatccga ttaggccttc tatttaatga    155040
     agtgttttta gttttcgata taaaacagaa cgatgaattc caagtgtact agcagctttt    155100
     gtcacatttc cattactttc ttcgagcact cgcagtataa agtgtttttc tacaccttgc    155160
     aaataatctt tcaaataaag tgagtctttt tttgtttgtt ctttaaaatg taagtctagt    155220
     gcgaaatcat ctgtttctgc aactgttact tctttatttc cagacataac aactaatcgc    155280
     tcaatcttgt ttctaagttc gcggacattt cctggccaat tatgagaaag taattctttc    155340
     gttttatcgc cacttaactg aaaatctttt tggtactttt gattaaattt ttgtatgaat    155400
     tgacgtgcaa gaccaataat atcttgcggt cgctctctta gtgctggaat gtgaaccggc    155460
     acaacattaa tacgataata taaatcacgc ctaaatgttc ctttttcaac catttctcca    155520
     aggtttcgat ttgtcgctga aataagtcta aagcggcgtt tcgtctcggt tgttgagccc    155580
     agtcttctta cctcgccagt ttcaagcact cggagcattt tcgcttgaag ttctaacggc    155640
     atttcagaaa tttcatctaa aaacaatgta ccgccatcag ctagctcaag catcccgggt    155700
     ttttcaatat ccgcaccggt aaatgagcct ttttcatgtc cgaaaagctc agattcaaat    155760
     agtgcttttg ggattgcggc acagttaatc gagataaaag gcccagcagc ttgtttactt    155820
     ttttcatgaa tatagcgcga caagacttct ttaccagtac cagactcccc gtataataag    155880
     actttactgt caaacggagc tatctggttg cacactcgaa ctatctgctt catcgcgacg    155940
     ctctctgcta ctatcacagt tccatcattt tctttataat cttcaagaag aagtgactct    156000
     ttattgcccg aaattgcctc accacgccat gttttaaaac tatctggttg cgtttcatct    156060
     gacatcgtaa caactaaatg caccgtgcca tctggataga gaattggtgt agaagtcgaa    156120
     cgaatactaa aacctttctt cgtattgatc acttttgttt tcttttgttt tgtgcggatt    156180
     gcttctagtg tgacagaatc attgtacaca ccgtcttcca ctaagtctct tacattacaa    156240
     cgaagcaatt cttcgagcga cattccaact gtaagcgcag tgaatttatt agaaattaga    156300
     atattcccat ctgcatccgt gacaaaaagc gttgtcggca tatccttatt taattcgcca    156360
     aatgactgta ctcccagcaa gttatccatt aagtcaaaca ttaaaagctc atccttttgg    156420
     actagtttcc tagttatttg ctcatcatta cacaatatat tataacataa gaaatctgcc    156480
     agaagtactc gtttttttgc gacagactaa tttccgtctg caatacatac ttgatttcgc    156540
     ccagttaatt ttgctttata taaagcctca tccgcagatt taaataatcc ttcacttgta    156600
     ttagcgccat ccttactgct gctaaccccc acggaaatcg taattttcac cacttgtcca    156660
     cttggtatca taaaatcgta ttcttctgtt tctctacgaa cttgttcagc aaaaaaattc    156720
     cctttttcaa tcgggcaatc taataagaca atggaaaatt cttccccgcc gtttctaaat    156780
     gcctcagaac cgtctgatgt atttcgcttt aaaataatag ctaattgttt caaaatagca    156840
     tcaccagcgt catgaccata tgtatcatta atatttttaa agtaatcaat atcaatcaac    156900
     atgagcgtaa cttgtctgct cccagcatcc atcacatgat ttattttttc atcaaattgt    156960
     cttacattcg ataatttagt caaataatct agcgtggagt cctgctcata tttttggaaa    157020
     agttgctttg atttaatcat gttgctcatt agtcccgctg aaacagcccc aataacaagc    157080
     gcaataagta cgaaaacagt catatttatc caaaaatgag actccctagc taaaatcaaa    157140
     tgcaggttaa taacaacaaa actacacgcg atgatattca aaataaaaac gccccaaatt    157200
     ttgaatttct ctatgcgttt gccaaaaatt gctgttatta tgccgattaa catcatcaca    157260
     acagccgcca taatagctgc ggaattcaca gataataaaa agcgcgatgc tgaaatgata    157320
     atagctgata caatcgcggg aatcggccca ccataaaagc ctaccattat tattggaatg    157380
     tgacgtaaat cgacaatcac attattcgaa attggaatcc cgaaaaccat cagcgcaaaa    157440
     ccgagaagtc cagcccaaat tccgattact atttttttat ttgttgataa ttcttttgta    157500
     attggttctt tataaactaa ggaaataata taaaagcctg cgagcaatat cgctgcatta    157560
     cttaccaact gttcgaccaa aaagcatccc cgcctctcac tttgttactc aataccccaa    157620
     tatgctcaca actattcata cgcataaaga aacaacctct gcaaaaatag acgctgtccc    157680
     aaagctttat tcttctattt tctcaaaaaa agtccacaaa agaaaatgat ttcctttgtg    157740
     gacgaaattt ttattagtaa gctgtccaac ctgcatcggc tgtgataact gtaccattaa    157800
     caaaactaga gtcatccgaa gctaaaaata gcgcgacttt ggcaatttca gaagcatcgc    157860
     cagctcgggg gttaatcccc attccaatca tggcacgttc ttggccgaat tcatccggcg    157920
     cataaatcgt tgttccaatg tttgtattta cagctcctgg cgcaattgca ttacaacgaa    157980
     tgtttttatt cgcatattgg aatccgacat ttttcgtaaa gcccacgacc gcatgtttgg    158040
     aagcagtata agccgctcct gctcttgaac caaatagtcc gccagcagaa gcaatgttaa    158100
     caatcacacc ttgtcctttt tcttcaaaga tatggagtgc ttctcgagtt gcgcgcatga    158160
     caccagttgt gtttatcgca aacactttat cccaaagttc atctgttaat tcaccagctg    158220
     gtacaaaatt atccataatt ccagcattgt tgactaaaat atctaatgtt ccaaatgcct    158280
     caatagcttg gttaatcata ttttcaatat cctcttgctt tgttacatta gctacgacgg    158340
     caagcccagt tccgtgttct ttttcgacta gttcgactgt tttttgcgcc gcctctaaat    158400
     tcaaatctgc cactactact tttgcgcctt ctttagcaaa aagaatcgca atttgttgcc    158460
     ccattccaga tgccgcacca gttactacgg ctacttttcc atttaatttc cccattgtta    158520
     tttcctcctt cacttttgtt ccgctagaaa aagaaatcat tccctttcta tttttattat    158580
     aatcccggta taaaacgctt tcaatatgta aagaaagcct gttttgttga ttaagcaaca    158640
     cttttgcgtt atatgtatag taataagaaa atttctcaaa tgggaggttc taaatcatgg    158700
     atagacgggt taaaaaaaca aaaaaagcct tcaatcaagc cctcttcaca ctacttgacc    158760
     aaaaaccctt tcagcaaatt acgattacgg atattgtcac agaagcagat gtgaatcgcg    158820
     ggacttttta taaacactat cgtgataaag aagaactgtt agatagcatc attgaagaaa    158880
     ttctgatgga cttaaaaagt gcctatcaag atccttattt acatacaagt catttttcta    158940
     ttcaaacact tacaccatca atgataaaaa tatttgatca tgtgtatcat catcaagcct    159000
     tttaccgcca agtaataaaa tcgactattc ggcccagttt tcaaaatcag gtttgtgacg    159060
     ttattcgaga gcttatatta gatgatgttg cgagtttccc tgatagttca gaagctaacc    159120
     tccaactact agccacttat caagcgcatg cgatttttgg aatgattgtt ttttgggcag    159180
     aagaagattt ttcgcattcg ccagcatata tgtcggagca attactttat attattcatg    159240
     ctaaaacaca acaagtgtaa tccttacata tttgttatgt tactttctag ctttgtcact    159300
     tgaatcgagg gcgtgagctg ttttcccttg ttataatgaa agcatattag aaaggtgtgt    159360
     tgattatgaa tgatcatcga attttaaatg ctttaagtta ttttagtatc ttgtttgcac    159420
     caattattgt cccggtgcta atttggatat ttgctaaatc agaagaagtt tcgcatcatg    159480
     ctaaagttgc tttattaact catattattc cgactatcgc tggattcctt tgtttctcaa    159540
     gtatttttgt tacagctacg acaagtggcg gcttactcgc aaatgtatca ctatttgtta    159600
     ctggtagttt gtttgtattt acattagttg ctgttgtcgg actatttatt tttaacattg    159660
     ttcgcggcat tcaaatgtta tgtgaaaaaa cagaagaaga tatttggatt taatcaaaaa    159720
     agtggctatc ctttgtagga tagccacttt ttttaatcat ttattttttt tgattttctc    159780
     aataagaata gtcccatgaa gctagcgaat aatccagtaa agattattcc atatggagac    159840
     tcatctcctg ttgaaggaag acttgttttt actgtaggtt tcttcgccgg gtctaccggt    159900
     ttagttggtt ttaccggtgt gactggttta tctggattta ccacgattgg cgctttgttt    159960
     ttctcgtata caaaggttac tttttgttcc gtttctttga atacgccctc tttgttcgta    160020
     ggttgttttg ttaatttata acctttgata tcttttgctt tcgttgcata tttatcgcca    160080
     acgatgccag tgtgaatttc tttctctgct aatacattgc cttttgtgtc aacaaattct    160140
     gcgatgactt ttccgctcac aactgttttt aggttcgttt ttgttacttg caacgtttct    160200
     ttttgatcga aagtgatttt cacatcaaca ggaactgtat ctaattcata gcctgctggt    160260
     gcttttgttt caatcaattg ataatctcca ggtgctaaat tagttatttc tagtttccca    160320
     gatgcatccg tagttaagtt ttctgtaaca ttattatctt catctactaa tttgaacgtt    160380
     gcatttgcaa gaagtgcttt cgtctcacca tctgttttag ttagtacaac agatccagta    160440
     gacatcgtgt ttgtttttgt cacttgaatt ggtgcttttt ggttgaactc gatggtgaat    160500
     tcaactggtg tagcatctaa atcataacct gttggagctt tcgtttctac taattgataa    160560
     tcacctggtg ccaagttatc aatttgcagt tgaccatttg cttctgtcac tactttgtct    160620
     ttcaaactta ccccaagttt tgtttgtagt tcaaattctg caccagctaa attacttctt    160680
     gatttactat ctagcttagt taagaccaca ctaccagttt tcgcaacatt ttctttagtt    160740
     acatttactg cagttgcttg gttaaattcg atggtaaagg taaccggtgt tgcgtccaac    160800
     tcatagcctg ttggtgcttt tgtttcaacg aacttgtaat cacctggcgc taaatctgtt    160860
     acttctagct taccatccgc attcgttgtt aaattatctt ttactttagt tccagtggca    160920
     ttttgtaatt caaattctgc tcctgataaa gtagcttttg aaacactatc ttctttcgtt    160980
     aaaactacac tacccgtttt cgctgtgttt tcttttgtaa caattacagc cgcttcttgg    161040
     ttaaattcaa ccgtaaattt cgttggcgcc ccatccaaaa catagccagt tggcgctttt    161100
     gtttctacaa attggtaatc gcctggcgct aagtccgtta cttcgatttt accatctgca    161160
     ttagatacta agttatcagc aacttttgta ccgtctgcat tttgcaattc gaattctgct    161220
     cctgcgatag catcttttgt tgcgctatct tcttttaaaa gaactacgct accagtttgt    161280
     tctgtgtttt caatagtcac actcgtcgct atatcggcgg taaccgtgat ttctttacca    161340
     tctttgtatt catcactaat tgtatatcct gttggtgctt ctgtttcaac aagtttatat    161400
     tttccggatt gaagaccatc cataacgatt ttcccgtccg aatctgttgt tgcctcttgc    161460
     cctgctttgt ctccttcaag cgtataaagc tggaatttgg ctcctgttag tttttttgaa    161520
     ttatcctttt tatcaacttt ggtaatttca agtgaaccaa ttgtcgccgt cccgctacca    161580
     ctaccaatag tgaaggctgg cgatatgctt gttgttcttg atttatacgt cattggtaaa    161640
     ctaccgtagt caggagaagc agttgtcgct gtgttactaa ctagcccgga cattaagctg    161700
     attgtactat aggttacttt aattggtgca gttgctttat agtctttgaa ttggatagtg    161760
     aaattattgt ctgtgtaagt gatgtcataa tattttgagt caatatcttc gcctgtcgtt    161820
     tcattcatta ctttaaagct actttttact acttgtgctc cagttgttcc tgttttcatt    161880
     gtatctgtaa ttgttgggtt gttaatagga cgatctgctg agatgttgtt aagtgttaca    161940
     atccagttaa ctttattatc aaaagatgga tcgatcgtag ctgttttggt catcgcatta    162000
     aaaagtttgc ttgcgtatgc ttggtaacta tatgattttt cgcctactcc attatcgctc    162060
     accttcgcag tgttttgtac gtaggagtag aaataccagt tttcgtttgg tttggtactg    162120
     tatttaataa atacgcgtga attctccaag ttagcaaatt ctaaatgtaa tttattccca    162180
     gttgtatcga cttttgttgg atagtttttg tcacctgttt tggctactgt tccaacagag    162240
     ttaagtggga tatatagatt catcatctca cttgtggaag ccacattacg atattgtagt    162300
     gaaccttcta cgtatgttaa gccagttgga atagcatcgt caaaaatcaa gttgtcgtag    162360
     tttttcgcca tagcatttac agatacaatc caatcgatat tccccgtagt tgaattgtat    162420
     gatccgtact taccaccatt tgtcatcatg cctggatctg gtgtcattga agcagttacc    162480
     tcatcaacat acttgataat cccgccatcg taataagaaa tggatgcttt attatcaatt    162540
     gtttttgtta catcagaaag gtcaatatct gtgacgaaat caacaacaat ttttttgtct    162600
     gtcgaagcat aatcgccgat aagttggata taaaaaccag ctggcgtcac atctttatca    162660
     atcgtataat ctttgccttc tgttagtaat acgctattgg tattatctgt ataggcgcgg    162720
     acagtgtaac tcttgagggc ttttacccca gtagaaaatt catccgtaat attaagattc    162780
     cccatcttaa ttctgtcgga gttagcagta attttccatg tcatcgtgtt attaaaatag    162840
     tcaattgttc cagcttcttt tttcagtaaa tctggttgaa tcgcgatcgt tgcgtcagcg    162900
     gaaacaccat tttcatctgt aatttcattt ttaattttac gatcactaaa gtcggtgatt    162960
     ttcgtagaat aagtgatttc atatgcgttg gtattagtgt ttttatacgt taaattaaaa    163020
     ttcccatttg ctgagattgc tgaggttgtc caatcacttg aagcgtcact tccaacgatt    163080
     ggcgacccgt tagttgcgtt aaaagttact cgtttaattt taagtgaatc tgctacatat    163140
     tcgacatcgt tatccgctaa aacatcggta agcactgttg aaggagatat ttcgtcttga    163200
     tcaaagttaa agttaatttt ccaatcaata ctttgtgttg agccgttgta agtagctttt    163260
     ttctccagat gcttataatt agtcatcgtc aggtaaacat aagcagagtt gcttgataat    163320
     gtccctgcat cgcctactgt gtaagcttgt gtagacatgt aagaaagtga atcacttggt    163380
     ttattgattg tacggtcata tgttacttgg tagcctttcc cagcaagccc accgtttaac    163440
     gtaacagtta gagaagttgc ggaataagtt aacgtatagt ccgtgccttc tacaagtaat    163500
     tttttcgtac caatgaaggt tcccccagca ctaacatcac tcgaatatac tttgatgcta    163560
     tctttatcaa tagttgttgt gccaccggaa gtataatcag taagtttcag ctcaccttta    163620
     gcatcttttt cttttgttaa gttgaacttg gcatccactt gccctttagt tggattcact    163680
     accccaggat ttgctgtaat tgctacagta gttggatagt taactactgg tacaacttca    163740
     atttgataaa tagtatcttt cccagctgtc ttgaaaacaa cttcttgtat cgtttcttct    163800
     gttgatgtaa atactttaaa agcggtactg atattcacat cataatcgcc ttcttgaata    163860
     ccatctttta agaaagtaat cgtaagttca cgcgttgtaa catcaagtga ccattctgct    163920
     tctgttgaag gcaagaagtt cccacttaaa tttttatttc caaagttgaa agcatctggt    163980
     aaaacggtag taaatgtatc tcccgcttta taatttttcc ctgaaaatgc aaagttcatg    164040
     ttaagcacaa ctccgctacc attttgaatt cggtccgaag tattgatttc atcgccattg    164100
     ccgtctttca gtgttacttt gttgaaaata ttgtctgtaa tagcagcttt tagatttgca    164160
     ttttgtgttg cttttttaac cggtgttgct gcttcttttg ttgtttcttc ttgcactttc    164220
     gctgaaacag aagtaatcac ttcttctttt tctgttaaag ttacactata ttctttttca    164280
     tctagcgcgt agccttttgc tgcaactttt tctttaacta gataatcacc aggtaaaaga    164340
     gaatccatag tcgcttcacc atttgcactg atggttaaat cacttgtttc acttgtttct    164400
     ttattcttta tctcaaaggt agaaccattg attttttctt ttgtatcttt atcttctttg    164460
     attattttta atgttgtgtt tgctgtttca tcgtctgtca ttgtagctag tacaggtgaa    164520
     acgttttgga atactagtaa tcctataacc attgcaataa ctagcttctt ccagtgtctg    164580
     atatttttca ctttgttttg tcctcctata atctatttct aactattgtt aaatctctaa    164640
     tagacttgtt gaattgtaac aaataaacgt actaaaaaat cacttttcat gaaaataaaa    164700
     aacggtttgt gtcttttttg tgaccaaaag taatcaaaag cactcataaa caattaaaaa    164760
     acttgtataa atcacctttt cttcataatc acaaaagcac ctgaaagcat gaaaagtcca    164820
     atgataaccc ataaattagt tgtagtagag tctcctgtat gtggaagttt tgccaacttt    164880
     ttcacgtttt cagttccctt attagaagac gaaattgata gattgcttgt cctttcatac    164940
     acataagtta ctgtctgtga ggtattcaaa aattttccag ttgcattttt tggagtctga    165000
     tataatttat accctgagat tttttttgat gaagttgtat aacttgaatt taattttccg    165060
     tttaagacaa tcgaatcagc tattttttcg ccatttttat caacataatt gacaatgatt    165120
     cttcctgctg tcactttttg ataaataaaa gtaattgtct gtgctttttc gttaaatgtt    165180
     ccacttacat tagcaggtat ttttacaagc gagtaattgt taattttttt ctgttttgca    165240
     gtaaattttt ctccgtaagc tcctgttaat gtttctgggc ttgcaatttg tttgtggttt    165300
     tgatcaacat attgcaccgt aactggagca acactatcat ctaaagccac tcctacttgg    165360
     gccggctcaa ttacttgaga attatttaca gcaacagcaa aagaattcca tgcagctctg    165420
     tcttcttttt tcgtttgttg ctttaaaaga gtcttatcta tttggttttt ctttggtgtt    165480
     tttaaatcaa attgaatttt catggatttc ccaggaatcc actcaatacc ttctttaagt    165540
     tctattttaa aagagtaaat atttgaccaa tcttttactt ctgacgctgt taaccaatct    165600
     gcttgtgttg cttctgtgtt atcgactaaa ggctccgttc ctattgggta aatcgtgtgt    165660
     ttatcaagaa tccctgcacg cttaggattt ttagcagtac tataagttac ttcgacttta    165720
     tctttccatt ctttcggaac ttctacagct ttcgttaacg caagattgaa tttactacca    165780
     cgttcgctgt tatctgtaat tcctaaatca ttttcacttg gtaaaacatc cattaagacc    165840
     atattagcta ttttttcatc tgaatcattt tccagtgaca attgatacga aacaatggaa    165900
     tttgttgtgg catttgccag tccgctgtat tctttatcgc gattaccctt agctttttta    165960
     ctaattttca aatgattact cgtatttaaa atgtaatgat ttcccgatgt gattctagac    166020
     tcttccgaat tcccattttg attaatgtca tttgaatcaa tttccatttt tgtatcagaa    166080
     attgttggag ttccactcac ttctggcaca ttgaaatccg tgtcctgcaa gaaaccaaac    166140
     atctcaacag tcatattact tggtgtgtct tttgctacac tcacattaat ttttgccgtt    166200
     aatttttctg ctggtaaaag cgtcttttta tcccatttca ctttgagtag ttgacgtcct    166260
     gcgttttggt aattctcgtt caacacagtt actttaaagc cattttgctc cgtgtttttc    166320
     attttgaccc cagaaggtaa taaaaccatt gcttcaaaag gaccttttaa tcgtgaaata    166380
     gaagctttat tgctttctaa attaacagaa atagaattat cacctatgtt gattaaattc    166440
     ccatcggtat catcaaacac aactgatcct tgtacaaatt tatttttacc agtaggttgc    166500
     ggaatgattt gcgctgttcg gtctcctgca taatttttcc aagcttccgg ccaaggattg    166560
     gtatcgtcat aataatggat atagtcttga ctatccgctc cgtacatgtt gatttgtgta    166620
     ctattcctaa cctcgcctac ataaccttct ttgactgttg taaagaaaga tagatcagca    166680
     gcatacattc cagctggtgc atacgtgaaa tgaagccata ctttactcac atgtttatca    166740
     tctggaattc caagatcttt tctcgaatac attttgctca gttctacatc ttcttttaac    166800
     gtagtccagt cagtatcccc atcatatttt acgagtaaat tgtatttagg ggattttttc    166860
     aactgagccc aacctgggta attaacattt ggtttaaaat aaaaatcgcc actccggaag    166920
     taatccaaat ttaaattatc atcaatattg tagtaagcat cataataaag gaagtcgtac    166980
     caaggtgagt cattcattgc cgaatttaac atcaaactaa agcctaattt agcagtatca    167040
     tatactttta tatcaggatt tccggtcaca gtagcgattc cccaattcgc atccaccggt    167100
     cctctgtgtg ctggagcata aacacttcca atagttggcg ggattgtcgc tggatcactt    167160
     gctgaaactg aaacagatgc tttggatgta tctacaatgc tatcagtcaa agtaacaaag    167220
     ttcgttgttg caacagcttt attttccacc gttgcaaaat tcggtatagt aggttggaag    167280
     aacgttctaa tttggaaagt cttgttaagt aaactgtttg ctttttcttg ttccaaatat    167340
     gtaggtgctg caatttccca agttagtttt tgtccttcga ccttcgttgg ttctggtgta    167400
     tctcctgcta cacctaagta atctagctta tctgctaatg tatactcaat aacaattttc    167460
     ttaccttctt ccataaaaag gcttcctgta gactttttcg gaatatttag gttgaaagac    167520
     caaatcccga tgtcaccttg actcggatta ttattgatgc tattttctac cttagtaaaa    167580
     tcatttgata aagctgttgt ggctgttgcg ttgacagttg tttcagcttg ttcagttact    167640
     ttttcagata aattatctgc gcttaattca cctgttacta ctaatttcgt tccatttggt    167700
     gtgtaaccat ttttcgtagt catcttgaga atcactttat caactacacc actgtttagt    167760
     gtttgatatg tgtaaacgag ctgacgagtt gttttgttat aacttggtgt tgctcccgca    167820
     atcttaagtt catttagtga ttgattaaat tccccatttt ttggtaaatt gattaccaat    167880
     ttagcatttt ggtaccttgt gtttggtcca gtgattttta aataaatatt atagtttacc    167940
     gtctgaccag attcaatcac gtctttttga gaattaatac tgaagtcccc tgaataattc    168000
     ccagttggaa atgattttgc gtttattgct ttatttactg tggtcccttt taaaggctct    168060
     gaagtagtct catttgaagt cgtttcctgc gtaacctttt ctttcgtagt tatttcttct    168120
     acgtccgttc catccctttc ttgactatct gcccaaaccg aaaatggaag aagtgaaact    168180
     atcagcaaag tacaaattaa tatagatact aattttttca aatgattcac attcgcccct    168240
     cctttgttta ctcaagatta attatttcat aggaggaagt ggctaaatgt tctcaaggta    168300
     caaaaaacag gacagtttgt tacggaaatg tgaactattt tacgtttata ttcacataaa    168360
     tgccattatt aacaaaaaat aaccaaaatc attaaataaa ttcaacgatt ttggttattt    168420
     tatttatctt attcgaatcg attcgctttc aactaatcta gcacccttta cttcctcacc    168480
     agattttagt atctctgcaa ttcgcttttt atcaatttta ggttcttgta gtaaaaagaa    168540
     cggttttagc aaagcttctt ccactatttc cacacttggt ggattctttt gtatttgaat    168600
     tgtaaaaagt gtactgttta tttttctaat ttccattcgt tccatctctg tttgtaaata    168660
     gttttttaaa ttttgaacat tattttctag cgcttgtttt cgttttaaaa gtcgtttcgc    168720
     ttctattcct gccatttcag catcagcagc taaagactta ataattttaa caatattctc    168780
     tgatttatca tgaaaactat cagtaagcgc atctaacgta tctttcacag catcagtatt    168840
     attttcttcc aaaaattctt gtacttttaa ataattatcg gttagttcat ataatttcat    168900
     cgttcgcacc ctttccaaaa aaggaaaaag cgccaaaagc tattatattt tggtgctttc    168960
     tcattttgtt actaattttc cttgaataac catacgtcct ttttcataat ctttttctgt    169020
     atcgcaagtt gaaagtgtta taattcggtc ctttccactg acttttacat ttgatgtata    169080
     cacagattgt tgttttactt tttgcaaata atcctcaaaa tccgttgttt ccggaaattc    169140
     tgtttcaatg tagtaaaaat ccgtcgtcgt ttcatacaca gcaaagattt ccacttcata    169200
     attcgttaag cccgattcat aggaaaacgt tggatgtgcc accaaaaaat ctttgtccaa    169260
     gtatttacgt aaatccgcaa acatggatcc gtccttcata ttatgaccat aaataatcgt    169320
     atttttatcc aaaaactcat tcgtattccg ataatcttta aaaatactgc ccgcgcgcgc    169380
     cttttcattt ttataattgt ggtgtaaata gtaatcatta tccttacttt gcaaaatcgg    169440
     ataatctatt tccgtatcta taatcgtcag ccacccaacc atatctttat ttaacttttg    169500
     caaatctcta agttcatctc gtacttcacc attcacattt gtagtagcgg catcctttgt    169560
     gtaaacagct ttcgcatcat ctagaatcgt ctggttatgc ttattttcat acagttccat    169620
     accaattttc catccagaaa aaagaaaaac ccctaacaca accaaggtca aacttttccc    169680
     caaaaacgat tttattttca ctctctaaaa ctcctttcgt ctttgaggaa caatgtattt    169740
     cccgttgttc gcatcgttta aaacatctgc aactacacca taagtttcag caatcaaatc    169800
     tgttgttagt aattcttctg gttctccttt tgcaaccact tccccatttt tcatcacaat    169860
     caaatggtca ctatacatca gtgcttggtt taagtcatgc aaaatcatta caatagtcaa    169920
     attttcttct tgatttaatc gtttcactaa ttctaaaatt tctagttgaa aatacatgtc    169980
     tagaaatgtc gtgggctcgt ccaacagcaa aataggtgta tcctgaacta atgctgttgc    170040
     tataaaaaca cgttgccgct ctcctccaga aagactatca acaaatttct ctgctttttc    170100
     agttagctcc gtttgcatca aagcccgctc aacagctaga tcatcctcct tcgtccgagt    170160
     cattcgccaa tttttataag gtagacgacc aaagtaaagc aattccttca ccattagttc    170220
     attcggaaga acattacttt gatgaacaat cgccacattt tgcgcaaatt cttttgcttt    170280
     ccattcaaaa atcgattttc cttccagtaa aacatcccca gaattaggtg aaaggagtct    170340
     agccaaaatt tctaataagg tagattttcc actaccattt ggcccaacaa tcgtattgat    170400
     tttatttttc tggatagtaa atgagacatt tttcaaaatt gcatcggttc cattataact    170460
     aaaattaacg tcccttactt ccataaaaat caccctttcg cattaaaaag attaagaacg    170520
     gaccaccaat aataagcata atcacagacg cagggatttc catttgttga aataacgttc    170580
     tgcctatagt atccgcgaaa agtagcaata aagccccaaa taatatcgaa aacggcacaa    170640
     gtatttgata atttccacca actagttttc ttgcaatatg tggtacaagt aaaccaacaa    170700
     aagcaataac acccactact gccgtggtaa tcgatgcaag gagtacagca atcaacgcta    170760
     gccatatccg cgttttatta actggcacac cgaatcctct agccatttta ttttcaagac    170820
     ctaacacatt gcaccattta gcaagtaaga gcgcacaaat cagtccaatc gttacatata    170880
     ttaataaagt ttccacatca gaccattttt tcattgccaa actcgctgca ctactggcag    170940
     attgactaga aacaagcgcc acttgcgaag ataatgcatc actcaatcct gtaaaaactg    171000
     catttattgc aataccaata ataataaaac gaagcggatt aaaatcagag cgataactaa    171060
     acaaaaagac tagaaaacaa gcaagcgcac caccaataaa agaaaaaagc ggcaaccaaa    171120
     aatacaattc tggtaaaaat aaaatgatga caaaactaaa aaatttagct ccagctgaaa    171180
     tcccaatcac accagcatca gcaagcggat tccgcattac agcttgtaac aacaaaccag    171240
     aaaccgaaag cgccgcacca gcaagaaggg caataataat tcgcggaaag cgcaaatcaa    171300
     taacgacatc caccatttca tttccaccac taaatatccc acttaaaaaa gctgggatgg    171360
     acatcgacaa actccccgct tgaactgccc acaaaatagt cccaatcaat aaaacaatca    171420
     cagcgccaaa agaacttttt tgcttaattg tcataaagca tcttttccat ttcctttagt    171480
     gcttctggcg cattcaaact tgctgtcata ccaaataaat tttcatccaa atcatacaca    171540
     cggttatttt tcaccgcatc aaaatgtttc caaatatcat ttgttttaaa ttcttcgtca    171600
     aacattttaa ccacttccgc aggcatacca tgagccgctc gcaaaataat atctggatta    171660
     gcgctttgta agtattctgt attagaagct aaatattcta ctttttggtc cttaataaca    171720
     ttttctcccc cagcaagttt gaccaaatcg ccaatgtacg cgtgttctgt tacaactaag    171780
     taacttcccg gaacccccat aagaatgagt acagtcggct ttttcttttt cgccacattc    171840
     gacttcacct gatcaatatc acttgttaaa tctttgttta atttagttgc ttcttctata    171900
     cgatcaaatt tggccccaag atttttaatt tccgtttgca ttgaagcaat actcgtaaaa    171960
     tctaaaaaat ccgcttctaa atctgcccct tcaaaaccac tcttcaagtc cgcttctagc    172020
     gtttttgttg aaaggaccat gtctggcttc aacatccgaa taatttccaa atcaggcccc    172080
     ataggcgacc cagtttcctt tacatcagca taacgtttcg gaagtttttt tgaactagac    172140
     ggaattccaa cgaggggcaa atcaagttta tccataattt ccgtaatcgc aaccgtcgtt    172200
     gccacaattt ttggctcttt atccgttttt tgttcaggct tttgagccgc ttcttccttt    172260
     ccgcagccaa ctaaaaaaag caataacact aaagatatga cagccatttt cctcatcact    172320
     aattccccca tttataaaat aaaatcggta aagcgagtta agcaaaggat aaccccgacc    172380
     taactcgctt ttactagttt tattaactca atcttttacg ttttaatcga taagctaaat    172440
     aaaggaagga tgctccaaat aatgtaatat accataccat acttgatgaa tcattcgtct    172500
     ttgcattttt ttctgtctta cttgctgttt tttgaacaga atttgtatca tcaaaatccg    172560
     gttttgccaa ttttggtcca gcattattgt tactcgctac attaccagta tttaaaatat    172620
     cttttttcac aggttccttt aacgttacat ctttccctgt aatgtcttta atcgttgctg    172680
     catttagttt tacttgaaca gtatactcat ggtcataaga aaaacctggc atatcttcaa    172740
     ttaatacatg cgtttttaca tctgtattag ccgtaccatc tttcacagga tacttgacgg    172800
     ttctcgtatt tttgttgata tctccggaaa caacttccat atctttccaa acaccattta    172860
     ctttatactg gaaggtttta atccaactac tgtttgttaa agttaaataa acatagggtt    172920
     ggttattttc aactttgatt aaagctggct tcatcacata gctttccatc atggaagttt    172980
     ctgttgttcc atctttaaat acatcaaaat caatcgagta cgtatggttg ttcagtagat    173040
     ttttcggatc aactactgcc ggtttacttg gtgttgttgg cggtgttgtc acaggtggat    173100
     tcgttgtacc tggatcaggc tttgtcactg gtgggtttgt ttcaccagga tttactacag    173160
     gaggcgtttc gtcactacct gggtatgaac ttgctgcagt tgctttcgct gtgtcaaaaa    173220
     cataacggaa gtctgcttgt cctttgtata cagaaccatt gaaaggcgct tcataattaa    173280
     catgagccgc aagtggttga tttaagtcct ccacttcaaa ctccacaata cgtgtattag    173340
     catctttatc ttcagaaaca acttttacat cttgtaaagt tccagcaaga gttgttttta    173400
     aagctgttac tgttttatta tcattaactg tcattgctac cattttctta ccatttttca    173460
     ctttcaacca agcaggattg ttaaaataat tttgcatgct tgaattgcta tcatcatttg    173520
     cttttttcgc tacaaacgga atcgtataaa ttccatccga aagagtcaca ggtgttgtaa    173580
     cagcaggttc tgagatgact ttgaaagtac ttggatcaat agttaaatcc acttgatacc    173640
     agtgatcata actaattgca tctaccttaa tatgcatata ggagaaaata acatcatcta    173700
     aagaactaag cttgaatttc tctacacgcg tatcttttgc tgcatcagtg ctcactgttt    173760
     gaacatcttc ataacggtct tggtaaacat ccgcttgtgc gggtttttca ggacgagttc    173820
     cattttttga aaccgccatt gtttgccacc aagtactatt tgtaattgtt aagtacatat    173880
     aaggttgacc attttccact ttaatcgttg ctgtatggtc aatatattta tctgcttctg    173940
     aagattcttt cgttgtctta ccagtattat ctttataaaa attcacttga acttggtatt    174000
     ccccgccatc tttcagacga gaatcagccg cgctggcaaa tccaggtatc aattgaaaaa    174060
     taagtgtcaa agctaagaaa gctactaagc cttttttcca taatttcttc attataatcc    174120
     ccctttttat ttaaaaatcg cacgtctttt aagtaaaatt aaccctgccc cagttgcaac    174180
     aaaaataatt ccgtataaaa acatttggct agaatcacta gactttggat ttgttacttt    174240
     attacttgaa tcactctttg ttgcgggtgt tgttgtatta ttatcagaag atttcaccgc    174300
     tccagctaat gcttttgcag atccttcatc gaaacgtaac ttgatttgat attcatgatg    174360
     ataattcaag tcgtcatcat caatatccac tttaattttc gcattaacag gattgcttaa    174420
     agtcgacaca ggaaacgaaa cttttctagt gtcacttgat gcatttttcg aagtcacact    174480
     aaccgcgttc ccttcaaccc ataggcccgt aatccactta ctatggttca cttgcaagct    174540
     aacagttgat ttccccccat ttactgttac cgttgcaggt ttatcaaaat agtcattcgc    174600
     catagatgcg gaatcactat ccccttgtat caccgtataa tcaaccgaat aggttccatc    174660
     cttaagtgcg gcttgtgccg ttaatccagt agaaagaaac gaaaaactga ataaaacgat    174720
     aaaagcagca aaaactaaaa ctttcttcat tcttaaatct cccttcttta ataaaaacta    174780
     ctatttataa aaaaccccca caaacacaag tggagtaaaa gtttatgtaa aagtatacgt    174840
     taattatcat tttaattgat aatgattatc attgtcaaca acagattatt tttttactaa    174900
     ttaaatactc aaaaaaacca tgaatagcaa ctcctatcca tggataataa ttatttccta    174960
     ttactcttct atttgagaaa agcgatcata taatagttcc ccttttaacg ttaaagtata    175020
     tcgtttttct gcaatattat tatttctaat taaaaaacca ttctcctcta accaataaag    175080
     agttaataac acttcatttt ttgtatagtc ccgcaaattc ccaaaatcaa tgacctcaag    175140
     cgacatatca ttaattttcg tatccacact tctggcaaaa agaagaactt ctcgtagtaa    175200
     tctttcatct tcaaattcca tctttagtcc tcctttaatt ctgagttagt atcgtaataa    175260
     cgtaaaaagc cgtagcaaaa tgccacggct tcttacagcg caatcaaaag gagaaattca    175320
     cacaatcaaa taaagggggt atttgtttgt gatttatttc acggttataa tataccatat    175380
     aaacgcttat aattcaatag ttcacatacc tatttttatt tgtttattcc atgaatactg    175440
     acaccactta ttcatacgaa aaaaaagaca cgcagccatt attgctactg tgtctttttt    175500
     tagtaaattt cacaatgtgt tatttaacca gctcttccaa ttcatccaat ttttgttcaa    175560
     atacctttaa tgcatcatct acgggattag gggtcgccat atcgacacct gcttttttca    175620
     acacatcgat aggataatcc gaacttcctg ctttcaagaa atcaatatag gctgttacag    175680
     catcttgacc ttctgttaaa attttcgcac ttaatgcaga tgctgctgaa aaaccagtcg    175740
     catattggaa cacataataa ttcatataaa aatgcggaat ccgagaccat tcataaccaa    175800
     tttcagcatc ataaaccatc gcttctccgt aatatttctt gttaatatca aaatatgttt    175860
     ccgtcaagaa atccgcagtc aaagccactc cttgttgatc cgcttgatga atggcatgtt    175920
     caaattcagc aaattgcgtt tgacggaata cagtaccctt gaatccatcc aaatagtgat    175980
     tcaacaagta tgcacgaact tttggatcat catatttctt aagcagataa tcagttagta    176040
     aattttcatt cgtagtcgaa gcaacctccg ctaagaaaat cgaataatca ccataaacaa    176100
     atggttgatt ttttcttgta taataactat gcacactatg tcctaattca tgtgcaagcg    176160
     tgtaaacatt attaatatta tcttgccaat tgagtaaaat ataaggattc gtactatatg    176220
     aaccagaaga ataggctcca ctacgtttcc ctttattttc catcacatca atccaacgac    176280
     tatcaaatgc ctcttttaaa atcgcttgat attcatcacc aagtggtttc agcgcctcaa    176340
     gcacgagttc ttttgcttcc tcataagtga actccaaatt aacatcatca gaaagtggcg    176400
     tataaaggtc atacatatgc aattcttcta agccaagtaa ttccttacgt aacttcacat    176460
     aacgatgaag caaacttgca ttagcattca ctgatttcaa caatgagtca tatactgttt    176520
     caggaatatg attaccagag agagccgctt cacgagccga tgtataccct cgcgtagaag    176580
     cataaaaatt agattttttc acttgtccat ttaaagtaga tgctaatgtg ttttttaatc    176640
     cttcataaac tgaatacaca ccatgaaatg catcacgacg cactcgtgga tcattacttt    176700
     ctaacaattt cccaaaacgg ccatgagtaa tttcgatatc ttccccattt tcatctttaa    176760
     tagttggaaa cttcatatca gcattattca aggtattaaa agtattggac gaacttccaa    176820
     gcacttcacc tgcattagct agtaaagcct cttccttctc actcaaaata taaggtcgac    176880
     ttaaatttaa ctcttccaac aaatgatcat ataattgtaa atctttattc tcatctaaaa    176940
     attgttttag aacattttca tccatagcta aaatttctgg gtcatagtaa gagagtgcag    177000
     acattagctt tgtaactagg cttcctgcac gactatgtaa accttgatat ttcgcattag    177060
     ctgtatcttg gtccattttc aaatgagcat atacatataa gttactaatc aaatcatatg    177120
     ctttatctcg aaattgaagt gcttcataaa gtgtttggct actttccgat aaacgacctt    177180
     taaattggtc gctttcctct gtgatttttt gcaaatccgt aaatgctttt tcccatgctt    177240
     catcattcgg ataaatcgta gtcaaatccc aagttagatt ttctggtact tcttctctta    177300
     aaggtaatgc atttgtttta ctcaatatta aaacccccaa ccatagtcat tttgttttta    177360
     ttatgagcca aaataactaa aaaagcaaaa cagatgatta tatatgtgct gctcgaatat    177420
     tagtaaaagc cattttccgt ttcacacgat atcgattatc tggtatggta gataacaccc    177480
     cttcaccaat taaataagaa agatatgact ttcctaactt caaactttca tttggagata    177540
     accaaatagt taatatctga cttacaactg atttgaaact ctctaaaaaa ctttccacac    177600
     taaaggtatc tcccttctct agacctttaa aaaacttttc ccacaaatca aattgccatt    177660
     caacagcagg tgtcaaaact aaaaattgtt cttctacatc caccccaatt tctttcggta    177720
     aatagtgtaa ataatagcct gcattaaaca atttttgcat aaactggcca tgttttttat    177780
     atttagcata gtaaaaacaa attttttgtc tttctatttc cctatctcgt ttaatgtagg    177840
     cgtgacgcga aataattcta gctaacttct tattccattc cctcaaaggc gacttcatag    177900
     aaaacttcat ttcgcttgcg aaaaaacgat tccctttttc aaatgttaga tgataataaa    177960
     gcgtgcaaat ttcacgctta gcagaatagt gccaaaaatg ataacccaat ttcttatcag    178020
     attgaataaa ggcttgttgg aatgcagaaa gacaaatacg ccccttctcc ttcttaacta    178080
     cttgcccgag tatccagtga acttccaagc caattgataa gtagtccatt gtgcgttgaa    178140
     tcatttcact aattgaaata gaagaacgct gaaattcaat tactgtcttt ccattcacaa    178200
     aaatatctgc ttgtcgatta atttccggaa agtaactttc tatttcaaca gggatacgct    178260
     gataacaaaa ccaggccatg atttgctttt tagcggctaa atgttcctca ctttctcctt    178320
     cagaagcaaa cgcacacttc attgtcttct cgtgggcaaa gtgcggtatt tttatctgtc    178380
     ctgcttttat cattactggg cttgcacacg atttacaaaa cagtctttct tcttgcttga    178440
     ttcgttccac attcatctta gtaatagtaa aagtttctcc aatgttattt ctggctgtaa    178500
     aaataattat cactctccta ttagctcttt aatattatta ttcgccaagg agcatccaaa    178560
     ttcctttctt atttttaaaa tcacaaaaaa gacccgtttg gctatttttc agcacatacg    178620
     ggtctttaaa ataatgtttt agaagtgttt tctaatttgc tttaatgcag gaacgtcaaa    178680
     gattactttt ccgtactcag ctagcatata accagttaaa ttcgactcta aaccgtactc    178740
     aagcaaaata ctaacggcat tgtcaatgtt agattcatca tatttattct caggaaattc    178800
     tacattcaaa taatactttc cttgatacga gtatagctta gttactaaat tttcaagtcc    178860
     tgttgctcgt gaaagagaaa tagcatcttc aaaatcacgg aactctaaaa taaactctag    178920
     cgtatcatct tctccaagtg cttctttctt cactggattg aagttttctt cgagtagttt    178980
     ttcgattttt tcttctgcaa gctcatctgg cgagctaagc gtgacatcga agccatcttc    179040
     gccttttcca ccaattgtag cttttgttac gaatacttct aaaccatgtt ttaaggcttg    179100
     gacttgtatc cagagcggac cttctggaga gaactcttct tcatatttca gctcatccat    179160
     catatcccag aaaagttctt cacttttctc gcgatcatac caaacatctt cttggttaaa    179220
     acctcgctct tccaaatcca gataagagat ataaaacttg attgtatcct cattaattcg    179280
     ttcaatttcc atcgtcacac tctcccttcc ttcttagtca ttgacaatga agggtaaaac    179340
     ttaattggtt aaattcattg tagctcatat taagaaatag taccaccatt tttccttcaa    179400
     tttactaggt ggaatcttat cttagctgaa aagcgaaaaa atttcaagaa catttactta    179460
     aactacaaaa aaagcgccaa gaatccaatt gaatggaatc cttggcaacc acttttatca    179520
     atcttagtta accatttttt gcgcttcacg tagttgatac gtacgtacac ggcgcggtaa    179580
     gaaacggcga atttcatctt cattgtaccc aacttgcaaa cgtttttcat caataatgat    179640
     aggacgtctt aataagccag ggtttttctg gattaattca aatagttgtt gcaaaggaag    179700
     actatctaaa tccacgttca acttttggaa cgtttttgaa cgagtggaaa taatttcatc    179760
     tgtaccatcc tcagtcatac gaagaatttc tttaatttca tccaaactaa gtggctcaga    179820
     aaaaatgttt ctttccttat aagggatatc atgttcttcc aaccatgcac gagcttttcg    179880
     gcaagatgtg caactaggtg aagtgtataa cgttaccatt agacattcac actccttatc    179940
     gggtattgtt tcattcatat aacgaaattc tagcaatatc tctatttgga aaattcatta    180000
     aagaacttac acttcattat acactaattt tgtgaaattc catatactat tttcaaaaat    180060
     tttctttcca aatatgtaaa accattgtta gcaagccgtt atgtatatga tacccctact    180120
     ataacttgtt taaactaaaa tcacatgaaa aaaatagctt ttttatgaga atttcatgag    180180
     aattttaatt ttaagaaaaa acatcaacca aatttaactc tgattgatgt tttcatttta    180240
     tttcgcagca gcttcagcag ttaacttagc atgcttttct ttatacataa cttcttcttc    180300
     ttctgaacaa taaacaaaat gtccaggagc aatctcgcgc attttaattt catcgccatc    180360
     tttatagtta tgagacgtcg gatcatatgt tttacgcaca cgagtacgtt cataatttgg    180420
     atctggcaaa ggaatcgcgg ataaaagtga ttccgtataa gggtgtagcg gtgcatgata    180480
     taaatcattg gcaggcgcta actctactaa tttaccgaag tacattacac caatacgatc    180540
     actaatgtac ttaaccattg ataaatcatg ggcaatgaat aggtaagtta gatttttttc    180600
     tttttgtaat tgacgtaata agtttactac ttgcgcttgg atagatacat ctagagcgga    180660
     aataggctca tcggcaataa taaattctgg ttgaacagca agcgcacgag cgataccaat    180720
     acgttgacgt tgaccgccgg aaaactcatg tgggtaacga ccagcatgtt ctttacttaa    180780
     tccaactgtt tctaacaaat cgtatacttg tttattcgtt tcttcaggcg ttttagcaag    180840
     gccatgaata cgaatacctt cagcaatgat atctttaact ttcatacgtg gatttaaaga    180900
     cgcgtatgga tcttggaaaa tcatttgcat tttacgacgg aattcaagca tttctttacg    180960
     gcttttacgt gcgtgcacat ctttaccgtt ataaataact tctccaccag ttgcatcgta    181020
     taaacgaatg atagtacgtc cagttgtaga tttaccacaa ccagattcac ctactaaacc    181080
     aagtgtttca cctttataaa tatcaaaaga aatatcatca acagcacgta cttcacttgc    181140
     agtacctttg ttaaagtatt gctttagatt atgaatttct aataattttt ctctttgttc    181200
     agtcattcta cctctacccc tttcgcatgg acagcttgca tgccaggatg aagttccgca    181260
     aactgctctt ggcgacgtaa tacagcatca ggaggcgtta cttcaggtgc atcaggatga    181320
     agcaaccatg tagccgcata atgtgtatca gacaccttaa atagtggtgg ctcttcttca    181380
     aggtcaattt gcattgcgta tttattacgt gcagcaaatg cgtccccttt tggaggatga    181440
     agtaaatcag gtggcgtacc tggaataaca aataattctt catcatctgt atccaaagta    181500
     ggcatagaac taattaatcc ccatgtataa ggatgttgtg gattatagaa aatttcatca    181560
     actgtcccga tttcaacaat tttaccaccg tacataacag ctacacggtc tgcaacgttt    181620
     gctacaacac caagatcatg ggtaataaag ataatcgacg tatcaatttt tttctgtaag    181680
     tccttcatta aatctaaaat ttgcgcttgg atggttacat ctagcgctgt tgttggctca    181740
     tctgcaataa gaatttgtgg gttacatgca agtgaaatcg cgataacaac ccgttgacgc    181800
     atcccaccag aaaattggtg aggatattgt ttaattcgtt cttctgcatt ggcaatacca    181860
     actaattgaa gcaaacgaag cgctgtttta tgtgcttcat gtttactgat tttttggtgc    181920
     ttaataagtg gttcagaaat ttgtttacca attgtcatcg taggatttaa tgatgtcatt    181980
     ggatcttgga aaatcatagc tatatctttc ccacgaattt tttgcatttg tttttcgtga    182040
     gctttagcga tatccattcc gttaaataaa atttggccac ttttaatttc tgagttacct    182100
     tctggaagta aacgcataat cgattttgtc gttactgatt tacctgaacc agattcgcca    182160
     acaatcgcta aggtttcccc tttatataag tcaaaattaa ctccacgaat cgcctttact    182220
     tctccggcat atgtgtggaa tgaaatattt aaatctttaa cttctaatag cttttccatt    182280
     tttcctcacc tctcttttaa tcgcgcattt taggatcaaa ggcatcacgc aagccatctg    182340
     caattaagtt aaatgcaatc atgatgatac aaagtacaat acatggatac agaatcatat    182400
     atggcaatac ttgtaatgtt ttatatccat catttaccaa gacaccaaga gacgctgctg    182460
     gcgctggaag accaagccca ataaagctta aaaaggcttc aaagaaaatc gcactaggaa    182520
     tactaaacat gatgttaatg ataataatcc cagaaatatt tggtattaaa tgttttataa    182580
     gaatttttgg agtagattcc cctaaagtca tggaagccat aacaaattct tgatttttaa    182640
     gttttaaaac ttgtcccctg actacccggg ccatcgttat ccaactcgtc attgcgattg    182700
     ctatgataat agatacaata cctggttcga gtattaacat cattaaaata accacaacta    182760
     agtttggaat tgcaccaata acctctaata cacgttgcat gaaattatct acacgacctc    182820
     caacataacc ggaaatcaaa ccataagcaa ccccaattac aaggtcacaa agcgctgcta    182880
     caacagcaat aataagagat acacgtgtac cagcccaaat acgagcaaat tggtcacgtc    182940
     caagcgtatc actacctaac caatagtaag taccctcttt aatattattt tgtttataaa    183000
     tatcaacgtc ttctccacca atagattgat gaccattcca gaaaggcata ttttcaaagc    183060
     cttgaacttt tggaggaaga ctcgcatttt cagtaatttg tcggttaata ttatgttctg    183120
     gtcctagatt ttgtgataaa taagggccaa caattgccat aataataaca agtgctaata    183180
     caattagaga aactaaagcc gctttatttt tacgaatacg aagccaagag tcttgcaaga    183240
     aagttaaact tggacgatta attttctctg cttccgcatc cagaatgtgt gctggctgaa    183300
     atctttcttt tgcaatttta tgttctgcca ttattttcta cctccagaca cacggattcg    183360
     aggatcaatc aatccgtaaa gaatatccac taccaagata acaaatacca acatgacagc    183420
     aaataaaatt gtagttccca taataactgg atagtcattt gtttgaatag aagaaacgaa    183480
     ttgactacca ataccaggaa tactataaat attttcaata actagggaac cagtcatcag    183540
     tgcgactgat aatggtccta aaactgtaat taaaggaata agtgcattac gaatcgcatg    183600
     tttaactgct acttccgttc tactattccc tttcgctttg gcaagtagaa catagtcaga    183660
     tgcgaataca tcaattaact ctgttctcat gaaacgagct gccgttgcaa gtgggaacat    183720
     cgcaagtgcg aatgctggca gaatagtatc tgcaaacgtc ccccaacctg ctactgggaa    183780
     aatttgaagt tttgctccaa gccagtattg taaaacagtc gcaaatacga aagatggaac    183840
     tgacttacct aatattgcta taaatgtact cgtataatcc ggccacctat tctgatacat    183900
     ggccgctatt acccctagta aaataccaaa aataacacca aaagccattg cctcgagtgc    183960
     taattggaca gatggaccaa tcagtgcact taaaatctca gacactggtc tattatcaag    184020
     ttggaaggaa acacctaagt caccttttac caaacctgtc atataattaa agtattggac    184080
     tggaattgaa tcatttagtc catatttttc attcatcatg tgaatttgtt cgtcagatag    184140
     tttctcctga ttacggtaag gcgtaccagg taagaatttc ataagaacaa acgtaaccga    184200
     agcaatgatg aataacgtta taagcatata taatactctt tttaacgtat atttaaccat    184260
     ctatctctac acctcccagt tttaattaat atataaaaaa agttattcct aaccaaattc    184320
     gcaagtttag tgagcctttt tctacatttc taaactttta ttgcattagt gcaaattagt    184380
     taggaaaaaa acttcatttt tcgaatgtta ggtttctaga agactagaaa aggatacttt    184440
     aatttttaat tataacacat gaaaatcatc agcaaaagga gagagcatat cgaaatatac    184500
     tctctctttc cgtcaagcat ttcttaaaga ctaatatttt atttagtcaa gtatgtttct    184560
     ttgtaagtgt aatctggacc aaatggattt ttttgcaagt ttttaatgta gtctttttgt    184620
     aggtatgcag tagaacgttg ataaagtggt tgaatagcta catcatccgt aagaaggatt    184680
     ttttctgctt taaccatttc atcccaacgt ttttgatcgt cagctgcata agttacagaa    184740
     gcatcattta aaatcttgtc gtagtctttg ttagaataac tcattctgtt ttgtgcacca    184800
     tcagttacga atagatctaa gaaagtagat ggatcttgat agtcaggacc ccagccgctc    184860
     atagagaaat cgtaatcttg gttttggtca ttttgtaaac gaactttgaa tggtacgttt    184920
     ttaagtttaa ctgtaagacc atctaagttc ttttgtagtt ggtcttgaat gaattcagaa    184980
     gattttctcg cattttcagt atcatcacta gtgaattcaa ctgtaatttc gttaactcct    185040
     aattctttca aaccagcttt ccatgctttt tgagcttctt ttacatcata ttctaaatgt    185100
     ttgccagatt cttttgtata atcttctttg ttacctgggt caaaagtgaa accttctggt    185160
     acaagattgt ttgcaggttt agatccgttt ttaagaactg tatcagtata cgattgtttg    185220
     tcaatcgcaa gagctatagc tttacggatg tttttgttag caaatactgt gtctttgcca    185280
     gcacgttttt ggttaaattt aatatagaaa gtagaagaat cattcactgt aacatagtct    185340
     ttattgtttt tgttttgagc agcatagtct gcactcaata cagtacggtc aactttgtca    185400
     gtgttgtata agttaagtcc agtaccggag tcttgaacaa cttgtacgtt gatttgtttc    185460
     aacttaactt tatctttatc ccaatattta tcatttttta cgtaagtcca ttttttgttt    185520
     gttccagtcc aatctttcaa ctcgaaaggt ccattgaata acatgttatc actattttgt    185580
     gcatattttt cgcctttttc cgtaacgaat ttttcgttaa gtgggaagaa agttgggaat    185640
     gcgaatagtg agttaatgta agcagttggt ttagaaagag taacttctaa agtataatca    185700
     tctactgctt taattcctaa ttcttcaggt tttttcttgc cagctacgat atctccaccg    185760
     tttttgattg catcaaatag gtaagaatat gttgcagcag tgttagggtc aactgcacga    185820
     cgccatgagt aaacatagtc atttgcagtt acagggtctc cgtttgacca ttttgcatct    185880
     tcacgaagtt tgatagtata aactgttttg tcatcgctaa tttttggctc ttcagcagca    185940
     ccggcaatgg caggaatacc atctttgtca agcgcatata gaccttcgtt tgtttggttt    186000
     acaacgttca aaccaacttg gtcatccgct tttgtgctgt ctgcagaagg aattagtgcg    186060
     ctttctgtca agttaagtac ttgctctcct gaagcttttc ctgaatctga gccttttttg    186120
     tcggatttgg aatctgatcc gcctccgcat gctaccaaga ctaagcttag taatagtgtt    186180
     aatccaagtg taagaaataa tttagatttt ttcactaagt agacctccct tttttatttt    186240
     tctgaaaaat tgtttcgata cctattatac tctaagaatt ctggctttgt aaattatttt    186300
     tacaagataa atgaaaacaa ggatgaaaga tacaagttat taaaatatta aggcaaaatt    186360
     gaaattgcgt gaaaactctg aacagaaagt gttacgcaat cctctatttt gcaataaatc    186420
     gaattaatta tgtatacttt gctaaacctt ttgattaagt tttcagaaaa cataaccatt    186480
     taaattgata aatttacgat gaactttgcc aattaagtta aaactggaag aagttatctt    186540
     ttttgtataa aagaaaatat cgaacccctt taaaatttaa aggattatta tatttatata    186600
     ctttttttga gctgttgtct agataaaaat atcaaaaatt taattaaatt ttgtaataaa    186660
     ttcgaaaaac gttgatataa agggattttt ctgttaataa tctgtaaaga cacttggcgg    186720
     aatattttac taaaaacgga caaatttcta acattggatg atagcttcct tctatcatat    186780
     agtctttcta tgcaaattgt gatagagtga attatgaatt ttaattagag gtgaagaaat    186840
     gtttttacga attactattt atacacttat tcaagaagct attatttttg gtattttact    186900
     cttcggaaaa aatcagactg ttagtttaag caactatgtg gatatttcct ttatggtagc    186960
     gcttatctca ctactaattg gattgtttgt ttatattatg agaagtgggt ttttagaccg    187020
     ggttcataat ggttttcgaa gtatttctcg caaaattaaa cgagaagaag aaaatgagtt    187080
     ttcagatatg cctttatctg aattagtcgg cctgcaatac gccggaattt tgtttagttc    187140
     catttttgtt atgttgacta gtattttatg tatgtttttg tgattgacaa gccgttttgt    187200
     aaactgatag aatgaaagta atataactga tgcgttaata ggaagattag tacattttgt    187260
     tgctttataa tagagagtct gtggttggtg gaaacagata aagcgcaaaa tcgaatggac    187320
     ttctaaggac tgtttgtgaa agcgagtagc gaacagcggc taaagaccgt tacttcttta    187380
     atagaaactt tctattgcta agagcctttt taggtactta gggtggcacc gcggataacc    187440
     gttcgtccct aacatttata tgttgggatg gacggttttt tattttcgca atcagtgaaa    187500
     aaattggagg aataatcatg aaaaaagtaa tattttccgg aattcaacct agtggacaat    187560
     taactttagg aaattatatt ggggctttaa aacagtttgg gcagtttcaa gatgaatatg    187620
     aatgttttta ttgtatcgtt gacgaacatg ctattacggt tccacaagat agattaaaac    187680
     ttcgcgagca aacaagaagt ttagcagctc tttatttagc agttggactg gatcctgaaa    187740
     aatccactct atttattcaa tctgaagtgg cggcacatgc gcaagcggca tggattttac    187800
     aatgtaacgt ctatattggt gaattggagc gtatgacaca atttaaagac aaatcagctg    187860
     gtaaagcagg agtgagcgcc ggactattaa cctatccacc attaatggct gctgatattt    187920
     tactttatca aacagattta gttccagttg gtgaggatca aaaacaacat atcgaattaa    187980
     ctcgcgactt agctgaacga tttaataaaa agcatgcaga tattttcacg atgccagaag    188040
     tattcattcc taaacaaggc gcacgagtaa tgtccttaca agatccaacg aaaaaaatga    188100
     gtaaatctga tgccaatttg aaaaatgcta tctttttact tgatccacca gcaactatta    188160
     gaaaaaaaat caaaagcgct gtgaccgatt ctagtggtat tattgaatat aataaagaag    188220
     aaaagcccgg cgtatctaat ttgctaacta tctattcggt tattaccggc gaaacaattg    188280
     ctagtataga agaaaaatat gttggaaaag gctatggtga tttcaaaaca gatttagctg    188340
     aattagttgt ttctgaactt gagccaattc aagaaagata ctatgcttat ctcaaatctg    188400
     aggagctgga cactatatta gatgcaggag cagaaaaagc agctcgcgtg gctaataaaa    188460
     cattgaagaa aatggaaaat ggcgttgggc ttggccgtaa acgcagaaaa taatataaaa    188520
     aaagccaatg acctagttaa tctaagtcat cggctttttt tatttaatca ttaacctact    188580
     ttaatttcca catcgatgtt accacgagtt gctttagaat atggacatac ttcatgtgct    188640
     ttttttagta gagcttctgt tttttctttg tcttggcctt cgatagttcc ttctaatacg    188700
     acaccaattt taaatccgtt gtcttctgga tcactatata agctgacagt tgctgttact    188760
     gtgctctttg cttcaatccc agcttttcct agaactaatt ctaacgcgct attgaaacaa    188820
     gctccgtatc cagccgcaaa tagttgttca gggtttgttc caccgccgcc gtctccacca    188880
     agttctgttg gcgcagaaat atcaaagtaa aatacgttgt ctggcgaatg aacttcacca    188940
     cttcttccac ctgtattaat gactgttgtt tcatataatt ttttcatttt ctattcctcc    189000
     taattgtttt gttaacgatt gtattttggt aagtaattgt gtgtagtcta attctgcaaa    189060
     atcgagtaat tgaaggcagt tgtccacgct ttttaatacg tcaggttgta tttttattgc    189120
     tttttctgtt aggcgaatat aaacgcggcg ctcgtcttcc ggatgacgac tccgtgtaac    189180
     atatcctaaa tgctccattc gttttaacat tggtgttaaa gttccactat ctaaagccaa    189240
     cctctttcca agttctgata cagtttgttc ttcaacttcc catagaacaa gcaaagcaat    189300
     atattgtgga taggttaatt gaaacggctc taaagcttca cgataaagtt tagtaaattg    189360
     tttggatgca ttgtaaacag aaaaacacag ttgttcttct aatatgcgtg tattcgtgtc    189420
     caacatgttc tcctcctttt aagttgcgtg caatttaatt gtaaccaatt atagtaatga    189480
     aagctagttt tttgctcaaa aaaagcctta cctcattttt ggaggtaagg cttttgatta    189540
     tattttagtc ttctattctt ttaaatacta aagtcgcatt atgaccacca aagccaaaag    189600
     agttagaaat tacaacattt acatttgctt cacgtgcttc atttggaaca taatccaagt    189660
     cacaaacttc atcttggttt ttcaaatgaa tcgttggtgc aataatatta tcacgaatag    189720
     tcaaaagcgc gaaaatagct tctatcccgc cagacgcacc taaagtatgt cctgtcattg    189780
     acttagtaga actaatcgct aattttttcg catgctctcc aaagacagtt ttaatagctt    189840
     gtgtttcgta ttcatcattg tatggtgtac ttgttccgtg ggcattaatg taatctactt    189900
     tatcaggagt aagcccagca tcatcaatcg ccattttcat tgcgcgagca gcaccttcgc    189960
     cgtttggtgc tggagcagta atgtggtaag catctcctgt tgcaccgtaa ccaacgattt    190020
     cagcgtaaat ttttgcccca cgtgcttttg catgttcgta ttcttctaaa ataacgatac    190080
     ctgctccttc gccaataata aaaccatcac ggtctttatc aaatggacga caagcagttt    190140
     ctggatctgg atttaatgac aaagctttat tagcagtaaa tcctgcaagt gacattttag    190200
     tgattggtgc ttctgctcca ccagtaatca ttgcatcagc atccccacgc tcaataactt    190260
     taaacgcgtc gccgattgag tttgttgctg ttgcacaagc tgtaactgtt gtagagttaa    190320
     tgcctttagc tccaaaacga atagaaactt ggcctgaacc catatctgga atcatcatag    190380
     gtacgaaaaa cggactaact cgacgatgtc cacgatttaa gaaaatttca tattgtgttt    190440
     cgaaagtttc cattccgcca attcctgaac caatccaaac accaacgcgg tttgcattgg    190500
     aatcatcaat aactaaacca gagtcttgta cagccatttc agcacttgca attgcataat    190560
     gcgtaaaacg gtccatttta cgagcttctt ttttctctag atatttttct acatcaaaat    190620
     cttttaactc tgctgcaatt ttaaccggaa agtcatccgg attaagtctt gtcatttttg    190680
     caacaccatt aacacctttt tttgcgtttt cccaagaagt ttccgcatcg tttccaatag    190740
     gtgtaacagc tccaacacca gtaacaacta ctcttctctt atccatttac tcatctcctt    190800
     atttttcaat tcataaaaaa caacttctgt ctaatgacag cagctagtat aaagttaagg    190860
     ctttatttaa aattaataat agtgcacaaa caaataaacc aaaagcctgc tccattataa    190920
     cataaataaa ggaaagttgt cctaactaaa ataagtgtta gggcaacttt ccttgtttaa    190980
     tttgttgctt acttacccca acgaatgatt agggcgcccc atgttagtcc gccgccaaag    191040
     cctacaagca gaacgttatc attatcttta atacgtcctt cttccactgc atcaactagc    191100
     gcaagtgcga ttgaagagga tgaagtatta ccatatttgt gtactgtttt catcagtttt    191160
     tcttccggta aattcaaacg ctcgcgagaa gcttccatga tacgaatatt tgcttggtga    191220
     ggaattagta agtccaagtc ttctttctca agaccagcac gttcaagtac tcgtagtgaa    191280
     gcttctccca tttggcgaac tgcaaaacgg aacacttcac gaccattcat ataaatcttt    191340
     ttattttcat ctaaattcaa gtatttacca cctgatccat ctgaacctaa gtcaaatgaa    191400
     agtaaaccat gatcatcaga aactggcccc ataactacag cacctgctcc atcaccgaat    191460
     aatacggctg ttgtgcgatc atcccagtta gtgattttag ataatttatc cgcaccgaca    191520
     actacgatat ttttatatgc acctgtttta atgaattgtg ctgcagtcac tactccaaaa    191580
     gtgaaaccag cacaagctgc ctcaacgtcc ataccggcag catttttcgc tcctaaacgg    191640
     tcttggataa tattagcaac tgaaggaaat gtcgcttctt gtgtaacagt tgcaacgata    191700
     aacaagtcga tatcatctgg tgtaagacca gcattcttaa tggctacctt tgctgcttca    191760
     tatgctaaat catgcgtata ttcgtcatca cgagcaattc ttctttcttc gataccagtt    191820
     cgagttcgaa tccactcatc agatgtatcc ataatttttt ctaaatcaaa gttagttact    191880
     attttttcag gtacgtattt acctactcct aaaattcctg cgttcatgtg ttctcctcca    191940
     tatcaaacta catcagggca aaaataaatt ttttcctggt tatttttatg acctggtgct    192000
     aattttaaca gagaactatc aattaagcaa ttggattgct acttttttat tttacttcta    192060
     acgctttatt aggattgttt tcagcaaaac cgtctgcttt tgaccagcca attacttttc    192120
     catcgtctga cttaatacgg taccaatatt catttttcac atctgcacga cggtcaatgt    192180
     ctaattcttt ccctagataa tcattaagat tggtaactac ttttgaattg tcttctactg    192240
     ggtaagcata gattttttga tccgaatcgg tgatatattt atctagtttc acatttgttt    192300
     catttttcgg ggtataaaaa acttctacag cattactgtt tacccatcca atagttttgc    192360
     cttgatcttg aagttgatac catgttcctt tttctgtaac agctttttga gaaattcgaa    192420
     ggcttttatt tttgtaatct ttgacactac ctgttttttc tgcgccctct gtattatatg    192480
     gttttgtcca aattgtttca ttgctagcat ttttgatttc tgcgtatgct aattggtttt    192540
     ctgttgatgt cactgtatcg taaatttggt catattgatc caaattgtaa ttttcaatag    192600
     ttgaaatgag tttttctgcg tatgctgggt cagttgcata acctgcatct tgaattgcgt    192660
     atgcagcttc cttatagttt gtttctccga tgaccgctga gtaaagattt gcattaccag    192720
     atactccgtt aacaaaaagt tgggcatgat cgactaaaga tgcctttttg tctggatact    192780
     ttctgaaatc agcttgtgtg tggtaggctt tcccgctgct aaattcttgc gttcccatcg    192840
     aaacggaact tccttcatag cttcctttaa ttccaaacag gttattagct gaagttgata    192900
     agccactttt accccaattg gattctaaaa tggcttgcgc taaagtgaca cttgtcaata    192960
     ttttttcttc tttttgtaga tcttgtgcat catttgcgat tgattgtata aattgttgtt    193020
     gtgataaagt cattcctgct tgacttactg tagtttggtt tgttcctgct gcctctgctt    193080
     gaacaaaagg tactaatgta gaacttacga tgacgcttgc tagtaaaatc tgcgtgaatt    193140
     tctttttcat tatcagttgg cacttcctat ccaaattagt tagttccccc aatttaaatg    193200
     gctctgtctc tgttaacctt cttcattcta gcattttcat tctgagagcc tactaatttt    193260
     ttgatgaaag atttataata aagtaagcag aatggctagt ataggggatt ctcgtgtacc    193320
     tgtttacatt tgacaatatt atgtcattgc ttatctaccc ctttacacta ctattctcca    193380
     tttaaagttc atttccttcc tttttttgat aatcgtattt tcaaatgata tatgattgga    193440
     taatccaatt ttatgtgcta aaatgtataa tgaaatagat gaaatggggt gtaaggatgc    193500
     gttacgtggt gactgtattt tgggtattct tactttcttt aatggcagaa ttcgttcttt    193560
     cttccatgtt atatgtatca tttgatatga cgcgggctat tattttaaca gtagggttat    193620
     ccttcttcat tattttaatc actttcttga tgcctaaaga tagcgaagtt tatgacttta    193680
     agtaaacatc caactttctg atagcgagaa ctgacttttc agaagtagtt caaaaaaaga    193740
     agctctttcc aatatatgga aagagcttct ttttttattt atccaagtaa tatttattta    193800
     ctggttttaa atcagcgttt aattcatata ctagcggtac gcctgttgga atttctaaat    193860
     ccattatttc atcatcacta ataccttcta ggaatttcac taatgctcgt aaactgttac    193920
     catgcgccgc gatgactact cgtcgtcctt ctttaatttc tggagcaatt gtgtccatcc    193980
     aataaggaat aacgcgttct aatgttactt tcaagttttc acctgatgga atagcgtgtg    194040
     tatcaaggag ttgataacga cgatcatttt ttgcttgtct ttcgtcgttt tcttctagta    194100
     atggtggaag tgtgtcatag cttctacgcc atttttgtac ttggtcagca ccatattttt    194160
     cagcagtttc ttgtttatta agtccttgaa gtgcgccgta atgacgttcg ttcaagcgcc    194220
     aagatttatg aactggtacc cacatttggt cagattcttc taacacataa ttaagtgttt    194280
     taatagctcg tgttaaaaca gaagtgaagg caacatcgaa ttctaagcct gcctctttaa    194340
     ttctttttcc tgctgtcatt gcttccacaa cgccttcttg cgacaagtcc acatcatgcc    194400
     aacctgtaaa taggttcaat ttgttccatt cactttgacc atgacgaatt aatactaatt    194460
     tcatcttcct catccttcca ttttcgccta ttttctaaac gactaatcca accaaagttt    194520
     tccctttcaa gtgaagtgtc aaaccttttt taggttattc tgtgacttta aaagtaaatt    194580
     ctttatctgc taaatcaatt tccacggatg aatgtggcat gattttacca gagacaattt    194640
     ctcttgcaag tggtgtttcg acatgacgca caatatagcg tttaagtggt cgtgctccgt    194700
     ataccggatc ataagcttcc tccgcaataa aggcttttgc atcatcggaa atagtgattg    194760
     taatttcttg gtcggctaaa cggatttgaa gttcttctac taatttctcc acaatacctt    194820
     taatatcagc aagtgttagt ggtttaaata gaataatatc atctacgcgg tttaagaatt    194880
     ctggtttaaa ttcactttgt aaaatttgca ttacatctga ttctaattcc ggtgaaattt    194940
     cgccttcttc ggttctttca agtaataaat tagagccaat atttgacgtc ataataatta    195000
     ctgtattttt aaaatcaatt aatcgacctt gtgaatctgt gatacgtcca tcgtcaagta    195060
     cttgtaatag tatgttaaat acatctggat gagctttttc gatttcatca agtaggacga    195120
     tcgaataagg gtttcgtctt acagcttcag taagttgacc accttcctca taaccaatgt    195180
     aacctggagg agctccgaca agtcttgata cggaatgttt ctccatgtat tcagacatat    195240
     caattcgaat catgtgatct tcggaatcaa acatattaaa tgcaagtgct ttagcaagtt    195300
     ctgttttacc cacacctgtt ggtcctaaga aaataaagga gcctattggg cgtttcggat    195360
     ctttaattcc tgcacgagct cgtaagacag catcactcac taattggacg gcatcatctt    195420
     gaccaattac tttttgatga aggacatctg ctaatttaag cagtttttcg cgttctcctt    195480
     ctactaattt agtcaccgga atccctgtcc aacgtccgac gatttctgca atttcatttt    195540
     ctgttacttc ttcttgtaaa atccgatctt cttgtgctgt tttttcgcga ttttctgctt    195600
     ctaactcaag caattctttt tccacagccg ggattctacc gtggcgtaat tctgctgctt    195660
     tgtttaaatc ataattattt tctgcttctt ctaattcatg gcgtaaatgg tcgatttgct    195720
     cccggacctc acgaatttta ctgatttcgt ttttctcgga ttcccatttg gacttcattt    195780
     ggttggcttc ttctttgtag tcagccagct cgcgttgcaa tatttctaaa cggcgttcac    195840
     tcgctggatc tttttcttct tttagtgctg cttcctcaat ttctaattgc attacttttc    195900
     tagttacttc atcgagttca cttggcatcg agtcaatttc gacacgaata gttgcgcatg    195960
     cttcatctac taagtcaatt gctttgtccg gcaagaagcg gtcagtaata taacgattag    196020
     aaagactcgc agctgcaact aaagcattgt catgaatatt taccccgtga tgaatttcaa    196080
     aacgttcttt taacccgcgt aaaatggaaa ccgtatcttc cactgttggt tctgggacaa    196140
     gcactttttg gaaacgtctt tctagtgcag catctttttc gatatattgg cgatattcat    196200
     ccaatgtagt tgcaccgatg cagtgcagtt ctccgcgggc aagcatcggt tttaacatat    196260
     ttcctgcgtc cattgcgccg tctgttttac ctgcgccgac aatcgtatga atttcatcaa    196320
     taaagagtaa aatttgacca tcactttgtt ttacttcttg gagtactgct ttcaatcgtt    196380
     cttcaaattc accgcggtac ttagctccag caataaggga accaatgtcg agtgagataa    196440
     tcgttttatc tttcagtcct tctggcacgt cttttcgaac gatacgttgc gctaatcctt    196500
     cgacaatggc tgttttacca acacctggtt cacctattag aactggattg ttttttgttt    196560
     ttctagataa aattcggata acgttacgaa tttctgcatc gcgtccgatt actggatcga    196620
     gtttgccgct tctaacttcc gcgactaaat cacgaccata ttttgttaaa gcttcatagt    196680
     tttcttctgc attttgagaa gtcactcttt tccctcctct gatttttaaa attgcttctt    196740
     taatttgttt tttagcttta tgttgatttt taagctcggc tgtaattgga ttcgattttt    196800
     gatccataac agctaagata agatgttctg ttgagacaaa atcatcttct aattgttgtt    196860
     gttctttttc tgcatccctc attagttgga aaagagcttg gctcattgct tggccataat    196920
     tcacgccact tcctgaaact actgggattt tttccaaagt attctctatt actttttgaa    196980
     gtgcatctgt atcaacttcc gctacatcat agactcgctt tgcaaagtcg ctttctgtta    197040
     ataacacttt aaaaacgtgt gcaacgtcaa tttcttgatg ttctgatgca atagctagat    197100
     tttgtgcgtc cgcaattgtt tgctggactt gttgtgtaaa tttttgtaaa tccattcatt    197160
     cgtcctcctt ataaaagata agtctgacct tttttgacct taactttatt atagtttttt    197220
     atcttgcttt tgtctaacaa aaaccttctt tttttataga aaaagatcta ccaattttta    197280
     ggttggcaga tcttctgaat ttcttaatca cgacctgtaa ataggcggag taagaacatg    197340
     aataagttaa ggaaatcaag gtataaattc agcgcaagca ttggtacatc tgctagttcc    197400
     acatcgcgct tcatgatttg gttgaagtcg tacaaaatat atagtgagaa aataatcgtt    197460
     ccgcctgctg aaataatagt tgacagcata gagcctaatg gtagaaagac tcctacaaag    197520
     ctaaatataa cgagaataat aatcgcagcg aataaagcac tgcttaagaa agataagtct    197580
     ttcttcattt ttgcaccaat aaaagctagc gttgtgaaag taacggttgc tgtaacaaat    197640
     gccattagaa cggcggcacc ttgccctgca ccaaaataat atgtcaaagt tggtccaagt    197700
     gttaagcctg tgacaaacgc aaatgctagt actactgggt agcctaccac tttattaatt    197760
     gttttacttc gacgcactac catcgctgtg ataagtaacg cgacctctaa cacgacaaga    197820
     ggcaaataaa gttctggact taatttactc ccaatcgcag caccgataga tgcaagtagc    197880
     aaagaaaata caaaccaatt aagtattttt tgcataataa tttgtttctc tgttcttttc    197940
     tctgtgttta ctcgctcgga tgtgtgattg atttcgttca tgaacatttc tcctcttcca    198000
     attgattagt tttattatat caaaagaatt attacaattc tatcggtctt gcgttggaat    198060
     ttcacaaaaa aagaagcgca cgaggcactt ctttaaatta aatcaaattg tttcaagcct    198120
     agcataatgc cgtcactatt gttatctttc gttacaaaag tagctttttc ttttaataaa    198180
     ggtacggcgt tttccattgc aatcgcataa tccactgcac caaacatctc taaatcgttc    198240
     atgccatctc caaaagcata ggtgggaaca tcttgatagc ccattacttc aagtagtttc    198300
     gaaataccaa ctgctttaga tccgcctttt cttaagacgt cattactaaa tggcgtgttg    198360
     cgaacaaatt gtaattctgg aaaacgttct gggaaatagt catcgccagt ttcgagtaat    198420
     agaagtgcca tattgatagt ttcttcttta tacatattag gtcttacttc aggcatcggc    198480
     tcgcctaaaa aatcataatg tgcttttaca actggcgtac tagctgttgc gccaattctt    198540
     ttatcattat aatagcaaac ttcgacattt tgtgattttg cttcttcagt caactgttct    198600
     aataaacctg catcaatcac atcttcatat actttttcac cttcaaaaat agccatttgt    198660
     ccgttcatca ttactgcgga ttcaatgcca gtaattttca tttgatgact gatttctata    198720
     agcgtccgac cagtagcaat aacaggaata acattatttt ctcgaagttt atcaagtgct    198780
     tgaagcgagg tatcaagtac tttggattca ctatttaaca gtgttccatc catatcaaaa    198840
     aaacaaattc cacgtggttt cacattattc atcctttact aacataatat atccatcata    198900
     ccaatcttac ggatgcaaag taaaggttat ttgtacataa caaaatctcc tgtgtgctca    198960
     aaaccaagac ggtgatatat ctcaccagcg actggattat cgtaaaacaa acatggtttc    199020
     tttccttcag ctaatacatc gcaacataat ttttttagaa gtgtacttgc aaagccgcgt    199080
     tgtctatatt catcacttgt cgcaacacct gtaatcattg ctgaaaagga attttctgcg    199140
     gatgtttctg ctacggcaac tacttcttgg tcttgttcaa tataataaat tcgtttcacg    199200
     cctttttcaa tttggcgaat aattaattct tcattttcgt cgcgtgaacc aaattcttta    199260
     atgtgtttgc gcattttaat aattgggccc acatcttccg ctactgccgt tctgacgata    199320
     acatcttgat ttactggaat acggtttaca tgttcgcatt cgcaaaaata agtgtcttgt    199380
     cttttttcgg caagttctgg taaaaatgcc tctagttctt ttgtgacacg ggacataccg    199440
     ctaacttcat atttgtcatg tgtagcaata atttctgaga acgcttctgc attaaaatta    199500
     gcgtcttttg aatagggtaa gaaaaacgta tcgaatcgaa gtaacaaagc atgtaatttg    199560
     cctactgaat cgaattcacc ccaaagatct tgcacatcac tctcataacc aaaattttcg    199620
     atgtccccaa taataaataa attttgggtt gcttcgggtt ttaaaagtgc cattacttct    199680
     tcattatcag atacagttag ttttctaatc atgtgccaca ctcctatttt gaaaattgtc    199740
     ttcattttac gtgagttagg taggttcgtc aagccctgaa tcttactatt ttgcgccata    199800
     taaaaaagct cgggacaatt agtcccaagc ttttatgatt cgtaatgaat ctcgccaatt    199860
     ttcaacatta agctgatagc attgaatttt tcatctccaa gatgcatttt gtttgtatct    199920
     tgaaaagtga taggtgctgc tgtaatcgct tctttcggtt gttcaaagaa tttttcttca    199980
     agtgccaaac tttctgtaat ttgcgatatg tatttttgga atttattttc gtttctcatc    200040
     ttccctatca ttaatgcttt tagcgtattc tgggaaattc cgactgcaag cgcgaatgtt    200100
     ctatgagtat atccatttat tttcatataa agtgacaaat tagtggcaat tctttgtttt    200160
     tctgccttgt ttttcatttg ggtgaacctc ctgtctttct atatttatca ttatgcccgg    200220
     tgaagatgag aatttgatta aaacttcata gtatttagct aaaaatattg aaaacgtttt    200280
     ctttatttca aaaaaatatg ccggaataac gaatatcccg gcaagacttt tatttaattg    200340
     ctatattttt cccagacaac tgttcttaat acttctaaga attctggatc cgagtttggc    200400
     attggtggtc ggtgataagc cgcgcccact tcatcggtaa ctactttaca ttcataatca    200460
     ttatcatata aaacctctaa atgttctgcc acaaatccaa ctggcgtata gataaagtgt    200520
     ttatattttt ctcgaccgta aagttctctt gttaaatctt gtacatcagg tccaagccac    200580
     ggctccccag ttttcccttc gctttgccaa cctagcgcat aatgaggcac tactactttt    200640
     tcgaaaatga aatctgctgt ttcttgaagt tgatttgggt acggatcgtt atgttgttta    200700
     attttctctg gcaaactgtg tgcggaaaca attaaaacag tatccaataa ttcatctgct    200760
     ggaatttgtt ttgctgtttc attaattcta tcagcccaca tttggataaa tttgggttgt    200820
     ttgtaccaat cattgattgc gttgatacga ggtccgccta gtttatcagc tgcttctttt    200880
     gctcttttgt tgtaagcctc gacactaaag ctagagtaat gtggcgctaa aacaatcgag    200940
     atcgcttctt ctattccgtc tttatgcata gcttctaccg catcttcaat gaaaggttca    201000
     atatgtttta aaccgatata tgccttgaat tctacttcat cctgcgagtc atttaacgct    201060
     ttttctagtc cataggcttg tgcttcggta atttttgcaa gtggggatag tccgccgatt    201120
     gcatggtatc taccgcgtaa atcggcaatc atttcttcac ttggcttatg accatgacga    201180
     atatctgtat agtaacgttc gatatcttca tctttatacg gtgttccgta tgccattaca    201240
     agtagaccta cttttttagt cattttatat catccttttt taatagaatt tcgctacgtt    201300
     catggatgta attagttagt tgtttcaaca tttctggtgg tacttctggg aaaactccat    201360
     gtcctaaatt aaaaatataa cctggttcta gtacgccttc ttgcaaaata cgatttgctt    201420
     cttttaaaca tttctctggt gcaagaagtg tggacggatc cagatttcct tgaattgctt    201480
     ttgttggaac ttttttccga gcacttgtga tggtttctcg ccaatcgacg ccaacgacat    201540
     caagtggcat tgtttcccat tcttctaaaa gatgacttgc gccaactgct tgcataataa    201600
     ttggggttgt tggatgaact gctttcactt ctctaacaat catttcgatt actggtcgaa    201660
     tgtattcagc atagtcagct cgactaagtg ctcctaccca agaatcaaac aattgcaccg    201720
     cagaagcccc tgcattaatt tgcgcaatca aatagttcgc agtcattcgt cccaattttt    201780
     ccattaatat tgcccaaact tctggttcgc gatacatgaa gctttttgtt tggtggtaat    201840
     ttttcgatgg accaccttct atcatatagc ttgctaacgt aaacggtgca cctgcaaagc    201900
     caattaaagg cacatctaac atatcatctg ctaataattt tatcgtatca agcacataag    201960
     gaacttctat ttctggtttg aaaattgtca gtttctctac atcttgaaaa gatctaatag    202020
     gattatgtat gactggacca ataccagatt tgatttcaac gtctactccc atccccggaa    202080
     gtggtgtcat aatatctttg tataaaatgg ctgcatcaac accatattga tctactggta    202140
     atttggttac ataagcacat atttctggct gatgagtaat ctcaaataga gagtattttt    202200
     cttttaattt gcgatattct ggttgagatc tccctgcttg tctcatgtac caaaccggaa    202260
     ttcggtcaac ttgttctttt cgcgctgctt ttaaaaataa atcattcgtt atttttgtca    202320
     tcgagtcgct tcccttcttt gttcatttac acacaatagg caacagaaca ataaataact    202380
     tctccagata aaaggatact agaaaatttg tataaaacca aacaaattgc ctatcagctg    202440
     tttcaattat gaaaaacgtg gaaaataaag gtgtaatcat ttttcttaat ggaataaaac    202500
     tgaaagaagg acttattatg aaaaaagtat ttatcacaac aggaacggag cactaccttc    202560
     gtcaattaat ggcgaattat actggcggaa atgtgacact tctgcaaaac ttttcccaat    202620
     cacttttgta tcaagagtcg actggtgaaa aacttttcca agaaggtgct gagtatcgag    202680
     tattgcaaag cagtggttcc ataaaaggtt ttggagtagt cgtctttgaa tatatccacc    202740
     tccgcgatga agaaatccct attttcttgc aaatgtatca acgagctagt cttcatttta    202800
     gtgaaacgcc tggcttgcaa agtacaaaac tcacaaaagc gatgaatatg aataaatttt    202860
     taattatttc cttttgggat tctgaagtat tctttcatga ctggaaaaaa tcacctttat    202920
     caaaagaaat tacaaatatc atgagaaaaa ataatactca atctggattc tcacatgaag    202980
     atatttatca ttatccagaa ttttcccatg atgctaaata ggaaaaagcg atttggacca    203040
     atcatccaaa tcgctttttt cattcgtaca tttttttcat tctgactgga gcataaagga    203100
     acgtgaagat gactacaaaa gccaaattaa ttcctaaaat aatcatcccg ccgatggttc    203160
     cattttgtgc aataccaatc acgctaaaga gcagtgcttg agcgagtaac aaaatccgta    203220
     gaaaatggat aaaactgcga tgacgataac gatcattaat cgggtaaagt cgtagcataa    203280
     tttgcgcatc ataatgtttt aacatcggaa taaattgaaa accagttaaa tacaaaaata    203340
     gtagcgaaaa aataatactt aaataaaaac cttgaacaaa cacaagtaaa ataactgcaa    203400
     tcacagtaag tctaatgtat agaccggcat attcatttgt tctaataaat gtccgactga    203460
     acaaataagc aaatgttttt cttttcgcat aaggaattgg ttgataaaga aaatcgagat    203520
     aactccgtct ccgaaccgtt cctcgtaagt gaggtacatc cgtaaataga ttcactaaac    203580
     gatagaaccg attcatccgc gcttcttctt tatccactaa atattcccag cgtaaagtta    203640
     cttttgcagt tttagttcga agccagtagt aactcgccgc aagtactact aaaaccaaag    203700
     gaatagaaat gtaaggggct gctattaatg caatataaat taaaatagcg ttaaggataa    203760
     cacgaataaa catccatgtt gtgtccgctt cttcaaattt catgctttcc cagccaaaat    203820
     aaatattcca tgctttaagc atactaagta caataaacaa agtgaaaaac tgactatatg    203880
     gaacctttgt cacttccaca tacatcggca tacaaacccc aagcacaatc acaaaaacat    203940
     ataattgcat gaagaaactt gctatttttg cttgagaaaa atacgtatcc attgcttttt    204000
     cctgtacaat taaataaaca atatccggtt ttttcaacaa cgtggcaaca ggactaacgg    204060
     caatagaagc agtgagtaaa ataaccatta acggaataac ggggaatgtt ggctcaagtg    204120
     tcttcaccca accagcgtaa taaaaaattc ccgctccaag tccaatcaca agcacaaaaa    204180
     gcaaatgatc attaaacata taacgaagat agcgcatgac ttcggtcgta taggcactaa    204240
     aacgttcttt ccaaagcgct ttgctgtcaa atatcatctt catcagcttc ctcttccttt    204300
     gtcaactgaa tgtaaatttc atcaagtgaa gctcctggca tttcgaaatt tgtttgcaag    204360
     tcttttaatg ttccttctgc gcgaatttca ccttgatgaa taataatgaa cgtatcgcaa    204420
     tatttctcag ccgttgcaag tatgtgcgtt gacatcaaaa tacttgcacc cttacttcgc    204480
     atttcatcca tccaattaag cagtgactgg attccaagcg gatctaaacc aacaaagggc    204540
     tcatcgataa tatataattt aggctcaatt aaaaaagccg acataatcat tactttttgt    204600
     ttcatccctt tagaaaaatg agctggaaac caattaagtt ttttctctaa acgaaactct    204660
     tttaaaagag gagtcattct tgcatgtagc tcttcttctg atatgccata agccatacct    204720
     gttaattcta aatgttcttt taaggttaat tcttcataca ataccggtgt ttccgggata    204780
     taagaaaatt gctttctata tgtttctgta tcttcaacca attggtgatt attgatttta    204840
     atggttcctt gtttaggatg cattaggccg gttatatgtt taatcgtcgt acttttccct    204900
     gccccgttta gcccaattaa gccaacaatt tgtttttctt caatcgcaaa tgaaatatct    204960
     tttaagactg gacgtttggt atacccgccc gtcaggtgtt caacttctac taaagccatt    205020
     tccatacctc cttacgtaat ctttagttaa taatagcata ttcgtccctt gaactgtcaa    205080
     aataatccac cacctactat ctaacacatg cttttcactg ctttttatgt taaattaaaa    205140
     tagtacataa ttatatgtaa tgaaaggtgg tcatacttaa tggacgattg cattttctgc    205200
     aaaatagttc gtggtgaaat tccttctgcc aaagtgtatg aagatgatga agtatatgct    205260
     ttcctcgatt taggccaagt tacagaaggt catacactcg taattcccaa aaaacatgct    205320
     aggaacacat tcgatttacc cgatgaaacg gccgctgaat tattccgccg cgtaccaaaa    205380
     atcgcgcggg cattaaaaga agctttaccg attcaaggat taaatatttt aaataataat    205440
     gaagaagttg ctttccaatc tgtttttcat tgtcacatcc atttaatacc aaggtatagc    205500
     aaatcagacg actttgggtt aaaatggaaa gataacgcag actggtacac acaagaacgt    205560
     taccaagaaa ttgctgaact tattgcagca aaagtagact aaaatgactt tatggatgga    205620
     gtggagtata aatgaataaa aaatcactta ttttcggtat tttagctggt ggggcaattg    205680
     gagccgcagc ctcggtatta tttgctccaa aatccggcaa tgagcttcga aaagatattg    205740
     tcgctaaatc aggtgaagca agtgttattt tgaaagaact cgcatataat gcaaatgagc    205800
     ttatccaatc cgttcaagtt ctcggcacag aaggttccac tttattaaaa gatgtttctt    205860
     ctgacatcat ggaatctgtt tccaaatgga atgaagaaat ggaaccggag aagaaacgct    205920
     taaaagacga aatcaaagat atgcaaaaaa caatttctga cttagaaaaa acgctaaaaa    205980
     aagataataa ataagtagag aaactgggcg actgctcagt ttttttattt gtctaaaatc    206040
     cctttcaaaa aaccgtcata attagacaat aatttctcta aaaaaagctt gaattttgta    206100
     gcatttgagc atacaatact atggtgcctt ctgatggaag agcactattt tagctataac    206160
     tggaggaaag cttacaatgc gctgcctaaa atcaatcaac acagagcgac gagacgaatt    206220
     taatcgactt ttcctaaaag gaattcttgt ctggctagct gccgtatgta tttgtttttt    206280
     aacacaacat ttgatctatc ctgatcaact tacaaatgat tatcaacttg ctagcttttt    206340
     aggtattatt ttaatttacc caattcataa attacttcat attcttggat gctttaaata    206400
     ccgtgaagga actgttattc agtggcgtat tcatttcttt ttccttcctt gtatcaaatt    206460
     aaatattaag cgaataatac caaaatggca ttacattttt tcgttaattt taccatttgt    206520
     gattataaca actattttag tcgcattaat gcttttcaca ccaatcggac attccggtat    206580
     gttcctatta ttactatctg tccatttcgg aatgagcttt tctgatttta cacatattaa    206640
     aaaattatgg aaaatgccga agaattgctt tatcgaaagt gcagaacgtg gattttctgt    206700
     tttaatttct gactaaacca taagaatatc attaaatttc tttcatcttt tctttttacc    206760
     tttaatttat gttatgatag ttattgtgtt aagcgggaat tattccaaca actaaggagt    206820
     gtgttttatt taatgaagaa gaaattaatt cttggacttg tcatgatgat ggcattgttc    206880
     agtctagcag cgtgcggtgg cggcggagat gtcgttaaga cagactctgg cgatgtaaca    206940
     aaagacgaac tttatgacgc aatgaaagat aaatatggct ctgaattcgt acaacaactg    207000
     actttcgaaa aaattcttgg cgataaatac aaagtaagcg acgaagatgt tgacaagaaa    207060
     ttcaacgagt ataaatcaca atacggagat caattctctg cagttttaac tcaaagtggc    207120
     ttaactgaga aatctttcaa aagccaactt aagtacaact tgttagttca aaaagctacc    207180
     gaagccaata ctgacactag cgacaaaaca cttaaaaaat actatgaaac ttggcaacca    207240
     gatattactg taagccatat tcttgtagct gatgaaaaca aagccaaaga agttgaacaa    207300
     aaactgaaag atggcgaaaa atttgctgat ttagcgaaag aatattctac agatactgct    207360
     actaaagaca atggtggaca attagctcca ttcggtcctg gtaaaatgga tccagcattt    207420
     gaaaaagcag cttatgccct taaaaacaaa ggcgacatca gtgctccagt aaaaacacaa    207480
     tacggatacc acatcatcca aatggacaaa cctgcaacaa aaacaacttt tgaaaaagat    207540
     aaaaaagctg taaaagcttc ttaccttgag tctcaattaa ctactgagaa catgcaaaaa    207600
     acacttaaaa aagaatacaa agatgctaac gtgaaagtgg aagacaaaga cttgaaagat    207660
     gcttttaaag attttgatgg ttcttcatcc agtgatagcg attcatctaa ataagcacta    207720
     aaaaaacacg cttggaaatt tccaagcgtg ttttttattc aaatgtagga ttataaaacg    207780
     aacgattatc taatccaaat actcgttcac tgaattcgcc cggttttgta tgttttagta    207840
     ctttatccat catgttcaag gaagcgtcca ttaaatcaat ttggtgtaaa atctcggctt    207900
     cacgcacaag cggtggtttt ggactccccc actcaccttt accatgatga gatagaagaa    207960
     cgtgttttaa aaccacgact tcttcaccat caatcgaaag ttcgtcagca attttgctca    208020
     cctcttctac tacgatggaa atatggccaa ttaaattacc ttctagtgta tacgtcgttg    208080
     atactgggcc tgaaagttca atgacttttc ctaaatcatg taaaatcaca cctgcgtata    208140
     ataagtctcg attaacagat gggtaaagat cggcaactga ttttgcaagt cgtaacatcg    208200
     aaactacatg aaaactcaaa ccggaaacaa attcatgatg atgacgcatt gccgccggat    208260
     aatcataaaa atcatcttga tattttttaa gcaatgcgcg cgtaattcgt tgcaaattcg    208320
     catttttcat ttcgaaaata tattgtgtga tttcatcggc catttcttct ttattaattg    208380
     gcgcggtttc cataaattca ctagcactaa caccgtccag tgctgtagct tgcctaattt    208440
     ggcggatttt caattgtttt cgaccacgat aattttgaat atcacccata aggtgaacta    208500
     tttgttgtac cccgtaattc gcttcatcac tttctttaac atcccatagt tttgcttcta    208560
     attcacccga tttatcttgt aaaacaagac tcaagaatgg ctttccgttg ctagccgttc    208620
     cttttacact tgatttaatt agcaagaata ggtctactgt ttctccaact tcaaaatcta    208680
     ataatctttt ttccatttta tcgccttctt tctttctgta gtaagaagtt tctccaccca    208740
     ttatagcatg cgtatgtcct cactggaaaa atatttgcga gtttcttgat ggcatgtgaa    208800
     aaaaatgact tggttttcac tttttctttt tcggagcagt tgcatcattt gtcccatcct    208860
     agcagaatca aaatgcacaa atccatcatc aataatgatt ggtagtggaa aatctttatg    208920
     aatcacatca attaaggcaa aacgaatagc caaatataat tgttcttttg ttgcttggct    208980
     tagctcttct gggaagaatg gtacaacatt cttactttct acttgaagcc tattatcttg    209040
     taagtatact ttgtcatagt taccattagt taagtggttg aaatattcac ttgctaattt    209100
     taacgtttta ggaagttttc cttcttgtaa ccgttgcatt gtatcttgta aaatttgaag    209160
     cgccagtttt gtttctgtcc attcggctgc tatttgttgt agtttgctct tttccgaata    209220
     gaattcttgc atcaataccg cgaaagtccc gccttcttct aatttgtgta ttgcgtggtt    209280
     ttgtgccgcg agtgaggcat ggattttttc ttgttctagt tctatttggc gaagtgtttc    209340
     ttccaattgc agctcttttt ctttgatagt tgcttggttt tcatattgat ttagagctat    209400
     tcgcttttct ggttcaagtt gggcttctat tagaactaat cgttctcgcc aattctgttc    209460
     ttcttttaca cgaattgcag ccatacgaaa ttcttcttca ttcttcgcat tagcactcgc    209520
     taataaatct gctttttctt tctttatgag caataaatct tgcttaacta agtctagttg    209580
     catcgttact tgttccaact tttctgcaag ctttgcattt tcagttaagt ggttccgata    209640
     atagagcaag ccttgtcgta aaaaagtgat tttttcttct gtatccgtat attttccagg    209700
     caattctaag tttgcaagtc ttgctttata tacttcttgt ttctctgcta atggttctag    209760
     ttttgagata agttccattg caagttgagc tttttcacta ttttttttat aaaccgcaag    209820
     ctcatatgcc caatttgcat cgggattatg ttttattcct aaatcagaaa aaagttgttt    209880
     taattccatt gtatgttgat aaattgtttc gtttagttta ttctcggttg ctcttagttc    209940
     agctatttgt gatgcaataa tgtccatttc gttgagaagc tgttgccatt cttgccttat    210000
     tttcttttgt tctaaaaaaa ctaaaagttg ttcattgttt gttggaagtg ctttccatgt    210060
     agtcataatt gcataaccca caataagcgc agatacaaaa acaagtgcta cactccagat    210120
     agattggaaa acaatcatca gtgataaagc tacagcaaaa acgccaaatg aaacaaaagt    210180
     cttagttcta aatgttttag gcttctgttg cattttttct tttgcttgtt ggaatgttct    210240
     attatcccac atatccattt ctatttgatc aatcttcttt tggagttttt cttctgtatc    210300
     attagtaagt tttaatttta actgaatttc atgttgttgc tctttgtgga actgttcttt    210360
     ttcttttaaa cgggccattg tttgttcaag ttcgctcgtc catactctaa atgtttgttt    210420
     tgagtcaact tgatgaaaat taatttcttg ttttaaattc tttaactgga tttctcgctc    210480
     tccaaaagct gcataggttt cgattaaata tgttatttct gcttcatttt tggcaaaaaa    210540
     agcgctatgt tcataatcat tgttgctaat tagatttttt ttacgttctt ccaattgaat    210600
     aagctgattt tgccattctt tttctcggag ctgtaggtgt tctaatcgta taattccatc    210660
     tggcggaaaa gtagcttcct ttttttggga agccttatta cttagtgctt tccattcttg    210720
     gtataatggc cacaaatccc ctaatgtttc taatgtatct aactctactc gtttagttgt    210780
     tttttctatt tgcaactctg cttgtcttgc tgtcgcttgc tctttctcat taattaattc    210840
     ttcatattgc gcattttgct ttttggcatt ttgaaaagct tgttgggctt cttttactct    210900
     tttaagctgt tgattgatta atggatttcg cccacttggt ttataaagac tatctagttt    210960
     tttttgtaat gtttctgctg tttttaaaag tgcatccgag ccagttgttc ctgtcgctaa    211020
     caaatagcgt tcaaactctt tcttcttcca ttgatgaata ttttgtaatc cgtgtatatc    211080
     aaaagaaaag atagcctcat aggtgtttcg atcaatttcg ccaataattt ctggcaattt    211140
     ttcttctcca gcagtttgac catcaccgta atatattcga acatctccag ttgcttttcc    211200
     ttttaaacgt tcaatgatga cttttccaaa agaggtgtct tctagcgtta atcttccgcc    211260
     gtatggtcca ccgttttttg gctccatgcg tggtattgat tgttgtttcg ttggaaaacc    211320
     aaacaaaata ctatgtataa aagccataat agttgatttt ccggcttcat tttcaccata    211380
     aaaaacttga aaattggcga tgttattaaa atgagcatcg gaccatttcc cataaccaat    211440
     gatatcaatg gatgttattc tcatttttca tcaccctcca cttctgcaag tgtcattcct    211500
     agttccatta aagcattttc caagagtctc tcacgctctt gttccgacaa atcatccaag    211560
     tatctgtttg caccactttc aagatacagc gcttctactg attgataaaa agctgattca    211620
     tcttgtagtt gctcaaatga gcgcctaatt tcttctcctg ctaaatgcga ttcataccat    211680
     gtttgtagat tacttcgatt cgttatctca gttgtcaatt tgtggaccca cacaaaagta    211740
     gtgtttgaaa gctctacttc ttcttgaagc atttgcaacc agtcatttgt atttattttt    211800
     tgcgaactag ccatttgaat aattatatga agaaaatacg aatggctacg tccttgataa    211860
     ctttctagaa cattagtaat ttctcggtaa aaggcattta tttcactatt tttcggcaac    211920
     gggatgataa tttcttccca aataatcgga cttgtaccaa taaaatcaat tgttgtactt    211980
     gcttctgata agttgatgat acttgcgcct ttttcacctg attctttgcg gtttcgccct    212040
     tgaatatttc ctgggtaata aatgctagga gactctgcaa gcaattgtcg cttatgaata    212100
     tgacctagtg cccagtagtc aaaacctttt ttgctaattt cttgcacgcg aaatggggcg    212160
     tagacatcat gttcctcgct actagatact tctgagccat gtaataacgc aatatgaaaa    212220
     tcagcatcac cttgaacctt gtattcatct attcggcttg agcgaatatg gcgttcattg    212280
     taactaaatc cataaatatt aacgctcaca ccggtggctg ttttatgcaa cattacttct    212340
     acttgctctg aaaaaacgtg aacattgctt ggtaatgcga gtttttcttt atgcttttct    212400
     ataaaatcat gatttccatg aatcataaac acggggatgt tcgccacttc taaccgtttc    212460
     atttcttttg caaaacgcgc ttgagcacgg acactttgat cttcactatc atatatatct    212520
     ccagcaatta aaacgaaatc tactgcttct tttatcgcca cagttgtaat ccgttctaat    212580
     gattgaaatg tgctttcttg tatggcagaa aaaagcggct gtggtagcgt cgaaagcccg    212640
     atgaaaggac tatctaaatg taaatcagcc atatgtaaaa atttgatttc tttcatgact    212700
     ttcgcctcct ataaaaaccg aatatacgtt cttattatat cgtactattg cgttaggtac    212760
     aagcatttcc aataaaaaaa tgaccctatt atctgctaaa taaataacaa ataatagagc    212820
     cacttggttt aacgaaaatt aatcattagc tacattataa agatcttgta atggcgtcat    212880
     gataatgcga tttagatcat tgataattgt gctcatcgct tgctcttttt ccattagttt    212940
     aacgattagt tcgttttctt gaacttcttg cgctacttgt tgtgctacat ctactgtttc    213000
     atcgtcaatt tcttgaccag tcatttgttt ttcttggata gttacttgaa catcgcgaaa    213060
     acgttcgaat tttgcttttg catctgcatt ttcgtttact tcacggtatg catcttgcaa    213120
     gctgatgaat tcaggtgttt cacgaattcc tttgtctaaa tcatgtgcta aatcataaat    213180
     attaactgcc attgataaat cctccaaata tctgtatttg tcacttctgt ttcactataa    213240
     caaaaagtcg ccggttattc cagtataaaa gaactaaatc cacattgcga gaattccttg    213300
     aataattcca ataaaacctc ctaaaatccc acctaaataa gtaatcattt tcaattctct    213360
     tccagaaatc tctacaacaa gtttttcgat ttcaggtaaa gaaaaagtgg caatttgtgt    213420
     ttcgactagt ttcgctaagt ccattctctc tactatttcc gcgctatgcg ttgctacaaa    213480
     atcaagcatc cgttctactg caaatggaat tactttttct gtaatagctg cctcatagcc    213540
     acgtagtatc acttgaatgg gctgattaaa taatttctca tgaggtaaag tttggataag    213600
     ttcagaagta agttgtccag ctaaatgagc ttgcttttca gtcgggataa gctcttgtaa    213660
     ttcttttgct tcgaagtttt tccattctgt tgttagaagc tggttaatta gatttttggt    213720
     gtcttcttga ccaatgagtt ttaagccttc ttgttgaatt ttttcagaaa agctatcgat    213780
     attaataaac attctagcca tgcttcccat tttgccgtgt tcttcaaaga atttttgtag    213840
     catttgttta atttggattt tgccttcttc actcgctaca aataatgtca ttttgctcgt    213900
     gattctttct gttacatgtg gtagtttagt tgttagttct gactctaaca ttgttggaat    213960
     taaatcgctc atttttgtcg tttttttagt acttagaaag tggttgattt ctttctctaa    214020
     ggttttttct atccatgcca tagaacggat ttctgcattt tcataaccaa aatgatgtag    214080
     gagttcatta ggtgttgttt ctaatttcat tttttcatgg aacattttcg taatggtatc    214140
     agttatttct ttttgtaaat tctcatctag caaacgagca cgaatggcgt cttctgtaag    214200
     caaatgactc actactactt ttccgatgtg ctcggctagt tcatcacgtc gttttgggat    214260
     taaacctggg gtaaatggta aacgtttatt aaataggtaa atggctttgt aggggcgaaa    214320
     aagcattcgg atggctatat aattcgtcat tgcgccaata aatccgccaa tcactgccat    214380
     taaaagtatc gtaaataaca ctgacatgtt ttgcatctcc taatatttgt ctagtaaaag    214440
     tggtttcatt atacgtgaaa aatccctaga caacaattgt ttctagggaa gttcattcta    214500
     aagtatgaga ttacaaatta gtcattttca atggatttat ccacaaatca aattcttttt    214560
     ctgtcacaaa gccggttttg attgccgctt cttttaatgt cgtattttca tcaaaagcca    214620
     gtttggcaat tttagcagct ttttcatagc cgatatgcgg attcaatgct gtaacaagca    214680
     ttagggagtc atttactttt gtttcaataa ctttttcatt cgcagtaagt ccttccaaac    214740
     aatgcactcg gaacgaacgc atgctatctg caagaagttt gatagattct aggaaattaa    214800
     aaatgataac cggcttgtag acatttaact caaagttccc ttggcttgcg gcaacattaa    214860
     ttgtcacatc atttcccatg acttgagccg ctaccatcgt aattgcttca cattgggtag    214920
     ggtttacttt cccgggcata atagagcttc ctggttcatt agctggtatc tctagctcac    214980
     ctatgccgct acgtggtcca cttgctaata aacggatatc attagcaatt ttcattagat    215040
     ccgaagcaag gctacgaatg gcgccatgaa caaaattaat cggactatga ctagttaaag    215100
     caaaatactt attggaatca gaagtaaaag gatatcccgt ttgtttcatc aattcttcgg    215160
     caaccttatc accaaaatca cgtgaggcat ttaagcccgt tccaactgca gtcccgccaa    215220
     ttgcaagtgg caaaattgct ttcatacttg tttcaagata gtttttatta tttgtaagac    215280
     atgcttccca gccactaatt tcttgaccaa gtgttaaagg agttgcatct tgtaaatgcg    215340
     ttctaccaat tttaacgaga tgcatatatt tatttttctt ctctgtcaaa acagcttcca    215400
     ttttagttat ttctggtaaa agttttgtta ctaaagcccc gtatgcggca atgtgcatcg    215460
     ctgttggaaa tgtgtcgttc gagctttgtg acatgttaac atcatcattt ggatgaattt    215520
     gtccttcgcc taaagttaag ttggcaacgt gtgcgataac ttcattgaca ttcatgttgc    215580
     tctgcgttcc gcttcctgtt tgccaaacga ctaaaggaaa atgctcatct agttctcctt    215640
     gaatgatttg atcacaaacc tggccaatcg ctatcgcttt ttcttcggct agttttcctt    215700
     ctgctgcgtt cacttttgca gtggctttct ttaactgagc aaaagcatat ataatttcta    215760
     tcggcatagg attatcacca atagcaaaat tccttttact tcgttctgtt tgcgctcccc    215820
     aatatttcgt cgcatctaca gaaatttctc caagcgtatc tcgctctatt cgttccattt    215880
     cgccacccct ttttattcta ttttagtata aagcggatgt tttcgcaaaa cacatggaaa    215940
     atgttcgcta ttccgttttt ggaagtgctt ttattttaat cattagaaca gtcaagccta    216000
     caagtaagat aatccaggct gcagtaatca aaattgtggg aataaaataa tccatcgtct    216060
     taccggacat aataagcata gtcgcatttt tacttaaata cgccggatta aatatttgaa    216120
     tccagccacc aagtccactg attagtccta aaacaatcgc tataaagaca ctaatcattg    216180
     caacaacggc attactatca aaaattgagc tcgcaaaaac caccaaacta ataacaaaaa    216240
     taaaccaaac ggcatacaca aaaaatccct caactaatga attaatcgct aattctccaa    216300
     atagaaagta cgtatagtaa gcagccaaga catagccgat taaaagcgaa cttaacccca    216360
     ccacacattg cattacccat ttcgataaca cgtattccac agcgctcact ggccttgtca    216420
     taataaatgc caacatacct cttgttcggt cattttgaat acaagccatc gcaacaacga    216480
     tgataatgat aataccaatt tgatcaaact gggagcctag tgtttgtgcc atcacttcct    216540
     gagctgattg attccccatt agtgcaacta cctgctccgt ttccgcccct gtgccaactg    216600
     cttttagaat ttctggtaaa aaatacatca ttagtggttg tgtgagccca agaagtgcga    216660
     atacaatcgg aagccagata atttttaaac ttcgacgttg ttccagccat tcttttgcta    216720
     ataaagcatt aaaatgtgtc atttgcccac cttctccata aaaatttcct ctaaactttg    216780
     gtgtctattt tcaacacgaa taaattcacc atctatttgt aataaagagc tcaaaacagc    216840
     ttctgatcca gctttttgat tagttgtgta aacttgatag accattccaa ctttttcaat    216900
     tttttccacg tatttatttt gaagcagtaa cgtttgccaa gcttcactat ttccattaaa    216960
     ttcgacatca aacaccggag agctttcttc ttccataagt tgcactacgg ttttatctgc    217020
     aactaattcg ccatttttga taatggcaat gcggtcacaa atttcttcag catcttttaa    217080
     aatatgtgta gaaaataaga tagtaatctc tttttttagt ttgtctaata gcagcatcat    217140
     ttcgcggcga ccaataggat caagtgcaga tactggttca tctagtacaa ggagttctgg    217200
     tcgatgcaaa atggcttgag caatcccgag tcgttgtcgc attccacctg aatacgtact    217260
     aattttttta tttgcactct cttctaaccc taccaataat aagacctcgt taatacgagc    217320
     ttttagatcc gtcttttcca tattagatag ctttcccata aaatgaaggc attccgtcgc    217380
     actcatccaa ccataaaatt ctggatactg cggtaaaaaa ccaattttct ctcgaactaa    217440
     ttttgcactt tcaccatcta aagtaatttg tccttcatcc tgtgttaaga tttggacaat    217500
     catattaatc atcgttgatt ttccagcccc attaggacca ataagtgcca cacattcttt    217560
     ttcattgata gtgaggtcaa tccctttaat gacccatttg ccattatatt ttttctttag    217620
     cccttgaatt tctaattttt tcattagtta acttcctctt tgcggccaaa aataaagtag    217680
     gcaatcggtc caaaaatatt aataacgatg ataacaatta gccaaataat aggatttttt    217740
     cgtgtattcc agttttttgt taaatcaata atggcagtta ataataaagc taaataaaga    217800
     agaattacgg gtataattaa tgcaatttgt gttttatcca atttactcac ctcatccttt    217860
     tgttatactt attgtataac agttataata ttaatgcaat ataaaaaagc acattttact    217920
     agagatatca tagtaaaatg tgcttttaat taattaccta tcgaatcgat taagtttcca    217980
     ataccatcag aaacttttcc accgaattct tttactttat cggcgccttt tttgattgtt    218040
     tctccagctt catcggcttt ttctttcacg ccactccaaa agtcgctacc actgttcttt    218100
     tctttttctt cctcttcttt tttcgctgca gtttcttgtg cggcactctt cgtactaaag    218160
     tctgcggatt tctgatactg caaaccacta ttcattacgt agtgagccaa actagaaaca    218220
     ccagcagaac tggttgtagt tagataatgc tctttgtcag ttttatcata tcccatccaa    218280
     acggctccga ctaggtttgg tgtgtagcct acaaaccatt gatcttttgt accgcttgta    218340
     tcatcaaatg gaacttgcgt ggaaccagtt tttccagcca tttcgtgacc ggaaacagct    218400
     gcactttgac cagtccctgt attgataaca tctaaaagca tggaagtcat ttcattagat    218460
     actgtttctg aaatgatttg tttagttttt ggaacatttt catatactgt attccctgat    218520
     ggatcgacaa ttttagtaat aatatgagat tctggtttgg caccgttgtt agcaaaggtt    218580
     gcatacgctg ttgccatttc tactggcgaa gcacctttac tcataccacc gagtgcaagc    218640
     ccgagcgttc tatctttttc tggaactgta ataccaaatt tttcgacaga ttttacgcct    218700
     ttatcgatac caatttgatc aagtaaccaa acggcagggg cattaatcga gttggctaca    218760
     gctttataca ttggaacttc tccactataa acgccgccaa cattggttgg tgtatagtta    218820
     cctttgtagg ttattttttc atcttttagc attgaatcca cgtcataacc tgattgaagc    218880
     gctggtgtgt ataccgcgag tggcttcatc gtggagcctg gttgtgcttt catctgtgtc    218940
     gctctgttaa agccacggaa aacatgctct ccgcgtccac caacaagcgc tctaattcca    219000
     ccagtagctg ggtccattaa aacagctcct gattgaacta atgtgccatc atttgcatta    219060
     gaagggaata gcccatcatt gttgtaaaca ttttctaagg aagtttgata attttgatct    219120
     aattccgtat agattttata tcctttttgc atgatttcat cttgcgttat atctgcttca    219180
     tttacagcct cattaataac tgcatcaacg taccatgggt atttattcgc aagcggatct    219240
     tttgattgat catttaaaac tatttttgta gctttgtatt tatcgccttc tgcttttgaa    219300
     attgtgcctg tttcgaccat tgcatttaat accatgttgc ggcgattagt cgctttgtcg    219360
     atatgttggt aagggtcata cgcacttgga gcttgaagca atccagcaat tgtcgcagct    219420
     tctggtatgt ttaagtctgc tgctgattta ccaaaatatt ttaaggaggc attttctact    219480
     ccccactccc cattaccaaa gtaagaacgg tttaagtaca tttccataat ttcgtctttt    219540
     gagtaggttt tttcgatttc acgagccata aatatttctt tggcttttcg tgtgaaggtt    219600
     tgttcttgtg tcagcagagc atttttggcg agttgctgcg taatcgtact accgccacca    219660
     gaaattcctc cgctagtgac taaattaaca ccagcccgag ctattccttt caagtcaaaa    219720
     cctttatgtt cataaaattt tctatcttca atggaaacta ctgcattttg taagttttta    219780
     gatattttat cgatggatac aaatgttgcg tcagtagaag aaagttcccc ggccttgtcg    219840
     ccatctttgt cataaataat cgtggctgac tctaaacctt ttttaagcgc gtctatgtcg    219900
     gcagactttg ctactattac aagataaata ataaaactta ataaaaatac aagtccagct    219960
     agtaaaaaaa tctttccgat atgtttgttt ttccagaagc gtctaaattt ttgccatcct    220020
     ttgttaagcc atttccctat aaaaccaaag aataatttta agtatttaat aagttgctgt    220080
     ttgaatttgt ccatgtaact ctcctatctt ctacacggta ttaaataaac tatacacaca    220140
     gttatacacg tattttacgt taaaaagcaa ctttacgcca ccaactttag accgattttt    220200
     gtaataattt tgtaataatc catatttcct acatatttat taacctcttt tttacaattt    220260
     cttcatttta atgtttctag taatttaaaa agggtagata ttactgttac cattacttgt    220320
     gttttggtaa taattatcat ctatatactg tgtacaacaa gtaatggcag caagttttac    220380
     atgggtccat taatacgccg gaaaggaatt ggaatatgac gcaaaagctg atctactttt    220440
     tatcacaaac gcatattcga agtgccattg ctgaagcttg ggcgaaaaga ctttcactta    220500
     gcaatgtcaa attcattagc ggttcttggc ataaatctaa atcaacaccg tttattgcag    220560
     aagcgttaaa tgagtttgca atcgagccac ctgaaagttt gtcttattca cctagttcag    220620
     aattactggc agatgctgat ctcattgtaa caatttatga ttctgcacat gaaactgcac    220680
     caaaatttcc agctaacata caagaaaaaa ttatttattg ggacattgat gatccagaac    220740
     aagaaatagc gttaccccaa aaatgggcga gttatcaaga agtatgtgat aacattgcct    220800
     tatcagtaaa aaatttagag cacgtattga tagaggctta gatttcgttg tcccgccatt    220860
     tgtaggcggg acttttatgt taaaagagaa aggagtacat acataatgga tggatacaac    220920
     gatttaaaaa aggctgaaaa agcggcattt ttgagtatat ttgcctattt atttctagcg    220980
     gttttaaaaa tagttgctgg gcaattagga aactctgatg ccttacttgc agatggtttg    221040
     aataatacga ctgatattgt tgcttctgtt gcgcttttaa ttggccttag aatttctcgt    221100
     attccgcctg atgcagatca ttcatacgga caccgacgaa cagaaactat cagctcttta    221160
     atcgcatcta tcattatgtt tctcgttggt gtgcaagtta tttggagttc gattgttcac    221220
     attatcgaaa aagaatttgc aacaccctca atgttaaccg ctgttgtcgc tcttttttct    221280
     ggtgtattta tgtatgctat ttatttatat aatcatcagc ttgcgaaaaa acttgatagc    221340
     caagcagtgc gagctgctgc atatgataat cgttcggatg cctttgttag ttttggtgca    221400
     tttatcggga ttatcggcgc ggttcttggt gttccttggc ttgactccgt gacagccttt    221460
     ttggtcggta ttttgattgt ttatactgct atcaaaattt tctatgatgc tgcacataca    221520
     ttgacagatg gtttcgatgt ttctaagcta gaaactattc atgatttaat tgcttctgta    221580
     cctgatgtca aaaaagtaat tgacattaaa gcacgaatga acggaaatag gatttggatt    221640
     gatgcaacta tcgctgtgga tcctgaatta aatgtagtta aaagtcatga aattaccgaa    221700
     attgttgaac aaaaaattcg caacgaatac gaaggtgcat tcactttagt tcatattgaa    221760
     ccattttttg aataatattc attgtcaata atcgtaaagt caactataat ttagattaaa    221820
     gtatcatttg ctgggaggga atattcgatg gggcagagaa actaattcac ataaattatc    221880
     aaactagaat gaaaaatatg cagcaacaca ttggaggagt tctcttccag ggcgtttttt    221940
     cttctatata gatagtttta tcataagctt atttatatta aactaggagg tgtttgcctt    222000
     agcagaaact atttctgtca aggcgattta ttgatattaa ccattaaatt tttaattata    222060
     gctttactta ttgctatatc agcatttttc gtggcaacag aatttgcgat tgttaaaatg    222120
     cgaccgagcc gtttagacca attaattgcg gagaaagata aacgcgcggt cctcgctaga    222180
     catatttaca atcatttgaa tgcttactta tcagcctgcc aacttgggat aacgattagc    222240
     tcccttggac ttggttggtt gggagaatct acggtagaag cggcgttaca tccgttattt    222300
     agcttaatgg aacttccgca atcagctatt acgattctat cctttacaat tgcatttcta    222360
     tttatcacat tcttgcacgt agttgttggg gaacttgtac cgaaaacttt ggcgattgat    222420
     aaaacagaga cagttgcact tgcggtagct cgtccactgc atatttttta taaagtgatg    222480
     ttcccgttca tttggatttt aaatggttct gcagttttca tcgcgcgtct ttttggtcta    222540
     gagccagctt ctgagcacga aatcgctcat accgaggacg aattaaaaat aatcgttggt    222600
     gaaagttata agagtggtga aatcaaccaa tcagaattcc gttatgtgaa taagattttt    222660
     gattttgatg aacgtatggc gaaagaagtc atgattccgc gaacagagat tgtgaccgtt    222720
     gatactggat ctacaatcgg ggaattatcc gacattatgc aaaatgaacg ttatacacga    222780
     tatccagtta ttgatggaga taaagaccac gttatcggcg tacttaattt aaaagaaatt    222840
     ttatcagcgt atgtcgaaca tggctcgagt ccaagtttta gcattgatcc ttacgtaaaa    222900
     ccaattattc gtgtgattga aacgattccg attaaagaat tgcttttccg tatgcagcgt    222960
     gaacgttccc acattgctat tctgcttgac gaatatggtg gtacttctgg acttgttacg    223020
     gttgaagata ttgtagagga aatcgtaggt gatatccgcg atgaatttga tgccgatgaa    223080
     attccagaaa ttcgcaaaat caaagatgga cactatattg tagatgcgaa acttctgatt    223140
     gatgaagtaa ataacatttt aggtactgaa attgaggaag aagaagtcga cacaatcggc    223200
     ggttggttct taacacaaaa ttatgaagta gaagttgggg acgaaattga ttatgatgga    223260
     ttcattttcc gcgtaaaaca aggcgaacct catcatattg aatatatcga aatcatcaaa    223320
     aaaacaaatg attaatcaaa cagtagctat ccctctcata gggtagctac ttttttatat    223380
     acgatgtgct aacataaatt gcttgaactt ctcagctgca ggcgttagtg tttggttttt    223440
     cgcgaccgca agataaaaga accgctccca gtttgggctt ctaattggta agactttgac    223500
     atccacataa tttaaaatcg gcatgttcgg aactacagca atcccaaagt tttgcgcgac    223560
     catcccggca atgacttgat ccacttcaat ttcatatgcg atttgataat cagcgccaat    223620
     ttttctgaat aactcatcga taattggacg caaaccactt tttttcgaga atgcgatatg    223680
     cggataatct accgtttcga ttaaatcaat ccagtctttc tcagcaagcg gatggctttt    223740
     agggacgatg agcactaatt cttgtttggc aattggtgta aagtgaatat ttctttcatt    223800
     ttcaagttta gaacaaatac caatatcaaa tttcttttct tttaggcctt gaatgatatc    223860
     aatcgaaaca cctgtatgga aaataaaatc gatttgtttt tctggttcgg tttggagaaa    223920
     ttcttgaaca agctttggta ttagagacgt gccaagtgtt tgcaagaagg ccaagtcaat    223980
     ctgcccttcc ccatttgccg ctttcttagt cgttgcaact cccgcgtcaa tcatatctaa    224040
     agactcttcc acataatcaa gaaatacttt cccagcctta cttaaaccta tattccgccc    224100
     ttctttttca aataaaggga tacctagttc ttgctctaat gaggaaattg cgtgacttaa    224160
     actaggctgt gtaatcagca atttttcagc tgcttttgtg taatgctcca tgtgcgccag    224220
     tgtgacgaag tatcgtaaat ggtgtaaatt catgcttctc tcctaactaa aaagttatct    224280
     atgcaattta tctatcaatt aatagaacaa taccaatttg tttttatgga atagtcataa    224340
     tacaattaaa ctgtagttac gccagtgaaa caaactattc cttaaaaacc aatatacggt    224400
     agaataggtt aactgtccag ttccattttt aactattgaa ggcgttatca catcagagat    224460
     ttttaattta gtggaattta tttttttact ggtgtttgtg aaaatattat caaagtttct    224520
     tgtaattttt attatggaga ggagataatt tttatgacaa atgcaaatgg caatctaaaa    224580
     aaatgcccca tcacgattag ctcttacaca ctaggaacgg aggtatcttt tcctaaacga    224640
     gtgaaagtcg ctgcggaaaa tggttttgac ggaattggct tgcgtgcaga aaattatgta    224700
     gatgcactag ctgccggatt aaccgatgaa gacatgttgc ggattttaga cgagcataac    224760
     atgaaagtaa cagaagtgga gtacataacc cagtggggaa ctgccgaaga tcgtacagca    224820
     gaacaacaaa agaaagagca aacaactttc cacatggcgc gattatttgg cgtcaaacat    224880
     attaattgtg gtttgcttga aaaaatccct gaggaacaaa tcattgtcgc gcttggtgaa    224940
     ttatgtgacc gcgcagaaga attaattatt ggtttagaat ttatgccata tagcggtgta    225000
     gcagacttac aagcagcttg gcgagtagca gaagcatgcg gacgagataa cgcgcaactt    225060
     atttgtgaca catggcactg ggctagagca aatcaaacag ctgaatctat caaaaatgtt    225120
     cccgctgatc ggattgtttc tatccaacta tgcgatgtcc acgaaacacc ttacaaagaa    225180
     cttcgtgaag aatcacttca tgatcgttta gctcctggag aaggatacgg agatacggtc    225240
     ggttttgcaa aaattttaaa agagcatggt gtaaatccac gtgtgatggg agttgaagtt    225300
     atttcagact ctatggtagc aactggttta gagtatgccg ctcttaaagt atacaatgcc    225360
     acgaaaaaag tattagacga agcatggcca gagatttctc cacgctaaac acctacttag    225420
     ttatgtgaaa atgataacgt agtaggaaga ctccctgtga aaggaatgtg ttatttttga    225480
     aatttaattc gatgttttca cctattgata tcgggccgat gaaagtgcct aacagatttg    225540
     tcgtatcacc aatgtgcaac aactatgcaa atacagatgg aactttatca gacacttccc    225600
     ttgcttacta taaagaacga gcacttggag ggttcgggct tattactttt gaagcaacgg    225660
     ttgtagatgt acgcgcaaaa ggtggcgcaa ataaagcttg cctatatagt gatcatcaaa    225720
     ttgctagttt taaacgagtg attgatgtat gtcacgatgc tggagcaaaa atttctgttc    225780
     agttacagca cgctggacca gaaggaaatt ccaaagtatc tggttatcct ttaagagcag    225840
     cctcagcgat tgcctcggct gcagggcgaa atactccaga agccatttcg cgagaagaac    225900
     tttatgagtt gattgaactt tacggagaag ctgccttacg agcaaaaaaa gctggtgctg    225960
     atgcagttga agttcactgt gcacacggtt atttagtaag tagtttctta tcggcacgga    226020
     caaacaaacg tgtagatgaa ttcggcggct gttttgaaaa tagaatgcga ttacctcgac    226080
     ttatcattga aagtattcgt aaacgtgttg gtcattctat tgcaattctt tgccgaatta    226140
     atagtactga cggtgtcgac ggtggattaa gtgttcaaga cagcgcgacg gttgcagctt    226200
     atttggaaga ttgtggtttg gatggtttac atgtctctcg cagtgttcat attcgcgatg    226260
     aatacatgtg ggcgccaacc gtcttgcatg ctggatttag ctctgatctt gtaacgcaaa    226320
     ttaaacgcgc tgtttctatc ccagtaatta ctgtgggtcg tttcacagag ccgcattacg    226380
     cggaattaat ggttcgtgaa ggccgtgctg acttggttgc tttcgggcgt cagtctttag    226440
     cagatccaga gacaccaaac aaagctgcag caggaaaact agacgagtta cttccttgta    226500
     ttgcttgtct tcaaggttgt gtggctaaca tgtacgccgg aaaaccaatt acttgtctag    226560
     taaatccatt actcggacgt gaatccgaag cttacttacc aaaaactcca agtaaaaaag    226620
     tggtggttgt tggtggcggc gttggtggac tttatgccgg atggatggct ggatcccgtg    226680
     gtcatgatgt gacagtttat gaagcatcag atatgattgg tggtcaaatg cgattagctg    226740
     cctatcctcc tggtaaaggc gacttaacaa atatggttcg tagttacatt aaaaaatgcg    226800
     aacagtttga tgtcgaaatt aaaacaaaca cacccgtaac attagaactt attcaagaag    226860
     ttgcaccaga tgctgtcatt attgcaactg gcgccactcc actagtttta ccaatcccag    226920
     gtatcgagga cgcaggattg attcatgcag ttgacttact ggatggaaaa gagaaatgtg    226980
     gtcaaaaagt tcttgttgta ggtggcggta tggttggtag tgaaacagct gcatttttag    227040
     gtgaggctgg tcatgatgtt accgttgtag agcttcgcga tgaagttggg gcagatgtca    227100
     tttctgagca ccgtaagttt cttatgcatg atttcgatga atataaaatc aaaagtgtta    227160
     ctaatgccaa agtaacgagt ttctttgaag acggagtaac ctattcccta gctgacaaca    227220
     aagaacagcg aatcgatggt tttgactctg tagttctagc aatgggatca agagcctata    227280
     atccactaga agaagctatt aaggcaattg taccggaaac ctatgttatc ggtgatgctg    227340
     tacgcgcacg ccgcgcactc gacgcaacga aagaagcact tgacgctgta ttacaattat    227400
     aatttattgt cctactcgct ctaatatgta gcgagtagga ttcattcgga ggaaaacaaa    227460
     atggaaaata gaatttcagg aacgactagg cttcttggct taattgggac acccatagac    227520
     cattcaaaat ctccaatcat gtataattac agttttcaaa aagcgggttt ggattatgct    227580
     tacctagcct ttgacacacc tatccaaaaa gttgcagata ctattaaggc aatcaagaca    227640
     tttaatcttc gtggtgcaaa tgtaaccatg ccttgtaaaa gtgaagtttt aaaacacatg    227700
     gatgaccttt cccctgccgc acggatgatt ggcgctgtta acactatcgt aaatgaagac    227760
     gggaaactaa ctgggcatat cacagacggc cttggtttta ttgcaaattt gcgagatgct    227820
     agtgtagatg ttgccggcaa aaaaatgact ataattggtg ctggtggcgc ggctacagca    227880
     atccaagtcc agtgtgcact tgatggggcc aaggaaatca ccatttttaa tattaaagac    227940
     gctttttatg acaaagcgaa acaaaccgtt gcttctatta aacaagaagt cccaaattgc    228000
     atcgtacata tttatgattt gaacgataca gaaaaactaa atgcagaaat taccactagc    228060
     gatatccttg ttaatgcaac actcgttggt atgcatccga atgaacatga aacacctatt    228120
     agcgatacat ccgtttttag aaaagaactt atcgttgcag atattattta taatcctaaa    228180
     aaaacgcaac ttctactaga tgctgaagct gctggttgta agactgtagg cgggttagga    228240
     atgcttttgt ggcaaggcgc tgaagcatac aaattgttta ctggtaaaga tatgccagtt    228300
     tcagaagtaa aagatctata tttcaactaa taaattcatc aggatttcga gaggagaaaa    228360
     aaatgaacgc aaaaagattt tatccaacag caatagcact ttattttact tattttattc    228420
     acggtattgg ggtatccatt cttggccaat acaaacaaga tttcgccgga gtatggggag    228480
     cagataagct ttctgacggt acatttgatg taagtatggt tatcgccgtt atcgcagcac    228540
     ttggtttagg gcgcttgctg acattaccaa tttctgggcc tttttcagat aaatttggac    228600
     gtaaaccttc cgcattaatt ggtgttgggt tatacgcagt ttatttcatc ggtcttgcct    228660
     ttgcaccgaa tatgtatatc gcttacgctt tcgcttttgt cggaggagca gcaaactcat    228720
     tcttagacac agctgtaacg ccatctgttt tagaaatttt cacaaaaaat ggcgcgattg    228780
     ccaacatgtt tactaaattc tcaatttcta tcggacaatt cgtattacct ttcgcaatcg    228840
     gtatggttgc ggcggcaaat atgtcattcc gtacactatt cgttatcaca atggctttaa    228900
     tcgttattga cggcttaatc attgcattta tgccattccc tccaatgaac aataatgttg    228960
     gcggcgaaaa agcaaaacca gaaaaaatga aattcaatgc aactagttgg gctattatcg    229020
     gtattggttt tacttgtacc tccactttcc aactctggct aaactgtaac caagaacttg    229080
     gaaaattata cggcatggct gatccgagta aaattcaatc attttattca ttaggaacaa    229140
     tgtgcgcaat tttaattacc gctgttctcg tgaagaaatt tattttgcca gtacgtattc    229200
     taattcttta tccagcgatt gctacattaa tgctactgat tatttatatc gtacaaacac    229260
     ctactatttg cttaattggt ggatttgtta tcgggtacgc tgctgcaggt ggagttctac    229320
     aactagctgt atctacggcc aatgaatttt tcccaacgaa caaagggaaa atcacttcga    229380
     ttgtcatgat ttcttccagc ctagcaaact atatcgtttt aaacgttgca agttatatta    229440
     ctaaagctgg tggtatcgaa ggtccaaaat atgtgttatt attcaatgta gcgataactg    229500
     ttattggtat cctattagca atttttgtta atatgcgtta caaaaacgaa tctaaaattg    229560
     ctactaaata atttattttt caactgagca tttatgatgc tcagttgaac ttacatatca    229620
     tttgtgaagt aaagcacaaa cttatgtatt ttatctatat gaactcactg aaaaagaggg    229680
     tatttttaat aaaaagtcct cataagtcat tacataaagg agagcagact atgaaaaaca    229740
     aatatttatc tacatcactt ggtctttata tgaactactt tgttcatggt atggcgttaa    229800
     tcatcattgc acaaaacatt gattttttat ctcaaaaatg gcatacagat ttagctggtg    229860
     ctgccggcgt tgtatcttcc tttgggattg gtaaattatt agctgtattt atttcgggaa    229920
     gactatccga taaattcggt agaaagttgt ctgttattct cggcgtgttt ttctacattg    229980
     tctttttagg aggtatatta ctcagtccaa acacgattat tgcttatatg tttggtattt    230040
     ctgcggggat agctaattca ttcctagata ctggtaccta tcctgcgctc atggaagctt    230100
     atccaaaaaa agccgcttct gccaatatca ttgttaaagc atttgtacaa tctggtcaat    230160
     tccttttacc gtttatgatt gcatttattt tggcaaataa cttatggtat ggctggagtt    230220
     ttattgtatt aatcgttatt ttactaatta acttactata tactttgacg cgtactttcc    230280
     caccgatgac tgttggaaaa ccactagatg tagcagaact tgccgaagag aaaaagcaga    230340
     agtttcattt tagtatagat gaaatttgtt tgattttatt tggttttgta gctcaaactc    230400
     ttctctatat tatgagccaa tggattgcta agtatggttc agaagttatt catatgacag    230460
     acgatgcttc tagactactt gtaagttatg ccagtgttgg agcgattatt tgtgtgtgtg    230520
     tgacgtttgt tttaggaaac cgcggcgtac gaacgctcca tatcttaatt acttatgtaa    230580
     ccatgacgat gcttatctcc tttacactgt ttgctttccc aagcgaaatc gtatgtattg    230640
     tcggggcttt cttattgggc tatttctctg ctggaggaat tatccaatta ggtctaacac    230700
     tacttgcgga ggtttctgct cgaggaaaag gttttgtcac tagtctttat actattgcag    230760
     aagggatagc tgtatttatt atccccttga ttgctgctgc tatttcccga attgatattg    230820
     ccgctatctt tttactaaat gctggtattg cgcttttcgg tctcgctctc ttaatgattg    230880
     tatttacaag aaagaaaaaa tttgctcgag atcatattta aaaagaccga gaattgattc    230940
     gtcaattctc ggtctttttt aatgtttccg taacgttttc catttgtaca tgagcatcca    231000
     aaaagcaatg acagaggcaa ctaaaattag tatgatttta attattaaac ttataacttg    231060
     tcctgtcgga attaattgat cgtaattaaa acttgcataa tgaccactta aacaaatagt    231120
     cacataaaga gagccaatga taagtatggg gagccggaat ttattattca tcaaaaatct    231180
     accattgttt tccaaagaag ctgttttcat tgcataccag ctaatggtta acattcctat    231240
     tgataaaata attaatacgc caaattcact taacgccgta gttccttgta aaattggtgt    231300
     tggtattgcg ttatacagca taaccgctcc accgtcaata tccactattg tttttccagt    231360
     aaagaaagct ttaaaaccaa tgattaaatt agtcaatgcg cctggaaaca tgtataaaaa    231420
     gctaacaatg gacccaattg ctataattcc ggctgtaatt atttctccaa ccaaattccc    231480
     aactgccatt gctaacgtgt aagagaacaa atacaataac aaaaaggaac taatatacat    231540
     aaatgaatca cttacactgg gtaaatacaa ccccggtatt tgctgataaa tataccaaaa    231600
     cctacagaaa atgatgattg gtactagtac gaaaattaaa agcaatggaa taagcatctt    231660
     atgccaaaaa atttgctttt tggagtatgg caatccaaaa gtaaaataat ccatttgctt    231720
     atttttctca aaaacagtta actttaatcc taaaaacaga aacacataga agaaaagccc    231780
     taaattccct tcaaaatcat aaggagttaa acttaaatca ttttttattt cattacccgt    231840
     catttgttga tctgctgtat tatttttttg aaattcttca gactgataat atttatagtt    231900
     atcattaaac atactaaccg tattagttgc agtcgtagct tcagaaccta taaaagcgat    231960
     tacgataaat ataaataccc acgcattctg acgccattct ttccaaagaa gccctgtact    232020
     cataatttct cgcctccttg ttcttctaga tgataaataa acaagtcttc taatgtgact    232080
     gcgagttcat ccatgaaaat aggtttttct ttttttattg ctgcgtataa ttctgtgttc    232140
     atatctcgga ataaaatggt gtaaacacgg ccatacttat taattacctt gccattttcc    232200
     agtaaaaagt gtgggatttt tttgttttca aaagcgattt gaattttaac tgcttgttcc    232260
     cgcagtgatt caaggtggta agactcttca atatgattat cttgtaaaat atgaatatag    232320
     tcagcaatcg gatctaaatc agctaaacga tgggaagaaa taataatgcc taatttccgc    232380
     ttctccactt cttctaataa tatgcccata attttctttt gagcaattat atcaagtccc    232440
     tccattggct catcaagcag aataaattcg gctcctatgg aaagagcaag aacgaggcca    232500
     aaaagccctt tcattccctt tgaataattt tgaaacttta cgtcttttgc taggttgact    232560
     tgcttcatta aattatcaaa tttgtctcca tcaaatagtg ggtacgtttt ttgatagaat    232620
     ttttttattg tcgggatttt ataaccatcc caacaattta aattatcttg aagcataaat    232680
     agtttttgct ttagttgatg atttttgctt aatggctcat ccagatacac atcccctgca    232740
     tcagggatat aaaagcccat gatggttcga aaaagcgttg ttttacctac gccatttcgt    232800
     cccactatac caataatttc tccaggtttt acttcaaaag ttattttatc cagcaagagt    232860
     tttccgtcaa tttttttgct aagagaatca accttcaacc acgtcacctc caatgatgtc    232920
     ttgactatat tcgtctgcta atttatgtat ttcctctatg ttaactccaa ggtaaactaa    232980
     atcgagaatg gtttctttta atttggtcct tgtttctgct aactttttgg gcgagctcaa    233040
     tttatctgtt tggttcgcta tgaaggtccc ttttcctttt actgtaatga ttacttcttg    233100
     tcgttctaat tcttggtacg ctttactcac agtgtttggg tttactccga ttctactagc    233160
     aaattcacgt atagataata tcttttcgcc ttcttgaagt acccctttga caacttgttc    233220
     tttaattttt tggacgatct gttcataaat cggtagttga ctttttgtgt taatcgtaaa    233280
     catctctccc cccgctttca tgaattctac tatagagaac taattgtact agttactata    233340
     gtacagtaga taaaaaaata aatcaattct cttattaaaa agaaaattga tttaagtttg    233400
     ctttttcaag ttttaagagt gattctttca tccctattcc cccactataa cctgttaaat    233460
     taccattttt accaattact ctgtggcatg gaataatgaa aagtagtggg tttctgccga    233520
     ttgttgttcc aactgcgcga acggctttgg ggcgatttat cagttctgcg atttctgtat    233580
     atgttctagt ttctccataa ggaatagttt ttaatgcatg aaatacttca atttgtagag    233640
     gagtagcgga caaatcaatt ggaacagtaa aattcgtaag ttccccgtgc aaataagcag    233700
     ctaattcttc tttatatatg ttcatttttt ctgggcttcg ctttgctgat tgaagctttt    233760
     ccgcctttgt tccaacgtaa actaacccca tttttgtcgc tgcgaaataa agttctgtgt    233820
     ctgaaaaatg gagcgtatca taatataaat ctgtcatttc cttcacctct ttctaatatt    233880
     aattatacgc caaattgaat aacattccta accagtttca ctataagagc aagattagaa    233940
     aagtttttct cgcaatttgc cttcataacg tttatgatta ataagaagtt gaggtgataa    234000
     cattgtcgga ttattactta accaaaaaaa gatggcaagc aatttcaaca aatgacaaga    234060
     ctgctgatgg tgcatttttc tatggcgtca catctacgaa gattttttgc tatccttcat    234120
     gtaaatcaag attacctaaa aaagaaaaca tcgttatttt ccatagtgcg gaggaagctt    234180
     tttcgcatgg ctaccgcgct tgtaaacgat gtaaatctgg tggtagtgct ctgcctgata    234240
     cggagtgggt aaataatatc gaaatgtata ttaaagaaaa ttttgccaag gcgctcactt    234300
     taaaaatcat tgcggatgat tgccacggaa gcccgtatca tttacaccga acgtttaagc    234360
     gaatcacgat gattacaccc attacttacc ttgagaacgt ccggattaat tatgcaaaaa    234420
     tgcagctaac cacgaccaac caatccattg aaactattgg aaaaatggct ggctttccaa    234480
     acccctctca tttttctact acatttaaaa ggcataccgg tttgtcacca aaccaatttc    234540
     gaaaaacaat aataaaaaaa ctaaattaga acggatgata tgaatatgac acatgtaaca    234600
     ttacccattt tagaagattg ggaaggcctt tcactaacta ctattttgca agaaaaattc    234660
     catctcggta aaaaagcgcg acatgaaatt cgcatgtctc aaaatgtttt actgaacaat    234720
     aagcccctgg acgattggaa tacgccactt ttcgttggag cgagtctttc tttaccaatt    234780
     tttttacatg acaaaatccc tgtttatgag tatgacttag aaattattta tgaagatgat    234840
     tttttactag tagtgaataa accagttgat atgaaaactc acccaaatga tagttatgaa    234900
     acagatactt gcgcgaatgc cgtgcaatat tacttagaaa aaactggcca agatgcgaat    234960
     gccttagcag ttcaccgtct tgatcaaact acttccggtt tagttctgtt tgctaaaaac    235020
     aaattagcta tcgccggttt atcttggcaa atggaaaaca gagcgattca caggacttat    235080
     cttgcggctg ttgatggcac ttggggactc gtgatgcaga ctatcaacaa accaatcggt    235140
     gaagatcgtc accacggatc gagacgccaa attagcccat acggccagcc agcagtaaca    235200
     catgttaaag tattagaaaa tgataatgaa aaaaacacct ctcttgtaga atgccaaatc    235260
     gaaactggtc ggacgcacca aattcgcgtt catttaagcg gaattggcca tccaattatt    235320
     ggcgatacgc tttatggtgg ttctcctcgt gctaatcgca tcatgctaca tgccgagaaa    235380
     ttacatttaa atcatccttt caaaggtaaa gaaatgaatt tttctgctcc agctggagat    235440
     gattgggtat tttaaaaagc cacaacatta tgttgtgact tctgtacaaa tttctacttt    235500
     tattccatta ggatcttcaa aaaatacagc ataatgattt ttaccgccag caaaaggata    235560
     tctttcttca tatagaagtt tgattccttt tgcttttaat ttaactcgaa aatcatccac    235620
     gcgttctttt gtaccaccat gaaaagctaa atgattgagc ccaactcgtt tgcggtggta    235680
     gccttcagaa ataaatggtt cctccgtttg tacaaatact aaatacgtat ctgcgtattt    235740
     ataactaaaa ccttcattcc aagactgata gaattcataa gaaagttctt ctaacagcca    235800
     tgaccaaaac aagcgactct cttctaaatc agctacataa atttccacat gatgtaacat    235860
     attacgcctc cccgatatgt ttaagcgctt ctcttcgact tagcggcgca agcgagtggc    235920
     tatttacaaa ctgacgaact gccccgctat ccactttcgc atattgtctt agcgcccatc    235980
     caatcgcttt ttgaataaag aattctttgg acgcaagcca tttttcgcaa ttgaaaaaaa    236040
     gtaaatctac atcggttttt tctttgtact tcaattgaaa taaaatcgcc gttcgagcga    236100
     gccaaatatt atctccgttt atccacgctt cattataggt aggaatcaac tcaggatata    236160
     gtttaaaatg attacttact acagttcctg ctaggccgtc cacagtatcc caccaagatt    236220
     tcgttacaat taattgctca tatactttta tcgcttcact gggctgtttt ttaccgtaac    236280
     ggcttaataa atcaatcgcc acatactgaa attcacgttc ttcttccgca aataatgcta    236340
     tcgtaaattc aagcaagtct tgcggcgccc cattttcttt caaatatgca gctactaatt    236400
     ttttccgttc cccagctcta atccctaaaa aagtaaattg gttcttcatg tatgcttcca    236460
     ttggcggagc atctgttaaa gaacgattcg ttcggaataa cgtttgaata tctgtcattc    236520
     ctcgttctca cttgctaaat aagcgcgttc tctctcaata ctacttaaaa agtattctaa    236580
     atcatctggg tctggcccaa cacgcttccc cgtttctaag cgatcaattt tttccatatc    236640
     actggcatct agttggaaat aagacaaacg tgaattctcc tcaatccgac tagaagtaat    236700
     tgacttcgga aaaataatcg tattgcggtt caagtgccat tgtaaaatca cttgatctac    236760
     agatgcttga tgttttttcg caatttctgt aataactgga ttttgcatta agatcccttt    236820
     tgcaagcggc gaccatgcag catgcgcaat attctgttcc accaaatact tacgaagatc    236880
     attttgcggt aacagtggat gcgtttccac ttgatttaaa accggttttt catttgcagc    236940
     aaccaataaa tcacttaaat gatgttgctt gaaattcgca actccaattg atttaatcaa    237000
     tttttcgtca tgaagccgct ccatcgctcg ccatgaatcg cgatatttcc cggcaacggg    237060
     ccaatgaatt aaatacaaat ccaaataatc caacttcaaa ttccgaagtg tccgctcaaa    237120
     cgcaaataac gtttcatcgt aaccaaggtc cccgttccac acttttgaac taataaataa    237180
     ttcttcgcgc gagaccgcac tacttgcaat cgcctgacca acaattgctt cattattata    237240
     aactgctgct gtatcaaaca aacgataacc tacttcaatt gccttctcta cagcaccagc    237300
     gataaattct tgttctgtta cttgaaatac accaagtcca atataaggaa ttgtcccatt    237360
     ccccggtagt atcattctgt cttgtaatgt ttttgtcaaa acgaaaccct cctcacgaaa    237420
     actgttttgt gaactttttc tcttaaatga attatacact attttcgcaa atttatattt    237480
     taaaaccagt ataccgaaat gagccttact ctcctaataa aaagccacaa aaaatctact    237540
     ttttttattc atttagtgaa atacctaaaa acagccattg gaaacgctgt cagaacgttt    237600
     atttacgcaa ctatcaaaaa aaagtttcct atttattccc atcctatgtt agtattaatt    237660
     tgtggtaaag atctatcaag ttttttattt gttttcgtta acttatcgtt aagaaaaaag    237720
     ctcccttttc aaagtaaaag cgagctgatt attaatgacc aaaaatgatc gggggaatta    237780
     agaaaatggc ttttaaaaat aaaaaagacc gttttgcttc gttgttgcat gacattgcag    237840
     taaatttaca tgaaggtgca aatttctttg caacttacaa cattaattcg gtggaggatt    237900
     tacatacttt ctcgaataaa atcaaagaat atgaaacagc tggagactcc atggttcaca    237960
     aaatgattat ggaattaaac gacgctttca ttacaccaat cgaacgtgag gacatgttag    238020
     aacttactaa ccgcttagac gacgtaatgg acgcacttga tgaaacagct ttctcactcg    238080
     aaatctgcca aatcactcat tatgatgaat acatgactaa atttatccaa gctattcaag    238140
     caagcactgt tgaaattgaa aaagcagttg atcttgtttt tgataaaaaa ctaaaagatg    238200
     ttcgtaaact tgcgattcaa attaaagatt atgaatctca atgtgatgat gtttaccgcg    238260
     aatcactaat ccaacttttc caaaacgaaa aagatccaat taaactaatt cgtctaagag    238320
     aagtttatga aaaattagaa gacattgctg atagttgtca aagcgttgcg aatacgcttg    238380
     aatcaattgt catgaaaaat gcgtaagggg cctagataga tggaaggaat gtttctcatc    238440
     accctcgtca tcgtacttgc cgcgctagca tttgacctaa tcaacgggtt tcatgataca    238500
     gctaacgcaa ttgcgactag tgtctctaca aaagccttaa aaccacgaca tgcgattatc    238560
     ctcgctgccg taatgaactt tgtgggtgct atatcattca caggggttgc taaaacaatt    238620
     acaaaagaca ttgttaaccc atttgactta gatcacgggg aacttgttat tttagcagca    238680
     ttactttcag ctattgcttg gaatttaatc acttggtatt tcggaattcc tagtagttcc    238740
     tctcatgcct tgattggttc catcgccggt gcagcaattg catcagctgg atttgcagca    238800
     attgaataca gcggatttac taaaatcatc attggtttat tagtatcccc tgtacttgct    238860
     ttcgtagtcg gttacacgat atattcactc ttcaaggttt tcttgaagaa cttaaactta    238920
     gccacgacca atcggcgctt ccggatgatt caagtcggaa ctgccgcact acaatcttac    238980
     acacacggaa ccaatgatgc ccaaaaatca atggggatta tcacaatggc attaattgct    239040
     agtggtttcc aaacaacgga tgatgtgcaa ttatgggttc aagtatcctg tgcgattgct    239100
     atggcgattg gtacgagtat tggtggttgg aaaatcatca aaactgtcgg tggtaaaatc    239160
     atgaaaatca aaccagttaa tggtgtagca gctgatttaa gttccgttat cattattttt    239220
     ggtgccactt tcattcattt accagttagt acaacacacg taatcagctc ttctatccta    239280
     ggtgttggaa cagctcaccg tgttaaaggt gtcaaatggg atactgctca gcgcatgatt    239340
     attacatggg ttatcacact tcctatttcc gcaacgattg cagcacttat cttctatgtg    239400
     ctaagattca ttctttaata actgttagag ccttgcttat gcggggctct ttttatacat    239460
     atttttgaat aaaatgaata aatattagta taaagcaaga ttattttaaa aatatattgc    239520
     atatttaatc attttgatgt attataataa gcatcgataa taacgattca ttgattataa    239580
     attactcaaa tactaaaggg agttgtactt atgcagaagc atttattaca aaagtttgca    239640
     gcaattttac ttgtttttat agttgtattt tctggcttca catccgtgtt cgccgctgat    239700
     actgaagatc aaactttagc taaaattcaa gaaaaaggcg ttttgacggt tggcctttcc    239760
     gctgactatc caccgtatga atttcatcaa acaatcgacg gtaaagataa agtcgttggt    239820
     tttgacgtaa gtattgcgga aaaaattgcc aaagatttag atgttaaatt agatattaaa    239880
     gaaatgaact ttgatagctt acttggttca ctaaaaaccg gcaaaattga tatgattatt    239940
     tcggggatgt ccccgacgcc cgaacgccaa aaagaagtag atttctcaga tccatacatg    240000
     ttcgttcagc aacgcgttgt gattagaaaa acggataaag ataaatttac aagcgtgaat    240060
     gattttagcg gcgtaaaagt tggtgcccaa aaacaaacga cacaagaaga attagctcaa    240120
     aacgaactag ttggttcaga agtagtttcc cttcaaaaag taccggacct tattcttaac    240180
     cttaaaagca acaaagtaga tgccgttgtt ttagaaggcc ctgttgctga agcatatatt    240240
     agtcaagata agacactcgc tatggcggat atcaaatttt ctaatggtag caaagaaaca    240300
     gccatcgcaa tgccgaaagg ttccactgct ttacaagaaa aagtcaacgc ctctattaaa    240360
     gatatacaag ataccggctt actaaaagaa tatcaaaaag aagctaacaa actaatgttc    240420
     caagatggta gcttttacga aaaatatggt aattactttg tcactggtac attaattacc    240480
     attgcccttg ccgctatcgg cgtgttatgt ggcgccattc ttggctcatt actcgctctc    240540
     atgaaactag cgaaaacaag atggttacgc tggccagcag catgttatat tgaatttgtc    240600
     cgtggtacgc cacttcttat tcaaattttc atcgtctttt tcggaacaca aattatcggt    240660
     atggacgtat ccgcctttgt ttccggttgt atcgccctat cgctaaacag tgctgcttac    240720
     gttgctgaaa ttatccgcgc aggtatttct gctgtcaaca aaggtcaaat ggaagcagct    240780
     cgttcccttg gtatgacaca aggagctagc atgcgttaca tcatcttacc gcaagccgtg    240840
     aaaaatattc ttcctgcact tggtaatgaa ttcgttactg ttattaaaga atcttccatc    240900
     gtatccgtta tcggtgtaac agagctaatg tttatgactg gcgtagtcca aggcgcaagc    240960
     ttcaagccat ttattccgct aatcattaca tcgttaattt actttgtact aacatttagc    241020
     ctgtcgagac tactaggtgt tgctgaaagg agaatgagaa caagtgatta atattaaaaa    241080
     tttacacaaa cattttggca aattagaagt cttaaaaggt attgaccttg aaatcgcatc    241140
     tggagaagtg gtcgtagtta tcggcccttc cggaagtgga aaaagtactt tcttacgttg    241200
     cctgaactta ttagaacaac caacaactgg tacgattctt ttcgaaaaca aagacctaat    241260
     ggcgaaacaa accaacgtca acgaacttcg tcaaaaaatg ggcatggttt tccaaaattt    241320
     caacttgttt ccacataaaa acgttcttga aaacctaatg ttagcgccta tgaaagtgaa    241380
     aaatgaagat agtgcagctg cgaaaaaaca cgccctttct ctccttgaaa aagtcggtct    241440
     agctgataaa gcaactagct atccttccca actttctggt ggacaacaac aacgggtagc    241500
     cattgcccga gcactcgcaa tgaatcctga cgtaatgcta ttcgatgaac caacttccgc    241560
     actcgacccc gaaatggttg gtgaagtatt aagtgttatg aagtcacttg ctaaagaagg    241620
     tatgacaatg gttgtcgtaa cgcacgaaat ggggttcgca agagaagttg ccgaccgtgt    241680
     tgtcttcatg gatgctggcg tgattcaaga acaaggcact cccgaagaag tattcggaaa    241740
     cccgcaaaac gatcgtacaa aagacttttt aggaaaagtt ttagcataaa caaagattac    241800
     gtcttgccta ttttaggcga ggcgtttatc tgcacttata gaaaaaagga gctaattata    241860
     catgatgaat cactcaaaga ttgctaaaaa acatcaacaa atgcctgtga acattctcgc    241920
     tgatattggc acacttgcaa aaacaatgcc tgatattctc gatttatcca tcggtgatcc    241980
     tgatttaatt acggatgaat cgattattaa tgctgctttt gaagacgttc gtgctggtca    242040
     tacaaaatat accgaatccg gtggcgacgt ggaactcatt gatgctattc gtggttattt    242100
     tagccgtaat tacgatcttt cttttgaacg tagccaaatc cgtgcaacag tcggcgcgct    242160
     tcatggtatg tatttaactt tgcaaaccat tcttgacgac ggcgatgaag ttattattca    242220
     tgaaccttac ttctcgcctt ataaagatca agtattgaat tctggtggta caccaatcat    242280
     tattccaacc tacgaaaaag atgattttgc gattaatgtt gatattttag aagcagccat    242340
     tactgataaa acaaaagctt taattttaaa ttcacctaat aatcccaccg gtgctgtttt    242400
     ttcaccagaa acctttgaaa aaattgctaa tctagcgaaa aaatatgatt tctttatttt    242460
     atcggatgaa gtatatgatg gttttagttt ttatgaagac ttcgtaccaa tggccaaatt    242520
     cgcaccggac catacgatta cattcggtag tatgtctaaa aacttcgcaa tgaccggttg    242580
     gcgcttagga tatatgattg cccctactta tttaaacgaa gctgcgaaga ttattaatga    242640
     aggaattact tattcagctc ctacaccgtc tcaaagagct gctatttacg cgttaaatca    242700
     ttctgagaca ctaattcctt tagtagcaga aaccttccaa aaacgcctag aatacatcgc    242760
     aaaacgggtc gaaaaaattc catatctttc tttacatcca cttaaaggtt cgatttacgc    242820
     ctttatcaac atttctaaaa caaacatgga ttccgtttca tttacagaat atgtgttaaa    242880
     agaaacgcaa gtcctcgtaa ttcctgggct agcttttggt gaatctggtg ataattatgt    242940
     tcgcctagct gcaacccaag acatcagcgt gctagaagaa gcgttcaatc gcctagccaa    243000
     attaacattt taatcaaaag agcaaactcg cttcataggc aagtttgctc tttttttatt    243060
     ttaaattgat ttctgcaaaa gaagaaacaa ccgtcgcctc ttttggaaaa gtgatgtttt    243120
     ttgtagcttc attcggtacg atatacactt ttaacccagc ctgcattgct gacagcgcac    243180
     catttttgga atcttctatc gcaacggctt cttctggttt aaccccaagt gcttccactg    243240
     cttgtaagta aagtgccgga tgtggcttaa tttcatccac atggtctgcc gtttgtattg    243300
     tctcaaaatc agctaaaata cccagacgat tcagcgtagg ctcaatccag tcaaatcccg    243360
     aacttgttgc aagacctatt ttgtaatcat tcgcttttac ttgttcaaaa aactctttaa    243420
     aaccatcacg aaagccaagt gattgttgac caagatgaca agcttctgcc acagtagtta    243480
     aaaatgcttc cttatcaaaa gccccgttcg ttgcttccat catatagcga ataattggtt    243540
     cttcacttgt cccgataatt tgttgataaa cttcatctgg caaatcaata ccgtacgtct    243600
     ctttcaaata gttcattgtc tccgtatacc ataaattttc cgtatcaagc atagttccat    243660
     caaaatcaaa aacaaccgcc ttcacatgca tcctcctagt ataagtgatg cttttattgt    243720
     aacatagata aactatttaa gaaatcttcg aaaaagggtt gcttttttag caaaaaacga    243780
     ataatattgt atttgtggtt tttaatgttc gtcatttacc attaagcatg attttaaaaa    243840
     aggagtgaaa cacacgcatg tttcaattaa aggcaaacgg tacagatgtt aaaactgaag    243900
     ttatctctgg ttttactaca ttcctaacga tggtatatat cgtagtagtt aacccagcaa    243960
     ttctttccgc agcaggtgtt ccattcaata ctgtattcat ggcaacaatc atttcagcag    244020
     ttatcggtac attatggatg gcgattttcg ctaactatcc aatcgcgatt gcgccaggac    244080
     ttggtatgaa cgcttacttc gttacagtcg ttacaacaca aaaactagat tattcggtcg    244140
     cattcgctgc ggtctttgta gcaggtatta ttttcttatt actatcttta acaccgcttc    244200
     gtgaaaaaat cattgaagcc attccacata atttaaaagc cgggatcaca gctggtattg    244260
     gtttatttat cgctttcctt ggcttccgta tgacaggtat tatcgtttct aatgattcca    244320
     acttagtagg tttaggtgac ttacattcca aagaagctat tttagctatt gttgggcttt    244380
     taatcacttt aatcttgctt gctttaaacg taaaaggggc attattcatt gggatgattg    244440
     ctactggtat tattgctttt atcactggtg aactgaaatt tacagatggt atcgtcaaac    244500
     ttccgccaat gccagaattt gtctttacta atcccattca cgctttcggt gatgtgatga    244560
     gttacgggct ctatgccgtc gtcttgtcct tcttactcat aacgattttt gatacaactg    244620
     gaacaatgat tggtgtcgct aaaaaagctg gcttgatgaa aggcgaatca ctgccaaacg    244680
     ccaaacaagc tttaatggcg gatgcagttg caacaagtgt tggttcgatg tttggtacaa    244740
     cgccaacaag tgcttatatc gaatcatcag ctggtgttgc aactggtgga cgtacggggc    244800
     ttactaccct tacagtagct atcttgttca tggtatcagc attcttcgca ccacttgttg    244860
     gtgctgtctc tggaatttct gctattactg caccagcact tatcgttgtt ggtagtatga    244920
     tgattggtgc tgttaaagaa atcgactggg atacattaga tgaagcattc cctgctttct    244980
     tagttattct agctatgcca cttacttcaa gcatcgcaat cggcttagca ttcggattta    245040
     tttcttaccc agtattaaaa gtattcactg gtaaatggcg tgaacttaac tggttcctaa    245100
     tcgttattgc cgtattattc ttcattctcg tagcattttt accacattaa taaatagtag    245160
     cgcctatctg aatacaggta ggcgcttttt tattggacaa aaacccgctc ttttgctata    245220
     aagaagagag aaactaatta gaaatgagtt gaacttgtcg tgtttttaaa atcactgctc    245280
     gccggtgtcg cacttgctgt tgttgttttt ctagcaagct ttttgatgcc tgactacacc    245340
     gtatccactt tatattccat tgtaacgact atcattgtct ttgcatccat tattctatcc    245400
     gcattcgtat cctttggtgg tcgtagtgga aaccctagtc gaaaaagcca attacgctgg    245460
     agtatcctgc ttttagtggc agcaattcct agttttatcg gctttatcgt tactttttac    245520
     ttttaaacta aaaagaagca ttccccattt gaggaatgct tcttttttaa tcttctaatg    245580
     cagaaatgaa cgctggtaaa tattctggta aatctggtgg gcgacggctt gaaataatgt    245640
     gaccgtctgt tacaacaggc tcgttatgcc aaatagctcc cgcattcgtc atatcgtctt    245700
     taattcccgg cgtacttgtg acattcacac cttctaaaat accggccgaa acaagtaccc    245760
     atccagcatg gcaaatttgt ccgattggtt ttttcgcctt atcaaacgca cgaaccaaat    245820
     ttagtacgct atcaaaacgg cgtaatttgt ctggggacca gccacctgga actaaaatcc    245880
     catcataatc ttctgcgcga acagaatcaa aatcataatc agaagtaaca gggactccgt    245940
     acttaccgtg ataaaccttt tttgcttcct ctgcaactaa atgcacagaa gctcctgcct    246000
     cgcgtaatct aagcactgga taccaaagtt ctaaatcctc aaagtcttca cttacaaggg    246060
     caataacttt tttacctttt aaagtcatat aaatctcctc ctatcctctt ctacagtata    246120
     acaataacca gattgttatt aaattattcc gcctataaaa gaagacaaaa aaagacgctc    246180
     gaaataaaca tttccagcgt tgccatcatg ttcgggcgcc tatgcataac gggatgaggc    246240
     atagacatga actacacggc caatgagatg aatgaaaaca aataatgatt ttggtgtcta    246300
     aacagatgtc tgactagttg ccattctatt ggaagatgga tacaccaaaa gtcattataa    246360
     ccatgatagg gtcttatccc catgaaaatc acattagtaa aaatgaaact ttcatcgagg    246420
     taaaactcta tcctataact tattttacta ttgttcttga aaaaagcaag taaataaata    246480
     tagatttttt gtgacgaaga taagaaagat gagaattgcc tcactattat tgtcgttttc    246540
     tgtataaaaa ttactatatt acaaataaaa aggaaaccat taaaggtccc cttcaactaa    246600
     aaatttctac aaccatccaa gaaataatag cgactaatgg aattaagacc catacattat    246660
     gaccaagtaa gctagagcga acatctggtt tatcttcgag tagttgaatt ctatcgcgca    246720
     agtcatgcac ttcaagctcg aggtcctgta ctttatcttc aagttcgtat aaacgttctt    246780
     ccattttaat ccctccacac cttttctatt gcctattata cgccaagcac tatgaaatgc    246840
     atcgttccat aggctgattt attgctaatt tattgtcata ccgttcaggc atttgctaca    246900
     atgaaagaaa actatcaact gttggggtgg aaaaatggaa attcaagtag aagaagctgt    246960
     tgtaaaactc attttgcatg gcggaaacac acgaaaagaa gcatacaaag caattgattt    247020
     tgcagaaaag tatcaattcg atgaagccga taaacatctg caaatcgcac aggatcaatt    247080
     ccaagaaggt catatttggc aaacgaaatt agtatccatt cgcgactcag aaacggtagc    247140
     tcatccttcc tttttactta ttcatgggca ggatcactta atgaccgcac aagcagaatt    247200
     gcaacttgcc aaaagaatca ttgaacaata taaacatcaa caacgcttag aagaacgact    247260
     tactaaactt gaaaatcaag catgagatgt agctgggaat aagaaataat tctcattcgt    247320
     aagtatattc gggcgcacaa acaacatatc ttccgtttca ataatatgcg cggcatcaat    247380
     gtatttgctt ttttccggtg tgaaaagaag atgaattgtt tcgatttttt tgataggtag    247440
     ataccttaga acttccacca catctagttt tttcgtacta agtatatcta gcacatataa    247500
     atcagcatct tcttgctcca ttaatacaat tacatctaat tcttctatat aataaagctc    247560
     atttttcaag gcaatcaata cataaaacat cagtaaatct tcactttctc gaacatctag    247620
     aatattagaa agtggcgttt tttcggatac aatacgactt attagctgaa aatccgtttt    247680
     attaccggga ttcagctttt ttaaattact agattctctt ttcaaactgc aagcatctac    247740
     agtaaaactg ctttcctcca cacgctcaaa tccaaatttc gggtaaaaat ccagtacagt    247800
     atcattcgca aatagataaa gaaaatcata ctggtcttcg tatttggcta ttacatgctc    247860
     taataatttc ttagcaagcc cctgcccccg ataatccgga tgcgtcatta ctgtcccaat    247920
     ttgcaaggcg cggtaatctt ccccttggta aattagattc atcttattga tagagacatt    247980
     cgcgattacc ttgttatcat caatatatga atagcaaata tacttatcat tccaaaagcc    248040
     gtccctgtac cattcttcaa aattaatatc aaatgtactt tcagcaagcc tattaaaact    248100
     atcacgatac attttattat ctttataatc acttatcatt tcataattca tcgttctaat    248160
     cctctattcc ttcgtataaa aataacaggt acaacgcgaa atacgtccta cctgctcatt    248220
     tttatttaat ttaacgtatt ccaagcgcta tttttgcata gcgtgacata cgatctttag    248280
     tccaaggtgg attccaaaca agatttacat ttgtatcctt cacttctgga atatcactaa    248340
     gcgccatctg tacttgctca gtcaaaatac cagcaagcgg acatcccatt gttgtaagcg    248400
     tcattgatac tgtgcaaagt ccgtcatcat ctaattcaac atcgtataca agcccaatat    248460
     tcacaatatc aattccaagt tctggatcga taacttgttc tagtgcgccc attagatttt    248520
     ctttcagttg ctcatccatg aagcatatgc ctcctttttg ccattttgta catttattgt    248580
     atcatatatg agaatgattt tcattataag aatttctcaa aaaagctgac cccttgtagc    248640
     attccttcaa cggaaacttt gtgttttgca ttatcatcaa tgataaattg cacattatct    248700
     gccaagcttt cttctactaa tgtttggtat aacttttcgc tgtacgcaaa aggtaccaca    248760
     tcgtcttttt tgccatgcca aagtaacaat ggtcggttat ttattttggt gatattttga    248820
     gttaaatcat atttttgtag cgctaaaatc cgttcatcca catcaaacgg aaaagttaac    248880
     ccttgcgcca acgcatattt ggatagctct ttagcaaaat caacataata ggcacttccc    248940
     attaaactaa cggctacttt aatattttca tatagcccaa gaaggccaag cgaagtaata    249000
     gctcccatgg aaactccgcc aacaccgata cgattcgcat ctgttttccc agctttaatt    249060
     agctcatctg taatcagcgg gaactccgta atattcgttt caatcacatc ccaaaagaat    249120
     gtagcctggt cttccggatt tgctccttgt aggcgctcgc catgtaactt cgcatctggc    249180
     aaaatcacgc ggaagccacg ttgcgcaagt aaatagccat aatgtaaata taattctttt    249240
     tgagatgtaa agccatgata gaagataatc gttggtaaca ttttatctgc attttcgcta    249300
     ttactaatat gtaaaactgg tattcccgca atttgttcat tttccacttg aatcattgtg    249360
     aagcctcatt tctattaggt ttattaagct attgtaaagg tcggaatcat ttacaaaatg    249420
     gtgataaacg tctatcattg atgtgtgccc ttattttagc atgaaggggc agctttgaac    249480
     caaacatatg aattaaagga gcaaactatg tctaaaaaac taatcgtact agaccttgat    249540
     ggcacaacac ttagagatga tttaactatc tcttcgcata caaaaaacac tttagaaaag    249600
     gcgcgcatgg ccggtcatga agtaatgatt gcaaccggac gcccatatcg aatcagtggt    249660
     tcttattacc atgagctagg attaacaaca ccgattgtaa atttcaatgg tgccgtgtat    249720
     catcatccta gactcactac atttgcggaa ggctatcacc atgccattga tctacaagtt    249780
     gttcacgagt tacttgattt ttccaatggc ttttcattag ataatatcgc agcagaagta    249840
     caggataacg tcttcttaaa agaacgaaac aacagcgttc ccgaaacatt ccatttaggc    249900
     actgaaaata ttgtattcgg aaacatccgt gatgcgatta aatcagatgc tacttcatta    249960
     ttgtttttcg gaaaactgga ccaactcgat ttaattagca agcacttgga tgaatctctt    250020
     tctggcgtta tttctcatca cacatggggt gcatctgctt ggccagctgt agaaattatt    250080
     aaatttggta ttcataaagc cattggcgtg caagccgcag ctaaaacact tggttttgac    250140
     cgtaaagata tcattgcatt tggagatgaa acgaatgatt tacaaatgct tgattatgcc    250200
     ggcgttggtg ttgctatggg aaatgccgct gagtccgtga aaaatgttgc caacgtggta    250260
     acagcatcta accaagatga tgggatcgca gtctatttag aagaaaactt aaacttataa    250320
     taaaaagctg caagtaatgt cttacaaaag ttaggaatgc taatttttga ttcaagagcc    250380
     attactttgc agctttttta catcatttta tttttataca tcgccattgc taatttttga    250440
     tctgcttctg aacgaaaatc accaaatacg cttgaggtct ccataacatt aataaatgct    250500
     ttagagtcaa actcgccaac aatgtgcgta atatcatata gttcataacg cgtaatcacc    250560
     ataataagca ttgctacatc ttcttttgaa tagccgccca ttgcgtcaac taccgtaatt    250620
     ccacgtacca tattttcatg gattgcttta attactgttt cggaatgttg cgtcataatc    250680
     atcactgtca atttctgatg tcttgtatga ataatatcga tgactctact ttgaacatat    250740
     aaagaaatga gcgtatacag cgcaaatgtc caatcatatg caaagcctgc tacaataata    250800
     ataactccat ttaaaagcaa gaagtatttc ccgaaagaac gtcctgtttt aatagtgata    250860
     tacattgcta ctatatctag cccgccagta gaaataccga attttagagc cagaccaata    250920
     cctacagatg caattaatgc cccaaaaatg gcattaagca aaatatcatt agatacttgt    250980
     acctccggaa taacaattaa gaagaaggac ataaaagcaa ctgtcaaaaa gctgaaaaca    251040
     gtaaatgatt tcccaacttt taaccaacct aaaattgcca ctggaatatt taataacaga    251100
     acgagtagcc ctgttgaaat agaaatattc attgaatcac gtaacatgtc tgaacctagt    251160
     tgtgcaaccc catttaatcc agctgcataa acttgtgctg gtattaaaaa gaagttcatg    251220
     cctattgcgt ttaaaagtgc tgctattatt gcaatggcgg tttttttagc atactcttta    251280
     tatactattt ttgaactcat tttcttctct ccttttttgg ccctaacata acataccaac    251340
     tttccagaga aaagagaagt ctttttcatt atttttttga tttttaatta aacaaaggat    251400
     atccgcctga tagataaaag cctaatgaga tggtaattac tactacaata acaaaaatca    251460
     tcaaaaacat tcctgttggt ttttgttgtt tcctgtaact aagtagcatc tccacaacac    251520
     caattacaat gattcccatc agaatcttaa atatcgccag aatccagctt tgttctatgc    251580
     tgtatttgac catcataatt ccactcaaaa taaccaaaat ataaaaaact cgattaatca    251640
     tttgtaacat tgtaaaactt tttgtcgatt tcgaataaat gagtagagct gtaatcgtta    251700
     gtacaacaat agccacccat gaaatcaaat gaatataacc ccacataata ccatccctca    251760
     ttcttattaa gattttctta ctttgttagt cagtgtccca attttatcaa tagtaatttc    251820
     gataatgtcc ccatcttgta gaaaagtcgg aggtgtcata ccatttccca caccacttgg    251880
     ggtccctgta gcaattatat cccctggaag caacgtatgc cctttggata aatcagaaat    251940
     aattcttgct aagccaaata taaatttatc ggtagagtca gactgtctta cttcgccatt    252000
     aaccttggtt tcaatgtgaa aaacaggttc tttgtttgcg ttattttcca acacgaatgg    252060
     accaatcggg caacttgcat caaggctttt ccctaaataa aactgtttat gttttttctg    252120
     aagatcgcga gctgtaatat catttaaaat agtaaatcca aagatggcag ataaagcctc    252180
     ttgttcagat atgtctctta ctttctcacc aataataaca gcaagttctc cctcataatc    252240
     taattggccc gttatatttt gatgtaactc aatgttgccg ttatgcggta atagactatt    252300
     agcactcttt gtaaatacaa gaatatgctc tgggacgtct tccttgcttc ccatctctag    252360
     cacatgatta taatagtttt ttccaattgc aataatgtta tttggcggaa caaaaggtac    252420
     ttgaatttcc acttcggcta aatcgatatg cccgtcaatt cctgttaatt ctggaacaag    252480
     cggtttttct ttaataaaat ctaaaagggt agctggcgga ttcgaaaaaa tcgttccagc    252540
     agggatgatt ttattttcag gtgttaaaat accataagcc aaatctcctt catacagata    252600
     actcaaccat ttcatttaaa gaccttcctt tgtgtttatt tggcatatat gttgtccatc    252660
     gaagaaatat aaataagccg cagcgacttt tttaccgcta atcgcttgaa tcgcttctgc    252720
     ataaagcttg atttgaatat gatatcgttc tttcattact ttttcagcag cgttccaatc    252780
     agcatatctt ccttctattt tatctgtttt ataatcaatt aaagtaatcg tttcttcctc    252840
     ttctatcata ctatccacaa caccttgaat gagtactcgt tcgtctaaat caactttttc    252900
     atataactct gacacaggaa gcaaataact aaatggcact tcacgtttta ctaaatcttt    252960
     tttctgcagc attgtttccc ctaatggaga ttcaaagaaa tctaatattt gtttgatatt    253020
     aattgcttta atttgcacat ctgttaagat atctttttct cgcattgtgt gtaaaagctg    253080
     ttccaaatct tcctttgtcg gtttataatc taacgaaact gcttgcataa gcgtatgcat    253140
     tgccgtacca atttctgttg cagagagttt atttttttgt aaaaatttag gtctatccag    253200
     tgatactttt tggaattctt ttaacagtgt agtatcactc cagctatctt gcaaagaaaa    253260
     ttggcgctta agctctgtta cagactgttt agcacgtatt tcagtcgccg cttcattttg    253320
     gtactcatac tccatatatc gctgaatttc gtccttatat gggctttgaa taggtactgg    253380
     ctgatgttct tttatatttt ccagccaatt atctgattca gccctttcta gctcattagt    253440
     tagaaacatt tcttttgttt ttatttcaat ttgtagtttc atctccgtcg caagtgtttg    253500
     gattatttct tcacacaaca attctttaaa agcaggatgc ctaatcgttg cgtttcctat    253560
     ccaatccaaa tagcatttcg ctttcgctct tgtggctgca ggtaaaatag tttctttttc    253620
     ttttgcgact tgcagccagt ttttacttgt tttttcaaaa tccggtactg ttgctactaa    253680
     aatcaacttt tcttctgcac gagtaagcgc aacatacaac acgcgcatct cttccgcaat    253740
     catttcacga gatttctttt gctttattgc ttgctgcata attgttgggt aaacaatcat    253800
     tttctcaaca tctcgataac tagatgcaaa gccataatct ttatctaaca acgttttgct    253860
     ataaatatcc cgcatattaa attttcgact tagcccagaa acaataacta caggaaattc    253920
     taatccttta ctcgcatgga ttgtcatcat gcgaacaaca tcttcttttt caccaagtgt    253980
     ttttgcggta cctaaatcat cgcctcgaat ttctaaccgt tcaacaaaac gaacaaaacg    254040
     gaacagacca cggaaagatg ttttttcata ttggttggcc cggtcgtata atgctcgtaa    254100
     attcgcttgg cgttgtttgc cacctggtaa gccacccaca aattcataaa agttagtttc    254160
     ttgatagatt tgccatatca atgacgttaa attttctcga atggacaatt cacgccaatt    254220
     gtttaattgt tgaacaaaat cactaatttt attcgctgtt tccgaaacgg ttatgtcctt    254280
     ataggttagc aatgcgtcat agaaataacc cttcttcttc gccatacgaa tttgccccaa    254340
     ctcttcttca tttaagccaa ttatgggtga acgtaaaacc gcagcaagcg gaatatcttg    254400
     gtaagggtta tctactactt tcataagtgc aatcattgta gctacttctg ttgtttcaaa    254460
     ataacctgag ttattattcg cataaaaagg gatatcttga actttcattg cttcttccat    254520
     atccggagcg ctcgtcattg cccttgataa aataatgata tctctgtatt gaataggtct    254580
     attttgttta agttttttat cataaatagg aaacttattg tctatcattt ctctgatttt    254640
     cattgcaatc gcacgtgatt ctacttgatt tttttgcaat tcttgaggcg ataattcatc    254700
     ttctgtttcg gtatcctcag ttttcatatc aattagtaaa agttccgttt ccatagcgtt    254760
     tgtttcaggg aaatttgcac ctaaagtcaa ttctgcggcg gtatcataat caatttcagc    254820
     aatgtgttta tccatcaatt gacgaaatat aaaattggta gcatctaaaa cttctttcct    254880
     actcctaaag ttctgtgaca aatcaatgcg tatcccgttt ccactaccat cttgttggaa    254940
     tgtttggtac tttgtcataa ataatgttgg ctctgctaaa cgaaagcgat agatagactg    255000
     tttcacatct ccaaccatga atagattccc ctgcgcttca ctagggttcg ttacaaggcg    255060
     tagaatagtt tcttgcacca tattggtatc ttgatactca tcgattaata cttctttaaa    255120
     ttgtttttga taattttgag caacttctga agctttatca tcatttaata aaatttttaa    255180
     tgctaaatgt tctaaatcgt taaagtctaa tacccctctt tgttgttttt cttcaaagaa    255240
     atttgcagaa aattttttga ccaattcact caaagtttga atatctggtt tcattttttc    255300
     taagtcagat aagcaattta cttcttccct cgaaaaccag tcagttgcga tatttttcat    255360
     ttctttttta gctgcatctc gaaatttctt cgcttcctcc acatatactt catcgtaatc    255420
     acttttattt ttaagtgtcg gaatacgctt gaaatctatg ttttcaatag atgttttcag    255480
     atgggtccaa ctgctccagt tcaactctga caatgcttga atttggacta aatcattttc    255540
     taatgtagct aaataaggtg ctggcccgtt attttcattt gcataattta ttgcgtttag    255600
     taaatagttt ttagcttgat ttactcttaa ttcaatatct tctttaataa ttggaaaata    255660
     aggtaactct gtaatcgaag taatctcttc tgtattataa aagttcacca ttgcttctaa    255720
     ccaagcgttt ggatctgggt tggcccttga gaaatcatat agcttagata ttaatgagtg    255780
     caattctgca tccgaacgat ctcctgtaaa agattctacc aaatgaaaaa aagcttcatt    255840
     attttcaata ccatattctt gttccagcaa accttctaaa acctcatcgc gaatcatact    255900
     actttcaatt ggctcaatta agcgaaaact tggatcaata tctgcctcaa aatagtattt    255960
     tcgaataatt tctaaacaaa aagaatggag agttgaaata gaagcatagt taagtaatgc    256020
     tacttgtctt tttagatgtg ctgaatctgg attttgtccc agagcttctt ccagtccttt    256080
     tcctattcta aacttcattt cagcagccga agcattcgta aaagttacaa ttagtaactc    256140
     gtctacattt aagtttgctg actcatctat taacttttca atgattctag tgactaggac    256200
     agctgttttc ccagaaccag cagcagcagc aacaagtaca ttattgcctt tagcttgaat    256260
     ggctttccat tggtcgtctg tccataatga ctcttctggt tttggcggta tatttaaact    256320
     catgctactg cgtccctcct tcaatatcca tttttgttaa aattgtttct gctttttcat    256380
     tagctaaatg tctatattga ttacttgtta aagatggatc aaatccgcaa aatgaacgga    256440
     aactgcaaaa ttgacaaggc gttctttctt ttagtttata tggattaatt gaaactgctc    256500
     catcaagtat tttattccca gcttcttgat atttatgacg gacaaattgt cgcattttat    256560
     caaattctgc tcttgtcgca gttcttgatc tcgcactcaa ctctccattt tgttttattt    256620
     ctgccggaat aatagtagat gcttttcctt tttcaagggt catatccatt aatgaaacag    256680
     ccacgggatc ggataaaatc aatcccttca ttttggagct tttttgtaat tcttttgcga    256740
     tagcctcatc acttaactct ttctctgctt gtacatattg attgtgcata tggaaataca    256800
     gcaccccagc tggttcggca gttttgccaa tcattttttg tgcatttgtt actacaatat    256860
     ccaggtaggt aagcatttga agcgctaaac cataatagac ttctgtgagc gccaaatcat    256920
     gcgaacttga tttataatct ataatgcgta ggaacgttcg atcatcttgt tctgccatat    256980
     caattctatc aattcgcccc tgcaaaagaa gttcgctatc tgattgaaga ggtattttta    257040
     atggcggaat atctcctttc aaaccaaaat caacttctaa cccaacagga cgaaacgcac    257100
     tgctttttgc ttgttcattt aaaacagttg ttgccctcgt tatgatttgg agtaatttat    257160
     actgaatata ttccattctt ttagagctaa gcaaaatttc atgctggatt ttaggagcta    257220
     ggaatgtcat tgcaagtttc gccatttgct tacattcttc ttctgttaaa ttaccccaat    257280
     ccagattatt tctttttaat tctgctgaga tccattccat tgctccatgg aaaatctctc    257340
     ccatatcaac ggcttgcaac tgaaaatgcc ctcgctcttc taatttcaag ccatattgag    257400
     cataatgttg gaactcacaa ctgaaaaatt tctccattct tgaaacactt gcatgaatag    257460
     tttctccaaa taagttttta gcagttgttt cttgtaatgg ttttgtttta ttttcataat    257520
     atagactcga tagcacttgc ttagccatta ttgattcttt ttcattttca aaataactat    257580
     tgtaggcatc ccaccataca ctagacagcg tgtaacctcg tttatacatt tgtaattgac    257640
     ttgtcaacaa tcctaatgtt gcttgcttag agcgaatgta actactttgt tcagcatcac    257700
     ttaataagct cgggtctgtt aaataaactg attcatttag ttcattaaac tgtcctttta    257760
     ttttccttaa ataattggat tcgcttaata cttttccttc ttcatcagcg gcaggataac    257820
     taagaaataa tttgtcacta gggagactta ttattttata tgctaataag tcttcttcac    257880
     caatattatt tttagcagat ggtttcaatt tactgtcttc agcacgcaat gcatctctat    257940
     cctgatccga aaaaatccct ttatcctttt gacgtagcgg cataacaccg tcattcatcc    258000
     caatagcaaa aatcactttc atatctagca atttcgcatt ctccatatca gataaaacta    258060
     cttggtctaa ggaaggtggc aaaagcgaaa attcaagtgc atcaagaccc gttccaataa    258120
     tttcagtaaa actgtctaga tctaacgttt cctctcctaa aacttctaca aattcatcca    258180
     aaagtgcgga aatggagctc catgcttgtt catgttctcg tgcaagttct aaatagcctt    258240
     gctcttctgc tctttgtctc catgactcca atcgttctac agcatttact tgctccaaat    258300
     aatgataaag agctaaagca aactccatcc ctgtttttgc cttccttaga tttaattcta    258360
     aagtagaaag tggattcact ataagattcc tcatctcatt aatgatagat tgcatatgaa    258420
     tctcctcatc tgtttgaggc aatacattgg tggatagtcc gcggattttc cggtaaatcc    258480
     aatctccttc tttttcccat ttccatttat tttgaatacc attttctaat acatagtttt    258540
     caagaatatc tgctttacgt ctgttaaggc ttgatttttc ggtaatatca aagaaaaact    258600
     ctgtcttaac tgcttgaaag attggttcgt acttccagtt aaatagaata gcatctaagc    258660
     tagaacgaat aaactcgata aaagggtgtt tagccatagc tctcttttta tcaataaagg    258720
     taggaatgtt atatgcttcc atcaccgttt cacataaaac gtcataatct ccaagatttc    258780
     ttgtcaaaat agctatgtcg cggtatctat atccatttaa tgcttgttga cgaatctcac    258840
     gagcaatccc ttctatttct gcacgtctgt tattcgcttg atggattttt aaattttgag    258900
     gttcgttttt gaaagacata aatttgttat gcccccaagt attagctaaa aaggctagtg    258960
     attctgtttt tgctcgctta ttctctaaga agaacttgtt ttcctcgact tgagtgccat    259020
     ttaatttagc caactctaat agagcataat acgcttctgt acttgctttg aacatactgt    259080
     attcatctag tccatgctga atttcaggaa cattaagcgt caaagaaatc gttactttat    259140
     cacatttccg cattaattct ccaatgactg tcagctcttg ttttgagaaa gaagtaaaac    259200
     catcaatgac tatttcagtc tgatttaaat aatcactatc ggcaattttt tctgcaagca    259260
     atctcaaata gtcttcattt tcaaggaatt tatccgctaa taattcctca tacttttgat    259320
     agattagcga gatatcatgc actttattat tcacacttgt agacagattc gtagcgctct    259380
     tgaccatgtc ttcaatggaa acctcttctt gtttcatttc tttaaataaa ttcgctaact    259440
     ctgaataaaa accctttcta gaagtagctc ttgaaaagat ttttaattta tctttttgat    259500
     caagggctgc ttttctgata accatttcta tacctgtctg acttaagaaa gttttagata    259560
     atccacctgt ttcttgaaga attttccacg ctaaacggct aaaactaaat atttgtgtcc    259620
     caagcatacc tgctaaattt tccttattta aaaagcttgt ctccatctga aacgtcattt    259680
     gatctgggac aataaagata tacgttttag aattttgttt aattttctct ccaacctcat    259740
     ccattaaatg agttgttttg cctgtgcctg atctacctgc aattatttga agtgtcatat    259800
     cctcaccacc gaacatatgt ttttatttag tttaccatat ttgagcaatc tgtccagaat    259860
     ttttttcgag gcattttttg tttgaaaatt tataaaacag ctcaaaaaaa ctaagatagc    259920
     tcttactatc ttagtttttc atatattcta ctcaaaagct agcatttcct gttgaatttt    259980
     attcattttt tctgtaagtt tcataaattc cgctttgttc ctattatcga gagctttatc    260040
     aatttcagct ctaagttgtt ctaattttct ctcttctagg agcatcgtca ggaagcattc    260100
     gataaaaacg tttgttaatt ctttttcacc cttaaggaca cccacctgat tcatcaacga    260160
     attagaaaaa tcacgcattt ccacgactac cactccttca ctcatattta ttacaatctt    260220
     aaaaaattgt aatatgccaa gaaaaaacag aaaacagctt gaaaatacaa ctttactaat    260280
     atctaatgac ttgcaaatta ccatgtgcta taatgacaaa aaataactca taactaactt    260340
     tgatgcttag tcgttactta gaagttttgc ttattaggca ataactctag gtttcttctt    260400
     agacataaat acaaacatag aggagttgaa tgaaatgaaa aaagaacaaa tcagtactca    260460
     gttttatgaa gtaaacccgc acacaatgat tatttttcca aaaaaatctg gaagtatagt    260520
     ctattcagaa atttatgaag ttgattctca ttatacttct aaatttaccc cgtttgagct    260580
     aattaaaacc agctgtaact ttttcggatc aagctatgag ggaagaagaa taaacgagat    260640
     accaaaaaag aacatcctct caaaaggatg tctttatttt tactattata tagaagaaac    260700
     attatttatg tgactaatta ttaacaatag attgatgttg taaatactcg tcatagatac    260760
     tctttaaatc catttcattc ttttttatac gcctttgcaa ggcttttaac tttcttgttt    260820
     catataattc ggcaaacagc ttttctatag ctttatcttt tccttctacg tagcagatgt    260880
     atctaaaatc attaaagcta tataatctca cgtcataacc tcgcaaaaaa taatatcttc    260940
     tatattaatg tcaattattc gctcgtcaaa gcgttcaagt gatacaatgt gttttttgtt    261000
     gtcaatgtat acaggaacta catacttata gcgtacatga tgattgttct ttaaaaacag    261060
     tacttctatt gaccaatttc tttttaacgc atctgctaat actattgaat gttctaaaat    261120
     atcatcaatt aaattataca tttccgtcac ctcttgtaca cattatacga acaaacgttc    261180
     ttgaaatcaa gcggtaaata ggattaaaat aaaataatgt ttgactttgt ataatacatg    261240
     tattataata taagtataga aaggagttga gacagtgaag gatgttttag aggaaataaa    261300
     aacagtcctc gaaattatca ctcttgcagt agcgctgata acattacgca agaaagataa    261360
     aaacaaggac aagtaaattc agaggggtgg aattcccctc cctctaataa attataacat    261420
     gcctttcaca aattatgaat aaatatatct ggattatatt aattgttatt gctgtaaatg    261480
     ggttggctag ttactttcag aacacagcat taactatcat tgctatactg actacattag    261540
     cttgtttagt gtatttaata aaaaatagga agtgattaat tatgacgaaa aaaacgacct    261600
     ctgacgcgca gttgaaagca aataaggcat ggcaagataa aaacaaagaa catgcaaatt    261660
     atttaaaaag tcgttcagct gcgcgatctt ttattaagaa aaaagccact ttagaagact    261720
     tggaagaact agaaattgca ataaagcaaa gaaaaactga aataatttca ttagacaata    261780
     gccctgaatg aaaaatttcg gggtttttat tttaaaataa atttaataaa actattgact    261840
     actacgatta ttcgtagtat aatatgtata tagtaaagga acgggaggaa aatacaatgt    261900
     ataacaaggc tgaaattatg aaacaagctt ggaattggtt caacgatagc aacatttggt    261960
     taagcgatat cgaatgggta agttacacag acaaagaaaa atctttctcc gtttgtttaa    262020
     aagctgcttg gtctaaagcg aaagaagaag ttgaagaatc taaaaaagaa agcaaacata    262080
     ttgctaaaag cgaagagttg aaagcttgga actgggctga aataaaacta ggattacgtt    262140
     ttaatatttc agatgatgaa aaatttacta gtgtaaaaga tgaaactaaa atgaatttcg    262200
     atttaaatgt ttgggcttgt gcaatgaaag cagttaaact acacaatgac ttgtttccac    262260
     aaacggcagc ttaaaattat attatagaaa aggaatgtga ttaaaatgac actaacaaca    262320
     gcgcaaaaaa gatattatga cgcgatgaat gaatttgaag caattaccag taaagaatta    262380
     gaacaaacac cagaattttc gcaggattta cttaatgact ctgactactt agctgttaca    262440
     aaaaatgaag cgtatgcagt agcactttgc ctgctcgatg atgacaagct atatttagat    262500
     gaaactttag ttcactcgac acgtttagat attgaagatg aaacttatta tattaacttt    262560
     gtagtaacta atgaagatga ttttaaacta gctacagatg aagataagga aaaacacgat    262620
     aaacaagaag taattataaa aagtgggttg aactaaaaat atgtcgataa aactattaga    262680
     tgaattctta aaaaaacaca ataaaacgag gtatcagtta agcaaactga ctggtatctc    262740
     acaaaacact ttaaaagacc agaacgaaaa accgttaaat aaatatactg tttcaatact    262800
     acgctcgcta tcgttgattt cgggtttatc tgtatcagat gttttgtttg aattagaaga    262860
     catagaaaaa aattctgacg atcttgcagg atttaaacac ctgttagaca agtacaaact    262920
     ctcatttcct gcacaagaat tcgaattata ctgcttaatc aaagagtttg agtctgctaa    262980
     tattgaagta cttcctttta cgttcaatag atttgaaaac gaagaacatg taaatataga    263040
     aaaagatgtt tgtaaagcgt tagaaaatgc tatcaccgtg ttaaaagaga agaaaaatga    263100
     gttactttga taagtttaaa aggaagtgac actagtgaac aatcatgtta tagatttgac    263160
     aaataagaaa tttggaagat taacagttaa agagtttgtt cgttctgaaa atgggaatgc    263220
     ggtttgggaa tgtgtttgtg tatgcggcaa tgaaaaagaa gtattagctc aacatttaaa    263280
     acgaggtcat gttcaatctt gcggttgttt agctaaagaa aatgggcgtg aatatgctga    263340
     aaaaaattta aggacagaaa cagcacagaa aaacgccctt aaaagaaaac tagaagtaga    263400
     cgcagtcgat ggcactatga aatcagcttt aactagaaga ctatcagcaa gaaacaagag    263460
     tgggataaaa ggcgtgcgtt gggatgagaa aagaaataaa tgggaagctt ctattacctt    263520
     tcaaaaaaaa ttacattttt taggcagatt tgaaaagaaa gatgatgcca taaaagcacg    263580
     tagagatgcg gaagataaat actttaaacc gattttagat aaaatgaatt gatataacaa    263640
     ttacgctaag cttatgttta gcgtgttttt ttgcataaaa aaagccctaa tgtttatata    263700
     atagggcttt atatcgtatc cgatataatt atatctacaa tcttacctct ttttgagaga    263760
     atgtatggct ctttggtagt tttttttaca tgtaatgtac aaagtctata tgtattatta    263820
     tttcgtgttt tctgcgctcc caagacaatg cacttgtctc gatcttttcg gtaaaaaact    263880
     aaatctagtt tcatataatc cccttgatta tcaatagggt ttacctttac acatatttgt    263940
     atgcttttgt ggatgaaaac gtcatgtaaa aaataataac ttttcaccct atctgatatc    264000
     ttttcataat ctttatgtac cataatacta tttaacgtaa ttttattatt tctaatttct    264060
     gtgaggattg cggttgcggt ttttcttttt actactttgt taatacctaa taaatgaggc    264120
     aaattatcat catataatga gataactatt tgccctattc cttttgttgt aagaataatg    264180
     cttttaccat gaaatttctc agtaaaatcg tttaatagtg ttaataactc aaatctatat    264240
     tccgctgatg cttcatccac taagcactca tcccgtctgt ataaaaataa agtgctccgt    264300
     cataaaacgg agcataataa aataagggat ggattgggat gcgtctccca tcgggaccaa    264360
     cggtaagtta taaacccact tcctggggca tatagcaccc tgctactata cgtcgtgcga    264420
     acacgattaa atgaccctac gaaaagaata ttaaatatgg gaagacaagg caagagacat    264480
     aaataaagcc tatcttccta attatcataa ccaatcacac aaccaaagta aataactttg    264540
     cacaaagcta aacaaatagt gttacattcg acactataat acacaacata tagtttaata    264600
     aaaaacgaat cagcttaagt acaaggagat tgaacttcca aattctatat attgtgttta    264660
     tgtcacacaa tatgagttaa ttattgctta aaaacacttc tttgaaatga atgtagcagt    264720
     ttaaaaagcc cccgcgaaag cgagggcttt aaactaaatc tttttaacaa acttcgtgtt    264780
     agcagtgaga tagtaaccag atttcgtttt caagcgaggt gtcccgcctt tagttttccc    264840
     catccctgaa atcgtgaaga ctgtgcctgg cggatatgtg ccaccggttt tatgcttttc    264900
     agtgaagtct actgaattgt atagatcaca ttgtactagt gttttaactt ttcgcggatt    264960
     ttttgtgtag tatgtgtttt tgcttgctgg tgtgtgtggt tttcctgctt ttaacttcgc    265020
     taataatgtt gtgttctgcg ttgctgttcc actgtaattt ttaattccgt aacttgtcgc    265080
     tagttttttg cgattcgcaa agcttgaatc tagtttgttt aaattcatat aatctactaa    265140
     tcctagactg ttcgtgttcg catttgcgct cggtttagaa gaattactag tactagctcc    265200
     ttttccaaaa gtatcagttc cataaccttt aaaattaaat tgaaggtgcg gattgtctac    265260
     aaatccagac caatcaccac cccactcaaa acctaaagat tttgcctttg ccacaaattt    265320
     cttgcctttg tctgaacgat aagcacccca atcgaccgtt ttacctttcg ccatgacgaa    265380
     atctagcgct tgtcctacta aatgataaga gcgcattgtt tgagacgctc cgctagcaac    265440
     atttgcggct tgttgttctt tcgttctaat tgtttcgtag attaacactt caatcccgtt    265500
     gctttcagac caatctagca attttctagc tgccgctttc gtattgtctg ctaacttatt    265560
     tacatttgcc aaacttctac tataataata acttgtcatt atttatcatc ctctccatat    265620
     tttttgcttc gattagtaaa ttgttcaaat aatccagtac cgccagctcc tgctaatgcg    265680
     cctgcccaaa tcatcgttgc aagcgatcca gagccgtcca aaaacgttgc taatgcgccc    265740
     agaatagcac caataagtat gctaacagtc ggaagccact taggcgggac taactccgtt    265800
     ttcttaatcg cctgaacaaa aacaggtgtt acaactacta aaaatgtcat gtaaactagt    265860
     aactcttttc caaactccat ttctatcatc ctttacttcg taattttgtg ttctagcaaa    265920
     tctaccttat gcgctaactt accaacggat tttgacaggc tgtcaattga ttgttgttgc    265980
     tgtttcatca tgtcattttg cctatccatc aatcgctgtt gttcgttcat cgtacttata    266040
     aatttatctc tctcttcttt cgattcctta ttacgcttct ctcgttcttc ctccactttt    266100
     tcgcgttctt ctttcatttc tattcttaca atttttgaat catcccaaat tctttttgtg    266160
     ataattagta agattataaa aagcgctaca aagagcgccg cgaaaaacat ttctttcgct    266220
     aaagcataat caaaaacttt tgttagccca tcatacattt tcatcatccc ccataaaaaa    266280
     aataagccta ttcggcttct atttcttctg actgtatttg ttgttgttct tgttttaact    266340
     catccacttt tgcttttacc tgacctcgca aattcgcagg aacttcttca atagtttttc    266400
     gattattcat cactaaattc acataaattg gtatcatata agccatgtca tcaccctaaa    266460
     ttactttcaa atagtgcggc taaagcctct tgggtgagta gtaattcctc tcttaatttt    266520
     tctatttcag ttttttctgc tggtatgatt ggattttctg attcccatct tttcttgtct    266580
     tctttccaaa tacttccatc ccagcttgga taatacattg ctcttgctat gccgttttcg    266640
     attattgaag gttcaatatt tgtagaattt ttcggttgat tgattaaacc tttttcatct    266700
     tcaaacacaa gtattgtttc gagataatcg ccattttcat catatgtgta aaactgttta    266760
     tagttcatgt ttactcctcc tagttcccga cttcatagct aataccagaa agacttatat    266820
     agctaggatt agcattatcc gttgatgata cttgtaacat ttttccgtca acgggaatag    266880
     caatacgtcc tccgttacca ttgtttgatg cgacagcaaa atattcagtg accacggttc    266940
     ttgttcccgc tggcattgtc ccaaccgtac tatttgcggt actggaaaac gttccagcta    267000
     tagcacctct aaattcagca aaagttttca aaccggtaga agtttgtttt gctacaagtc    267060
     gatattgagg tgtattactg tcaccagttg agtaaccagc ggcaaggggt acatttatcc    267120
     acgctccgta actatccatc ttgctatctg tatatgcttt tgcagagttt aatgcactat    267180
     ccgcttttgc ttgtgatccc gcggtatttt cttttgtatt ccaattcgtt ttatcagtca    267240
     tcgtcacatg aatgtttgtg ttgtttatat gattttcaaa atctgctttt tggggaaatt    267300
     ggtctggatt aagactatcg aatgtgtttt ttaattcagt agcttgtcct tgcaaatcat    267360
     caatttcatt ttgaagaatt tccacttttt cgttaaatat tttctcgtaa tcatcccatt    267420
     tttcaacata ataggtagca acgggcaaaa aattatcatc aatcatcgct ttttcaataa    267480
     caaaactaaa acgattgatt tgcattgttt gatttggata tttaacgtac aattctgcat    267540
     tagcttgtcc gtcgtgactt atttgctcat cagtcaatga gtattcaaaa acgcctcctg    267600
     ttctgttaat tatttctgga ttaacaatgt agctactttc gtattttttg ccaacagaca    267660
     ataccatagc aagcgttacc tctgccgcgc ttgaaagtgg taaattgtta tcatcttttt    267720
     ttgcagtaaa ctttaatcgc gcagtccctc ctgagtcttg cgtactaaac cttatctgag    267780
     gaacattagc tttagcgttc tgtgcactaa cagaaaaatc aagaatagct gatttaaaga    267840
     tttgatttgt cattagaata tctgacctcc cgcttgtttc aattctgcgg tagtagcgtt    267900
     taaaactggc gtaccagact taaccaaaat gcctccgcta gcagctttta agccgacatt    267960
     cgaagttgct tcgcatgtat ttgttgatgc aaataaagca tgtcccatgt actcggacga    268020
     cataataatg ttttgatttt taaaatagtt gctataacag ttacctcgag attgattgta    268080
     ttgcacagtt gtaatattag ttgctttcaa attagtgtca aatcggcatt tagtaactgt    268140
     gccgtaccag caccttgcaa actgaattac cgtagaatta ttattcactg ccgtactcat    268200
     agaattaagt ccttgtacca cgcactgaaa catgatgcca gaaaacagaa tacttttaac    268260
     aaaaaaacct gtttgtccag ttgtcgggtc gattgttgct aaatttgtag gctggatata    268320
     aaagcattct gcgccgctga acgactgtac tactacatct tcgttatatt gccccggctc    268380
     acaaaagata taaataaagc ctcctacttt tactttcgga accatattta cagctttttg    268440
     aatcgtcttg aatggtgcat caatagctcc tgttcctgtt acatcatttc cgtttgttga    268500
     actaacataa tactcaatat ttgatgcaga attaccgtac aattcatcta gtttactttt    268560
     taatacttta ttttcttcgt ttactgtttg aagtagcgca tttgattcag ctaaatcact    268620
     tgcaattgct gaatagtcac catttagccg cgagtttaaa gtgctgtaga cttgaccgtt    268680
     tttgctagtt ctagcatcta ctacttcagt aatattattt ccgccagctt ctaaaacaac    268740
     attatcaatt ctgttattag ttgcatttat atctacatct tttgctaatg aatctttttc    268800
     taatttttcc atattagcat taaactgctg atacttatta gaatcaaaaa gtgtatttcc    268860
     ccatttatca agatttaaca tctatttcgc tcctttcaat acttttgcta attgggccat    268920
     tattgatact atcgactttt tattatttga aagtgtaatt tctggcgctt ttattgtgaa    268980
     tgggtatttt ttatatgcaa ctatctgcac atcataatca atgccaagcg gttcataaat    269040
     aaatagaaca taatcacctt tttcacactc ataatcattc ttcaatatca cgcttcccgt    269100
     tgttgctgga tagtcttgta attcaagctt taagcgcctt tgcatgttac ctgcaacagt    269160
     atatcgttca tctgaaacgg gttcttgcca acgaatgccc catttttcta cttccgggct    269220
     agtgtatgtg attggggaaa aatagttatt tccgttacta tcaacttttc catatccttt    269280
     aatcttcgtt tttaacgaaa gagtatcaat atcaaaactt gcttcgtctg tattgtattt    269340
     atatctgata aaattttccg tcttagcacc ataaatttca cgtggtttaa atactaagtg    269400
     tcggttatct ggaataacga ctactccata atcatccaat aattgatcaa taagtgttaa    269460
     gtagttgtta tttccaaagt tttcttgttg aactttttct agtatattgg aagggtctat    269520
     tatctcccat gaaaagcctc tgttatcagt tttaaagata tgagttaagc attgttctaa    269580
     agtaaaagaa cctgttatag cgtcgtcttg ccgtccatcc tgacatgtat aataaatgtg    269640
     aggcgctcta atatccttcg atagcgtttt tccaacggcg tcatgactta attgttttac    269700
     aacaaactct tgacctctaa aataaacaga gctttcataa tctaaaaaag agtagcagtg    269760
     agcgtttttg ggagtttgcg ctaccttaaa ctcaatgctc cacatctcgt tttctgtcca    269820
     actttcgcaa aaactatctt tatcgaaatc tgttaatatt tcttcgttat tcttccaaaa    269880
     atcagcaact ataatatcac tattcatata ttcacctact tgtacaaaaa ggagaaatcc    269940
     cacttcgtat ctaaatgact agtattgcta atctcgataa gattctctcc ttttttcaaa    270000
     cttattaacc cgtgattcgt gttacgaccg cagggatttc cgtttattct aggtgtagcg    270060
     caatcaataa ttaatgtgtc tgttgtactt aacgatggat aatagataaa tctatcgcct    270120
     gtcgtaatat tattaattgt taattctcct tcattctgac cacgcaaagt aattgctaaa    270180
     taatgttcgc gcgggtctat gtcaaaacta ccgccattat aaatgatgaa acgactttta    270240
     gtgtgagtat atctataatc ctccattgct agaccttgcc cgaactgcca tttatcgcaa    270300
     tcaatttcag aatcgctaag cgtagaactt agcgattctg aataacctcg aaacacatcg    270360
     aattcaagtg tcaaatctgc gtatcccggc gctttgcggt caataccaac gccactcgga    270420
     tgtactctat attttttgcc aggcgtttta gaatgaacta aaaagtattc ttttctctga    270480
     taaataagtt ccaataactc atctagttta acgtgatata agtctgctga ttctgttcta    270540
     aaatggcaca aaatcgagat aggaaacatg ctaaagttac tatctgtcgt tctagcgccg    270600
     tcagaaccag cgaattcagt ataattatta actatttgcg gcggttctct gctcacttct    270660
     cctacctcta aatcgaataa ttcattaagc atatatgttt taccttcaat tactaatgcc    270720
     agcgatgtag ccatgttata gcccctttcc gtaaaatgct agtgatgtag aacttcctaa    270780
     gtgattgttt gtattatctg caatatcttt tccatcgaca ttaaaaataa taggtctatc    270840
     gccagattgc tgaatggctt tgattaaatc agcgttgctt gactcttttg tcttgttgtc    270900
     aataatcgtc ttaactgtaa tagttctgtt taaatcaacg ctttttaggc ccagcgcttt    270960
     ttcggctgaa attttcggca gattaatagt cggaacggtc atattagaag cggcgtttac    271020
     tactttatca accattttgt tagttgattg aacagcgcct ttagcgccag ctaagactcc    271080
     atttccaagg cctcccgtga agaattttcc gagttcgatg gccacacgtg aaggagaatg    271140
     aattttaagc gcctttttca ctgaattagt gattgtgtta gcaatgctct tagctgcttt    271200
     ttcaagttgt tttttctgac tgtttagtcc gtttattaaa ccttttgctg cgttaatacc    271260
     agcagaatac attgcattag ccgctgtatt tcccatcgcc ttagatgctg aattgatttg    271320
     attctgcgtg ctgttaatcg ctttgatagt cttagcgtca gacttagcaa gagcttgcgc    271380
     ataagatgaa ccattctcta ctcccgattc caaaatgtcg tttataatgt ctttgctaac    271440
     acctttttta cgcaattttt caacatttgc ttgaaaagct ttaatttctt ttaagcgttt    271500
     ctgcatttct gcttggattg attttggatt ttctgggtct acattgctaa tagatccata    271560
     actttgcatt ttttcagtaa ttgaagctgc atactcttta ctctgcttcg tcaagtccgc    271620
     cattttagta ttagcagctt ttaattgagc gactacttta tcacgtttct tagctgtcgc    271680
     tgctaatctg tttgtttgtt gaacaatgta accttcaata ctattcaggg ccttagcttg    271740
     tttgagttgg ccactgctct tattcttaga atgcaatccc gcgtcaatcg ctgaggatat    271800
     tttgtctttc agcgtactag acagcttctt gatttgcgat tcagttccta gcgcgcttgc    271860
     tacaagatta tttgccgctt tcgtcactgc tttatttttg tctgcgatac ctagagaata    271920
     accagttccg aagtctccac ctagtttttt cgactctttc gaaggtgaat gcgagtcttg    271980
     ttttttctga actgccgcta gtgctttatt tgccaaagaa gcagccgctc taccaaccgc    272040
     gcccatacca ctcaaaatgc cgtttacgta tccagaagca aaatcagaac caactccact    272100
     agaatcaacc gaaccagcac cagatttagc agaattcccc acgcttgacc cagctgaata    272160
     agcgccgcct tttcctccca taactccatt gttaaagcct gcgctgtctt ttgaaccaac    272220
     tgctttgaat gcgttcgggt ctgtcgcgcc ttcttttgct ttatttttaa ctgctgaacc    272280
     agctgattta gcagcgcctt ccttaccttt tacaccgtcc gcaaagttct gtccgccagt    272340
     ttgacctttt gttttcattt ccgagtcaat agagtcagtg cccattttta cgccatcaac    272400
     taaatatttg ccagctccct gaaagtcacc agatttgata gctgttaaaa attgattttt    272460
     cccactttct ccattcaaaa acataccgtt tggcaagcta gaaatagtac ttagaacatc    272520
     attattaata tttaaagctg ctgtagtata atcaccgctt tgaagcgctg tgacaaaagc    272580
     ttgtactcct tctccgccac gctgacccat tatgccagct aatcctgcta acgtattatc    272640
     aattgatgtg cttgtagaaa caaagttttg ccataaagcg gataactgtt catcactaat    272700
     atttccaagc tgagacaaac cgtttgcgaa tgtttgtgcg tttaaagttc cgccattcgc    272760
     aataattgag ttcatttcag atgcccaatt tttaaggtta gtagacaatg tttgattttt    272820
     ctttgtttgt tcgtcgattt ggatttgata gttcgctttt tcggtttcag ttgaagcgtc    272880
     cgcttttttc tttttcaaat cagcaagcga tttctcgcca gtttcaacag cttttttctt    272940
     ttcttcatat aagctctttt gaacttctaa gctcgtattt ctttcctttt catttaagct    273000
     tttaccttgt tctagtcgta gtaaatttgc ttcaacatat agctgatttt gtttcgctaa    273060
     ttctgtttga atatcagtag tttgttgttg taaaaacttc ttctgctgag ctgttaactc    273120
     ttgcccatcg gcccaacgat ttgtttttag catatttgaa taatcacttt gcaaagttag    273180
     taatgtgcta ttattctttg ttgtttcgtc tactaaagtc ttatttgcat ctgctatagc    273240
     ttttttacgc ttatctcctt ctaggctttg cgccttttcc atagcagcag tataagcatc    273300
     ttgtgacttt ttagctgatt cttgatactg actgtatagc tctttagcag aattcaagaa    273360
     cgacttagtt ttctcgctaa gtttattgcc gtactgatct actccaccgc ttaacatcgt    273420
     atctattgct tgatttgact tcgaaactgt tgtttctgtt tgcttagcag tagattcaac    273480
     tagttttaat gtgtctttta tttttttacc tgatgtttct gttttcttcg ctgttttttc    273540
     ggcttctcca cccatttgtt tgaaggcttc aacagtacca gttaatgcat aattatcttt    273600
     attaaaagca tctttaatag ctgagccagc atcgacaaag gcatctttgg actgttctaa    273660
     gcttttctta gcacctttta aatcaccttg tagcacttga aatgccgctt taatagcata    273720
     gtaaagtccc tgtaacgctt taatagctac taacactatt cgtgctagca cttgaataac    273780
     atcaactaca gcagctaaag caaaaccaag tacaacccac gccctcacgc cgatatattt    273840
     caatatgcct ttaaacccgc ttccgacggg ttttagggct gatactattt gtttgaaaac    273900
     atctattatc ttgccgaatg agtttttcac cgcttcccac atgccagata gaaagctttt    273960
     tatccccgcc gtgttttcct taaaagcggt atacattcca tagataacag ctattactgc    274020
     gccaaccgcc gcaacaacaa cgccaaaagc agcagttgtt gagccgagtg ttcctactaa    274080
     tttaacgaat gaccctttaa ttgtattagc tacaactgaa agtagtgacc cgctagacgt    274140
     caaacttttt atcgctcctg ctagtttagc tacttttgaa aatacgctac taataatatt    274200
     aaaagctaca aatcctgcgg caacttttgc caatagtggt gcccactcaa tcaaaacagg    274260
     tataaactct tttattttct gaattaaatc agaaagtttt ttctggaatt ctgggcttgc    274320
     tgttactgcc gcaaactgtt tgaatgcgtt tttagcaacg tctaacgcct gaattatcgg    274380
     accttttagg ttttctacga tattcgcaag actcttaaca gctgccgttt tcatgttcgc    274440
     aaatgaaccg ctgatagtgt tacctgctgt ttttgctaga cctgccattt tagccgtgtt    274500
     cccagccatt cctgttgttc cttcttcgat accttttgtt agcattgcaa tagctctagt    274560
     tgattctaat gatccctcgg aaacatattt cttcatttct ccaacagatt taccagtcga    274620
     attcgctaaa atttgccaag caggaacacc cgcgtcaact aagcggttaa tatcgtctgc    274680
     ataagcaaca ccagacgctt gtaatgctga gatagcatct gtcatctggt caattgattc    274740
     tgaaccattt ccgacaccat aggcagcgtc agcaatagcg gtgaatacag gttttacatt    274800
     cgccgctttc atgcctgccg caaccatttt tttagcgcct aaagcgacgg catcgagcgc    274860
     aattggtgta ccatcgatag ccgctgtaag gtctgtcata actagttgcg catcttttgc    274920
     tgaaccagta aggactgtta acgatttagt tgcagtatca atcgtatcaa ctcgaccaat    274980
     agcgctaccc acaacatttt tagttgctgc aattaatccg aacgctgctg ctaatctgag    275040
     aatactaaag cgagcttgtt cggcgggctt ttcaactgaa tttttaagcg cttcacgcat    275100
     tccggcgcct gcacctttcg ccgccgcttt cgctgcgtta aatccgctta ctaatccact    275160
     tttaattaac gaaccagtgc tttttgcaat attccctagg ccttttaatg ctgaaatacc    275220
     agcttggcca gccgctttag ctccggattt cacagcgcta aagcctgttt ttaatgctga    275280
     tttcactgtt gttcctgtcg ttttcgccgc gcttgctaca gcgctaaaag ctgttttcat    275340
     tgcgctactt actgctaacg ctgctgattt tgtagcacta ggaatagctt tcacagcgct    275400
     aatagttcct tttacgctca tataagcagc aactaccacc gctttgtaag ctactacgaa    275460
     actgtttttc actgctgtag ccgctgtttt agcagctcct ggaatacttt taataacttt    275520
     tacagtagtt tgagcaaaag aaatagcagc cgatttagct gcttgtaaac tacttactaa    275580
     tgcggattta atactgattc cagcgctttt aattgcgccg gggatggatt taatgacatt    275640
     aattgatatt ttaacagctg acacaatact actttgtact gtcttagcaa ttgaaaagaa    275700
     gccgtttttg atattaactg ctgtgttttt gatactcgtt ccaagatttt taaccgctgt    275760
     aatagatgct ttagcagcgt ttacgaatcc agtttttaca gtggatgcaa gtttagatag    275820
     tgccgcttgt acattagaag gtaactcacg tataaagttt aaactagctt ttaaagcatt    275880
     tgagcctgcg tttcccatgc ttttaaacgc attaacaaat gtgtctttta atcgttttga    275940
     ttgactagca atatcagaca ctgcttctct gtatgcttta tctaatgccg ccccagcgtt    276000
     tgttcctgct tttgccaaat ctttttcaaa cgcatcaagt tgtttatctg cttttttatc    276060
     gtctaaacta atctcaatta ctactgatcc atcgctcatg ttctcacctc taatctttta    276120
     acttatatct gtttttcagt ttaattaatt cgtttcgttc tttttctgtt cctttcccag    276180
     aaggtaattc cgcttgccta atgccgatta tcgttttaat tgttgtatca tcacgcaaac    276240
     tttctaacaa tgctctaaac ttataccagt gcattttccc tcgactatct aataaatcaa    276300
     tattgtagtc ttgtaaaaaa gaagcgtaga tataatccgc atcttgcgtt aacgaatatg    276360
     aagcaatttc ttccgcatcg tcattgttgt ttgtagcgct tggcatcttg tttccgtcga    276420
     tatcataaag cagaccatca tcattttctt taacaatata attagtgaaa atatcaataa    276480
     gtaccagtga tttttcttca atattcgcgt attcgtcttc ctcatttgaa cgtggccaag    276540
     gcatatcatc agcaaaaagc acatcaattg cgaggttagc tctgaacaca tcagacaaac    276600
     tattatcttc cgttaaatca atcactctta gaacgttgtc aaaagctaaa tcgagcttat    276660
     attctttccc ttcgtattcg taaatatcat taactccaaa agcgagcgaa agcatttaaa    276720
     tcacttcgct ttttttgtca tttttgcttt atatttcttt tgaatttcat tttgttgttt    276780
     ttctactgaa ccaacgatac tttctgcaac ttgatcgtat acttgataca tttttaaaat    276840
     atctttgcat tgcttgtaac atttagagaa tgcttcttcg tcgtctaata aaactgcata    276900
     cgcttcagtt aaagcttctt taacatcttc ttctaaagca aaataatctt ctgaactcat    276960
     ttcgtctgta ttatcaatgt tgtatttatt taacttttcc agtttcttct tgtacttctc    277020
     atctgcttca atccatttgc ggcgcatttc atcacctaaa ccgactctaa acagttccgt    277080
     gccaagttga aactcttgat atgattcttc taattgaata ttgattacat tattttgtgc    277140
     catgtatgat ttcctccaat ttaaaagccc ctactataaa cgtaagggct tcatttatta    277200
     atctgctgct tctactgtta cttgtactac tttgttgata gaagtacttt ctttagatgc    277260
     aactgttatg tttgctgttc cttctgctac gccttcacct gtacccacgc tattgatttt    277320
     tgccttcggt ggattagatg aagtgtaagt tacttcttga ctagctccca ctggcaatac    277380
     agaagcatta atagtaaatg tttctcctac tttaacggta attgtattgt ggtccacttc    277440
     gacgctggac gggctctcct cagggttttg taaccgtagg tgtttcatca taagcgatgc    277500
     ggcaaccaaa cgctgggaat tctgtagcat cgccgccacc cgcggagcct ttaatttccg    277560
     aaacagtcgc tttaccgata gctgtttcgg tatctggaat ttcgatttta aacataatcc    277620
     cgcgattttc tggcgttcta cgtttagcga caattaagtt ttgtgcatca tcttcacgat    277680
     cgtgtgtccc ttcaaatgtg taagcttctg agtaacctag cacaaccgtt ttttcgttgc    277740
     catcaccgtc atagtcgcct tgctcttccg tgttgtccga accatcgtca gacacgtttg    277800
     taatccattt ggatagtcgt ttccaatccg gttcacctgc accagtaaca atttcagcaa    277860
     cagaatattt cgtttttgcg tttttaattc tcatctttat ttttcctcac tttcaatata    277920
     taatttgatt ttgaaactag cgctataaat aaacgttcca tcgtcactag cagaaacgag    277980
     gttcggcaca ctagttgttt ctttgtcttc tagcacaaag ctgttattta agctctgaat    278040
     gctttctaat tctgtgttat caaaataagc agtaatagca ttcaacacat ttaaaacttt    278100
     catttcttgc ttgctagagc cgtttaggtt aaaagaaaaa gaccgctcat aagagccgtc    278160
     ttgataacct tgtttatcgt tatttggagt cagcagcaaa gcgattgact cgggttttaa    278220
     tatcgctgtt cttaatttca tatcttttaa atcgacgttg ttttcgatag catccatgac    278280
     actgtccaaa aaatctaatg acattataat ccctcctcaa ccgctttttg cgctacttct    278340
     atccaacttt ctagcttatc tacttttgca cgttggtccc atttaggacc agctaacgga    278400
     tgatgtgtga gtgtgaaatt gaagtttatt ccgttgtaga gtctccgcgc ataaatagat    278460
     gtccacatta tttctttgtc gttcataata acgtattgat ttgataaatc accctccaaa    278520
     aaggggacat aaggtgcaat atcagcggcc gcttgattaa ttaaagcaaa ctgacctctt    278580
     tctttcgcct tttttacgct cccttttgct tttgagaggt ccacacgtac tttaatcggc    278640
     atcaaaccac ctcgatttcc caatgataca cgctattaga agtcgcatag caaggtataa    278700
     ctttaacaat cttataagct tttccagaga aaaaaattct cgatctactt ataaaatcgt    278760
     ttggcatgtt catgctgttc accgcatcaa taaaaataac cgcatcatat ctatcactat    278820
     cagacaatcc cgcgatttga tttgattttg agaaatcaac acgaacatgt tcaatctcaa    278880
     tgcctttttc ataaacgact tgattatgtc tatcttcttc tttgtacgct tcatagctaa    278940
     tgttatgaat tagccagtca agaggtaacg gaggggcatt tgttatcggt tttgctactt    279000
     tcattagcga acacctaccc cgctataaag caagcctgtg ggagctaaat acgtcctcac    279060
     gtcgcttcca atcagcccgc tattgagtga tgttgcagtt gatgcaaagt tactatcact    279120
     aatagaagtt cttccgatgc tcacattatc cggcttagat acagctagct cacttgttcc    279180
     gcccgcctct ttgaaatact cgatttggtt gcaagtagct aactgtattt gatgctgaat    279240
     aaattcactg aatgactcaa ttccgctttt tcgaattcga taaaatgtca ctgaatcgat    279300
     ttttctttca gcgtgtttta acaatttgtc aaattcatcc tgttccaaat gctccccagc    279360
     gtattcatta gtataaaatt ccagtgttgt gtaaggcata atattcgccc ccttttatca    279420
     agccccgcca gctggcaatt cttcaactaa atgttgaata ccaacaatac cgatttgttt    279480
     atcttcgtaa actttttccc agtttccagc tttcgctaag tctgcattcg tcggagtgat    279540
     ttcgttagca tcacgaacag catttttaaa tttaactcca tatggatgca tggtgaaagc    279600
     acgtcgagta aatacttggt cattaccttt ggatgcatca cgagccgttt cgaaagttgt    279660
     taacttagct gggttacctg tgtttcttcc gatagaacca gttgcgaata aatacgatgt    279720
     atatactttt gctgcgcctg ttcctgtgga aggtactcca tcatctacaa ctacacggta    279780
     tcctaaataa gtcgggatat taacttctcc ccgagcattt gggataaatg caattaagtt    279840
     ttgtttttgc aatgctgtat acactgctga atgcataacc attaagttta aacgatctgc    279900
     agaatccccg agtaattgtt ttgcatctaa taccaaattc cccgaaattg cagatgttgg    279960
     ttttgatagc aagtgagagc tcgctaatgc accgttttta gcaaatagtc catttaacac    280020
     ggaaattagt acagtttgct cacgacgcat ccaccaagaa gcgattttcc ccattaaagc    280080
     attcaaaggg tcgtctcccg agatgaccgc cgcaagttca ttgactgacc agccacgacc    280140
     acgatacatt acagctgcaa tgtcagcgct agccgtgatt ttccctgttt ctagtccttt    280200
     ttcaccgtca cctaaagttt cgtcttcacc atctaaatcg ttccaaaacg gcatattaac    280260
     aagtaatccg cccgctgtga tattttgtgc aacgcttggg tcagcaactg caattcctga    280320
     ttggataatt gctgattttt cagatgtgaa gttatccatg tacgcattaa aaacctctgg    280380
     tgttacaacg tctaataatt ttgtgatttc atttcccatt attcactctc tcctttttcc    280440
     gttaaaaatt ttgttaaatt aaatgaatct gattttaaat tttcttttaa tgaaccgtcg    280500
     taaccagctg gcgccttcgg attaccacta aatccgaatt ttggaacctt ttcactttct    280560
     tgagcaaata aataagcatc gctttcctgc aatgctccca gctgttcatc aaggcctttc    280620
     agaccttcgt ctgttagttc tagtttgtcg ttatctaaaa gcgcttttac cgcctttgga    280680
     tttctcgctt ttgcaccagc aagcgctagc tcaatagctg aatttttctt tgtttcggca    280740
     atttcagact ggtaatcaga ctctaaatct ttgttttttt gctgtaagtc ctcgatttgt    280800
     tttttcaatt cttcgccagt accagaattc tttttcaaat cgtcaatatc cttgtcccgt    280860
     tgtgtcagct gactttttaa gccgtctctc tctgcttcca cctcagataa ttgttgctta    280920
     gcagctgtaa catctttacc attttcagcc atcactttat taatgacttc atcctccaag    280980
     cccaaacctt ttagatattc tctttgcatt ttcgttcctc cttcgatatt tttacgcggc    281040
     aacgaccgcg agagccgtct ttttacgact tccgaacagg tcgaatatta ggcatatact    281100
     tgttctctgc tgtattgcct tgttaattta tgtgtgttta caaatgctct tagcttgctt    281160
     tgtttcgttc taacagcctg tttcgctttt ttaactgcca gttcatcgcc gagctcttcg    281220
     gcagctgata atttgcgttt agacgctctt atgtctcgtt ccattaaacg ttgttgctga    281280
     ctcaacatgt aaacgcgttt gttttcttct tcgtctatta actcactatc ttctggcgct    281340
     acgttaatgc cctcaacgaa cgggaaacga tgatgacggc aattacagcc gaaaacacca    281400
     tcgccgtatc catatctgag ttccggtgaa taaatagaca tgtatttatt gccgtatttc    281460
     gtttttgttt cttcaacaga taacaaacag ataactttac cttgaacaag tgaacatgtt    281520
     ggacgtgcgc ctacatgttg cgaaatacgc actaaatcaa catcatattc attcattcgc    281580
     tcatcttcaa cgctgttata aacactgtta accgttgtcc ttgtaacagt ccggacgtaa    281640
     gcttcaggtg tccacctttt atttgccttg tctacaagtg caggaacacc attttcagcg    281700
     aatttagtta ctgtttcagc taatgcttgt ctatgtgttt ttaaaccagc cagaacgctc    281760
     tgtgtggttt cgtgaatgat atctgaatag atttgtcttg cttgcgataa catcgtttga    281820
     ttgacgcgat tatagttact ttctgctaac ttaaaataac ttctcattac tttatcgact    281880
     atcgtttgcc cgtcacccac gagcggcaac acagcacccg cttcagctaa tttgctgaaa    281940
     tagttatcta cttgttttaa atcgctgtat cccgcatctt tgacaataga aaaaagcttc    282000
     ttagctgata caccggaagc tttggaaatt ttatttagca tttgctgatc taatgcgtga    282060
     acttgattaa gtttttctat ttgccaagcc agcacattgt cagcactgat atttttcttt    282120
     gttttcaatc gccgaacaat aagagtgaac aattcatttt ctaaacctgt ataaacatca    282180
     acgaccggct gcacaaataa gtcgagttgc cgcggagtca gtgccatcta atccacttcc    282240
     tttttagagg tcttttcctt ctctgtaata acaaacccat tccctgcatc agctaagatt    282300
     tttctcgctt tttcttcgtc aaacggaaac gctgcaacga tcatttcaag tgcggaatta    282360
     taaggaagtt ctcctttagc aaccgattga actatattaa ctaatgaagt tatttgagcg    282420
     ccgtttaatg acacctcttg aatagtttcg cctgcgacag cactagcttc taatgtcccg    282480
     ttcgcatttt catctggcag ctcgatatcg cctaacaatc cagataaatc atttcccgga    282540
     atttctgctt gtacatcttt ttctatctct tctttccacg cttctgcttc tgcatcggta    282600
     atattccaag cacgctgtaa agcaattttt agcggtatca taccttggtt tttagcagta    282660
     gtataacgat tgattgttgt atcttcatct tgtgctatag aatcgtcaaa atcgactgta    282720
     atagtatcta gctctactac ttcgccgcta taagcttcaa taaatttccc gacctcgaga    282780
     atgctcacaa tcatttcttt tatgccttgt tcgattagtt gcgaatgact gtttttagtt    282840
     tgataagttt ctgacttctc gcttacgacc tctgtagctg tttttaagcc gttttcatcg    282900
     aaagtgaatg tgccagcgct taacccaacc tgcatcgcat aaatgcgtag cattgcgttt    282960
     atagactcga taaactcagt tgagcgaatc tctacagata tatcttttac tgatttaccg    283020
     tccgcatcct ggtcaccttg atataggaaa aatgcttcat cggttgaatc gaaatactgt    283080
     gtggttgagc cgtctaatcc aatggctgtt ttaacgaaac ttgaaggcac taacactttc    283140
     tttttaccca atttaaattc ttgatagaat gaatcaaaca tcaagtcaag cgtttttaat    283200
     gtgtctaatg cgttagcata aacggaaatg cctaaaggtg aagttaagtt cttgttattc    283260
     gcaatgttag gtttgatata aataaatgtt ggacgtgtaa acttcggcaa tggtacaact    283320
     ggctcaatat cattaaacaa caattttaag cttacttttc caccaagttc gtccgggtcg    283380
     tcagattgat atagctctgt tgtgactgtg tatatatcgt cttgccattc attccattcg    283440
     agcaacgtat aatatttatc gtttttatga aaactattag cgataacaca ttcgtctacg    283500
     ttctcactgt catttgatag aggatacatg caatcagctg tcgcgaatga aactttgacg    283560
     ttcttttttc cgtcgtgata cacttttatc acaaaaccgc ccatcgcttc gccgtattcg    283620
     atgtaacgct ccatgttctt cgtaaaaccg tttgttttca atacattaag cacgaattcc    283680
     tcagcggctt tatcatcaat attgattttc actttctcat taaaaagaag cttagacatg    283740
     tatttagccg taaccttcgg caaattcata gataattgac gtctgttaac cggattgcca    283800
     ttgtgttcgt aatttagatt atgccattca gcgtaatggc cttggtacaa tcgtttccac    283860
     atgtcaatat acttataatc ttcatcatta gcatttactt ttttatggtc ttttacatct    283920
     ttcagtgctt tcaatagtcc cattctccgc atcactcctt tcacgcttgc gattatttgg    283980
     ttaatcaagg tttccccccc ctagtatttg agccctaact tccttagatt gtcttttaca    284040
     tagtactgaa aagcatcaca cgtatgatcg tcttctttga tgacttcagg cttatctgta    284100
     ttaactgttt tgacatccca ttgatatttc cggtgttcct cgatgaatat ttgattttct    284160
     ggaatatcaa gataataaaa acgaccttgc gcgagtaaat cacacacaaa gtcaatcata    284220
     tccacttttt taccttttgc gacggggtgt aagctaacgc cgtaatcttt ataatattga    284280
     ttgcgaagcc ctccctctgc gctatctact gtttgcatat caacatttgt attgtagttt    284340
     ccaactactt tagtcataaa atctcgcaac tcctttgaat actcgctagg tgctttttta    284400
     acaacttgat tagcaggact ataatagtat gtgttaagca aaataacatt tctttttgca    284460
     gtgagaccaa aacttagata tgttgtagct gacacttgat gccccgtatc gatagcaaag    284520
     tcaattaaaa taagcctgtc atccgcagga atagctttaa gcggctgaaa caggttcatg    284580
     ttataaacat tatcaccaag gcctattacc tcgcctagat acatccagcg gtagtagtca    284640
     aggtcattct ttttgtattt ctcaatcttc ttaatgattt gcttagataa aaatcctttt    284700
     tcatcatcca aataagtagt gtgatgtatt aaataatcat cgtcacttcg cttactatct    284760
     acatattcat tcacccattc atatggattg cgcggcgggt taaatgacat gtatattgta    284820
     acttcttgcc catccggcaa atcttcacga atgaacgtat cttctacgac atcaatgtca    284880
     gtcacaccgg aaaattccgc caattcctca aaccacaaat cgctaacata acccaccgga    284940
     attttcatcg attttagttt agcgggatca tcacaaccag aaaaataaaa acccgttccc    285000
     cattctttat ggatgatttc cattggtgac ttaccaaact taaattggtc agcaacgccc    285060
     atttcataca aagcccattt gatttgctga tacactgatt tatagagcgt attagctact    285120
     ttacgaagac acaccatgtt agattgtgga ttagccattt tcttttctac gagctttaaa    285180
     ctgataacag acgacttcat agaagaacgt ccgcccttag ctatgatgtg attatgttta    285240
     gatagccaca agtcataaaa agcaggatta atcatatctg ttacattgat aacctggtaa    285300
     tcaattagtt gtttgtgtat cgtcgcgttc atcggtgcca cctgcctttt tatcaaggta    285360
     ggcttgcatt tcgtcaacat ttgacatgat aattgttgca aagccagaat ccttacaatc    285420
     ttttttggct tctaattcaa gcttattaat ctgtgcatca agaagagcta cacgcctatc    285480
     ctgcatgtct tttgtttctt tatagcccga tctatcgaat aagtcttgaa gtatttgcgc    285540
     tcttaaagat agtatttctt tccaatcttt atgccacaat aaatcccgct tcgatgtact    285600
     gttctcttca taaatttcac ttacactatc ctcaagctct tctagttgaa tttttagttc    285660
     gtcatattct tccaataact cttttttaaa ttttccttca tcagctttcc ttccatccat    285720
     ttttttaatt ttggattcag ttcgccttat tttcgccttt aaattattaa tatcagctat    285780
     cgcagttatt ttacgagcat cggtaatact taacttgcga gatgcttctt catgcttcgc    285840
     cattttatcg tcaatcattc taacctgttt ccataattca gcatatattt tcgaagcgtc    285900
     atcctgcata cgttttgaaa gtagtttcat ttcttcatct ataagttcca gcaccttaac    285960
     attccttaac aacctagaag cttgttgctc tgctgtctta gtactgtaac ctgctgatat    286020
     ggcagcttct ttaccgttaa acccattcat tacataggtt ttagcaaaga ttttatattt    286080
     ctcttccgtt ttcactacat atcaccacac tcccttattt tgataaaata aaaaggacca    286140
     tcacaggccc tttatttttc ttaactcaag tttctcttta tgtttaaata tttttgatgt    286200
     tgaatctata aattgtattt cgattgcaaa attaaatctc ttgccatctg catatttttt    286260
     aatttgttta acaataaatt cataatcaaa cattattggt tcgccggata aattaggttt    286320
     aataatttgc caattcgctt tattctccaa ctgttttaaa agagcttcta tgtttgataa    286380
     ttttttgggt tctgctctaa ataataatct atccatcaaa cttggcacta ataatatttg    286440
     tctaaaatta atttccaagc taaatttact attatttaca ggagtaatta taaaaacttt    286500
     cggttttcca tcacttataa ttataccgtt ctttttgcta acaaatgaat gtctaaataa    286560
     tatggttagc ctttttctat tttcgttact atttaatttt atagcccaaa acaatgctcc    286620
     tactgtcgct aacccactta cccagtcagc taaactccca acctctagta taaaactcat    286680
     ttgcaacacc cttttatttt tcactatacc aaataaaaac cacctgctca attttcaaca    286740
     gatggaaagg gctatatatt taaaaaactg gttaacgcac cagtcagcgc cacatgcgtg    286800
     ttttacatcc agtatggata ggatatgaga ttgaacagaa gtgtcgtcat ctgttgagac    286860
     tagtgcccag atacaaagcc tctgccgggc aacatagcaa tctcctgcta tatcatcata    286920
     agattataaa tgagaagtgg agcgcagact caatataaga ttttattttt gtaatcatct    286980
     tcacttctca ctaataacat tttatcacct ttttttgctc aaaaagtgcc agaaaagtgc    287040
     cattttcaat ttagcacttc aatcccaagt gttgttgcta attcaataac agccttcctt    287100
     ttctctcttt tgtattgcct ttcttcgtaa ggaatatcaa gcataatagt tatatcttgt    287160
     aagttatgaa tgaacttctc aaacagtatc tttctatgaa tgtgctcaag ctgattcaaa    287220
     atagcatcgt attttttaac cgcttcttgt gctgcatgaa cgttatcgac attatgaatt    287280
     gcagcatctt ctacttttga atgaaattca ttactgaaat tcggtggcgt taatttgtat    287340
     gttgtcgtca ttgttggcaa tttacgactt cctgccatta cacgcagcat taaatagtct    287400
     ttaaagaact ttcttactgc tctgactgtc tgaatgtagt taatatcttc aacttgtggt    287460
     agattgaata gttgtcccat aaagtcgccc ccatcacttt ataaattttc gataaactcc    287520
     cttattttct caaccttttc agctgtatca ataaaagatt cttcactaat tgcttcaaat    287580
     tcaatattat aattagcgat ttctacgtcc tttccgtcac aaattgtttc tcttgtaaat    287640
     acatttaact tttcaatttg cattttcatc ctcctaaaac atatttcccc aaatccataa    287700
     aatcccttta accgctaatc ctagtacaaa aatcagcact aggacccaca gagtgtaaat    287760
     agtaacagct ccaataaatt tcgctacttt atcaatcatt ccaaatctcc ttattttttt    287820
     gatattcgtt catgtcaaaa atctgatagt attctttttt gtttctttgt gtgtaattga    287880
     aaactacagc cttcgacact ttgaaatgct cagcaattgc gtaacatgtt agccctgcgt    287940
     tacgtaaatc agcgaattca cgaattgtaa tttccgccca ttttttcttt ttcacgatgc    288000
     gatcgaacgt tttggtccag taagtttttt gcttttctat tgtattctcg ttcattagtt    288060
     gattgagttc tttttgcaac tttagtaatt cgtctagttc tacatcgtta tttgctatat    288120
     aactaataat ttcccgctgc ctcgctttac tcttcgttat ctccattact gtcatttgtc    288180
     acacctccac gaaatttcga cctttcagtt tcaaacactt aattgattgc atataacgca    288240
     gttcgaaaag tttttgtttg attcgaaact cttttgttaa cattcctttg atgtcgatta    288300
     attcctcatg tccatcactg taacgaacga gaaaatcagc tttatattta atcgctcgat    288360
     atagcttccc gtttttccga aagctttctt gtagcacaaa ctctggctgt aaatcgaaac    288420
     tcactacttc cccgctcatt tttaatagtt tcaattgctg ataataagct gcttctgctt    288480
     tgctatcgaa ctttatattg tcaataacaa cttttttcgc attatattta cttcgcgtac    288540
     tcgttcgcct cgttaatgac gaacgcggta tactttgcct caatctcttc gtcccccata    288600
     ctttcgattt cgctaatttg gtagtttgtg acttctgcaa tcgcattagc catttgtctg    288660
     atgctcattg atctatttct caactttttt attgctgtgt ctgctgtcat ttttattcac    288720
     cctttccctc aaaatggcaa atcatcttca ttaatatcaa tcggcttacc ttcacttgca    288780
     aatgaatcgc tcttctgact cgtatccgct cgatatgagc ttgtttgatt gttatttgaa    288840
     taattagcct tgttttggta attattcgat gtagcacctt ctacgttgtt atttttaggt    288900
     tctaagaatt gaactgattc agcaactacc tcagtaacga aaacacgttt accgtcgtta    288960
     tcctcataat tacgagtttg aacacgtcca tcaacgcccg ccatgcttcc tttcttcaag    289020
     aaattagcaa cgttttctgc tggtttgcgc caaacaacac aattaatgaa atctgcttct    289080
     cgttctccgt tttgattagt gaatgtacga tttactgcta atgtaaaagt cgcgactgct    289140
     acgcctgctg gagtgtaacg taaatccgga tcttttgtta atcgtcctac aagtactaca    289200
     cgattcatca ttcgtcttcc ctctctttca tcaattcgca atcaagcaaa ttttcatctt    289260
     caattaattt tatatgtgca tctggtcgat acatgggatt gaactctgct attcgtatcg    289320
     cctcttcctc gttctcagct tcaacttcgt acacttcttg agataaatat gtgattttat    289380
     acttcattcc gccacctctt tcaaacattt taatatttta agtagtaaca ctcttacaga    289440
     tcgttttaaa cgccttgact gaaaggaata tgtttcatgt tgtcggtact tcattcctcc    289500
     gcctctttcc gaagtacgta ttgtacaagc ccacccatct gctcaatatt atctcccaca    289560
     taagtagctg tcaggatttt ccatccgtca tcaagaagct taataagttc ttctccttta    289620
     tctgcaagaa aacctacctg aactatttta tgtttcattc cgccacctct tcaaaacttc    289680
     taatatcaat ttcttccacc atttcaatct taaaacacgc tggcaaataa tctcgttgtt    289740
     tagcccattc atatatcaaa tctgataatt gttctttatg ttcttgagtt acgtcattca    289800
     aatattcctc cccgcactct ccaacttcgt cataaacgca ttgagctata ttttcaagca    289860
     aagtatctac ttctgtagga aattcgactt cttctatttg accaacgaaa aatgtataaa    289920
     tgttttcata atccaaaggt cgcatattta atccatcaga taaatcataa tctctgcgtt    289980
     catcatcatc taaactattg tattcagtta ataactcaac tccataaatt attgcttctt    290040
     cttttgtgtc aaatcgttca aaagcacccc atctttcacc atctgtacca tttaacatcc    290100
     attgtccgtg tttcattccg ccacctcttt caaaataaaa tcaatcactc tgtaatatct    290160
     ctttctaagc ttttcgttat ctccatgcgt ttgttcaaca gacgctttaa gttcatctaa    290220
     tgttccttgg aaacaacctg ttatccatat gtctaattct ttgatatatg ctatttgatt    290280
     gtttttacgt gtcgtatcta cttgtacgca gattactgtc aagccttcta catgttgcca    290340
     gtttacccaa tttaaattta cattacttaa atttgcataa cttaaatctg cattacttaa    290400
     atttgcaaat cttaaatttg cataacttaa atctgcaccc cttaaatctg caagtcttaa    290460
     atttgcaaat cttaaatttg tgttttttaa gtctgcatta cttaaatccg ctctatcgcc    290520
     accttcgttg aacagccatt tcccatgatt ctctaatatg atgtctaact cttcttgttt    290580
     cattccgttc cctccaataa ttccggattt tcgtgtatgt tgccgataac ttccatatgc    290640
     tttactaacg aactgccatt ttggttcaac acataactag gctcgccctt gtatgttgtt    290700
     ttaaaacatg ctccgtcata aacgatggat gtaaaacaga atgttggctc aacatctccc    290760
     gcaaatgaat ctgtgtattt attgatattt gaaaatgccg ttacaacatc cccttcgaaa    290820
     atcttcttgc cgtttttgtc ttttaaacct gtgtattgca taagcacgac atcatcaaag    290880
     ctgtaccagt cgacgcacag cgtacatttc gcattaccac aaccgctcac acctacagct    290940
     tctgtttcgt taaagcacaa atccgtaaca ggaagcattt tcttttttct ttttacaaac    291000
     gctctaaatc caatcgctct catgcttcac cctccgcttc ctcaaaagaa aagaagttaa    291060
     taggttctaa ctccgcaatt ttgtacaatt ttccactctc tttatatctc caagcatgtt    291120
     tttttaacat ttctaagtct ttaaacactg ctagagttcc tttactacga tgtttagcaa    291180
     cctgtaaatc ctcgtcaact attgcatata attccatatt tacgcctccg cttcctcaac    291240
     aagaacagca aactgccaat atatttcgcc tccaggtatg cctttaattt ccgcttctgt    291300
     taatttggtt ctccattcct tattttcatt gataattgat ccagtaatag atgtttcatc    291360
     agattgtaca tttaacaaaa catacatatt aatcacttct aattcggctg cgtcatcgtt    291420
     ccatgttgaa agcggcaacc ttacataata aagcggttct ttctcgactt cgtagccgtc    291480
     aagccaagcg cgggcgagta gttcttgatt atcagctgat gaaattaacc attcgtacat    291540
     ttcagcagac atatcagaat cttcatagtc taacaaacaa gctaaatcgt attctctttg    291600
     tttacagtgt tttatccaat ccgcggcaaa ccgaggaacg gctatcaatt ccggctcttt    291660
     taccttaacg acatcctcta atttccggaa aaaccaactt aaatctgaaa ctttcaggtc    291720
     tacccaacca acatcgttgt taacacgttt tattgtgcca atgataagtt cattattttc    291780
     tataaattgc actttatcgc cttctttaaa tctcatgctt tttcctcctt aaaaaggttt    291840
     aattgcattg gtggctcaaa attacaccaa ataatttctt gcctatcaga tttcttttct    291900
     gatgttattc ctacttttgt catcgtttta agcactggcc agtctgataa ctcctgttta    291960
     tatagctctg attcgtaacc gcttaacatt actttgccat catgattttt aagcactttt    292020
     agtaactctt tgtgttgctc taaactaaag tcatgctgat aatgtgaact tgctaaagaa    292080
     gttgcaacat atggcgggtc acaatatatc agtgtatctt tatcgttatg ctgttcaatc    292140
     agtttaattg catctacatt ttcgatttga gcgtctttca gtcttgctgc agctattccg    292200
     atgcggttat acatgtcatt ccactcatat gcgttgtaag gaccattcca agacacgttt    292260
     tttctaaatc caacatttgc attagtcttg cctccgacgg caaaccagag tctcacggcc    292320
     attcgtctgg catcctctaa tgaatcgctt gttatttctt gagaaagcat atactcttca    292380
     cgagaataca gcgtgtgcat gattaaatac tgcagttttt ctggattatc acgcattgct    292440
     ttaaaaagat taactagtcg accgtctaaa tcgtttatcg tctctaaagt agctttttgc    292500
     ttgttcataa agactgcaca tgatccgcag aatggttcta aataactttt atgctccggc    292560
     atattttcaa ttattaaatc tgccaaaccc catttactgc cgggataatt aagtattcgt    292620
     ttcacgcctg cacctcattc ctagccgcta actgcgcttt aatttcagcg acttgttttt    292680
     ctaagtcttc gcttgatcct gttgttgaag tttcttgttt tgtttgtttc tggtctttgt    292740
     cgaaccagtc cggcaatact tcttctttaa ctggtttgtt atatttgttg taagtgggct    292800
     tgttatattt ttgctctaac tctatctgtc gttgtttttc cgctgcatca acatcagcta    292860
     ttgttttaaa tcctctgctt tcccagtttt taagaatctt attaacgtaa gcgtaattac    292920
     gtttgttagc tccttgctct gatgtaactt ccaaagcctt catgacaatt tctcgattac    292980
     ctgcaaaatc atctacccaa gcaagtaatt tttctagttc aactggaagc atcattccga    293040
     atccgttttg ttcccaaaaa tccttgaaat ttaaatcgct gttgttgttg ttaatatctt    293100
     tatctaattc tttatctata tctattgcgt tactttgcgt aacagtaacg ctacttgtaa    293160
     cgttacactc tttatttcct ttactgtcac cactcgctat tctgttctgc cgcatagctt    293220
     ctcgatgttt ttccactctt ttccttgttt gctcacgaac cctttccata ccatcaacgt    293280
     tttgatgttt ttcccaattt tctatttcaa tcaatccatt ttctgttttt tgaatcattc    293340
     cgaagctctg taacgtatgt aacgttacac gtataatccc aacatcacgg ttgaaaaggg    293400
     tcgcgagcat gtcttccgta tacggtacat tttcgtttaa ataaatgcgt cctttgtcgt    293460
     tagtttttcc agctaaagct agaagcctaa tccatacaat aagcatttgg ttaccctctg    293520
     gcattttttc gagcaactta atcttttcat catcaaacat attgacggat aactttatcc    293580
     attgaatccc cgacatactc gctcctcctg ttttaattaa cttgtttttg cgcctctatt    293640
     tctgcatcta gttttttaat tagtgcagaa gcttcacctt tactcattga ttttgtgtcc    293700
     gtaattttat agctttctag tacaaacgtg ccatcatgcc cgaacggttc acctataacg    293760
     ctcgctttcg caaatattgc cttcctttgt gccggtgatg ctaaattatc attttgttgt    293820
     gattgttttg tttgttgctg actattacta ttttgattgt aattattaga tttataactg    293880
     ttattctttg ggtatttgct aggggaactt tgaatatttc catctttatc ttcatcagac    293940
     acaatcccaa aaacagctgc tataacataa cgttttgcat atgtgatggt cccaccagct    294000
     tcttgcgcgc tactcatttt cttattggta attactgtca tgtatagtgg atcgtattca    294060
     atccattcac cagattcatg cattaacatt gttccaatac ctatcgttcc gttatcacca    294120
     ctaatgggcc attgtgtaaa ggagactcca tgaccaggag caactttaaa tattgcttcc    294180
     acaatcttat cgagtggtgt atatttgcta tctgtaaaag gattagccgc agatttttct    294240
     aacggcttta cttctttttg aatagccgcc atggctttcg ctatagcccc aatactttca    294300
     gattttttca ttctaattac ctcaccctca atgattcggt ttgtactaat ttagcgcccg    294360
     gtacgtctct tccttctttt agagcgcttg taatagcttt cttatctaat tttttaggtt    294420
     gctctactaa aaacatgaat agtttttctt cgtcctctaa acgcaagcta ggagggttct    294480
     tctgaatgct aatagtaaat agtgagcttt taattttacg gatatccact tttaacattt    294540
     cgctctctaa atactctttc atgtttttag cttttgcatc taacgctgtt ttacgcttcg    294600
     ttaacctctc tacttcctta gctaatccct cagcctcagc atcaatgctt tttaccattt    294660
     ttataatatt ctctgccttt tcttctatcg gctctctaat gctatctaaa gtgtcttgta    294720
     gcgtttctgt gtctaattcc tccgccattt ctaaaacttg attgtatgct tgagtcaatt    294780
     cgtataattt catgcttgca cgccttctct ctgctcaatt tttttagcta gtttttcatg    294840
     tatatcaatt aattcatcaa atagtttaga tccttctaag ttagttgatt gcttctttag    294900
     taagttataa agcggtgtta attcatcgtc ataatcatgt atcacgactt taaagccata    294960
     atgaatcgtt ttaaaattat ccatgttatc cctccattga ttaaatttcg gatttaaggt    295020
     ataatttctt taaggtaata tctcaaatcc                                     295050
//

If you have problems or comments...

PBIL Back to PBIL home page