(data stored in ACNUC7421 zone)

EMBL: AL591985

ID   AL591985; SV 1; circular; genomic DNA; STD; PRO; 1683333 BP.
XX
AC   AL591985; AL603642-AL603647;
XX
PR   Project:PRJNA19;
XX
DT   23-JUN-2004 (Rel. 80, Created)
DT   07-MAR-2015 (Rel. 124, Last updated, Version 7)
XX
DE   Sinorhizobium meliloti 1021 plasmid pSymB
XX
KW   complete genome.
XX
OS   Sinorhizobium meliloti 1021
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Sinorhizobium/Ensifer group; Sinorhizobium.
OG   Plasmid pSymB
XX
RN   [1]
RP   1-1683333
RG   The MELILO EU Consortium
RA   Weidner S.;
RT   ;
RL   Submitted (07-JUN-2001) to the INSDC.
RL   Weidner S., Universitaet Bielefeld, Biologie IV (Genetik) Universitaetstr
RL   25, D-33615 Bielefeld, Germany. Submitted (07-JUN-2001) to the
RL   EMBL/GenBank/DDBJ databases.
XX
RN   [2]
RX   DOI; 10.1073/pnas.161294698.
RX   PUBMED; 11481431.
RA   Finan T.M., Weidner S., Wong K., Buhrmester J., Chain P., Vorholter F.J.,
RA   Hernandez-Lucas I., Becker A., Cowie A., Gouzy J., Golding B., Puhler A.;
RT   "The complete sequence of the 1,683-kb pSymB megaplasmid from the N2-fixing
RT   endosymbiont Sinorhizobium meliloti";
RL   Proc. Natl. Acad. Sci. U.S.A. 98(17):9889-9894(2001).
XX
DR   MD5; e23b0f8473c3de2cb263e8f30bbb95f2.
DR   BioSample; SAMEA3283068.
DR   EnsemblGenomes-Gn; EBG00001178151.
DR   EnsemblGenomes-Gn; EBG00001178152.
DR   EnsemblGenomes-Gn; EBG00001178153.
DR   EnsemblGenomes-Gn; EBG00001178154.
DR   EnsemblGenomes-Gn; EBG00001178155.
DR   EnsemblGenomes-Gn; EBG00001178156.
DR   EnsemblGenomes-Gn; SM_b21712.
DR   EnsemblGenomes-Tr; EBT00001756477.
DR   EnsemblGenomes-Tr; EBT00001756478.
DR   EnsemblGenomes-Tr; EBT00001756479.
DR   EnsemblGenomes-Tr; EBT00001756480.
DR   EnsemblGenomes-Tr; EBT00001756481.
DR   EnsemblGenomes-Tr; EBT00001756482.
DR   EnsemblGenomes-Tr; SM_b21712-1.
DR   EuropePMC; PMC2266912; 18226217.
DR   EuropePMC; PMC2493264; 18515420.
DR   EuropePMC; PMC2656595; 19103235.
DR   EuropePMC; PMC2893487; 20418433.
DR   EuropePMC; PMC3553834; 23123907.
DR   EuropePMC; PMC3622305; 23431003.
DR   EuropePMC; PMC3957732; 24600043.
DR   EuropePMC; PMC4914127; 27190233.
DR   EuropePMC; PMC5739047; 29220487.
DR   EuropePMC; PMC6328680; 30643907.
DR   GOA; P35474.
DR   InterPro; IPR018369; Chaprnonin_Cpn10_CS.
DR   InterPro; IPR037124; Chaperonin_GroES_sf.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00489; ctRNA_p42d.
DR   RFAM; RF00490; S-element.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   StrainInfo; 115196; 0.
DR   UniProtKB/Swiss-Prot; P35474; CH105_RHIME.
XX
CC   MELILO EU Consortium:
CC   Laboratoire de Biologie Moleculaire des Relations
CC   Plantes-Microorganismes, UMR215-CNRS-INRA, BP27, F-31326 Castanet,
CC   France, Laboratoire de Genetique et Developpement UMR6061-CNRS,
CC   Faculte de Medecine, 2 avenue du Pr. Leon Bernard, F-35043 Rennes,
CC   France, GATC GmbH, Fritz-Arnold-str. 23, D-78467 Konstanz, Germany,
CC   Universitaet Bielefeld, Biologie IV (Genetik) Universitaetstr 25,
CC   D-33615 Bielefeld, Germany, Unite de Biochimie physiologique,
CC   Universite Catholique de Louvain, Place Croix du Sud 2, Bte 20,
CC   B-1348 Louvain-la-Neuve, Belgium, Unite de Microbiologie, Faculte des
CC   Sciences Agronomiques de Gembloux, Avenue Marechal Juin 6, B-5030
CC   Gembloux, Belgium.  E-mail:Anke.Becker@genetik.uni-bielefeld.de
CC   http://sequence.toulouse.inra.fr/meliloti.html
CC
CC   join(AL591985 AL603642 AL603643 AL603644 AL603645 AL603646 AL603647)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1683333
FT                   /organism="Sinorhizobium meliloti 1021"
FT                   /plasmid="pSymB"
FT                   /strain="1021"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:266834"
FT   CDS_pept        1..1275
FT                   /transl_table=11
FT                   /gene="lacE"
FT                   /locus_tag="SM_b21652"
FT                   /old_locus_tag="SMb21652"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21652"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48401"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q926I0"
FT                   /protein_id="CAC48401.1"
FT                   /translation="MDIQTRAYLPRIAGLALAGASFLGVTAAQAKEITIWCWDPNFNVA
FT                   IMKEAGARYTKTHPDVTFNIVDFAKLDVEQKLQTGLSSGTADALPDIVLIEDYGAQKYL
FT                   QSFPGAFAPLSGTVDYSGFAPYKVELMTLDGQVYGMPFDSGVTGLYYRKDYLEAAGFKP
FT                   EDMQDLTWDRFIEIGKQVEEKTGKKMMGLDPNDAGLVRIIMQSAGQWYFDKEGKPNIAG
FT                   NAALKAALETIGKIMQANIYKPANGWSDWVGTFTSGDVATVVTGVWITGTVKAQPDQSG
FT                   NWGVAPIPALSIEGATHASNLGGSSWYVLESSEEKAEAIDFLNEIYAKDIDFYQKILQD
FT                   RGAVGSLLAARGGAAYEAADPFFGGEKVWQNFSDWLAKVPSVNYGIFTNEADLAVTAQL
FT                   PAVTQGTPVDEVLQAIEAEVSAQIQ"
FT   CDS_pept        1369..2265
FT                   /transl_table=11
FT                   /gene="lacF"
FT                   /locus_tag="SM_b21653"
FT                   /old_locus_tag="SMb21653"
FT                   /product="ABC transporter, permease"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21653"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48402"
FT                   /db_xref="GOA:Q92XF9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XF9"
FT                   /protein_id="CAC48402.1"
FT                   /translation="MVRARRGIGRYYDVNGWLFVAPALGLITLFMVYPIAWSLWMSFQS
FT                   GRGMTLKFAGFANIVRLWNDPVFIKALTNTMTYFVVQVPIMILLALILASLLNNPRLVG
FT                   RGVFRTAIFLPCVSSLVAYSVLFKGMFATDGIVNSTLQAIGLAASPIPWLTHPFWAKVL
FT                   VILAITWRWTGYNMIFYLAALQNIDKSIYEVARIDGVPAWARLTHLTIPLLKPVILFTT
FT                   VISTIGTLQLFDEVYNLTEGKGGPSNATLTLSLYIYNLTFRFMPNLGYAATVSYVIVVL
FT                   VALLAFVQFFAARERDR"
FT   CDS_pept        2262..3080
FT                   /transl_table=11
FT                   /gene="lacG"
FT                   /locus_tag="SM_b21654"
FT                   /old_locus_tag="SMb21654"
FT                   /product="ABC transporter, permease"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21654"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48403"
FT                   /db_xref="GOA:Q92XF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XF8"
FT                   /protein_id="CAC48403.1"
FT                   /translation="MNGFGRFAAMAATYGFLGLMAFLSVFPFIWMVLGATNSSIDIIKG
FT                   KLLPGAAFATNVANFFTLVNVPLVFWNSAKIAIVATVLTLAVSSLAGYGFEMFRSRRRE
FT                   RVYRAMLLTLMIPFAALMIPLFVMMGKAGLINTHLAVVLPSIGSAFVIFYFRQSTKAFP
FT                   SELRDAAKVDGLKEWQIFLFIYVPVMRSTYAAAFVIVFMTAWNNYLWPLIVLQTNETKT
FT                   ITLVISSLASAYYPDYGVVMVGTILATLPTLAVFFFMQRQFVQGMLGSVK"
FT   CDS_pept        3086..5353
FT                   /transl_table=11
FT                   /gene="lacZ1"
FT                   /locus_tag="SM_b21655"
FT                   /old_locus_tag="SMb21655"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21655"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48404"
FT                   /db_xref="GOA:Q92XF7"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR040605"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XF7"
FT                   /protein_id="CAC48404.1"
FT                   /translation="MMRSVTSFNDSWVFSEGFDAADAGTLRAGQPISLPHNAVELPFNY
FT                   FDERCYQRAFTYQRVLAWRPDFSGREVSLVFDAAMADAVVYLNGEEIVAHRDGYTPFEA
FT                   RLTDRLLEGDNLITVKIDGSENPEIPPFGGRIDYLTYAGIYRDVWLKVTDPVSIANIKI
FT                   ETRDVLSDTKAVSLRCDLSNPQGLSFSGTISALLKNAAGEVLAEVAGETTGQSLAFEMD
FT                   GLKGLSLWDIDDPVLYVIEVELRTGQGSDCFAAHFGFRTAEFTTEGFRLNGRPLKIRGL
FT                   NRHQSFPYVGYAMGRTAQERDADIMKHRLHCNLVRTSHYPQSKWFLDHCDRIGLLVFEE
FT                   IPGWQHIGGEEWKQEAIRNVRRMIERDWNHPSIVIWGVRINESQDSHDFYAETNRLARE
FT                   LDPTRQTGGVRYITDSEFLEDVYTMNDFILGNEELPGANRPRTALRPQQECTGLPRKVP
FT                   YLITEFGGHMYPTKIYDQEQRQAEHVRRHLEVLNAAYGDPGISGAIGWCMFDYNTHKDF
FT                   GSGDRICYHGVMDMFREPKFAAYVYASQCDPSEEIVMKPVTFWARGERNIGGVLPLIVL
FT                   TNCDEIELKYGSLTKRVGPDRENFPHLPHPPVVIDHRHFTKDELGVWGMKWESAEFTGF
FT                   IAGKPVADLRMAADPVPTTLQVEADSKTLRAEGRDSVRLILRALDQAGNVQPFLNDAVD
FT                   IEIHGPARLVGPARIVLQGGSAGFWLESTGAAGAIVVSVASSRLGAAKLDLVALADGAA
FT                   SA"
FT   CDS_pept        5350..6426
FT                   /transl_table=11
FT                   /gene="lacK1"
FT                   /locus_tag="SM_b20002"
FT                   /old_locus_tag="SMb20002"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20002"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48405"
FT                   /db_xref="GOA:Q92XF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XF6"
FT                   /protein_id="CAC48405.1"
FT                   /translation="MSELQLSDVRKSYGGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEEISSGDLTIDDVRMNDVDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAG
FT                   VPRAEIEKRVNEAAHILELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSN
FT                   LDAELRVHMRIEIARLHKQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLY
FT                   DDPANLFVAGFIGSPKMNFLKGVIEIDEDQAYARLPDYGDAKIPVTLQAAAGTAVTIGI
FT                   RPEHFDEAGPAALDLAIDMLEHLGGETFAYARHHGNGELIVVETKNGRGLKTGDRLTAR
FT                   FDPVSVLVFDGEGKRLRS"
FT   CDS_pept        6485..7261
FT                   /transl_table=11
FT                   /locus_tag="SM_b20003"
FT                   /old_locus_tag="SMb20003"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /function="L-proline + NAD(P)+ = 1-pyrroline-5-carboxylate
FT                   + NAD(P)H + H+"
FT                   /EC_number="1.5.1.2"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20003"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48406"
FT                   /db_xref="GOA:Q92XF5"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XF5"
FT                   /protein_id="CAC48406.1"
FT                   /translation="MRIGFIGTGAITEAMVTGIVGSGLDVAGILVSPRNREIAARLAGR
FT                   FPLVRIVKDNQQAVDAADVLFLAVRPQIAEDVIPKLKFRKGQKIVSVIAATDRSTLLGW
FT                   IGEEVELTQAIPLPFVAEREGVTAIYPPNRAVAAIFAALGTAVECETREEYDLLAVGSA
FT                   LMATYLGILDRTTAWFAEKGLHRDKARAYIAPLFASLAQRAVRDEGTPLEELAREFSTK
FT                   GGLNEQVLTDFDRGGGHGALTDALERVLLRVRGDDR"
FT   CDS_pept        complement(7268..8173)
FT                   /transl_table=11
FT                   /gene="gstR"
FT                   /locus_tag="SM_b20004"
FT                   /old_locus_tag="SMb20004"
FT                   /product="putative gstR-like transcriptional regulator
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20004"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48407"
FT                   /db_xref="GOA:Q92XF4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XF4"
FT                   /protein_id="CAC48407.1"
FT                   /translation="MDRWQAMRIFVQVVESGGFAPAAKVLHMSPPSVTRAVAKLEDLIG
FT                   TRLLVRTTRSLKLTAAGEGYVADCRRILGEIAEAEANAAGSFTAPAGLLTVTAPALFGR
FT                   IHVLPVILDFLDHYPAMQVKTIFVDRVTNLVDEGLDVAIRIASLPASGLVARRIGSVRQ
FT                   VLCGSPDYFARFGDPGSPQELARHRIIGREGLFGHSEWLFGRDNNIRVPISPRLICNTN
FT                   DAVLAAAVAGWGLSRFQSYQVAPDVSAGRLKVVLADYEREPVPIHIVHAEGRIVSARVR
FT                   AFVDFAAGRFRRHAGLRTEL"
FT   CDS_pept        8289..8900
FT                   /transl_table=11
FT                   /gene="gst15"
FT                   /locus_tag="SM_b20005"
FT                   /old_locus_tag="SMb20005"
FT                   /product="putative glutathione S-transferase protein"
FT                   /EC_number="2.5.1.18"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20005"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48408"
FT                   /db_xref="GOA:Q92XF3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XF3"
FT                   /protein_id="CAC48408.1"
FT                   /translation="MKLYHHPLSGHAHRARLFLSLLGIEHELVVVDFARREHKQADFLK
FT                   LNSFGQVPVLDDAGTIISDSNAILVYLAKKTGRPDWLPEDAVGAAAVQRWLSVAAGQIA
FT                   HGPAQARLINVFKAPYRPEEVIPRSHAILALIEQELEGRGWIAADRPTIADVALYSYVA
FT                   RAPEGDVDLQPYPEIRAWLARIEALPGFVEFEKTPVGLAA"
FT   CDS_pept        9086..10039
FT                   /transl_table=11
FT                   /locus_tag="SM_b20006"
FT                   /old_locus_tag="SMb20006"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20006"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48409"
FT                   /db_xref="GOA:Q92XF2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XF2"
FT                   /protein_id="CAC48409.1"
FT                   /translation="MPNIHATKGTIVMEAPILAHSPWHEGEIALQKRLGVETRMDEVGR
FT                   RVMRDHLIDQHREFYPLLPMVVLGSVDRDGDAWATLRAGEPGFLHAPDQKRLTVELPRE
FT                   PTDPAEAGMEDGAPLALLGIDLGTRRRNRLNGTLKRHAGGFDLGVDQSFGNCPKYIQLR
FT                   QVRFVRDPSEPPAAPPVSSFGLDAAARALVAQADTFFVATYADLAGGRQLDVSHRGGPA
FT                   GFVRAGGDGWLTIPDFVGNRFFNTLGNIAVNPRAGLTFPDFSTGGLLQMSGEAELLSEA
FT                   PNGVPPDGAERYWRFRPRRIVWRADALPIRYELKSS"
FT   CDS_pept        10154..12271
FT                   /transl_table=11
FT                   /gene="katC"
FT                   /locus_tag="SM_b20007"
FT                   /old_locus_tag="SMb20007"
FT                   /product="KatC"
FT                   /function="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="catalase,, PMID: 15449959"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20007"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48410"
FT                   /db_xref="GOA:Q9X576"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X576"
FT                   /protein_id="CAC48410.1"
FT                   /translation="MAKKPSAPNNTKPATIHDQKATRGNGGELHQIAEGDTPVLTTAQG
FT                   GPVADDQNSLRAGERGPTLIEDFHFREKIFHFDHERIPERVVHARGYGVHGFFETYESL
FT                   AAYTRADLFQRPGERTPAFVRFSTVAGSKGSFDLARDVRGFAVKIYTKEGNWDLVGNNI
FT                   PVFFIQDAIKFPDVIHSVKPEPDREFPQAQSAHDNFWDFISLTPESMHMIMWVMSDRAI
FT                   PRSFRFMEGFGVHTFRFVNAKDESTFVKFHWKPKLGLQSVVWNEAVKINGADPDFHRRD
FT                   MWQAIQSGNFPEWDLHVQLFDQDFADKFDFDILDPTKIIPEEVLPTKPVGRLVLDRMPE
FT                   NFFAETEQVAFMTQNVPPGIDFSDDPLLQGRNFSYLDTQLKRLGSPNFTHLPINAPKCP
FT                   FQHFQQDGHMAMRNPVGRVNYQPNSWGEGPRESPMKGFRHFPSEEQGPKLRIRAESFAD
FT                   HYSQARQFFISQTPPEQRHIADALTFELSKVETPVIRERMVAHLLNIDETLGKKVGHAL
FT                   GLETMPKPADAAVATRQDLDPSPALSIIQRGPKRFEGRKLGILATDGADGALLDALIAA
FT                   VEKEKAAFELIAPKVGGFTASDGKRIAAHQMLDGGPSVLYDAVVLLPSAEAVTDLIDVA
FT                   TARDFVADAFAHCKYIGYAGAAVPLLERAGIAELLDEGTIELTDAASAAAFLTEIGKLR
FT                   VWGREPSVKLK"
FT   CDS_pept        12297..13364
FT                   /transl_table=11
FT                   /locus_tag="SM_b20008"
FT                   /old_locus_tag="SMb20008"
FT                   /product="DNA ligase (ATP)"
FT                   /function="ATP + (deoxyribonucleotide)n +
FT                   (deoxyribonucleotide)m = AMP + diphosphate +
FT                   (deoxyribonucleotide)n+m"
FT                   /EC_number="6.5.1.1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20008"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48411"
FT                   /db_xref="GOA:Q92XF1"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XF1"
FT                   /protein_id="CAC48411.1"
FT                   /translation="MASSAHGKPTKKAAPSSAAKKAGGFPLPVSTAPMEARSATELPGG
FT                   DAWQYEPKWDGFRCLAFKSGDEVDIRAKSGKPLGRFFPEIVALLRRLEPDMFVLDGELV
FT                   IEVDGRLSFDALQMRLHPAASRVQKLSQETPAKLILFDMLAGTDGTILTGEPLQTRRAC
FT                   LEAFAKKNAVAEMLESSPFTLDIKEAERWLTSWEAGATDGVVAKRRDGVYECGERAMVK
FT                   VKRLKTADCVVGGFRYESDSSLVGSLLLGLYDTEGLLNHVGFTATISDKERPALTNQLE
FT                   ALREPPGFTGKAPGGPSRWSSERSGEWEPVRPELVVEVRFDHVSNRRFRHGTKLMRWRP
FT                   DKDPRQCTYQQIMPS"
FT   CDS_pept        complement(13351..14280)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20009"
FT                   /old_locus_tag="SMb20009"
FT                   /product="Putative transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="HTH lysR-type regulator family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20009"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48412"
FT                   /db_xref="GOA:Q92XF0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XF0"
FT                   /protein_id="CAC48412.1"
FT                   /translation="MELRHLRHFVAVAETLHMGRAAQRLGMAQPPLSQSIARLERELGV
FT                   KLFERAHRRLALTRAGASLLPEARRTLQDAEAARAVARGAGTGTAGDVRIGFVSAALYE
FT                   LLPSLVVSLRQEFPMIRPVLTEMATNEQVAALAEGTIDFGICHPPLGSSERLDIIPVAD
FT                   ETLIAAIPEDGRTGPVTIAELARMGLVLFPAAQGPSLHASILNAFAEAGHDVSIQQPAT
FT                   RALTMLSLVAAGVGAALLPRSTERISFKGVRFAPIKGLQLPALPVAAIARRRPRPLIVD
FT                   TVLGVFNHSLEAGTGEENRLGANKLTTA"
FT   CDS_pept        14375..15442
FT                   /transl_table=11
FT                   /locus_tag="SM_b20010"
FT                   /old_locus_tag="SMb20010"
FT                   /product="hypothetical protein"
FT                   /function="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /note="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20010"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48413"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XE9"
FT                   /protein_id="CAC48413.1"
FT                   /translation="MTRLNAIFLALISTVFAAPVFAGDDQLVRTDRFVTLAGGERLFVR
FT                   EVRPAERQQAASAVLLIHGARVPSVASFDLAVPGGSIAAELAAEGHSVYLVDLRGYGAS
FT                   SRPHEMDAPPGGGTPLMRTDEAVSDIAAAVEAVAEWSGDGKVSILGWATGGQWAAAFAA
FT                   RHSARVERLILYNSLYGASDRHPTLGRGSPLEAPDRPGSLNMAALGAYRLNTAESLFAA
FT                   WDKSIPVPDKSEWRDPAVARAYADMALSSDPTSGERTPPSFRSPSGAMADSFELAFGRK
FT                   QWSAAALTMPVLVIRSQHDFWSRPEDAAAIAREAPQASLVELPHATHFVHLDRSETGRS
FT                   AFLSAVTQFLEQAAR"
FT   CDS_pept        15669..16448
FT                   /transl_table=11
FT                   /locus_tag="SM_b20011"
FT                   /old_locus_tag="SMb20011"
FT                   /product="putative heavy-metal transporter"
FT                   /function="Predicted divalent heavy-metal cations
FT                   transporter"
FT                   /note="putative divalent cation transporter"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20011"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48414"
FT                   /db_xref="GOA:Q92XE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XE8"
FT                   /protein_id="CAC48414.1"
FT                   /translation="MNNDLLIILGIAAAAAVASPLGGLVAISLRPSSLVLSIAVGFAAG
FT                   VLMGTFAFEMMPTSMELAGLPLAVAGFLLGLGLVYILDLYVNRWKMAGPEADQKAEVDR
FT                   LHRRRRPRGSNVAVLAGGTSAEELIEGMTIGVGATFEPEVALIVGLAICIDNFSEGMSI
FT                   GELTLDEERKNAKRRTLGWTSLIGLSLFVSAVAGWFLLKGLAQPVTGFLFATGAGGMFY
FT                   LTITDLVPEAESHQFQQSSAIANAAGFLLVMVLAQMS"
FT   CDS_pept        complement(16480..19023)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20012"
FT                   /old_locus_tag="SMb20012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20012"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48415"
FT                   /db_xref="GOA:Q92XE7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XE7"
FT                   /protein_id="CAC48415.1"
FT                   /translation="MPKDANQPTVLITGSSGFLGQAIAHRLRDRYRVIGLDLSPPKGES
FT                   ETEETIKLDITSDESVREAIETAGKRSGGRLASVIHLAAYYDTTGKDNPKYGAVNVEGT
FT                   RRLLEALQGLPTEQFIYASTLLVQAPSPAKGARINEDDPLDPAWAYPKSKAETEAGIAK
FT                   HRGAIRTATLRLAGVYDEDCRAAFIAQQIARIFERLPTAYLFSGDLDAGQPYLHKDDLV
FT                   EAFARTVGHRNELPDDCVFLIGEEETLSYGDLQKRIGRLIHGEDWRTLALPKSLAKPGA
FT                   WMQTEVLDEESEIKPWMIENSDDHYEIDISRARKKLGWEPRHSLAATLPEMIRRLKQDP
FT                   TAWYAKNKLEPSVVAASDPEIEQAEKRLAEPLERSDAEVEVAVEEHRLRTLWAPLANVA
FT                   LGLWLVSSPATLGLFDPVGVPLPPALGHEIAEPAIRNARLGISEILSGLLVAAFALFGM
FT                   YRRWSHAQWITAALGVWIMLAPLVFWTTSAAAYAVDTLAGMLIVAFAVMIPPTPGIRLR
FT                   ALAADDDRPLGWSYSPSSFTQRMPIVALAFVGLFVSRYLAAYQMGHVDGLWDPFFGPGE
FT                   APVRNGSEAVVTSWVSKGFPIADAGLGAFAYALDILAGAIGDSRRWRTMPWMVLLFGLL
FT                   IVPLGAVSVSFIIIQPPLIGALCTLCIIQAAVTVVLIPYSIDEVLATIQYLWRVRKAGE
FT                   PFWRTFWMGGPAISEDQTPAPDLNRPASELLKEFIVGGVNFPWTLVASALLGAVLMTTP
FT                   IVFGSVPPLYHSDHILGCVVILVAVTAMAEVVRPVRFLNVLLGAWVAASPFLLAGGSTV
FT                   ATVANLAIGLALIALSLPRGTRSEEHYGGWDRAIV"
FT   CDS_pept        complement(19079..20323)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20013"
FT                   /old_locus_tag="SMb20013"
FT                   /product="putative oxidoreductase"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /EC_number="1.-.-.-"
FT                   /note="putative oxidoreductase family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20013"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48416"
FT                   /db_xref="GOA:Q92XE6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XE6"
FT                   /protein_id="CAC48416.1"
FT                   /translation="MTTLPKQTLRVGFVGTGFIAHFHLKSLIGVRNVEVTGVYSRNPEN
FT                   RARFVSEVEALDLGECRAHESLESLLSAGDVDAVWILSPNYTRLDVMRTLHREIKAGRG
FT                   KIFAVACEKPLARTVAEAREMLHLAEDAGLNHGYLENQVFCTPVLRGKEIIWRRAASTT
FT                   GRPYLARAAEEHAGPHEPWFWQGDKQGGGVLSDMMCHSVEVARHLLTAPGAPRNSLKVK
FT                   SVNGTVANLKWTRAGYADELRRRFGEDVDYRRRPSEDFARATAALEDEEGNELMIEATT
FT                   SWAYVGAGLRIQLELLGPEYALEYNSLGTGLKIFLSRAVQGTEGEDLVEKQNAEQGLMP
FT                   VLEDEAGVYGYTDENRHMVECFRKGIKPLETFEDGLAVVEILMGLYRSAEIGATLHFPA
FT                   PELEDYVPVVARTGA"
FT   CDS_pept        complement(20377..21378)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20014"
FT                   /old_locus_tag="SMb20014"
FT                   /product="probable transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="probable HTH lacI-type transcriptional regulator
FT                   family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20014"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48417"
FT                   /db_xref="GOA:Q92XE5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XE5"
FT                   /protein_id="CAC48417.1"
FT                   /translation="MRDRPKIKDIAEKAGVSVATVSRALAASTLVTAETRQRVLDLARE
FT                   LDYRPNVSARNLRTRRSMTVLMVVRDVGNPFYLDILKGVEATAREAGYAVLMGNTENDP
FT                   ARETEYFSMLRDGHADGMILMTGKLPSAGDWNHLPVVVALEMIEGSGLPHVQVDNVAAA
FT                   RGAVQHLISLGHRRIAHISGPVPEPMSVYRREGFRLAMRDAGLTIPAGYEVRGDFLIES
FT                   GEECCRSLFSLSDPPTALFVANDEMAYGAVHELRRIGRDVPGDVSVVGFDDLYLSKAFY
FT                   PPLTTVGQPRSEIGRTAMAVLLGILAGGSEVAEPIVLPTVLKVRGSTAPPLI"
FT   CDS_pept        complement(21392..22348)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20015"
FT                   /old_locus_tag="SMb20015"
FT                   /product="putative sugar ABC transporter"
FT                   /function="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /note="putative inner-membrane transport system, permease
FT                   component"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20015"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48418"
FT                   /db_xref="GOA:Q92XE4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XE4"
FT                   /protein_id="CAC48418.1"
FT                   /translation="MSRVVSFVRQPIVVALVLIVLLLYLGEALSPGFATGGQILRLLIV
FT                   ASLLGIVAAGQNVVILGGREGIDLSVGGVVSLSAILAGNVMNGADGGILPAVAACLAAG
FT                   AFFGLLNGLGVTLLRIPPLVMTLGMLGVLQGLLVVIRMGIPSGQAAPALSRFVTQPLAY
FT                   GIPGIIWLWIVIGILLALMLNRTVFGHRIYAIGSNEHAAYMAGVPVKLVRIALFMISGM
FT                   FAATAGLCLLGYSGTSFANVGEQYMLPSIIAVVFGGTSLAGGKGGYTGTMAGAVLLVIL
FT                   QSILTTINIEESGRQMVFGATLLLLMMFYGRGRAMRA"
FT   CDS_pept        complement(22345..23337)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20016"
FT                   /old_locus_tag="SMb20016"
FT                   /product="putative sugar ABC transporter"
FT                   /function="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /note="putative inner-membrane transport system, permease
FT                   component"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20016"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48419"
FT                   /db_xref="GOA:Q92XE3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XE3"
FT                   /protein_id="CAC48419.1"
FT                   /translation="MAETATVPTYRRAGGIGRLLERYPFLPALVIVAALLLLNGFFSPN
FT                   SLTFRALTGLLSTYMALILLAIAQTYVVYAGDIDLSAGAILSLVNVAIVVLMERWGGGA
FT                   GAVFLALAIGLLLGLACGLVNGLVVAALRLQAIVATFATSIFFTGLALYILPVAGTPAP
FT                   ALFWRTYGGRLFGVPFVFYILAALVILLAVMSRTRLVTQLLAVGDDQQAAYQTGLPVIA
FT                   TRIKGYVLCGLFSALAAFCITGDTASGDPLVGGKMTLYSVAAVVLGGSALSGGWGTVVG
FT                   SLLGALTIGLINSVVFFMGTPSEWQNFVQGLAILLVLMAGVLAGRRARS"
FT   CDS_pept        complement(23337..24842)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20017"
FT                   /old_locus_tag="SMb20017"
FT                   /product="putative sugar ABC transporter ATP-binding
FT                   protein ABC TRANSPORTER"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20017"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48420"
FT                   /db_xref="GOA:Q92XE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XE2"
FT                   /protein_id="CAC48420.1"
FT                   /translation="MSKLKLSGVSKAYGATLALRRGDLELMAGEVHVLMGSNGSGKSTL
FT                   CKIIAGSVRPDGGKIFVDDQPVTISGPRSARSHGIGIFYQELSLAARRSVEENISLGKL
FT                   PVKSRVFIDRSELRQRAARYIGLFDGVCGEGFSADTLVGNLRPDQRQLVEIMKALASEA
FT                   PLLIFDEPTSALDRAQVERFFEILRDLKRRGRGIIFISHRMDEIKAIGDRVTIIRDGET
FT                   ITTLNLGETDPATVIRLMVGGAGDMPASQSSVPAVVEGEGGTALTVRDLSGRGFRNVSF
FT                   EVGRGEILGFGGLHGQGQSAVLRAIFGAGSIASGEILIGDSRFDASNPRDAIRRGCAYV
FT                   SGDRSRDGVISGRPIIENVTPIHYLRDRLMIARPGKLRAKVAPALDSMHTKFASLFHPM
FT                   GSLSGGNQQKVIIARWLIDRPDVLLLDDPTKGIDLSAKADLFALIRRLAAEGLGIVLYS
FT                   SEDAELLGNANRILVFNGGSVSRELTGADRTRYNLYQAAYEAA"
FT   CDS_pept        complement(25092..26114)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20018"
FT                   /old_locus_tag="SMb20018"
FT                   /product="probable sugar transport ATP-binding protein"
FT                   /function="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="Conserved hypothetical protein"
FT                   /note="probable sugar transport ATP-binding
FT                   protein,putative ribose"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20018"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48421"
FT                   /db_xref="GOA:Q92XE1"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XE1"
FT                   /protein_id="CAC48421.1"
FT                   /translation="MKKFFAFALGTVASIVLSASAHAETFKIGLSNGWVGSEWRTQMID
FT                   EAKAAAAEWKEKGVDVEVSVQSANVDVPGQIAHIRNFIAEGVNAIIVNPNSPTAFDPIF
FT                   AQAKEAGILVIATDAEVSSPDAIYVGIDQTAWGAAGAKWLAETLGGKGKVVAINGVAGH
FT                   PANEMRVAGYKSVFKDHADIQVVNEVNANWDQAQGQQAMQNILATYPDINGVLVQDGMA
FT                   AGAWKSIMDAGKAGQIAATGEIRKDFIDLWIKEKLNSGATVNPPGVMASALNVAVLMLQ
FT                   GKELKEPAKAGQYGNALYLPIPFIDSKNVAEAAKQLEGKPGYYSYTSSLSIEEAEALFK
FT                   "
FT   CDS_pept        complement(26206..27342)
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="SM_b20019"
FT                   /old_locus_tag="SMb20019"
FT                   /product="dihydrolipoyllysine-residue succinyltransferase"
FT                   /function="succinyl-CoA + enzyme N6-(dihydrolipoyl)lysine =
FT                   CoA + enzyme N6-(S-succinyldihydrolipoyl)lysine"
FT                   /EC_number="2.3.1.61"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20019"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48422"
FT                   /db_xref="GOA:Q92XE0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XE0"
FT                   /protein_id="CAC48422.1"
FT                   /translation="MGGFIDIQAPLEQEGTKAVVRNWLRKIGDPVKSGDPLVELETDKV
FT                   TQEVSAPADGVLAEILMRNGDDATPGAVLGRIGSEAAGAGHAPHYSPAVRHAAEEYGLD
FT                   PATVTGTGRGGRVTRADMDRAFTARQEGPASVAAEAGDRGAAPKSRRIPHSGMRAAIAE
FT                   HMLNSVTTAPHVTAVFEADFSAVMRHRDEHGKRLAADGTKLSYTAYVVSACVAAMRAVP
FT                   EVNSRWHEDALETFDDINIGVGISLGDKGLVVPVIHRAQDLSLAEIAARLQDLTTRARS
FT                   NALSRADVTGGTFTISNHGASGSLLAAPIIINQPQSAILGVGKLDKRVIVREVDGADTI
FT                   QIRPMAYVSLTIDHRALDGHQTNAWLTHFVRVIETWPK"
FT   CDS_pept        complement(27345..29423)
FT                   /transl_table=11
FT                   /gene="pdh"
FT                   /locus_tag="SM_b20020"
FT                   /old_locus_tag="SMb20020"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring)"
FT                   /function="pyruvate + [dihydrolipoyllysine-residue
FT                   acetyltransferase] lipoyllysine =
FT                   [dihydrolipoyllysine-residue acetyltransferase]
FT                   S-acetyldihydrolipoyllysine + CO2"
FT                   /EC_number="1.2.4.1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20020"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48423"
FT                   /db_xref="GOA:Q92XD9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XD9"
FT                   /protein_id="CAC48423.1"
FT                   /translation="MAQAALKKDRRNAPDESIDWKKVVQLLLLSRALDEMEEQRLVPEK
FT                   KILYQFSARGHDMAQILLGLHLTGRHDAACGYYRSRPLLLALGVDPADALGSAMGRAGG
FT                   YSDGRDIGVVFNYPNPHGASALPMCGGVGTQYTPTAGWAQAITYFSEVLGKEEYQKDIA
FT                   VVLGGDGSVASNGFWSALTIATTQGLPLLFYIEDNGFGISVPSSFQTPEGNIAGNLAGW
FT                   KNLTVLDGDGSDPEEAARLTKGAVELVREGRMPVLLRLEVPRLEGHSFQDTQTYKSEEL
FT                   VRSEWAHDPLPRLRDYIVPAMLSAEEWNEAARDAKAAAERARVEAESRPVADPETVTSH
FT                   VFFEGRMQVMGGQHPAGYRPPKTTETATGDGQRINMVTAIRRTLDHEMTVNQRVVLFGE
FT                   DIGPKGGVHAVTLGLQEKFGTARVFDTSLSEEGIIGRAVGMALAGLVPVPEIQFRKYAE
FT                   PAIEQLNDCGTIRWRTSNRFAAPIVVRMAGGFLKCGDPWHSQTNEVAFVHQPGWKIAVP
FT                   SNAEDAVGLLRTALRGNDPVIFFEHRAMLDHPWARRPYPGDAFALPFGKAKFTREGRDI
FT                   TIVTWGAMVPRCEEAAEGISADVIDLRTLMPWDRKAVIASVRRTRRCLIVHEDLATAGF
FT                   GAEIAAAVADEAFIDLDAPISRLTMPDIPSPHNPALLDWAVPSTERIRRKIIDLLEF"
FT   CDS_pept        29540..30010
FT                   /transl_table=11
FT                   /locus_tag="SM_b20021"
FT                   /old_locus_tag="SMb20021"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20021"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48424"
FT                   /db_xref="GOA:Q92XD8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XD8"
FT                   /protein_id="CAC48424.1"
FT                   /translation="MMNSFNLDAIDRKILGILQDRGDISHAALAEAVGASPASCWRRIK
FT                   ALETAGVLVKTVSLVNPDLVGRGLNVFCQVRMKSHDPVARRNFERFVESHEEVLECYSM
FT                   SGDWDYLLRVLVADVADYERLLMRGILTHEAVANSSSHFALKSVKYSTAVPV"
FT   repeat_region   complement(30049..30090)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   repeat_region   complement(30111..30160)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        30658..31224
FT                   /transl_table=11
FT                   /locus_tag="SM_b20022"
FT                   /old_locus_tag="SMb20022"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20022"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48425"
FT                   /db_xref="GOA:Q92XD7"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XD7"
FT                   /protein_id="CAC48425.1"
FT                   /translation="MTTVILFHSVYGLRPFERGVAERLTVAGHEVFTPDLYEGRVASSI
FT                   EEGFALKEEIGWSTLCERAERAVADLPADAVLGGFSMGAAVAASVWPKRPETAGILFLH
FT                   SIAEIPANARRGLPVQVHLADPDIFEPADEVAAWRADAERTPVALEVFIYPGAGHIYTD
FT                   ATLVDYDSEAARLTWSRVERCLAAL"
FT   CDS_pept        complement(31301..34918)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20023"
FT                   /old_locus_tag="SMb20023"
FT                   /product="probable 5-oxoprolinase"
FT                   /function="N-methylhydantoinase A/acetone carboxylase, beta
FT                   subunit"
FT                   /EC_number="3.5.2.9"
FT                   /note="Hydantoinase B/oxoprolinase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20023"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48426"
FT                   /db_xref="GOA:Q92XD6"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XD6"
FT                   /protein_id="CAC48426.1"
FT                   /translation="MSVTGAWDFWVDRGGTFTDVVGRDPAGALHALKVLSENPGAYRDA
FT                   AVHGIRQHLGLGTGEPVPAGMVGEVRMGTTVATNALLERKGERLALVTTRGFRDALRIG
FT                   YQERKKIFATEIIKPEALYSDIVELDERVLADGTIERPLDEAAARRALEGLKAAGYGAV
FT                   AIVLMHAYKYPAHEASVSKIARSIGFEQVSVSHEVSPLVKYVGRGDTTVIDAYLSPVLG
FT                   RYVAQVSEELDVARSGARLMFMMSSGGLTAAEMFQGKDAILSGPAGGVVGLARTGEAAG
FT                   FGRVIGFDMGGTSTDVAHFDGEYERAFETEVAGVRVRAPMMLIHTVAAGGGSVLHFDGE
FT                   RFRVGPDSAGANPGPACYRNGGPLAVTDANVMLGKLLPEHFPTIFGPEQNLPLDVETVR
FT                   ERFVALAAEIGDGRRPEDVADGFIRIAVANMVEAIKKISVSRGYDVTRYALNCFGGAGG
FT                   QHACLVADALGMKSILLHPMSGLLSAYGMGLADIRATRQKAFGVGLDDAAPEALAALGR
FT                   ELQSECLADLEAQGIARERIRTHLRAHIRYAGTDTVLPVEATFPDEDDQARLRREFEHL
FT                   HRRRFGFVAENKALVIDAVEVETVGGGAAEMEAEGLAVTAGHVVANRWTRFYSQGAFHD
FT                   APVALRSEIGPGRKLTGPAIIIEANQTIVVEDGWEAELTAKDHIVLRRIKALPERTAIG
FT                   TKADPVMLEIFNNLFMSIAEQMGVTLQNTAYSVNIKERLDFSCAVFDNKGNLVANAPHM
FT                   PVHLGSMDASVATAIRENPVIHPGDVFLINAPYNGGTHLPDLTVCTPVFDDEGREIRFW
FT                   VASRGHHADIGGISPGSMSPLATNIEEEGVYIDNFKLIDRGRFREEELERLLNGARYPV
FT                   RNILQNVNDLKAQVAANEKGVAELRKMIAQFGEDVVEAYMGHVQDNAAESVRRVLDRLP
FT                   DGEFSYEMDQGCRIAVKISIDRESREATVDFTGTSQQRPDNFNAPEPVTRAAVLYVFRV
FT                   LVEADIPMNAGCLRPIRIVIPQGTMLSPRYPAAVVAGNVEVSQAVTNCLFGAVEAQAAA
FT                   QGTMNNLTFGNADYQYYETICSGAPAGPGYDGADAVHTHMTNSRLTDPEILETRFPVVL
FT                   EDFHIRKGSGGRGKWSAGDGTQRTIRARERLDFAILSGHRRVRPFGLKGGGPGEPGRNF
FT                   VRRNDGRIEELPGSAHTVLEAGEAFTVVTPTGGGYGKAS"
FT   CDS_pept        34935..35897
FT                   /transl_table=11
FT                   /locus_tag="SM_b20024"
FT                   /old_locus_tag="SMb20024"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /function="16S rRNA uridine-516 pseudouridylate synthase
FT                   and related pseudouridylate synthases"
FT                   /EC_number="4.2.1.70"
FT                   /note="probable rluB gene, Ribosomal large subunit
FT                   pseudouridine synthase B , Pseudouridylate synthase, Uracil
FT                   hydrolyase, Pseudouridine synthase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20024"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48427"
FT                   /db_xref="GOA:Q92XD5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XD5"
FT                   /protein_id="CAC48427.1"
FT                   /translation="MLPAAFHGRFLWAGDDRQAREEEARHQRKGSRCLCRISGLAPPFM
FT                   SEEARSNSAETETVKQRRPTAKRRVGDEKAGELPGKRVTLARALSKLGYCSRTQAEKLI
FT                   AEGRVSVAGRKITDLSHWVDIEADRIAVDGTVIAAQARVYLMLNKPRGLVTTRDDPEGR
FT                   PTVFSCLDNVDVPSLSPVGRLDKASEGLLLFTNDTVLAQRLLDPETHLGKVYHVQVRGI
FT                   FGEAMAARMVEGVTEGGELLRALRVERLKGGDRNSWIEIELDEGRNRQIRRMLDVLGFE
FT                   CLRLLRVSIGEIRLGDLPKGASRPLTEAEALYLRRRTGL"
FT   CDS_pept        36147..37124
FT                   /transl_table=11
FT                   /locus_tag="SM_b20025"
FT                   /old_locus_tag="SMb20025"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20025"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48428"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XD4"
FT                   /protein_id="CAC48428.1"
FT                   /translation="MKILNALLGAATAVSLFAASASAQTYPERTITMVVPFSAGGPTDT
FT                   VARLVAESMSKDLGQQIIVENVGGAGGTLGAGRVAQADPDGYTLLLHHIGMATSATLYR
FT                   KLAYDTLNAFEYVGLVTEVPMTIVARKDFEPTDLKGLIEHVKANKDTVTVANAGIGAAS
FT                   HLCGMMFMSAIETPLTTVPYKGTGPAMTDLLGGQVDIMCDQTTNTTKQIQGGTIKAYAV
FT                   TSPQRLKIFPDLPTAEEAGLSGFQVGIWHGIYAPKGTPAEVTDRLSKSLQKALKDENVV
FT                   ARFGELGTEPSSEADATPAALKAKLESEIGRWKPVIEAAGQYAD"
FT   CDS_pept        37331..37792
FT                   /transl_table=11
FT                   /locus_tag="SM_b20026"
FT                   /old_locus_tag="SMb20026"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20026"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48429"
FT                   /db_xref="GOA:Q92XD3"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XD3"
FT                   /protein_id="CAC48429.1"
FT                   /translation="MKSISFDTTNALCGGILTAVGLFFAWQSLGLELGTAFRMGPGYFP
FT                   LVLSAVLILLGLIILIQSARVHSEPMGPIAIRGIFFILPAPIFFGLTVRGLGFVPSLFF
FT                   TALIACFASSRMKPLWAIALSLALTIFSVGVFSYGLNLPFERFGPWTRF"
FT   CDS_pept        37805..39310
FT                   /transl_table=11
FT                   /locus_tag="SM_b20027"
FT                   /old_locus_tag="SMb20027"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20027"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48430"
FT                   /db_xref="GOA:Q92XD2"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XD2"
FT                   /protein_id="CAC48430.1"
FT                   /translation="MELFSNLALGFATAASPANLLFCLIGVLLGTLIGVLPGIGATATI
FT                   AMLLPITFQLEPVSSLIMLAGIYYGAQYGGSTTAILINMPGESSSAVTAIDGYQMARKG
FT                   RAGTALAIAALGSFFAGTVSTFLVALFAPPLTEIALEFGAAEYFSLMIVGLVSSVALAH
FT                   GSVIKALAMVALGLLLGLVGTDIYTGTPRFTLGIREYSDGLNFVALAVGVFGIAEILRN
FT                   LESEKTREVLMAKVTDLMPTREDFRQMVAPVLRGTAIGSALGVLPGGGAILAAFASYTV
FT                   EKRLSDRPEEFGRGAVAGVAGPESANNAGAQTSFIPLLTLGIPANPVMALMIGAMIIQG
FT                   IVPGPNVAVEQPALFWGIIASMWIGNLMLVVLNLPLIGLWVKLLKIPYFVLFPIIMAFC
FT                   SIGVYSVNSNVYDLYAVAFFGLVGYLLLKLRCEPAPLLLGFVLGPLLEENLRRAMILSR
FT                   GDPTTFVTRPISATLLLIALAVLVVVFLPSVKKKREQVFVEED"
FT   CDS_pept        complement(39374..40510)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20028"
FT                   /old_locus_tag="SMb20028"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20028"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48431"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XD1"
FT                   /protein_id="CAC48431.1"
FT                   /translation="MRRRAEKFEVSGPTPFLCAGPLPVVIGRALAAVRDGEGTRAGITV
FT                   ALPSHSFGPYTPLAMEKTFVAAREERPGKAWLSRFAAGRTEAESWYFGRAERASGPSAR
FT                   ECREALWQYMPELVPHYEHACALVGDDEVAHRMLSHFRPAPDAYGCSQSVWLGEGGPAL
FT                   IRNFDYPPSIVSDRFEMTEWSGLKVIAKAQRPWGGCVDGMNEEGLAASITLGGGRSQGR
FT                   GFSIILVIRYVLETCHQVEQAVKALCRIPVALAQNVTVLDSAGNYATLFLGPGQRPIIT
FT                   RLRACANHQRAARPSSFSVARQQFILRALEDPSMSLEKLTDGFLRSPLYSVSATHPTLY
FT                   TAVYRPAKGRVDYIWPGKRWSQRFEDFQIGEYTHNFTH"
FT   CDS_pept        40950..41423
FT                   /transl_table=11
FT                   /locus_tag="SM_b20029"
FT                   /old_locus_tag="SMb20029"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="weak similarity to
FT                   pfam02627,CMD,Carboxymuconolactone decarboxylase family."
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20029"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48432"
FT                   /db_xref="GOA:Q92XD0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XD0"
FT                   /protein_id="CAC48432.1"
FT                   /translation="MTARLDPFAAAPSLMKSWFSISTAVASSLESSLIELVKIRASQIN
FT                   GCANCINMHTAEARAKGESEQRIYLLSAWREAPCYTDRERAALAWTETLTRLSEGHAHA
FT                   AAYEALKAEFTEEEQVKLTLMINIINGWNRLAVGFGLWVEPAAAKAIAEKAVA"
FT   CDS_pept        41423..42280
FT                   /transl_table=11
FT                   /gene="rpoE9"
FT                   /locus_tag="SM_b20030"
FT                   /old_locus_tag="SMb20030"
FT                   /product="RNA polymerase sigma factor, ECF subfamily
FT                   protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20030"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48433"
FT                   /db_xref="GOA:Q92XC9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XC9"
FT                   /protein_id="CAC48433.1"
FT                   /translation="MTQATQADAAASFDPLRPKLMRVAYRMLGSVADAEDMVQEAFIRW
FT                   MGADRAEVREPEAFLRRTVTRLCLDQLKSARRQRETYVGPWLPDPVVEEEEVEDVTLPL
FT                   MLALERLSPLERAAFLLHDVFGLGFEEVAATIQRDAAACRQLAARARTHVREARPRFHV
FT                   EKERGLELAEAFFKASRSGDMNAFGAMLAADVSIHADGGGKRSAAIMPIIGFDAVMKVH
FT                   EKLAALFRANGSKLLRVGFVNGLPGFITMEADGEIQTTALEIEGGKVAAIYVVRNPDKL
FT                   RHLH"
FT   CDS_pept        complement(42306..42554)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20031"
FT                   /old_locus_tag="SMb20031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20031"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48434"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XC8"
FT                   /protein_id="CAC48434.1"
FT                   /translation="MVDVIKGEILRKGRVTEPYSKDGHWRDPRPRLAAADGQIVITDPR
FT                   HSLIRVIDAETLKETRTIPIDGQPFAIVAVGGSGASH"
FT   CDS_pept        complement(42651..43385)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20032"
FT                   /old_locus_tag="SMb20032"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20032"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48435"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XC7"
FT                   /protein_id="CAC48435.1"
FT                   /translation="MRDGKELGRYDIKGYAALTVSASGQTVFAAQSEQDIVHIIKTGIG
FT                   FSDHGEHRDVEVSDAALLPVAIEGKRPAHVVPHDDHAIIFYDRGGKADIIDEAALLEGN
FT                   AQVRAIDTTKPHHGVAVSMGRHVLVSVPDTEIEPKPDELPPRVGLRVIDEKGGQIGEIS
FT                   KCTDLHGEATSARLVAFGCKEGVLVARPGGIDGPKLTMLPYPSDFPKGYTGTLLGGKAM
FT                   QFFLGNYGEDKVVLIDPDSSEP"
FT   CDS_pept        complement(43775..44437)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20033"
FT                   /old_locus_tag="SMb20033"
FT                   /product="hypothetical transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20033"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48436"
FT                   /db_xref="GOA:Q92XC6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XC6"
FT                   /protein_id="CAC48436.1"
FT                   /translation="MAERQANGRKNDPQRTQDDILEVATEEFSTHGLAGARVDQIAERT
FT                   RTSKRMIYYYFGSKEALYLAVLERSYRKIRTLEADLELANLPPEEALRTLVATTFDHDE
FT                   ANPDFVRLVSIENIHRAAHMLRSDAIRDLNVSVIQMIEAIIERGLGDGTFRRKADPIDV
FT                   HMLISAFCFFRVSNRYTFGTIFRRDLSEPKTIARHRTMIADAVVSYLKSDEPRAARR"
FT   CDS_pept        44734..45297
FT                   /transl_table=11
FT                   /locus_tag="SM_b20034"
FT                   /old_locus_tag="SMb20034"
FT                   /product="ABC transporter, permease"
FT                   /function="TRAP-type C4-dicarboxylate transport
FT                   system,small permease component"
FT                   /note="Transports quinic acid."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20034"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48437"
FT                   /db_xref="GOA:Q92XC5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XC5"
FT                   /protein_id="CAC48437.1"
FT                   /translation="MSRIIDFYFFALKVTIALLLASMVVLVFGNVVLRYAFNQGITVSE
FT                   ELSRMFFVWLTFLGAVVAMREHGHLGVDSLIKRLPARAAKAAVLCGHALMLYATWLVIS
FT                   GSWTQTLINLHVGAPATGISMAFFYGAGLAFGIPAFLILLADAFAIATGRIDVTTTDLV
FT                   RESEDEAALDNLPAPALGPLSAKH"
FT   CDS_pept        45308..46588
FT                   /transl_table=11
FT                   /locus_tag="SM_b20035"
FT                   /old_locus_tag="SMb20035"
FT                   /product="ABC transporter, permease"
FT                   /function="TRAP-type C4-dicarboxylate transport
FT                   system,large permease component"
FT                   /note="Transports quinic acid."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20035"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48438"
FT                   /db_xref="GOA:Q92XC4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XC4"
FT                   /protein_id="CAC48438.1"
FT                   /translation="MTISIFLGALLGPMALGVPIAFALILSGVALMLYLGLFDAQIVAQ
FT                   NVLNGADSFPLMAVPFFLLAGEVMNTGGLSRRIVALAMAMVGHIRGGLGFVAIFAACIL
FT                   SSLSGSAVADAAALGALLLPMMLKSGHDPARASGLIASASIIGPIIPPSIGFILFGVVG
FT                   GVSITKLFLAGIFPGLMIAAALSITWLIVARKEQFELPPRQSGRLRLRAFVDSLWALFL
FT                   PVIIIAGLKFGVFTPTEAGVIAAVYSLFVSMVVYRELAPAQLFHVFVSAAKISAVVMFL
FT                   VACAAVSAWLITVADVPGALAALLEPLMGNQTALLIAIMVLIVIVGTAMDMTPTILIMT
FT                   PVLMPVIKQAGIDPVYFGVLFIINNSIGLITPPVGTVLNVICGVSKLSMEDLMKGVMPF
FT                   LFAELIVLFLLVLFPELVTVPVSWFGR"
FT   CDS_pept        46649..47665
FT                   /transl_table=11
FT                   /locus_tag="SM_b20036"
FT                   /old_locus_tag="SMb20036"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /function="TRAP-type C4-dicarboxylate transport
FT                   system,periplasmic component"
FT                   /note="Transports quinic acid. Expression of SMb20036 is
FT                   induced by quinic acid."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20036"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48439"
FT                   /db_xref="GOA:Q92XC3"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XC3"
FT                   /protein_id="CAC48439.1"
FT                   /translation="MFDRLTKLTLGLAVPLALMTAGPALAEIRDQTVKFASANNKGHPQ
FT                   VTGMEKFAELVKEKSGGKIEVKLFPGGTLGGDVQTVSALQGGVIEMTVLNAGILASNVK
FT                   EFGAVDLPFLFDSGEEADKVMDGPFGTSLMERLPATGLVGVAYWELGFRNLTNNRHPVT
FT                   KLEDIKGLKIRTIQSPIPVELFNALGANAVPLPYTELYTALETGTVDGQENPSANIINA
FT                   KFYEVQKYMTLTRHQYNPQIVLVSKKFWDGLNDEEKTVLQQAAVEARDFQRKVSREQDA
FT                   AALEEIRKTGMEVSELSAEETQKLRDAVKPMIEKFSADIGQETVEALFKEIGTARGQ"
FT   CDS_pept        47745..48605
FT                   /transl_table=11
FT                   /gene="aroE2"
FT                   /locus_tag="SM_b20037"
FT                   /old_locus_tag="SMb20037"
FT                   /product="putative shikimate 5-dehydrogenase protein"
FT                   /EC_number="1.1.1.25"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20037"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48440"
FT                   /db_xref="GOA:Q92XC2"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XC2"
FT                   /protein_id="CAC48440.1"
FT                   /translation="MTETLVRSLKAGLIGTGIQASLTPAMHMAEGAAQGIRYDYELIDL
FT                   NLLGASEKDLPRLLADAERRGFAGLNITHPCKQAVIPYLDELASEARQLGAVNTVVLRS
FT                   GRRYGHNTDWWGFAEGFRRGLPDADLFSAVQLGAGGAGVATAYAALSLGLQRLVVFDRE
FT                   AGRAQALARMLSPLFPRAEVAAGNDLPSEMRNAAGLIHATPTGMAKYPGLPLDAELLSR
FT                   SLWVAEIVYFPLETALLREARRRGCKTLDGGGMAVFQAVGAFRLFTGLEPDAARMLGHF
FT                   RAMTG"
FT   CDS_pept        48822..49049
FT                   /transl_table=11
FT                   /locus_tag="SM_b20038"
FT                   /old_locus_tag="SMb20038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20038"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48441"
FT                   /db_xref="GOA:Q92XC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XC1"
FT                   /protein_id="CAC48441.1"
FT                   /translation="MQALGPRRQSTLIAFKGTAETAGSVGDTEPLPGFGNVAKAVFGAV
FT                   LLVIGIAIVTGVDKQLEAALVEASRPGSRA"
FT   CDS_pept        complement(49146..50570)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20039"
FT                   /old_locus_tag="SMb20039"
FT                   /product="aspartate transaminase"
FT                   /function="L-aspartate + 2-oxoglutarate = oxaloacetate +
FT                   L-glutamate"
FT                   /EC_number="2.6.1.1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20039"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48442"
FT                   /db_xref="GOA:Q92XC0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XC0"
FT                   /protein_id="CAC48442.1"
FT                   /translation="MEKVPVRMQLKATSAAGESLIAKVMGTVKHRIAARSLTPGARLPS
FT                   IRSFALAMKVSKSTVVEAYERLQAEGVIRSRPGSGFFVAAPLAPLTLAEIGPRVDRAVD
FT                   PLWISRQALEPGEGVLRPGCGWLPPHWMPEEGLRRALRGIARGAAATLVDYGAPLGLLP
FT                   LRQLLTRRVAQHGIEASPDQILLTESGTQAIDLLCRFLLKPGDAVLVDDPCYFNFHALL
FT                   RAHQARIFGVPYTPSGPDIGRFAEALAEHKPRLYITNSALHNPTGAMLSPLVGHRLLKL
FT                   AEQAGLTIIEDDIFADFEETPAPRLAAFDGLERVVHIGSFSKTLSAAVRCGFIVAPRDW
FT                   VEALTDLKIATCFGAAGFSSELVLTLLKNGSYRKHMETVRQRLAGAMAETAQRLARIGI
FT                   TPWIEPQAGMFLWCRLPDGIDAARLARQALARGIVLAPGNVFSHAQTASGFLRFNVAQS
FT                   EDERLFRELAALTAAA"
FT   CDS_pept        50652..51512
FT                   /transl_table=11
FT                   /locus_tag="SM_b20040"
FT                   /old_locus_tag="SMb20040"
FT                   /product="hypothetical protein TRANSMEMBRANE"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20040"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48443"
FT                   /db_xref="GOA:Q92XB9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XB9"
FT                   /protein_id="CAC48443.1"
FT                   /translation="MNKATSGWMSGLIGVVIFSGSLPATRVAVMDFDPIFLTVARATIA
FT                   GILAFCLLFAFRERRPARGDLASLAVISLGVVVGFPLMTALALRHVTSAHSIVFIGLLP
FT                   LATAIFGVLRGGERPRPTFWVFSGLGSAIVVGFAARQGFSASPIGDLLMLAAIVACGLG
FT                   YAEGAKLSRRLGGWQVICWALVLSLPVMTALMLATMPSSLAGPSAASWLGFGYVSVFSM
FT                   LIGFIFWYRGLALGGIVAVGQLQLLQPFFGLALASTLLGENVSWSMLAATVAIVACVAG
FT                   AKKFA"
FT   CDS_pept        51703..52233
FT                   /transl_table=11
FT                   /locus_tag="SM_b20041"
FT                   /old_locus_tag="SMb20041"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20041"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48444"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XB8"
FT                   /protein_id="CAC48444.1"
FT                   /translation="MMRRKIFRFVLAGLVLVGGILPLETSAAPADEAAFLNSLEGRWTG
FT                   GGTVLLRIDRGPINVSCNFSSDATGTALAMRGTCRGLLVVSRSISADLRSDGARYTGIY
FT                   VGPRGGRSALSGSRRGNAINLTVTWAREVNGDRKATLIVQKRGENGMRLSTVDVDPATG
FT                   KRVVTSELNLRRS"
FT   CDS_pept        complement(52256..53413)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20042"
FT                   /old_locus_tag="SMb20042"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20042"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48445"
FT                   /db_xref="InterPro:IPR011670"
FT                   /db_xref="InterPro:IPR021068"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XB7"
FT                   /protein_id="CAC48445.1"
FT                   /translation="MRYEIPDPLDPALLTVLIAAEDGLARLDERAGRHAVAEGFRERGQ
FT                   FFDAAAALWVAGELVHVEDLVLHDSHMDARAPSHELTIAHAVLRARRRLDLADADWALS
FT                   PPGLSALRGEAGAAVRHDSLNTSALRDDPDETDAPDAADGPIDSSLSDAFAEIDAAIAR
FT                   SARLLDIHAGSAVMAEQPVIESQSSRVEPTGQLGLLFDDDWDETARLDAWRAVLPVADQ
FT                   LPAALGAALLFDAWERIEPLRRQHWLGSLLVGAYLRFRGKVGSHVLAYNTGLKTIRHER
FT                   RRSKDRLTRLTGFLEAMSAAAELGMKELDRLSLARTQMEMRIRDRRSNSNLPGLIDLVL
FT                   SRPIVSAPLIARHLGVTPRGALNLVRELGVREMTGRGRYRGWGVL"
FT   CDS_pept        53787..54629
FT                   /transl_table=11
FT                   /locus_tag="SM_b20043"
FT                   /old_locus_tag="SMb20043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20043"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XB6"
FT                   /protein_id="CAC48446.1"
FT                   /translation="MVSDILAASGGVKQVICINWGTKYGAPFVNRLFAMVARNITPPFT
FT                   FTCFTDNREGLRPEIRCEDLPPLDVETMPVNTKGIWPKARLWGPVLGSLKGPVLFLDLD
FT                   LVIVGSLDAFFEIGGPDDIVMTRNQTTPLERLGQTSLFRFPVGKLVPLQEKFRADPQKV
FT                   ADEYEFEQRFVTRNAPGGAKFFPRRFVLHFRQDCRRPFPLNYFLPPRLPADARVVIFPR
FT                   GLLPQHAIDGQFGYKGRVATPSDHIRGLFSPDRREKSPFRYLRHYILPSPWVAEHWRE"
FT   CDS_pept        complement(55090..56400)
FT                   /transl_table=11
FT                   /gene="repC1"
FT                   /locus_tag="SM_b20044"
FT                   /old_locus_tag="SMb20044"
FT                   /product="probable replication protein C"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20044"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48447"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XB5"
FT                   /protein_id="CAC48447.1"
FT                   /translation="MERGSVTTPFGRRAMTLGMLASQIAAGNVPPDRSVDKWKLFRSLC
FT                   EAKTVIGVSDRSLAVLNALLSFYPGAELSGENGLVVFPSNAQLSLRTHGMAGTTLRRHL
FT                   ACLVESGLILRRDSPNGKRYARRSRNGAVGEAFGFDLSPLVARADEFKAAAAELAAAKQ
FT                   YHRLMRERLSLCRRDIAKLLELLRDSDLPTDCERQQRRYEELSAPLSRKAPVSDVETLH
FT                   DAMAELRTDLSNQLEKLLNSKKMGANDRHNGQHIQSSHPDSQFESEPGLGKGSGKFSAG
FT                   AQSCNADPVTPTAKLSEVSTRIDSQQPVSSVSPSLPISRLAREIPLPVLLSACPQIADY
FT                   GPQGRITNWKDLLTAAVVVRTMLNVSTDAYDDACTVLGQENAATVIACILERADCISSP
FT                   GGYLRVLTARARRQAFSVAPMVAALRRARGASMPLAS"
FT   misc_RNA        56345..56491
FT                   /gene="incA1"
FT                   /function="transcript for incompatibility determinant,PMID:
FT                   15659174"
FT                   /note="submitted with locus tag: RME591985_1601"
FT   CDS_pept        complement(56556..57560)
FT                   /transl_table=11
FT                   /gene="repB1"
FT                   /locus_tag="SM_b20045"
FT                   /old_locus_tag="SMb20045"
FT                   /product="probable replication protein B"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20045"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48448"
FT                   /db_xref="GOA:Q92XB4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR017819"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XB4"
FT                   /protein_id="CAC48448.1"
FT                   /translation="MARKNLIGISESPLAPEDGERPAVGRPIAGLAPAQRSTGLVGGIT
FT                   RSLSNITQKVERAEELERQLADGHAIVELDPELIDSSFIIDRLGVAPDVQAMLVQQIRD
FT                   HGQQVPILVRPHPAESGRYQVAYGHRRLAALREIGIKVKAVIRNLNDEQLVISQGQENN
FT                   ARTDLSFIERALFATRLEDRGFSRDTIMSALGVDKAALSKMIAVVRRLPLDIIEAIGAA
FT                   PGFGRRRWMELADLIDRDDRRPKALHFIETAAFKALESDQRFEKLFALLSLARKPSKAE
FT                   TWIAPDRSRPVRIRETDAETTLAFSKKAAPGFAEFVRQRLEALYLEYQRETGD"
FT   CDS_pept        complement(57564..58760)
FT                   /transl_table=11
FT                   /gene="repA1"
FT                   /locus_tag="SM_b20046"
FT                   /old_locus_tag="SMb20046"
FT                   /product="probable replication protein A"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20046"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48449"
FT                   /db_xref="InterPro:IPR017818"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XB3"
FT                   /protein_id="CAC48449.1"
FT                   /translation="MLQQRIQSLEEQEHLPSLLSADAQELAHQLQEHQKKIFSPSAQKT
FT                   MRLFSPAEAAAFIGIGEGYLRQIASEGHGPQPLSNGRRMYAMEDIDRIRRVLDEGSKTG
FT                   KYIPHRRPGEKLQVVSVMNFKGGSGKTTTSAHLAQYLALRGYRVLAIDLDPQASLSALF
FT                   GHQPELDVGEGETLYGAIRYEAPRPIAEVVRSTYTANLHLIPGNLELMEFEHETPKAMI
FT                   AGSTETMFFARIGEVLSEIESFYDIVVIDCPPQLGFLTMSALCAATSVLITVHPQMLDV
FT                   MSMSQFLSMTSELMAVVENAGGRTSYDWMRYLVTRFEPNDGPQSQMTGFMRAIFGNRML
FT                   QNAMVKSTAISDAGVTKQTLYEVERSQFIRGTYDRAMDSLSLVNAEIEEMIRRVWGRK"
FT   CDS_pept        59127..59315
FT                   /transl_table=11
FT                   /locus_tag="SM_b20047"
FT                   /old_locus_tag="SMb20047"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20047"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48450"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XB2"
FT                   /protein_id="CAC48450.1"
FT                   /translation="MFYLGGMTLGYLVPPPRTGVAPKPAVSKEPANDRPDRENAPGDGE
FT                   RDQEWARAFLAPWHLFY"
FT   CDS_pept        59484..60191
FT                   /transl_table=11
FT                   /locus_tag="SM_b20048"
FT                   /old_locus_tag="SMb20048"
FT                   /product="probable transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="probable Histidine utilization repressor, hutC"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20048"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48451"
FT                   /db_xref="GOA:Q92XB1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XB1"
FT                   /protein_id="CAC48451.1"
FT                   /translation="MSLHQRILSEVEGHILSGDWPPGYRIPFEHELTEQYGCSRMTVNK
FT                   ALSELVKRGLIERRRKSGSYVSFPQVQSAVMEIHDVKREVQSLGLDYAYRLGERAVRKM
FT                   RAGDEGRIDLPVSSRLLDVTCRHFAGGRVFCLEERVINLSAVPEAETETFETAAPGSWL
FT                   LGKVPWSTAEHRIRAVAASRPTAQALEIAVGAACLVIERRTWSGGVPVTSVLLTYPGDR
FT                   HELVAEFAPSAPA"
FT   CDS_pept        60310..62271
FT                   /transl_table=11
FT                   /gene="fusA2"
FT                   /locus_tag="SM_b20049"
FT                   /old_locus_tag="SMb20049"
FT                   /product="putative elongation factor G protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20049"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48452"
FT                   /db_xref="GOA:Q92XB0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XB0"
FT                   /protein_id="CAC48452.1"
FT                   /translation="MRCFTVLGPSQIGKSTLVERVGSLGGEPKKSVTPYGLGLTEFEFG
FT                   GEAWCALDVPGNNEALAHAQHALLASDACVLCVSPILDEAVLAAPYLRMIEASGTPCIL
FT                   FINRMDEPRGRIRDIVAALQDFCSRPLILRQIPIRDGDRIIGSCDLISERAWRYREGQP
FT                   SSLFEIPESALEREHEARAELLEHLSEFDDWLLEELIEDREPASDAIYSISTRVLNENK
FT                   IIPVLLGSASHGNGLMRLMKALRHEAPRAEALKKRLAAGAGVDETTLLAVSFHAHYRQS
FT                   VGKTVLARALQNGVKQGATLGGASLGALQDPASGRPIGSGVTEAGQLFGAVKSDHLPVP
FT                   SLLTAGAAVAPPDWTTPPTPMLERILVPASERDETKLSETLAKLAETDRGLKVMQEEGT
FT                   GAQLVCAQGPVHLREVCRTLSDVFHVEVSDRPPSPIYRETVSKSSDVHYRHRKQTGGAG
FT                   QFADVKLSVHPNGRGDGFSFAETVKGGAVPRNYIPAVEAGAREAMEKGPLGFKVIDVGV
FT                   LLTDGQHHSVDSSEYAFRTAGKLGVRQALSQAASVLMQPVFRVEIHVPSVYSGSLVPIV
FT                   ASLKGQVLGFDRDEAAKGWDIFRALLPGSALDDLARSLRSATQGIGYFSKNFDHFEELY
FT                   GKEAQAIVTAHGAPANEH"
FT   CDS_pept        complement(62415..62924)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20050"
FT                   /old_locus_tag="SMb20050"
FT                   /product="hypothetical TRANSMEMBRANE protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20050"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48453"
FT                   /db_xref="GOA:Q92XA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XA9"
FT                   /protein_id="CAC48453.1"
FT                   /translation="MIPGSSIETLLALHVVVSLIGIASGLVALPTLGAGRWLGHWHAVF
FT                   LVTTGATSITGFLFPFSGITPALVVGAISVLTLAIALAALHVFGLRGRAGPAYAVSATF
FT                   ALYLNLFVLVVQSFLKVPALQSIAPTQTEAPFVVAQALLLAASMALGAAAIIGSRQVAL
FT                   PLPVRG"
FT   CDS_pept        complement(63020..63847)
FT                   /transl_table=11
FT                   /gene="cpo"
FT                   /locus_tag="SM_b20054"
FT                   /old_locus_tag="SMb20054"
FT                   /product="chloride peroxidase"
FT                   /function="2 RH + 2 Cl- + H2O2 = 2 RCl + 2 H2O"
FT                   /EC_number="1.11.1.10"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20054"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48454"
FT                   /db_xref="GOA:Q92XA8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XA8"
FT                   /protein_id="CAC48454.1"
FT                   /translation="MATITTRDGTRIFYKDWGSRNAQPILFSHGWPLTADVWDAQMVFF
FT                   ANKGYRVIAHDRRSHGRSDQVWDSNTMDRYADDLAELIEALDLRSVILVGHSTGGGEVT
FT                   RYVGRHGTGRVAKVALIGAVPPLMLKTEANPGGLPIDVFDGIRKGTYDNRSQFFRDLTI
FT                   PFYGYNREGAAISEGIRESFWLQGMMGGLKGQLDSIRAFSESDFNADLAKFDKPTLVLH
FT                   GDDDQIVPIGASALSTVKIVKHAVLKVYEGADHGLTQTYQDRFNADLLEFIET"
FT   CDS_pept        63995..64984
FT                   /transl_table=11
FT                   /locus_tag="SM_b20055"
FT                   /old_locus_tag="SMb20055"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20055"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48455"
FT                   /db_xref="GOA:Q92XA7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XA7"
FT                   /protein_id="CAC48455.1"
FT                   /translation="MAKGRALPSKAEIGLMLYPGCQMAMVHGMTDLIGIAGQFSAERGG
FT                   PVARITHWRLQDDGCLARCFDTHPELGSREAPEILLVPGRLTGPMEAEEAAPYARWLLD
FT                   RHAKGATLASTCGGTFVLAATGLLKGRPATTHWLFANAFRDRFPDVRLDPDKIVIEDGD
FT                   IITAGGLMAWTDLGMRLVDRLFGPTVTVETGRFLLIDPAGREQRHYSSFSPRLNHGDEA
FT                   ILKVQHWLQTREARAVSVAEMAKVVAMEDRTFLRRFKAATGMKPIEYAQHLRVGKAREL
FT                   LEFTKRSVEQIAWSVGYEDAAAFRKLFHRIVGLSPGDYRHRFAVAAAG"
FT   repeat_region   complement(65450..65499)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        66644..67711
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="SM_b20056"
FT                   /old_locus_tag="SMb20056"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20056"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48456"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XA6"
FT                   /protein_id="CAC48456.1"
FT                   /translation="MNSFLKRPLIAGLITFSIGAAALGHPVYAAETTYPLTLENCGRQI
FT                   TFDKTPTRTVSIGQSSTEILYLLGLADKVAGTALWVGPVLEGYEEVNAKVERLADNDPS
FT                   FESVLAKKPDMVAVQFQWQVGPEGVVARPEQFEELGIPVYTSPSDCTGKENSAASDGVR
FT                   RQVFTMDLVYREIRELAHIYNVQDKGEKVVAELKSREEAARAKVASAGDKLSAVFWFSS
FT                   AADADPYVAGRNGAPGYIMAALGIENIIDTEDEWPTVGWETIAKAEPTMIVAGSMERRR
FT                   YPLDSLDAKLEFLKTDPVASLMPAVAKGYVFAMDAQAMNPTIRTIEGIEALADAIAEAG
FT                   LASKAGLASKGGLGK"
FT   CDS_pept        67708..68751
FT                   /transl_table=11
FT                   /gene="btuC"
FT                   /locus_tag="SM_b20057"
FT                   /old_locus_tag="SMb20057"
FT                   /product="ABC transporter, permease"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20057"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48457"
FT                   /db_xref="GOA:Q92XA5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XA5"
FT                   /protein_id="CAC48457.1"
FT                   /translation="MSRVLTLAGRTGTGRVGAALAALVILFAALWMGAAIGETAIPFKT
FT                   VAQTVANRLWNAGYPLAPIDEGIIWSYRLSRAVVAASCGASLALSGAVLQSLLRNPLAD
FT                   PYILGISAGASTGAVSVAILGVGAGMLTLPLGAFIGALVAFVLVSLLAVKAGRGTAAII
FT                   LAGVAGSQLFNALTSFIVTKAATAEQARGIMFWLLGNLSGVRWPDAWLAVPATLLGLVV
FT                   CLWHARPLDAFTFGSESAASLGISVRRTYFALVGVSAMMTAVMVSIVGSIGFVGLVIPH
FT                   AARMLVGVRHGVLLPAAALIGAVFMILADILSRVLIPGQVLPIGVITALVGAPAFALIL
FT                   GQRRDRA"
FT   CDS_pept        68748..69548
FT                   /transl_table=11
FT                   /gene="btuD"
FT                   /locus_tag="SM_b20058"
FT                   /old_locus_tag="SMb20058"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20058"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48458"
FT                   /db_xref="GOA:Q92XA4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XA4"
FT                   /protein_id="CAC48458.1"
FT                   /translation="MTLSASGVSWSAGGVEILKDVSLTVETGEFLGIIGPNGSGKTSLM
FT                   SLISGIRKPKRGEVLLDGCPIGTLGRRTVAQRLALVEQQAETGERITARQAVELGRTPY
FT                   LGPLSPWSPEDDAIVGAALANVDMAHLADRLWHTLSGGERQRLHIARALAQQSKILLLD
FT                   EPTNHLDIGHQISLLDLVRRQDLTVVAALHDLNHAAMFCDRIAVMQAGRLVALGRPREV
FT                   LTVERIRAVFGIEVEVEHEFDGSCSIRYRARRPRPLAAIAAVGA"
FT   CDS_pept        69552..70331
FT                   /transl_table=11
FT                   /locus_tag="SM_b20059"
FT                   /old_locus_tag="SMb20059"
FT                   /product="SAM-dependent methyltransferase"
FT                   /function="SAM-dependent methyltransferases"
FT                   /EC_number="2.1.1.-"
FT                   /note="May be involved in cobalamin metabolism. Sequence
FT                   upstream of SMb20056 is"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20059"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48459"
FT                   /db_xref="GOA:Q92XA3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XA3"
FT                   /protein_id="CAC48459.1"
FT                   /translation="MDMRNHDLKEDIREYWSKRSQTFDLAFGHRIPPGPELDAWAAAMR
FT                   DALGARPLKVLELACGTGEVTNVLLSLGHEVTALDFSEAMLAVARRKHAGNDRVRFILA
FT                   DAERTMEPDETYDAVVCRHLVWTLTEPEQAFAEWFRLLKPGGRLLVFDGDWSKPTPLGR
FT                   LASIAVAALEQIIGHDPHYDGAMSERHATIMERLPFGDGLTVERLLPLIEEAGFENIEL
FT                   PSRRPIAAAQRRNADLRNRLRTFFYRRFFLVCSRPSG"
FT   mobile_element  70327..71666
FT                   /mobile_element_type="insertion sequence:ISRm5 OR SMb21610"
FT   CDS_pept        70423..71619
FT                   /transl_table=11
FT                   /gene="TRm5"
FT                   /locus_tag="SM_b20060"
FT                   /old_locus_tag="SMb20060"
FT                   /product="probable ISRm5 transposase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20060"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48460"
FT                   /db_xref="GOA:Q92XA2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XA2"
FT                   /protein_id="CAC48460.1"
FT                   /translation="MTKTEGRTASAAVKDILLSNPDGLREVIRTVMQEVLEAEMDEALG
FT                   AAKGERTPERLGYRSGHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVAT
FT                   LAEMYVQGVSTRKVKAITEELCGHAFSASSISAINKRLDESLKAFAERSLQEPFAYLIL
FT                   DARYEKVREAGVVMSQAVLIAVGIDWDGRRQILSVEMAGRESRSAWKDFLVRLKGRGLK
FT                   GVELVVSDDHAGLVAAIGEVIPEAVWQRCYVHFLRNALDHLPRKHGDDCLQELRWLYDR
FT                   RDLDEAKADLAAWLGKWSVRYPRLTSWVEETIEQTLTFFRLPRQHHKHLKSTNMLERLN
FT                   EEIRRRTYVVRIFPNTESCLRLVRALAVETHENWMEANRYINMDDLREHKKLALRQAA"
FT   CDS_pept        complement(71778..72098)
FT                   /transl_table=11
FT                   /locus_tag="SM_b22003"
FT                   /old_locus_tag="SMb22003"
FT                   /product="putative partial transposase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22003"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51276"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDB7"
FT                   /protein_id="CAQ51276.1"
FT                   /translation="MLACSERKLNRPATSWAALPCGSNSCGVCPKGWCVLVGFRAGHMD
FT                   GRDWYVEPIRVRCGVVRRTAPGDRDGHYGVFFAAHHIATINLTNNQSVSDVSEQTSVMS
FT                   PG"
FT   CDS_pept        72259..72414
FT                   /transl_table=11
FT                   /locus_tag="SM_b20061"
FT                   /old_locus_tag="SMb20061"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20061"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48461"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XA1"
FT                   /protein_id="CAC48461.1"
FT                   /translation="MPPAYWETLEEVSFRTPEDKGKRIPQERLVAEALNLLFAKYNFPV
FT                   VREGGE"
FT   CDS_pept        72518..72766
FT                   /transl_table=11
FT                   /locus_tag="SM_b20062"
FT                   /old_locus_tag="SMb20062"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20062"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48462"
FT                   /db_xref="GOA:Q92XA0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q92XA0"
FT                   /protein_id="CAC48462.1"
FT                   /translation="MAARSTSISLGDHFAGFIDSQVQTGRYGSASDVVRAGLRLLEEHE
FT                   AKVRALEAALIEGEESGEPEPFDNEAFKAEMRAEYGD"
FT   CDS_pept        72756..73052
FT                   /transl_table=11
FT                   /locus_tag="SM_b20063"
FT                   /old_locus_tag="SMb20063"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20063"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48463"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X99"
FT                   /protein_id="CAC48463.1"
FT                   /translation="MATERPFRLAPTAKADLRKIWRYTARRWSLEQAETYQDQLYTAFE
FT                   GLAVGTKKGRNVDVRPGYLKYPAGAHIVYFRDRGDRIDIIRILHGRVDAQRHL"
FT   CDS_pept        complement(72974..73420)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20064"
FT                   /old_locus_tag="SMb20064"
FT                   /product="putative transposase protein"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20064"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48464"
FT                   /db_xref="GOA:Q92X98"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X98"
FT                   /protein_id="CAC48464.1"
FT                   /translation="MDLASEGYSMPWREVSTMGERRGFVRLPLEEGVNRRELCRRFGIS
FT                   PDMRYKWLARWEAGDGELADRSRRPHISPMRCNEAVEAEVLAMRDAHRAWGTWADDYML
FT                   TGKHDTLPYFDASRGRPLLYKCRWASTRPCRMRMMSIRSPRSRK"
FT   repeat_region   73737..73785
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   repeat_region   73787..73831
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        73972..74370
FT                   /transl_table=11
FT                   /locus_tag="SM_b20065"
FT                   /old_locus_tag="SMb20065"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20065"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48465"
FT                   /db_xref="GOA:Q92X97"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X97"
FT                   /protein_id="CAC48465.1"
FT                   /translation="MAQEKRLGSTIPRGVVDTKNGSVGVPDQASMEEEVRSLREQVNAL
FT                   TEKLSDLGIYSGRAIADTGRRAGEMAREHPAWTALAVVGLLGLLIAGTSRPYWHSRSSS
FT                   RIEDLIADIEDRLSDLKGRYWSSGWRPW"
FT   CDS_pept        74537..74722
FT                   /transl_table=11
FT                   /locus_tag="SM_b20066"
FT                   /old_locus_tag="SMb20066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20066"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48466"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X96"
FT                   /protein_id="CAC48466.1"
FT                   /translation="MEHKPDRPKTKGESGTAKKNQPGHVGGDEARKAKEWGGGSKASKG
FT                   EVSREDKRNPNSSAKS"
FT   CDS_pept        complement(74726..75247)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20067"
FT                   /old_locus_tag="SMb20067"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20067"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48467"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X95"
FT                   /protein_id="CAC48467.1"
FT                   /translation="MNGWGFAQSGTDRHGKSSGGDEGKLMKQKLLAQDASERTFILVLE
FT                   EGDEAFSAISAFAAQADIAGASVTAIGAFSSATVGFFRIESRDYRKIPVAEQSEVLSAI
FT                   GDIARDEAGSPSLHLHAVLGLEDGSTRGGHLLEGYVRPTLEVIIRESPTGLCRRKRPEL
FT                   GIALIELDAE"
FT   CDS_pept        75462..75671
FT                   /transl_table=11
FT                   /locus_tag="SM_b20068"
FT                   /old_locus_tag="SMb20068"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20068"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48468"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X94"
FT                   /protein_id="CAC48468.1"
FT                   /translation="MSEHVYKKIELIGSSPNSIDEAIEGAISRASKTTRNLDWFEVDQI
FT                   RGQIVNGKVAHYQVVMKVGFRIDD"
FT   CDS_pept        76205..77608
FT                   /transl_table=11
FT                   /locus_tag="SM_b20069"
FT                   /old_locus_tag="SMb20069"
FT                   /product="probable Na+/aminoacid symporter"
FT                   /function="Na+/alanine symporter"
FT                   /note="probable Na+/alanine or glycine symporter, putative
FT                   agcS gene"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20069"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48469"
FT                   /db_xref="GOA:Q92X93"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X93"
FT                   /protein_id="CAC48469.1"
FT                   /translation="MEALNQFFNWLNGIVWGVPMIVLIIGTGLYLQLRLGFMPIRKVAY
FT                   GFRMILKSRRPGRAAEGEITPYAALMTALSATIGTGNIAGVATAIAVGGPGALFWMWVT
FT                   AFVGMATKYAEVVVAVKYREVDDKGEHAGGPMFAIKNGLGKHWQWLGTAFAIFGGLAGF
FT                   GIGNMVQANGIASAVENAFGIETWISGIVMTVLTGAVILGGIKRIGAVAEKVVPFMAIF
FT                   YLVCVAAVLVVFAGNIPQAIATIFTQAFSPTAATGGFLGSTVLMAIRMGVARGIFSNEA
FT                   GLGTAGIAQAAGSTANPVFSGVIGMMGTFIDTIIVCTLTGLAIMVSGVWASGETGAVLS
FT                   SAAFEAALPGYGNYLVTISLALFAFTTILGWAYYAEKCWEYLIGTASAIPFRIVWTVAV
FT                   FFGATLSLDFAWLVADTLNALMAIPNLISLLLLSPVIAQLTRDYFAEERAGAGVASHSQ
FT                   GQSASRKSV"
FT   repeat_region   complement(77650..77694)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(77869..79356)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20070"
FT                   /old_locus_tag="SMb20070"
FT                   /product="putative sulfate permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20070"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48470"
FT                   /db_xref="GOA:Q92X92"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X92"
FT                   /protein_id="CAC48470.1"
FT                   /translation="MKTTITSYKREWFSNIRGDVLSGIVVALALIPEAIGFSVIAGVDP
FT                   KVGLFASFAIACVSAFAGGRPGMISAATAATAVLMVTLVKEHGLEYLFAATLLMGLFQI
FT                   AAGFLKLGRVMRFVSRSVITGFVNALAILIFMAQLPELIGVPHLTYAMIAAGLGIIYLF
FT                   PYVTKAVPSPLVAIAVLTAVDFWTGMDVRTVGDLGALPSSLPIFALPQVPLTFETLQII
FT                   FPYSVALAAVGLLESLLTAQIVDDMTDTTSSKSQECIGQGASNIASGLIGGMGGCAMIG
FT                   QSVINVTSGGRGRLSTFVAGAFLLFLILVLDDLVRIIPMAALVAVMIMVSVGTFSWRSI
FT                   LDLRRNPLPSSVVMLATVVTTVGTHDLAKGVLVGVLLSGVFFAGKVARLFHVRSMLEES
FT                   GKVRTYHVDGQIFFASTEGFIGAFDFAEPLEKVVIDVGEAHLWDITAVGALDKVVLKYR
FT                   RHGVTVEVIGLNAASAHMLDRFAVHDKSEGASLTVTH"
FT   CDS_pept        complement(79574..80767)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20071"
FT                   /old_locus_tag="SMb20071"
FT                   /product="putative efflux protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20071"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48471"
FT                   /db_xref="GOA:Q92X91"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X91"
FT                   /protein_id="CAC48471.1"
FT                   /translation="MPLAIFALTIAAYAIGTTEFVIVGLLPTVATDLAITLPLAGLIVS
FT                   VYALGVTFGAPVLTALTGRIERKPLLLGLMALFIGGNTAAALSPNYEVLLVARVLSAFA
FT                   HGVFFSVGSTIAADLVPENRRASAIAMMFMGLTVAIVTGVPIGTYIGQVFGWRATFWGV
FT                   SGLGVVAFAGIATLLPGTLAKAAPASLLDQVRVLGSGRLLIVFAMTALGYGGTFVAFTF
FT                   LAPILQEVTGFSERSVSLILVLYGVAIAIGNIAGGRIANTNPVKALIGLFLLQALVLVI
FT                   FSFTAVSPVLTLVTLAALGFLSFANVPGLQLYVVQLAMEHRPGAVDVASALNIAAFNLG
FT                   IALGAWLGGMVVDSPFGLSATPWVGAILVSGALLLTLWSGVLDRRGAVSGEPATVTG"
FT   CDS_pept        complement(81239..82168)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20072"
FT                   /old_locus_tag="SMb20072"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /function="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="Expression of SMb20072 is induced by myo-inositol.
FT                   Not part of an obvious ABC transporter operon. Has
FT                   similarity to SMb20712."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20072"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48472"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X90"
FT                   /protein_id="CAC48472.1"
FT                   /translation="MKHLLSAAVLALFAGSAHAENVGITIARSDSAFLTILRNGMQDQA
FT                   AKLDGVTVQVEDAQNDTSRQLDQVQNFVSSGVDAIIVVAVDGDSTPALTKMATDAGIPI
FT                   VYANHPPADVDKLPETAAFVGSNEIDSGTLETKEVCRLLGGKGAAYVLMGPLNNHSSLT
FT                   RTKDIHDVIATDECKGMSVIEEQSANWDRLEAANIMTNWLSTGREFNAIIANNDEMAIG
FT                   AIQAMKAAGVDMSKVVVGGIDATPDGLAAMAAGDLDVTVFQNAIAQGAAAMDAAVALSR
FT                   DQKTARQIWVPFELVTPENMKDYATANQ"
FT   CDS_pept        complement(82331..83188)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20073"
FT                   /old_locus_tag="SMb20073"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="(3R)-3-hydroxyacyl-[acyl-carrier protein] +
FT                   NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+"
FT                   /EC_number="1.1.1.100"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20073"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48473"
FT                   /db_xref="GOA:Q92X89"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X89"
FT                   /protein_id="CAC48473.1"
FT                   /translation="MEKFPHPPFPRQTQEMPGTTDRMQPLPDHGENSYQGSGRLKDKRA
FT                   IITGGDSGIGRAVAIAYAREGADVLISYLSEHDDAMATKALVEEAGRKAVLAAGDIQSS
FT                   DHCRRIVETAVRELGGIDILVNNAAHQATFKNIEDISDEEWELTFRVNMHAMFYLTKAA
FT                   VPHMKKGSAIINTASINADVPNPILLAYATTKGAIHNFSAGLAQMLAERGIRVNVVAPG
FT                   PIWTPLIPSTMPEDTVADFGKQVPMKRPGQPVELASAYVMLADPMSSYVSGATIAVTGG
FT                   KPFL"
FT   CDS_pept        83384..83626
FT                   /transl_table=11
FT                   /locus_tag="SM_b20074"
FT                   /old_locus_tag="SMb20074"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20074"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48474"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X88"
FT                   /protein_id="CAC48474.1"
FT                   /translation="MERAKRPTAAPLDVKTVGGPIENDSDLRPEADKPPIEPDDIPNAK
FT                   AAREAARLKRDEYIVKSDLEDADQRNPLPDMKDQE"
FT   CDS_pept        83675..83866
FT                   /transl_table=11
FT                   /locus_tag="SM_b20075"
FT                   /old_locus_tag="SMb20075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20075"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48475"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X87"
FT                   /protein_id="CAC48475.1"
FT                   /translation="MKTPKEGAPGTTDQSPRWEGPKETRPRGYLPAKDDPERDRDAVGE
FT                   NLKDPHRGKVSDAGKTKG"
FT   CDS_pept        83965..84981
FT                   /transl_table=11
FT                   /locus_tag="SM_b20076"
FT                   /old_locus_tag="SMb20076"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="(3R)-3-hydroxyacyl-[acyl-carrier protein] +
FT                   NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+"
FT                   /EC_number="1.1.1.100"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20076"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48476"
FT                   /db_xref="GOA:Q92X86"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X86"
FT                   /protein_id="CAC48476.1"
FT                   /translation="MLNSLEDAVVVITGASSGVGQATAEAFARRRSKLVLAARDAAALH
FT                   EVARTCRELGAEVLVAPTDVTDADAVKDLARKAMSFGKIDVWFSNVGVGAVGRFEETPI
FT                   EAHEQVIRTNLIGHLNDAHAAVPIFRKQGHGIFINMISLGGFASAPFAAAYSASKFGLR
FT                   GFSEALRAELADERDIHICDVYPTFMDTPGVGHGANYTGRRLSVPPPVYNARRAARAIV
FT                   RLAERPRNSLTVGLVADLTRFAHFVAPNMTPRLMAKLTARYLSRAPRVARSHGNLFRAP
FT                   AEPGGIDGGLRSSRRIPVATTAAVCVLGIAVAALVLGKPRAPVGRGRSGVARLFRRA"
FT   CDS_pept        85081..86745
FT                   /transl_table=11
FT                   /locus_tag="SM_b20077"
FT                   /old_locus_tag="SMb20077"
FT                   /product="putative sensor histidine kinase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20077"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48477"
FT                   /db_xref="GOA:Q92X85"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X85"
FT                   /protein_id="CAC48477.1"
FT                   /translation="MAITQPTRNDAPARAHRPAKEFAGLAREWLLRTDPERLICLGRVI
FT                   TAAFAILAIYLDPTRPNSLLYESRVVLGLYLLLAIALVIFPLRYSFISPVHLLIHGIDA
FT                   AVVGWLTFLTNELVSPFFSILPFVILAMTMRWGLKGAALGALIALVVQLVVGLPDLLDG
FT                   DAELNVFIMRSIYFVLVAATLGYFGAYRERSRQRLAQLAQWPPGAIGEDRVSWLSILLE
FT                   HASGVLGDAHLLVMWREQEFESGCVAYWANGTLQLADLRHTDFWRRHDPDHYDGRDRRS
FT                   GEALNGLFADLPQIHANTDQSDRKVFSAAFSSVRYRGCVFVVSFANAADDTKDLSQIIA
FT                   TRVGTELERVALIQAARSEGRMRLARDLHDSVLQNLTAARLKLKLIGEGIPDGAKTQLT
FT                   EVGSLILEQQQCVRKFVDENRPGEEGNLARLEQQLPEFLELLRTQWNCAIDVSHGPTPL
FT                   VVPRWMLYEIMQLISEAASNAVRHGRATVLRIAFVRTAELLNLEITDNGTGISGEQEMK
FT                   PLSLSQRVAELGGKLAVCRNSPGFGLKIALPLKLEVR"
FT   CDS_pept        86745..87380
FT                   /transl_table=11
FT                   /locus_tag="SM_b20078"
FT                   /old_locus_tag="SMb20078"
FT                   /product="probable response regulator"
FT                   /function="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="Conserved hypothetical protein"
FT                   /note="probable two-component response regulator
FT                   reveiver,,putative narL gene"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20078"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48478"
FT                   /db_xref="GOA:Q92X84"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X84"
FT                   /protein_id="CAC48478.1"
FT                   /translation="MHSVLLVDDHPLLLRGLQDIIAAAPDFDVVGATASGVEAISLISG
FT                   LQPDIAVLDVAMPGMGGLEILRAIRNPRRLTRVIFLTATISGPQIAEALKMGLSGLLLK
FT                   EYAPEALLDCMRRVAMGGKWLPADLMANASQVSNDAPLERFSLLTPREREISALICGGL
FT                   SNRMIASRLGTSEGTVGIHLHNIFRKLDISNRATLAALHVQYTNPLRS"
FT   CDS_pept        88213..91431
FT                   /transl_table=11
FT                   /locus_tag="SM_b20079"
FT                   /old_locus_tag="SMb20079"
FT                   /product="probable type I secretion target repeat protein"
FT                   /function="RTX toxins and related Ca2+-binding proteins"
FT                   /EC_number="4.6.1.1"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20079"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48479"
FT                   /db_xref="GOA:Q92X83"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X83"
FT                   /protein_id="CAC48479.1"
FT                   /translation="MAVINGTAGNNVLIGTDLDDVISGFGGDDFIQGLGGADVINGGAG
FT                   VDTVDYSEKTTSVVVTLTGANAATVFVNGVADDTLSNVENVYGGSGNDTITGDAQNNLF
FT                   RGGGGNDVLDGGAGNDTADYADKTTSVVVTLMGATPATVFVNGIAEDTISNFENVYGGS
FT                   GNDILTGDDRSNILRGEAGNDILNGGADDDLLSGGAGNDTADGGTGIDTFDLREKTSSV
FT                   VVQLSGANAATVFVGGVAEDTIRNVENIVGGTADDTLSGDAAANKLSGARGNDWLKGGG
FT                   GADTLDGGEDSDTADYSDKAAAIAVALNGGNPVTVTVGGIAEDLIAKIENIVGGSGGDT
FT                   IIGDAAANAFRGGLGADVLDGGGGSDTADFSDKVQSVVLALNGAVDAIAAVGGTAEDTV
FT                   RNIENITGGSGNDQFTGDAAANTFRGGLGADVLDGGDGSDTADYGDKTVSVVVTLAGAN
FT                   PTTAFVDGMAEDSLRNIENIIGGSGNDVLAGDGFQNVLDGGAGTDMADYSASAKGIAVM
FT                   LNGANDAKVIVGSAAEDTLRNIENVTGSAFADVITGDAQANILLGGSGSDILKGDGGQD
FT                   VIDGGAGTDTADFSEKTAAVVLALAGAANAIATVGGLAEDTVRNIESIFGGIGADVLTG
FT                   DGNSNTIRGGAGADSLDGGAGVDTVDYRDKTKSVAVTLDGATPVTVKVGGVIEDTIRNF
FT                   ENISGGSAGDMLTGDGLANVLVGNDGADTLRGGLGKDVLDGGNGVDTADYLEKTDAISV
FT                   TLNGTASAAVLVGGTAEDTIRGVENILSGSGADTLVGDTASNMFRGALGADFIDGGAGV
FT                   DTADYREKTGSVEVALSGASDSFVFVGGVVEDTIRNIENVFGGKGNDTLTGDGLANTLN
FT                   GNDGKDLLTGGGGADILDGGAASDTASYRDKTASVSVTLDGATYTTVTVGGAAEDTIRN
FT                   VENIWGGTGNDSLSGDANANLLSGGGGSDILFGGAGADIFQFDFALGSTNVDTVLDFTA
FT                   GDRLFLSKSIFTSLSGGTLAATQFYAAADATAAQNVNQKIIYDTTSGALYYDADGSLSG
FT                   HTAVQFAVFSTHPGLTAGDFVLVV"
FT   CDS_pept        91546..92715
FT                   /transl_table=11
FT                   /locus_tag="SM_b20080"
FT                   /old_locus_tag="SMb20080"
FT                   /product="formaldehyde dehydrogenase (glutathione)"
FT                   /function="formaldehyde + glutathione + NAD+ =
FT                   S-formylglutathione + NADH + H+"
FT                   /note="High confidence in function and specificity"
FT                   /note="deleted EC_number 1.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20080"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48480"
FT                   /db_xref="GOA:Q92X82"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X82"
FT                   /protein_id="CAC48480.2"
FT                   /translation="MKALTWHGKGDIRCESVPDPKIEDDRDAVIKVTACAICGSDVHIF
FT                   HGLIPSMENGDILGHETMGEVVEVGKGARGLEVGDRVVVPFTIACGECFFCRKGFYSAC
FT                   ERTNPDREKAAKLWGNSPAGLFGYSHLLGGYSGGQAEYLRVPHADVGPIKVPDELTDEQ
FT                   ALFLSDIFPTGYMAAEFCNIEPGQTIAIWGCGPVGQMAIRSAFLLGAERVIAIDSIPER
FT                   LRLAESAGAMTLDYMAEDIYDRIMEITHGRGADACIDAVGTEADSRASLDSLVDRVKVA
FT                   TFMGTDRPHVLRQAIHCCRNFGTVSVVGVYGGYLDKVPLGSAINRGLTLRMAQTPVQRY
FT                   LPSLLDRIRKGEIDPSFVVTHRGGLDDGPELYKTFAERKDGCIKVVLRP"
FT   CDS_pept        complement(92735..93445)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20081"
FT                   /old_locus_tag="SMb20081"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20081"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48481"
FT                   /db_xref="GOA:Q92X81"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X81"
FT                   /protein_id="CAC48481.1"
FT                   /translation="MSKLKVAAVADLHVKEDRSVSYTDLFAEISRAADVLVIAGDLTDL
FT                   GKPAEAELLAADLKSCTIPVVAVLGNHDHQCDAVEEVSSILVRAGVHLLDGQSVEISGV
FT                   GFCGTKGFIGGFGRHMLGAFGEAAIKTMVKTSVDEAMRLENALRATRAERALVVLHYAP
FT                   IPETVAGEPKEIYPFLGSSRLAETIDRFKVSAVVHGHAHQGAYQGRTPGGAPVFNVAAH
FT                   VEKPTGRPYAILEL"
FT   CDS_pept        complement(93442..94260)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20082"
FT                   /old_locus_tag="SMb20082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20082"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48482"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X80"
FT                   /protein_id="CAC48482.1"
FT                   /translation="MTSIPPRSPSEHPSEPLALPRLVDEEAEAFVAEAIAELGRSQIPF
FT                   LIAGTFAVSAHTGISRPTKDLDVFCKPGDYTRILNHFKALGYAVEIEDDRWLGKVFKGK
FT                   SFFDVIFSSPNGTMMVTDAWFANALLTEIGASTCAIVAPTELVWSKAFIQLRHRYDGAD
FT                   VAHLILKAHDRIDWARLLGYMEAHWEVLLIHLLNFRWIYPSERDKVPLWLMDELLSRLA
FT                   AQRDLPLPLTKICRGRMYSRPDYEIDVKEWGFADVGGDSDISAETEDTES"
FT   CDS_pept        94552..94791
FT                   /transl_table=11
FT                   /locus_tag="SM_b20083"
FT                   /old_locus_tag="SMb20083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20083"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48483"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X79"
FT                   /protein_id="CAC48483.1"
FT                   /translation="MPVISPTIHTQQNSRELECQRAMEDEFLVLTALAEEAGWSWQEIA
FT                   LAMLELTEQYVAAMRPSSAMEARSLLRSHSKSLH"
FT   CDS_pept        complement(94903..95076)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20084"
FT                   /old_locus_tag="SMb20084"
FT                   /product="hypothetical protein TRANSMEMBRANE"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20084"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48484"
FT                   /db_xref="GOA:Q92X78"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92X78"
FT                   /protein_id="CAC48484.1"
FT                   /translation="MLKWALIFFVISLIAGFLGFSGVSAATAGIAKILFYIAVIIFLVF
FT                   LVLALAVGGAVT"
FT   CDS_pept        complement(95128..95274)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20085"
FT                   /old_locus_tag="SMb20085"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20085"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48485"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X77"
FT                   /protein_id="CAC48485.1"
FT                   /translation="MATNVKDGKTAKSSKGTHGGNRAGDQAKKDDVKKSSQAAGKDPNR
FT                   GSR"
FT   CDS_pept        95472..95774
FT                   /transl_table=11
FT                   /locus_tag="SM_b20086"
FT                   /old_locus_tag="SMb20086"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20086"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48486"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X76"
FT                   /protein_id="CAC48486.1"
FT                   /translation="MKNIVFGVAVLLSAAAAPAFAQTAGNTPAIATPDRQNPTAPVPGK
FT                   NSFTEDQARERMQEAGYTDVKELKLDDKGIWRATAMKDGKSVSVTLDFQGNVVAL"
FT   CDS_pept        95797..96402
FT                   /transl_table=11
FT                   /locus_tag="SM_b20087"
FT                   /old_locus_tag="SMb20087"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20087"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48487"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X75"
FT                   /protein_id="CAC48487.1"
FT                   /translation="MRTVAGLFDDYGEARGAVSDLEAAGFPSENISIVANNAGDRYSGD
FT                   GSAVASGAGAGAGLGAVGGGTLGLLTGLGLMAIPGVGPVVAAGWLASTAAGAAAGALAG
FT                   GAAGGIIGSLTDSGIEEEDAHLYAEGVRRGGTLVVVRTEEPLVAQADGILRNRDAVDIS
FT                   VRRRAYTEDGWTRFDTASSPYSLDEIERERERLSRPAL"
FT   CDS_pept        96557..98533
FT                   /transl_table=11
FT                   /locus_tag="SM_b20088"
FT                   /old_locus_tag="SMb20088"
FT                   /product="conserved hypothetical protein"
FT                   /function="Protein-L-isoaspartatecarboxylmethyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20088"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48488"
FT                   /db_xref="GOA:Q92X74"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X74"
FT                   /protein_id="CAC48488.1"
FT                   /translation="MIDFSRARERMITSHLSRRGIRDRHVVEAMGVVPREAFVDPGFEE
FT                   FAYEDSALSISHGQTISQPYIVALMIERAEVQPGDTVLEIGTGSGYAAAVLSRIAAYVY
FT                   TIERHAGLAEVAERRFAELRYGNIDVRVGDGTAGWPEAGPFDAILVAAGGPEIPHALKE
FT                   QLDLGGHLVIPVGPPEEQRLMKVTRVNATTFEEQDLGGVRFVPLVGEYGWHEERAQSRA
FT                   RPRPAPTLPELVAEAAEPLPDLDDPAFGLLFDRFAGRRIVLLGEASHGTSEFYRARAAI
FT                   TRRLIEEHGFAIVAVEADWPDAAAVDRYVRHRRQGIRLDAPFQRFPTWMWRNREVMDFV
FT                   EWMREHNGRRSLPDRAGFYGLDIYNMRGSISAVLRYLDETDPEAAAVARERYGCLTPWQ
FT                   NEPSTYGRAAMTAGFRKCEEAVVRQCRELLEKQLEAGRDSGDELLDAVQNARLVASAER
FT                   YYRIMYYAGADSWNMRDTHMFETLEHLLNARGARSKAVVWAHNSHIGDARHTDMGMARE
FT                   ELNIGQLCRERFGDQAALIGFGTHGGHVAAASDWNGDMEVKPIRPSLEGSYERVMHDSG
FT                   VGCFLIDFARHARLRDGLLKPLLERFIGVIYRPDTERFSHYAHASLPRQFDGFVWFDQT
FT                   TPVEPLGAQHIKAGVPDTFPFGL"
FT   CDS_pept        complement(98552..98875)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20089"
FT                   /old_locus_tag="SMb20089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20089"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48489"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X73"
FT                   /protein_id="CAC48489.1"
FT                   /translation="MQEELKIYRLSPLAEPDDPNWQNASYQGEVVVAARSSGDARIVAS
FT                   EAELDFLEIDAKPAEGVTTDMASAFRSEKLYTVVEEGPAPDGTERGVLRGEVSVDNIIS
FT                   TQL"
FT   CDS_pept        complement(98879..99070)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20090"
FT                   /old_locus_tag="SMb20090"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20090"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48490"
FT                   /db_xref="GOA:Q92X72"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X72"
FT                   /protein_id="CAC48490.1"
FT                   /translation="METGKPQVSRFGLDNRRKVHMSKLLAAAVIVVLVVIAALWMMFPL
FT                   DQSAESGQPPPHAIDQSE"
FT   CDS_pept        99186..99692
FT                   /transl_table=11
FT                   /locus_tag="SM_b20091"
FT                   /old_locus_tag="SMb20091"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /note="conserved hypothetical protein,, putative yciE
FT                   gene,DUF892 protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20091"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48491"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X71"
FT                   /protein_id="CAC48491.1"
FT                   /translation="MATANEHLVAWLRDAHAMEEQAITMLTSQSSRLENYPELKTRIDR
FT                   HLQETKDQAAMLERCLERLDGGTSSIKDISGKIVAFGQGLSGLFVSDEVVKGTLASYTF
FT                   EHMEIASYRILIAAAEQAGDQETKRVCESILQQEIAMAEWLAQNAGEITRKFLERDQRD
FT                   VTAKH"
FT   CDS_pept        complement(99778..100536)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20092"
FT                   /old_locus_tag="SMb20092"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20092"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48492"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X70"
FT                   /protein_id="CAC48492.1"
FT                   /translation="MLRVPKAMRQRIRFLTYNVHSCFGTDRRLDPARIAAVIAECQPDV
FT                   IALQEVDVGRARTGGIDQAHMIATHLNMEAEFHPALHLEDEKYGDAVLTALPMRLIKAA
FT                   PLPSSSEPRGALWVEIDVAAVKLQVIVTHLGLRGAERLRQATALLGPGWLGGMAQGDAH
FT                   VVLAGDLNATGRSTAYRLLARQLSDAQLLTGVKPRPTFPSRLPLLRIDHVLVGKGIEVA
FT                   SCRVHGSTLARSASDHLPLLAELDVVMRDK"
FT   CDS_pept        100574..101515
FT                   /transl_table=11
FT                   /locus_tag="SM_b20093"
FT                   /old_locus_tag="SMb20093"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20093"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48493"
FT                   /db_xref="GOA:Q92X69"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X69"
FT                   /protein_id="CAC48493.1"
FT                   /translation="MSRKILARLFIAAGICVAGWLIYRTLSQHSFHEIAGSIMRIPARN
FT                   LFVGIGFVFLSYFCLTLFDTLAIRYVGRKLAYPQIAIASFTSLSIGHNVGGAALSSGAV
FT                   RYRFYSRWGLSAEEVAKVILFCGVTVGLGLVALAGLCFLIVPSGAARLTGFSTTGAFLL
FT                   GTACIAAAAGYVLLAYFLRGSVRIFRWTFEMPSVGIAALQVVVGVANFLCVSAALHQLL
FT                   SAFEEVSFIDTAMAYVGAGVTAIVSHVPGGIGVLEATIAFLLGSSASLGALIAFRAIYF
FT                   FLPLPLGLISLSVAEFVARRDEEKSLVSKAKS"
FT   CDS_pept        complement(101410..103182)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20094"
FT                   /old_locus_tag="SMb20094"
FT                   /product="phospholipase D"
FT                   /function="A phosphatidylcholine + H2O = choline + a
FT                   phosphatidate"
FT                   /EC_number="3.1.4.4"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20094"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48494"
FT                   /db_xref="GOA:Q92X68"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X68"
FT                   /protein_id="CAC48494.1"
FT                   /translation="MGDWRVRLKARNLLISSCREMFRHGKAPPTWSPRRLCSATMLLLE
FT                   QITVERDSFPVATYGIGSLDWKSAFTGNPAGRWRRTSRPIIKEAENVWRSAPARHLSFL
FT                   VDAAAYYACLDSTFDQAEEQIWITGWDFDPRIKLRPDGPQAESLGSRLERLAAQKPKLK
FT                   IRILVWAMGPIYSGKSLRLFRRQQWAAHPQIELRFASHRALRGSHHQKLVCIDDSIAFA
FT                   GGIDLTARRWDTPEHAAENELRRDPDGKPYDPVHDIQVALEGEASRAIGDLCRSRWKAS
FT                   TGEEIEAPPARALAWPNGTVPVLEDCPVAIARTEPGSGKRRGRQEALRLTLDALRSAQS
FT                   HIYIENQYFASGRIGQLLCDRLQEPDGPEVVVITTRSSHGLLERIVMGGNRDRLVRRLK
FT                   RADRYGRLRVAYPVVPAADGSEQEVIIHSKVVAIDDRFFRVGSSNFNHRSASLDTECDV
FT                   AVEAANEGQRAAIARVRNGLIAEHLDIEADAVEKALRETNSLVAALDRLNTRRRGIRAF
FT                   DGIDDDGATSLVWGTEIVDPQRPIRPFYRTHKLVRRWIGQLFALLTRLFSSSRRATNSA
FT                   TESEIKPSGSGRKK"
FT   CDS_pept        103207..105024
FT                   /transl_table=11
FT                   /locus_tag="SM_b20095"
FT                   /old_locus_tag="SMb20095"
FT                   /product="acetolactate synthase"
FT                   /function="2 pyruvate = 2-acetolactate + CO2"
FT                   /EC_number="2.2.1.6"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20095"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48495"
FT                   /db_xref="GOA:Q92X67"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X67"
FT                   /protein_id="CAC48495.1"
FT                   /translation="MPNTSDILIDTLIEWKFDVVFGLPGDGINGIMEALRRRQDRIRFV
FT                   SVRHEQSAAFMACAYAKFTGRLGVCLATSGPGGTNLLTGLYDAKLDQMPVLAITGMQYH
FT                   DLIETFSQQDVDLTRVFENVAVYNAQVNDAAHMENLANLACRSALSKRGVAHLSIANDV
FT                   QERMADGGRSRRNRPGHMPSRYFAGKLVPLESDLSRAADLLNAGRKVAILAGRGALEAK
FT                   EALRETAELLGAPVAKALLGKAVLPDDDPLTTGGIGILGTAPSQEIMQQCDTLLIIGST
FT                   FPYIEYYPRPNTAAGIQIDHDPQRIGLRYPVEVGLVGEAGETLRMLNKRLKRKQDRSFL
FT                   ERAQEQTRNWRRELRAMEGDRSSPLKPQAAVAAFGRRIAKKGIVVTDSGQNTELAARHL
FT                   DLGADHMFAVSGALASMASGLPYAIAAGIAMPDRPVYAVVGDGGFAMQLGEFATAVGYR
FT                   LPLKLLVIRNDMLNQIAWEQMMFLGNPQFACELPPIDFAAAAEAMGGRGFTVRSFGELD
FT                   GIMDQAFAVDGPVVIQALVDRYEPLMPPKMPADYARNFRAALPETPGHEKIEEILRNSS
FT                   VGRKVTDEEPQPPHEAAPDENTGELPGIP"
FT   CDS_pept        105053..105493
FT                   /transl_table=11
FT                   /locus_tag="SM_b20096"
FT                   /old_locus_tag="SMb20096"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20096"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48496"
FT                   /db_xref="InterPro:IPR009794"
FT                   /db_xref="InterPro:IPR036698"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X66"
FT                   /protein_id="CAC48496.1"
FT                   /translation="MPSSVRTGSMGFEDPRMTHAIGSRRWAIADGYIPSSSASDDPALV
FT                   SPALVSHESACILNTGDTPAKVEIMLFFSDREPAGPYRVTVAARRTVHLRFNDLDDPER
FT                   VPRDTPYASLIESDTPIVVQQTRLDSRQPPHALLSTIAYCQE"
FT   CDS_pept        105495..106724
FT                   /transl_table=11
FT                   /locus_tag="SM_b20097"
FT                   /old_locus_tag="SMb20097"
FT                   /product="hypothetical oxidoreductase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20097"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48497"
FT                   /db_xref="GOA:Q92X65"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X65"
FT                   /protein_id="CAC48497.1"
FT                   /translation="MPNTPWSATSQNLGQDFHNWSGGLRFRPSRLDVPEDEETVAALVR
FT                   AAARQGRSIRPVGSAHSSSEIYVTDDILVSMAGICGLREHDAQHHRATVGAGSQLTELS
FT                   KELQAAGMTLSNFGDVATQTVGGAIGTGTHGSGRDFPNLSMMLVGGRLVTAGGEIRTFD
FT                   VEEEPDFVRALRVSFGTLGILTWTTLKLEPLHDLHRQEWCLAFEPCMEVLDKLSRENRN
FT                   FDFYWYPRSDEVKIRCLNPPGEEKDYGAFARLAKDETGPPHEVIPQHSDLPHRFEEMEY
FT                   SMPAEAGPECLGKLRARIKERWRRSVGWRLLFRYIKADDSWLSEAYGRDSVSISLHQNA
FT                   TLPYWDFFLDLEPIMRDHGGRPHWAKKHSLRAAELRPLYPMWDRFLALRQEMDPGGRFL
FT                   TRYLRGLLGC"
FT   CDS_pept        106733..107128
FT                   /transl_table=11
FT                   /locus_tag="SM_b20098"
FT                   /old_locus_tag="SMb20098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20098"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48498"
FT                   /db_xref="InterPro:IPR009794"
FT                   /db_xref="InterPro:IPR036698"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X64"
FT                   /protein_id="CAC48498.1"
FT                   /translation="MRAIGKRRWTIAGGRIPLESNGPEPEFTSRDEIAVLNCCDSPARL
FT                   RIHIHYADRPAVGPYEVEVAARRVRRIRFNDLIFPEALPLDEDFGAVIDADIPVVVQFT
FT                   RLDSGTASRIAVAAAAYAERNLQGSGR"
FT   CDS_pept        107125..108759
FT                   /transl_table=11
FT                   /locus_tag="SM_b20099"
FT                   /old_locus_tag="SMb20099"
FT                   /product="maltose alpha-D-glucosyltransferase"
FT                   /function="maltose = alpha,alpha-trehalose"
FT                   /EC_number="5.4.99.16"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20099"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48499"
FT                   /db_xref="GOA:Q92X63"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X63"
FT                   /protein_id="CAC48499.1"
FT                   /translation="MKEAPWFSSSVIYGIDVRRFSDGNGDGIGDFIGLKERVSYLHYLG
FT                   IDCVWLSPFFRSPFADNGYDVSDYYSIDPVLGTLDDFLDFLHAAGEQGIRVVVDLVANH
FT                   TSSEHPWFQAARRDARCRFRDYYVWSESPPPVAPDNKTAFPGEESSVWTYDDLAQAYYF
FT                   HKFRHFQPDLNIANPAVRDELLRVVDYWLTLGVDGFRVDAAPFVIGETGIEHADPRDPQ
FT                   GFLREMRKLVDGRRQDGLLLGEADLAPEKLRSYFGDGKLDLLFNFVLCAAFAASLAGQK
FT                   ADPIGQALSIMPEPPPHRGWANFLRNLDELNLDRLPEDIREETFAAFAPDEEMRIYGRG
FT                   IRRRLAPMLDGNRARIELAFSLLLSSPGVPLILYGDEIGLGEDLSRPGREPVRVPMQWN
FT                   AGSNAGFSTAQRAKLVQPPVTDGPFSFKRVNVEAQREDPGSLLNRVRAMILARRRHELF
FT                   NRGRPVMLHTGDPALFALAYSDGTELFVVLHNLSDGKRRAELELPGAIDARLNDILGEG
FT                   EVELSGQRLAIGLGPFGYVWLHSGKKD"
FT   CDS_pept        108761..109747
FT                   /transl_table=11
FT                   /locus_tag="SM_b20100"
FT                   /old_locus_tag="SMb20100"
FT                   /product="putative dehydrogenase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20100"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48500"
FT                   /db_xref="GOA:Q92X62"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR023907"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X62"
FT                   /protein_id="CAC48500.1"
FT                   /translation="MASIGYHASHEQFTPLDLLNWARAAEEAGFDCTMSSDHLAPWSER
FT                   QGQSGFAWAWLGAALQATERKFGLVTVPCGWRYHPVITAQAAATLAQMFPRRLAWLALG
FT                   TGEALNEHVVGGAWPGKAERNGRLREAVDVIRELFAGRTVTRDAPIAVSEARLYTLPET
FT                   PPALIAAALTPETAEGAGEWADGLITVNQSPEKLAAIAQAFKRGGGDGKPLCLQVHVSY
FT                   ARSDEEARRNAFDQWRSNALSAFQSETLRTPGDIETATSGVRPEDLDAYVRISSDPGRH
FT                   LAWIEEDIAAGFDEIYLHNVGRNQLEFIDVFGRTVLPRVRASRPATE"
FT   CDS_pept        109808..111088
FT                   /transl_table=11
FT                   /locus_tag="SM_b20101"
FT                   /old_locus_tag="SMb20101"
FT                   /product="probable oxidoreductase"
FT                   /function="Predicted dehydrogenase"
FT                   /EC_number="1.2.1.19"
FT                   /note="probable oxidoreductase, FAD dependent,, putative
FT                   aminobutyraldehyde dehydrogenase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20101"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48501"
FT                   /db_xref="GOA:Q92X61"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X61"
FT                   /protein_id="CAC48501.1"
FT                   /translation="MPAESGGRGCGLYDYCIIGGGIVGLATAMALQERMGGASIVLLEK
FT                   ERELARHQTGHNSGVIHAGIYYAPGSLKAKLCREGAEATKEFCTGNGISFETCGKLLVA
FT                   TNDAEIERMESLEERAQQNGIEYTRLSKSQLRSDEPNIAGLSALLVHATGIVDYSAVCR
FT                   AMAERIEVRGGEIRCGVEATAIAEEDGGVRIASATGRIEARRLIACAGLQSDRIALMAG
FT                   LSIDHRIVPFRGEYYVLPASKAGVTRRLIYPIPDPNLPFLGIHLTRTIDGGMTVGPNAV
FT                   LGFAREGYPKGSFKAADVANMAAFPGFWKMAAKNWRSAITEFANSASRFRYLRECRKYC
FT                   PSLTIDDLAVPQAGIRAQAVMADGSLVHDFLFKQTERMLHVCNAPSPAATSAIPIGRMI
FT                   VDRLLDGAPPATERSQSLHGTHAQLHR"
FT   CDS_pept        111176..113059
FT                   /transl_table=11
FT                   /gene="acoR"
FT                   /locus_tag="SM_b20102"
FT                   /old_locus_tag="SMb20102"
FT                   /product="putative acetoin catabolism regulatory protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20102"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48502"
FT                   /db_xref="GOA:Q92X60"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X60"
FT                   /protein_id="CAC48502.1"
FT                   /translation="MVSHSEHIREIERVSRGLPVRRDETVVKSWLRCLEHHRLDPAQSC
FT                   EAYIVPETRLREHRQQSEDLIAIARSGLENLFRQVAGQNYVLLLSDREGVTVEFLGDPL
FT                   FGNSLRKAGLYLGSEWSEWRAGTCAVGACLETGEALTIHQTDHFDNTHTPLSCTAAPIY
FT                   DIQGELSAVLDISLLSSPILKASQNLALHLVSATVRRIELANLMAQARNQWVLRFSRSP
FT                   EFLDVDPEAAISIDGLGRIAGMTHAGAKILARSTGLDWRDPQQLIGEPVSRFFDIEVDN
FT                   LSDLTRRRPTRERLVFARDGNALFAHAIEPHSKVRAPLVSREQIPPALRRLGGDAPVIA
FT                   ALQAKAAKLARTRLPILIQGETGTGKEHLARAIHEGSGLEGPFVAINCAAIPEQLIESE
FT                   LFGYLPGAFTGASAKGRKGLIEQADGGTLFLDEIGDMPLALQSRLLRVLAEGEVLPVGG
FT                   TAPRKVRIRIVSASHRPLQTLVSQGAFREDLYYRLNAATLTLPALRDRPDFDWVLEQLL
FT                   KRHGDGELILSPAALSALKAHDWPGNIRELDNVIGVAAALAENGVVELGDLPDQLLANA
FT                   DTVGGNEASATLSLTLTACNWNISEAARRLGLDRSTVHRQIKRYRLKPHRH"
FT   CDS_pept        113274..115076
FT                   /transl_table=11
FT                   /locus_tag="SM_b20103"
FT                   /old_locus_tag="SMb20103"
FT                   /product="probable FAD-dependent oxidoreductase"
FT                   /function="Predicted flavoprotein involved in K+ transport"
FT                   /EC_number="1.14.13.8"
FT                   /note="probable FAD-dependent oxidoreductase,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20103"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48503"
FT                   /db_xref="GOA:Q92X59"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X59"
FT                   /protein_id="CAC48503.1"
FT                   /translation="MLEESPGTRVDTVLAKLGKALEQGDIDAAVNLFQADCYWRDLVAF
FT                   TWNLKTMEGQDQIRDMLTTQLAAIKPARLRQDEKEPASAGAGVTEGWFEFETEVARGHG
FT                   HIRLRNGLIWTLLTTMTELKGHEEPKGLRRPLGAEHGHDPDRKTWKEKREAEAAELGYT
FT                   TQPYAVIIGGGQGGIALGARLRQLGVPTIIIEKNERPGDSWRKRYKSLCLHDPVWYDHL
FT                   PYIPFPENWPVFAPKDKIGDWLEMYTRVMELNYWSSTLCKSARYDEATEEWTVIVERNG
FT                   EEVVLRPKQLVLATGMSGKPNVPKLEGQDIFKGEQQHSSQHPGPDAYRGKKVVVIGSNN
FT                   SAHDICAALWEGGADVTMVQRSSTHIVRSDTLMEIGLGDLYSERALAAGVTTRKADLIF
FT                   ASLPYRIMHEFQIPLYEKMRERDAKFYADLEKAGFMLDWGADGSGLFMKYLRRGSGYYI
FT                   DVGACDLVIDGSIKLKSGSDVSHLTEDAVVLKDGTVLPADLVVYATGYGSMNGWAADLI
FT                   SKDVADKVGKVWGLGSDTPKDPGPWEGEQRNMWKPTQQEALWFHGGNLHQSRHYSQYLS
FT                   LQLKARCEGISTPVYGLQERHHLS"
FT   CDS_pept        complement(115152..115910)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20104"
FT                   /old_locus_tag="SMb20104"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20104"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48504"
FT                   /db_xref="GOA:Q92X58"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X58"
FT                   /protein_id="CAC48504.1"
FT                   /translation="MMDYLLLAASGFIAWIVSTIGGGGGAMLLVPLIGFIAGAQAVAPV
FT                   VAVATLIAGGGRILIFFGDIEWRVAAWGLPGAALGGVLGAAAFSNTSAEWLQIVVGLFL
FT                   ISTIFQYGFGRRERTFAVATWWFFPAQFVVGFLSGLIGAIGPILNTLYLNAGITKEKMV
FT                   GTKTAISLPMHLAKLRTYTALGALTGKLLLFGIAAGLGALLSNWLAKRVLTNMSELNFR
FT                   AIVVGFMALSGAVMIWEQRETLLRIFPGST"
FT   CDS_pept        complement(116012..116644)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20105"
FT                   /old_locus_tag="SMb20105"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20105"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48505"
FT                   /db_xref="GOA:Q92X57"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X57"
FT                   /protein_id="CAC48505.1"
FT                   /translation="MEYLRERILALDLAPGTALSRVELQKQFGLSQTPVRDALMRLEEE
FT                   GLVTVYPQYATLVSKIDINLARQTHLMRRAVEQEAVFNLAEKANRGQIADRLRVANTKL
FT                   KALASKEHAEFLAADRAFHFIIFEEAGLEHIWPIIRRHSGHIDRLRRLNLVNVGTKRVV
FT                   DTHDMIIEGIEKGAPVEAAQAMKTHLSGTLSMIDDIAARYPDYIELG"
FT   CDS_pept        116824..117555
FT                   /transl_table=11
FT                   /locus_tag="SM_b20106"
FT                   /old_locus_tag="SMb20106"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20106"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48506"
FT                   /db_xref="GOA:Q92X56"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X56"
FT                   /protein_id="CAC48506.1"
FT                   /translation="MPEKSPILESLAEARPSSYADQVYGRILHDILNGIFQPGARLPTE
FT                   NELAERFGVSRPVVREALARLRVDGLVEARRGSGTYVLSRPSQDLPNLADLEDISRFLR
FT                   YQELRFYVEGQAAALAAERRTEKQLAAILEAHEAFAHEVGRGAFLPESDRRFHLAICEG
FT                   TGNEFFAKALEGPEVSLTSFMNVSLALTRSGSQARARRVIAEHAEIVEAIRTKDAVWAR
FT                   VAMETHIINARRRMTDGTIDT"
FT   CDS_pept        117623..118579
FT                   /transl_table=11
FT                   /locus_tag="SM_b20107"
FT                   /old_locus_tag="SMb20107"
FT                   /product="conserved hypothetical protein"
FT                   /function="Dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase"
FT                   /EC_number="4.2.1.52"
FT                   /note="Dihydrodipicolinate synthetase family (DHDPS)"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20107"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48507"
FT                   /db_xref="GOA:Q92X55"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X55"
FT                   /protein_id="CAC48507.1"
FT                   /translation="MQTRLGARDYAASVVAVPPIALNADLTVNADANRAIIRHIEAGGV
FT                   RILLYGGNANLYHFGLDDYRAGMEAVIAAAAPQTGLITSIGPDFGKAMAQAPIARDLGF
FT                   KNVMLLPTQFPADPAGVANGVRRLAAILGHGLVLYLKRENYVDPDELARLVSEGAVDFV
FT                   KYAVERADPAQDAYLDAVIGAIGKDRMASGMGETPIHDHLGRRALTTYTSGAVCIAPSA
FT                   AMELLTLYKAGRGAEALELSQPFLEFERVRTDLGGLQALHDGMRLAGIADTGPLMPMIS
FT                   NLGAAKLDPVGAAVEALKAAEAACLRRSGKAAAAASA"
FT   CDS_pept        118703..120211
FT                   /transl_table=11
FT                   /locus_tag="SM_b20108"
FT                   /old_locus_tag="SMb20108"
FT                   /product="putative ABC transporter periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20108"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48508"
FT                   /db_xref="GOA:Q92X54"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X54"
FT                   /protein_id="CAC48508.1"
FT                   /translation="MTIRYCTRAVALLTATLFSGVAMAAEGEVKIVLPEQPANLDPCRS
FT                   IRSDIGRIINSNITETLTVIDTEKGTVGPWLAEKWEQVDDLTWRVHLKSGVKFQDGAAF
FT                   DAEAVVKSINRLMNPGLTCDSRSKFGDVKLTPKAVDAQTVEISSDSPVPIMPTLLGTVQ
FT                   IVSPNMPFDKESNDPVGTGPYVVESKSNEQIVLKRHDAYWGAKPDVTRATYVWRSESAI
FT                   RAAMVESGEADMTPSIAVQDATNAESDFAYLNSETTRMRIDAQIPPLDDVRIRKALNMA
FT                   IDWDGMGEALFGKDVLRASQMVVPGVRGHNPDIKPWTYNPEEAMKLVEEAKAAGAPVDK
FT                   EIVLIGRNGFFPNSAESLEAMRSMWQEIGLNVSIRQLEAADWVRYLDKPFPEGRGPTLF
FT                   QQQHDNNTGDAGFTAPVMYLSEGQYSTIADPDLDVVLKKAMAATGDEREKLFQEVFAKV
FT                   HDEIVADVPMYHMIGYVRVGSRLDWKPDLKTNSEIALSEIHFKD"
FT   CDS_pept        120284..121207
FT                   /transl_table=11
FT                   /locus_tag="SM_b20109"
FT                   /old_locus_tag="SMb20109"
FT                   /product="putative oligopeptide ABC transporter permease
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20109"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48509"
FT                   /db_xref="GOA:Q92X53"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X53"
FT                   /protein_id="CAC48509.1"
FT                   /translation="MFAFILRRAGQSLIAVIGLLVLVFFLSRLTGDPAYLYLPLDSSEA
FT                   QRQAFSETHGFNDPLVVQFGRYLVDLARFDFGDALSRNRPAMEVALEAFPQTLKLAVIA
FT                   IVLSLCFAVVVGSLAAARPNSLFDKIASTASLAGASAPDFWVAIVAILVFSVGLGLLPT
FT                   SGTGTALHWIMPIFVLTLRPFGLLVQVVRGTMMGALASPYVKTARAKGVNRSRIVFRHA
FT                   LRNSLLPVITVAGDLAASLVNGAVVVETIFGWPGIGKLMIDAIVRRDFALIQATVLVTA
FT                   IAIFVLNIAIDLVYARLDPRIRFETR"
FT   CDS_pept        121204..122151
FT                   /transl_table=11
FT                   /locus_tag="SM_b20110"
FT                   /old_locus_tag="SMb20110"
FT                   /product="putative oligopeptide ABC transporter permease
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20110"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48510"
FT                   /db_xref="GOA:Q92X52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X52"
FT                   /protein_id="CAC48510.1"
FT                   /translation="MSATAMTTSADTPETKVSRFQILRLISRNWLALAAVIFLLLVVAC
FT                   AVFGPWLMGDLIDKPNFRARNMAPFSLSQGWTYVLGADTLGRSLLARLVVGAQNTIGIA
FT                   FFAVFCSVVIGGMLGLIAGYSRGAAGTMIMRGADIVMSFPSLLLALIVLFSLGPSVTNL
FT                   ILVLAITRVPIYLRTTRAEVLEVRERMFVSAAVALGANHTRILFRHIAPIVLPTLVTIG
FT                   AIDFATVVLAESSLSFLGLGIQAPEFTWGAMVATGRGYLSTAWWIAFWPGLAILLTTLS
FT                   LNILSSWWRTYADPQQRWRIELARSKKGIPEKRK"
FT   CDS_pept        122148..123788
FT                   /transl_table=11
FT                   /locus_tag="SM_b20111"
FT                   /old_locus_tag="SMb20111"
FT                   /product="putative oligopeptide ABC transporter ATP-binding
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20111"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48511"
FT                   /db_xref="GOA:Q92X51"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X51"
FT                   /protein_id="CAC48511.1"
FT                   /translation="MTGPHLLEVKDLTVDFLSLGGAFRATSGVSFHVDAGETLVILGES
FT                   GSGKSVSASAIMGLIDTPPGDICAGSVAYRGRDLSSLSEGERRDLNGRRIAMIFQDPLS
FT                   HLNPVYTIGWQLEEVFTVHGVASGAEARQRAIEILGRVGIPEPEKRIDQYPHQFSGGQR
FT                   QRIMIGMAIALRPEILIADEPTTALDVSVQAQILELLKKLQAEDGLAIIMITHDLEVAA
FT                   NMADRVIVMKSGRIVEEGEARAVFENPAHSYTRTLINALPHADDRAPPRPARPAGKPIL
FT                   EVKNIDKFYTLSSGFFAKPARLHAVKNLSFDVAAGETIGIVGESGSGKSTVARVLLGLN
FT                   EASGGEALFHGRDVLKMDRKQLLAFRRKVQMVFQDPYSSMNPRMTVFDIVSEPWRIHKD
FT                   ILEKTRWRDRVTELLGLVGLNPEHAKRYPHQFSGGQRQRIAIARALACDPELVVCDEAV
FT                   SALDVSVQVQVIDLLAELRDRLGLAYIFITHDLPIVRHFADRIIVMKSGEIVEHATTEE
FT                   IFRNPQHAYTRQLINATPKPKWQTAADAA"
FT   CDS_pept        123785..124672
FT                   /transl_table=11
FT                   /locus_tag="SM_b20112"
FT                   /old_locus_tag="SMb20112"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20112"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48512"
FT                   /db_xref="GOA:Q92X50"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X50"
FT                   /protein_id="CAC48512.1"
FT                   /translation="MKKIALPAVVAGALLMGANSLVAAMDGVIVRFVAGEVHPIGIVFF
FT                   RNLASLIALYLLLCRRGFPLGIAQSSGRAMHFSVHAIRAVIKLLALVAAFIAVTEIPLA
FT                   SATAIAFTMPLFVALGSVLFLGERFSAARVFGLVAGFAGILIVVRPGAATFQSGAAWAL
FT                   ASAVGLAIVALLMKVSAEREDPLSIAWLNLLVTVPVAFVMALPFWQTPSLFSLALMTLQ
FT                   GIGGLFAQLSFARAMKLADASLLVIVDFIRLPIALILGLVLFGEPIRLEVVIGGAIILG
FT                   AIALLFHREGKRRG"
FT   CDS_pept        complement(124709..125641)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20113"
FT                   /old_locus_tag="SMb20113"
FT                   /product="(R)-2-hydroxyacid dehydrogenase"
FT                   /EC_number="1.1.1.272"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20113"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48513"
FT                   /db_xref="GOA:Q92X49"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X49"
FT                   /protein_id="CAC48513.1"
FT                   /translation="MTMLRDITILQAAELPEKTDLELKETFNTVRLPRDASAIGPFLSE
FT                   YGARIRGIAVRHAHIDAAMLDRLPALEIISSYSAGLDGIDVETAHARGVVVRNTSKILA
FT                   EDVADLALALSISATRGLMRGHDFVREGKWGESAFPLGRSLRSMKTGIVGLGHIGSAVA
FT                   ARLSVMGAPTAYYGPRRKPVDLPYFDGIGALAAWADLLIVTCPASPETIGLVNAAVLAS
FT                   LGSEGYLVNVSRGTIVDEQALITALAGNGIAGVALDVFEKEPFVPEALRTDPRVVLSPH
FT                   MGSGTRETRQQMGDSMVAALVEHFESRSA"
FT   CDS_pept        complement(125644..126369)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20114"
FT                   /old_locus_tag="SMb20114"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20114"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48514"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X48"
FT                   /protein_id="CAC48514.1"
FT                   /translation="MTTYVLSDETRRKFEGVSCATLCTALFKRGLRNQFIQDVRPVAPK
FT                   AKNMVGQAFTLRYIPAREDLNQLSAFQNPEHPQRAAVEKCPPGFVMVMDSRKDPRAASA
FT                   GSILVSRLMVRGVAGVVTDGGFRDSPEIGELDIPAYHSRPSAPTNLTLHQALDINVPIG
FT                   CGDVAVWPGDVVVGDREGVVVVPAHLADEIAAEAVEMTAFEDFVTEEVLKGRSIIGLYP
FT                   ATKDETKTEFAAWRRTKGR"
FT   CDS_pept        complement(126396..128117)
FT                   /transl_table=11
FT                   /gene="ilvD4"
FT                   /locus_tag="SM_b20115"
FT                   /old_locus_tag="SMb20115"
FT                   /product="putative dihydroxy-acid dehydratase protein"
FT                   /EC_number="4.2.1.9"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20115"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48515"
FT                   /db_xref="GOA:Q92X47"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X47"
FT                   /protein_id="CAC48515.1"
FT                   /translation="MTSTLRSARWFAPDDLRSSGHRSRLMQMGYDAKDWGEKPIIAILN
FT                   TWSDLNPCHAHFKHRIDDVKRGVLQAGGFPVELPVQSLSESSLKPTTMLYRNFLAMEAE
FT                   ELLRGHPIDGAVLMGGCDKTTPALVMGAISAGLPMIFLPSGPMLRGHYKGEHLGSGSDA
FT                   WKYWDERRAGTITDEQWIGVEEGIARSYGHCMTFGTASTMTAIAESLGLTLPGASSIPA
FT                   ADANHIRMSTRCGRRIVEMVHEKLGPEKIITEKSVANASAVAMATGCSTNAVVHLIAMA
FT                   RRAGVPLTLEDLDGISRTTPVIANIRPSGKQYLMEDFYYAGGLRALMAEMKELLHLDAM
FT                   TVSGFPLGATLEGAEVHNSDVIRPLSNPIYHEGSLAVLKGNLAPDGCVVKPSACEERLR
FT                   VHEGPALVFDSYPEMKAAIDDEDLDVTPDHVLILRNAGPKGGPGMPEWGMLPIPKKILK
FT                   QGYRDMLRISDARMSGTSYGACILHVAPESHVGGPLSLVRTGDIIRVDVANRTIDMLVD
FT                   EEILAMRRAAWTRPADKYERGYGWMFSKHIKQANEGCDFDFLETAFGTAVGEPDIF"
FT   CDS_pept        complement(128252..130456)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20116"
FT                   /old_locus_tag="SMb20116"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20116"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48516"
FT                   /db_xref="GOA:Q92X46"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X46"
FT                   /protein_id="CAC48516.1"
FT                   /translation="MGTNLSGGPAEAAPDVTSADDLGPAAVSRYERSSRSLKHGDTFAV
FT                   FDHNGDAFSSPSNPEGIFHRDTRHLSEFVLTLNGARSLLLSSTLRDDNATLDCDLTNPA
FT                   LVLDPGGEVLKHDLIHVRRTRFLWQEACYERLVLRNFDEVPRRLQVELSFAADFADLFE
FT                   VRGTPRRRRGTHHSALVGNARVVLAYDGLDGQTRSTTLRFDPEPQRLTGREASFVVELA
FT                   PHQAQSIFIEIACNSLEDNPHPPAFTFFLALRDARRALRYSASRAAAVVTSNAVFNEAV
FT                   RRSVTDLYMLLTETPEGPYPYAGIPWFSTVFGRDALITALETLWLDPEIAKGVLRHLAA
FT                   NQATDFDPAADAEPGKILHEMRYGEMAELGEVPFRRYYGSIDSTPLFIMLAGAYLDRTG
FT                   DLDTVRNLWPNVVAALDWIDRFGDRDGDGFVEYGSRTAKGLVNQCWKDSHDSIFHAGGN
FT                   LASGPIATAEVQAYVFGAWQAAARLSRKLGHVEDALRLERRAEELRIRFDTAFFDDELG
FT                   TYSLALDGEKNPCRVRSSNAGHALFTGIALPERAGRVVSTLMAQSSFCGWGVRTIAASE
FT                   ARYNPMSYHNGSVWPHDNALIAAGFVRYGFQAEAASIFEGLFAASTYTDLRRLPELFCG
FT                   FARQRARGPTFYPVSCVPQAWAAAAPLYLLQSMIGLGFDAGRMHVTLNEPTLPPFLDEV
FT                   VLKRLRVGSGMVDIALRRSRSQVVVDVLERRGGVKVLTTH"
FT   repeat_region   complement(130274..130299)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(130586..131686)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20117"
FT                   /old_locus_tag="SMb20117"
FT                   /product="hypothetical sugar transferase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20117"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48517"
FT                   /db_xref="GOA:Q92X45"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X45"
FT                   /protein_id="CAC48517.1"
FT                   /translation="MKIAQIAPLFERVPPKLYGGTERVVHHLTEELVRQGHEVTLFASG
FT                   DSMTSAKLIPCSDMALRLNPAVQDPIPYHMLMLEEVRRQANGFDVLHFHIDLLHFPLVR
FT                   SLAGKTVTTLHGRLDLPDLQPFYAAFPDVPLISISDDQRKPMPPVNWVATVHHGLAPDV
FT                   LPFTGQPRGDYLAFLGRISPEKRPDRAIEIAARVGMPLKIAAKVDKADEAYWLNEIEPL
FT                   VRRYPNVEFIGEIDECQKGEFLGNARALLFPIDWPEPFGLVMIEAMACGTPVVAFRCGA
FT                   VPEVIDHAVSGFIVDSMEEAVKAVHDLDRLDRHTVRATFDRRFTARRMADDYLDLYRAL
FT                   AGGAQRVMPIHAANESGAGPGSARVA"
FT   CDS_pept        complement(132167..132586)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20118"
FT                   /old_locus_tag="SMb20118"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20118"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48518"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X44"
FT                   /protein_id="CAC48518.1"
FT                   /translation="MLADSDERTLRMQMIPRNPRNGIYPATDDYVHAMEVSGAARFLFV
FT                   SGTMGLDPEGKAPDSLEEQLSLIWSNIRRILAEANMTTDNIVRLTSYLRDASYAEANQN
FT                   VRIAALGNRRIPTTAIVAETLVPEWLVEIEVVAAA"
FT   CDS_pept        complement(132609..132965)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20119"
FT                   /old_locus_tag="SMb20119"
FT                   /product="putative site-specific recombinase"
FT                   /function="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20119"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48519"
FT                   /db_xref="GOA:Q92X43"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X43"
FT                   /protein_id="CAC48519.1"
FT                   /translation="MTTTNPSRAACRQRRHGGNTLASWYEPHGVRQPRSVAARSHMVST
FT                   AFAGIADFERSLIVERTSAGRIAAKARGVRFGPSPALSAAQIENARKLIKDEEKTGPRS
FT                   LGSWVCIVRPFIGR"
FT   CDS_pept        complement(132946..133338)
FT                   /transl_table=11
FT                   /locus_tag="SM_b22004"
FT                   /old_locus_tag="SMb22004"
FT                   /product="probable plasmid stabilization system protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22004"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51277"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDB8"
FT                   /protein_id="CAQ51277.1"
FT                   /translation="MTRYASILPASVSDLTRRDAHRSFHPGGSRPARHAGSRYFRAASP
FT                   AVAARYVDSIVDYCGKLQTFPHRGTRRDDLRPGLRTLGFRRRVTILFEVADGTVNIIGV
FT                   YYGGQDYEAPLRDGDLTEIEHDDDES"
FT   CDS_pept        complement(133283..133558)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20121"
FT                   /old_locus_tag="SMb20121"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20121"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48521"
FT                   /db_xref="GOA:Q92X41"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X41"
FT                   /protein_id="CAC48521.1"
FT                   /translation="MRSTQQFSVTLPNEMAQMVKTKVSSGEYASESEVIRDGLRALQAR
FT                   DKALESWLRTEGVSAYDKLKANPSRALSVDQVRQHLASKRKRSDPA"
FT   CDS_pept        complement(133740..134075)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20122"
FT                   /old_locus_tag="SMb20122"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20122"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48522"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X40"
FT                   /protein_id="CAC48522.1"
FT                   /translation="MPRACANSGDRLDIEHLRFFRKRILDTAIKTAEQPAAAPAAPAAS
FT                   HTPVEPKRPAASPLPAGTYIPLYGLARQPKPTNCRPPIGKRWKKSAFERATTRVSGFRR
FT                   SGLWPRR"
FT   CDS_pept        complement(134261..135157)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20123"
FT                   /old_locus_tag="SMb20123"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20123"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48523"
FT                   /db_xref="GOA:Q92X39"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X39"
FT                   /protein_id="CAC48523.1"
FT                   /translation="MNVTLRQLQAFIAVAELGRFHLAADHLGLTQSAISILIKDLEVAL
FT                   KHRLFDRHTRMVSLTTAGAEFLPQARKIMSDLEIAVANVHELASLQRGRVTIAAAIVLA
FT                   ATLLPPVIARFVKRYPDISVQVRDMPEEEIRSALKRNEADLGIGTVSADDPEIQASVLM
FT                   RDQLTLICRSDHRFAKARQVSWASLAGEGVIGLAKDNPLRGLVDRALIASGVEVKTRYE
FT                   VRFSTTAISMVAEGLGIAILPENSRQLTTNVDVRIVELVDPVISRNISILQYRQPMLSP
FT                   AAAKMKEFLMGASRKLS"
FT   CDS_pept        complement(135279..136805)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20124"
FT                   /old_locus_tag="SMb20124"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20124"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48524"
FT                   /db_xref="GOA:Q92X38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X38"
FT                   /protein_id="CAC48524.1"
FT                   /translation="MAGKQLLLMDGIHKRFGPLIVSAGVTLDVEENEIHALLGENGAGK
FT                   TVLMSILCGVLSPNEGQIVFKGRPLKLGSPREAIKHRIGMVHQHFMLVPNLTVAENYVL
FT                   GQGSPFSMIRDMRAVHARILELSDRYGLDVAPDALVSSLSVGERQRVEILKVLYHGIEL
FT                   LILDEPTAVLTPQETDRLLHLLRQLVADGKTVIFISHKLDEVMRVSDRVSVMRDAKVVR
FT                   TVKTSETTARELARMMVGRDVLMYLPRAPLEPGRVVLSVEHLSCDGEAGLPALRDVSFE
FT                   VRANEIVGIAGVSGNGQSELALALTGLLPVASGSVTLDGTQLAGLSSYEINQLPMAHIP
FT                   EDRHRMGIVLPLPLTENVILQRFDKPPFSSRGLLDLNEITRQTRDLMRRFKVKASGPGD
FT                   RIRNLSGGNQQKLVVGRELDRRFDFLLINQLTRGIDIGATELVMHKILEQRSAGKAILL
FT                   ISTELEELFTLSDRILVMYEGRLVGEIPPDRSRLEEIGLLMAGKSPLSAA"
FT   CDS_pept        complement(136815..137747)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20125"
FT                   /old_locus_tag="SMb20125"
FT                   /product="ABC transporter, permease"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20125"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48525"
FT                   /db_xref="GOA:Q92X37"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X37"
FT                   /protein_id="CAC48525.1"
FT                   /translation="MEDVASLSFLAATIAASWRLAAPLMFASIGEVFSERAGVLNIGLE
FT                   GVMLAGAFAGFAAAFTSGSILLGVAAAVAAGVLVGLLFAFFTITIKADQIVVGAAINLL
FT                   GLGLTAFLFRAYFSSAGKGIEIAKPVDLPWLSDLPFFGEAFFRQNAFVYSTLPVAALAV
FT                   FVLYRTSFGLTLRAVGEHPKAVDVSGRSVALYRYGAVLICSALAALGGAFLTLAHSNQF
FT                   VEGISSGRGFIALAVVVFARWSPIGAFIVSLLFGVFYALQLQLQAQPVLFLPYQLFQAL
FT                   PYVMTIAALILVRNRVDTPSMLGVAYKKS"
FT   CDS_pept        complement(137756..138853)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20126"
FT                   /old_locus_tag="SMb20126"
FT                   /product="ABC transporter, permease"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20126"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48526"
FT                   /db_xref="GOA:Q92X36"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X36"
FT                   /protein_id="CAC48526.1"
FT                   /translation="MANSESGQPLAVVPQAYGALWRGLLGPLRTIIQPAAAVVLALACG
FT                   AALLAFNGYEARAVIDVMVLGVFQDTRSIAEILLKATPLILIGVGLCVAFRCSIWNIGA
FT                   EGQFYAGAIAATAAGVSFDGLTAWIYVPLVMIAGALAGAAWAAIAGLLKVYFRASEIVT
FT                   TIMLNYIAIIMTSYLVTGPLRDAAAAYPQSARLVQEAWMPRILPPTRLHIGILVALALA
FT                   VVMYIFLFRSTRGYALRVVGISPDAARYAGISVPRNIMLSICLSGSMAGLAGAFEIAGV
FT                   TRRLFQSISPGYGFEGIAVALLANNNPIGAVFSGLLFAILRSGSELMQITAQVPQVLVL
FT                   VIQGIVILSVVGFAVLRIPSMRPSE"
FT   CDS_pept        complement(139006..139986)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20127"
FT                   /old_locus_tag="SMb20127"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /function="Uncharacterized ABC-type transport
FT                   system,periplasmic component/surface lipoprotein"
FT                   /note="Involved in xanthine and xanthosine transport."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20127"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48527"
FT                   /db_xref="GOA:Q92X35"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X35"
FT                   /protein_id="CAC48527.1"
FT                   /translation="MITRRGCLGSAVAMAALIAAGPAFAEGSPFKMGLLVPGSVSEEGW
FT                   NRIGFNALKGVEAELGAEVSYVELQQNPASFEKAFRDFASQGYNVILGHGFEFQDAALE
FT                   VAPEYPDTVFLISSSYIFEGNVIGLNTDTSQPFYLMGVIAAKTGKKAGLVGGMEIPPIK
FT                   EAFEGFTNGVRSVAPDFPVSEVYIGNFTDATATKEASLSLISQGADFVLPNASGATVGG
FT                   FQAAAESGADVKTFSIFSDYTSVAPKNILGLYVADYARGVIRIVGDIRNGKKPTTNVEF
FT                   GLKDADVMKFTYNDQAANPVTEDVRKYVDEVKGKIAAGEIKTRQK"
FT   CDS_pept        complement(140042..141355)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20128"
FT                   /old_locus_tag="SMb20128"
FT                   /product="deaminase"
FT                   /function="Cytosine deaminase and related metal-dependent
FT                   hydrolases"
FT                   /note="Amino acid sequence is most"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20128"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48528"
FT                   /db_xref="GOA:Q92X34"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X34"
FT                   /protein_id="CAC48528.1"
FT                   /translation="MEWSHSMHTVLGTRHGGARRALLLRGCRIAGEAAAADERDILVGE
FT                   DGRIASIGHRLEVGPDVIGVDLRGALVSPGFVDVHQHLDKTGVLKFTPNPSGTLQGARE
FT                   AFARYARQAPEDDVTRRAARTMERCLARGTTAIRSHINVDKDAGFNGINALARLRSEWA
FT                   DRLTLQLVAFMTPHPNQDIEWLEKNIDAAVEQADAVGGTPAVAEDPMRYLDILFAAAER
FT                   HGRPIDLHLDEHLSPERPLFDAVFERVRRFGLQGRTVLGHASVLSALPRKEFERIRDQM
FT                   IDLDIAVVTLPAANLYLQGRSHDMLPPRGLTRVAELIRAGVAIATASDNIQDPFVPTGS
FT                   GDMLEIARWTLLAGHLRGDELATAYDMITAIPARMMNLTDYGIREGTWADLVVTDCEDV
FT                   SALVGGGPDCIQVLAKGRPVAAPASPAVEAIRALEDVP"
FT   CDS_pept        141805..142584
FT                   /transl_table=11
FT                   /locus_tag="SM_b20129"
FT                   /old_locus_tag="SMb20129"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20129"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48529"
FT                   /db_xref="GOA:Q92X33"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X33"
FT                   /protein_id="CAC48529.1"
FT                   /translation="MAASPFFRSARYRPPAGAAMSGPEAEQRVVQVIVEAIMHHRVAPG
FT                   ARLIERELAIASGASRSAIRNGLMRLAHAGLVELSPNKGASIAMCSPDEARQIFDARIV
FT                   IETATVEKLAGTIGETERARLRSFVEDERNAYEEGRMEEARHLSRRFHLLLAEMAGNDV
FT                   LTGVIRDLINRQPLLSWSRPDTEPRFCGNHAHSEIVEAIASGDGERAARLNMEHLRALE
FT                   RELVADRAAAMQAFRSVQANAASGESAQREDGDAGID"
FT   CDS_pept        142635..143498
FT                   /transl_table=11
FT                   /locus_tag="SM_b20130"
FT                   /old_locus_tag="SMb20130"
FT                   /product="probable oxidoreductase"
FT                   /function="Aerobic-type carbon monoxide
FT                   dehydrogenase,middle subunit CoxM/CutM homologs"
FT                   /EC_number="1.17.1.4"
FT                   /note="putative xanthine dehydrogenase and aldehyde
FT                   oxidase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20130"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48530"
FT                   /db_xref="GOA:Q92X32"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X32"
FT                   /protein_id="CAC48530.1"
FT                   /translation="MKPFEYYEPASLAEASDLLRRLGKDASIIAGGTDLLVEMKEELRS
FT                   VLHLVNIKKIPNLRDFTYDPAAGLRFGALVTVREIETSPHVIGNYPNLAKAVSLLGSVQ
FT                   VRNRATIVGNICRASPSADTIPPLIADGASLSVYNGGTERTILLEDFFTGPGRTVLSPG
FT                   DIVTGISLPAPRPTSGRAYIKHGRRKAMELATVGVAVSIEHVAGQCSDIRIALGAVAPT
FT                   VIRARRTEDLIRGRRIDAALLAEAAESAMQEATPIGNVRASAAYRRDMVGVLTRRAIGY
FT                   AMGGAQ"
FT   CDS_pept        143495..143980
FT                   /transl_table=11
FT                   /locus_tag="SM_b20131"
FT                   /old_locus_tag="SMb20131"
FT                   /product="probable oxidoreductase"
FT                   /function="Aerobic-type carbon monoxide dehydrogenase,small
FT                   subunit CoxS/CutS homologs"
FT                   /EC_number="1.2.99.2"
FT                   /note="putative xanthine dehydrogenase and aldehyde
FT                   oxidase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20131"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48531"
FT                   /db_xref="GOA:Q92X31"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X31"
FT                   /protein_id="CAC48531.1"
FT                   /translation="MNRLVSMTVNGEARELAVVPNRTLLDALRNEGSLTGTKKGCDVGD
FT                   CGACTVIMDGRPVNACLVLAIEAEGATIETIEGLQPAYDQPHLLQQKFMEHGGAQCGFC
FT                   TPGIIMMAKALLDENPDPSEDEIRFALAGNICRCTGYTKIIDAVRATAEELRKAGTL"
FT   CDS_pept        143977..146295
FT                   /transl_table=11
FT                   /locus_tag="SM_b20132"
FT                   /old_locus_tag="SMb20132"
FT                   /product="probable dehydrogenase"
FT                   /function="Xanthine dehydrogenase, molybdopterin-binding
FT                   subunit B"
FT                   /EC_number="1.17.1.4"
FT                   /note="putative xanthine dehydrogenase and aldehyde
FT                   oxidase,, putative coxL gene"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20132"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48532"
FT                   /db_xref="GOA:Q92X30"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X30"
FT                   /protein_id="CAC48532.1"
FT                   /translation="MNTYERIDRDLSDRDFTVVGKSVKRSDTLEKVTGTARYAGDVALP
FT                   GMLHAKMKRSNIAHARIRSIDTSKALALKGVKAVLTHEDVPRVLHAGSPHPRSASVTKD
FT                   QYILDDRVRYWGEGVAAVAAVSEEIAERAVALIEVEYEPLPGLFTIEAASVPGAPPIHE
FT                   NGLDRNQVLPPVFVTRGDVDRGFAEADLILEREYDLGRPTPAYMEPNVCVSQWDGNGKL
FT                   TMWTSTQSAFMVRGTLAEVLGVPLNKVRVIVDHMGGGFGAKQDLFQNEFLCALLARQTG
FT                   RPVKMEFSRKETFLGGRSRHPGKIWLKQGFTKDGRIVAREARVTFNSGAYGSHGPGVTN
FT                   VGTAALTSLYRCENVRLEGRCIYTNSPIAGAFRGYGVVQTYYALDLMMDEAAEKLGFDP
FT                   AEFKLMNAVREGDIAPSGHPIVGHGLGDCIRRVMEETNWHELRRREKPETVKRRGIGIG
FT                   CEMHGSSAYPGIKEQGNAIVKMNEDGTVTLITGTAGLGTGAHTALSQIVAEELGVPFEA
FT                   VSVVQGDTDIVPWDIGAFASHTTYLGGRAAQLAAADVRRQVLEHAAPMLKAEPENLAIR
FT                   DGFVVVTNGSNRSIRLSEAVGPQRGMPAVQLVGVGTYMPTKSYSFAAHFAEVEVDTETG
FT                   EVAVLQVVPVHEIGRVIHPIAAAGQIEGGIQQGIGHTLSEDYVIDLTDGRSLNPSFVDY
FT                   KMPLSMDMPSIRTIILETAPDPGGPYGAKGVGEDPIIAIGPAIANAIYDAIGVRFHHYP
FT                   ITPEQVLNALKSKANETRQ"
FT   CDS_pept        146295..147344
FT                   /transl_table=11
FT                   /locus_tag="SM_b20133"
FT                   /old_locus_tag="SMb20133"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20133"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48533"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X29"
FT                   /protein_id="CAC48533.1"
FT                   /translation="MQTNHLQDSKIPVTILTGFLGAGKTTLLNHILTERHGHRIAVIEN
FT                   EFGEVDVDSDLVLASEEEIYQMKNGCICCFVDVRNDLIEVLQKLLARKDKFDHILVETS
FT                   GLADPTPVATAFFIDDEIGKHVTLDGIVTLVDAKHIGQHIDDPVLDGRDNQAVDQIVAA
FT                   DRIIINKIDLVSEGEIAPLERGMRKLNQTAEIVRSSYGRVDLSSILGISGFAPSYVAER
FT                   AKLLDLDHHHHHDHHHHHHHLHDATVSSESFVFDRPFDQGRLTDYLAGLLREEGDDIFR
FT                   TKGIIAIAGDPRFFVLQAVHKLMDFRPDHVWGKDMPYTKLVFIGRNLDRAALERGLECC
FT                   LASAGDTDN"
FT   CDS_pept        complement(147547..148938)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20134"
FT                   /old_locus_tag="SMb20134"
FT                   /product="putative permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20134"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48534"
FT                   /db_xref="GOA:Q92X28"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X28"
FT                   /protein_id="CAC48534.1"
FT                   /translation="MNTDSKCDAIEAMFPAPKLAALGLQHVLVMYAGAIAVPLIIGSAL
FT                   NLSKDQIAMLISADLFCCGIVTLIQCLGVWNVGARLPIMMGIGFTAVPPIIATGTDPDL
FT                   GMPGVLGAVIASGVFTLLAAPYFSRWVRFFPAVVTGTVMLVIGLSLMRVGVNWAAGGQP
FT                   MIKGPDGLIPNPAYGEPFALAVAAIVLVSILLMTRFLKGFLANLAVLFGIGIGFAIAVA
FT                   FGKVDFQGVADASWVTVVTPFAFGMPIFDLWATVALCTVMIVMMIEATGQILAVGDMAG
FT                   RTISEADLARGLRTDGLGNIIGGIFNTFTYTTYAQNVGLLQITGVMSRWAVAAGGVVLI
FT                   LLGCLPKIAFITASIPSYVVGGAAIVMFGMVSATGVKILARVNFVDNRRNLYIVAVSVG
FT                   LAMIPVVADKIFAQLPEFIDRFFHSGVLVGTFSAVLLNLLFNGVPPREEVQPDLLGEGA
FT                   MRHPG"
FT   CDS_pept        complement(149017..149649)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20135"
FT                   /old_locus_tag="SMb20135"
FT                   /product="putative 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase protein"
FT                   /EC_number="4.1.1.-"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20135"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48535"
FT                   /db_xref="GOA:Q92X27"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X27"
FT                   /protein_id="CAC48535.1"
FT                   /translation="MKADREQRKRIIVGISGASGVIYGIRLLEILRDLDIETHLVMSRA
FT                   AQITLAMETDFKVADVEALAACVHSNKDIGASCSSGSFRTLGMIVAPCSIKTLSEIATG
FT                   VTSGLLSRAADVTLKERRRLVLMLRETPLHIGHIRSMAQATEAGAIICPPVPAFYARPQ
FT                   TLDEMVNHTVARVLDLFDIDTGLAHRWSGLRAAVPDTRREDVEVKMR"
FT   CDS_pept        complement(149680..151053)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20136"
FT                   /old_locus_tag="SMb20136"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20136"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48536"
FT                   /db_xref="GOA:Q92X26"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X26"
FT                   /protein_id="CAC48536.1"
FT                   /translation="MEFGSQDVRYFLREYQKAYPEDVLTIEDCITDDQDASAFIWKLNQ
FT                   QGRAPLLHFRNVEGVGGEVIANTFGSRERIARMFGTSQDRLHEAYQARSRQALPPRLVD
FT                   GGPVTECVEEHDIDLGTLPMLKHFATDRAKYITSGIIIAEHPETGAGNLSYHRAMIHSK
FT                   NELATSLHSRGHLWRLLNMAKDRGEKLKAAMVIGAHPLFMIAASARLAFGEDERDVAGG
FT                   LIGEPLEVVRTPKYGIRVPAYAEIVLEGVIEPEAQVAEGPFGEFTGYSSDRSTNNLFRV
FT                   ETFLRRKDAILVSVAGGNSSEHLNLGRIPREAEMVEKLKQRFPSVTAVHYPASGTHFHA
FT                   YVALNQTRPGEARQIMLGLLGWDAYLKTVIAVDADVDITRDSDVLWAMSAHFQPHKDVV
FT                   IIEGLPGNALDPSASGIGTTSRMGLDATRGPDFHGVLARIDEAAFDRASAILAKFGRP"
FT   repeat_region   complement(151125..151169)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(151195..152136)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20137"
FT                   /old_locus_tag="SMb20137"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20137"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48537"
FT                   /db_xref="GOA:Q92X25"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X25"
FT                   /protein_id="CAC48537.1"
FT                   /translation="MIIDTHLHPTNLVDEAWRHTGTPFNGERMLKLMDGPYMINGKPRR
FT                   IDMGFIQPPPGNTGYRDGNRMGREGIRDYMAYIAELCQKYPDRFIGNFNYNPRWGPENG
FT                   AAELEFHVKEYGFKMLKLHANMHGYRPDRALDWLRPAMKKCAELGVVVLIHTGDGPYTI
FT                   PTMFYPIIREFPMVNFIIGHFGIQTGGNYSFESFWMAMDTPNVYCESGWCFQSRIVEFA
FT                   KELPKHKIVFGTDSPPNEPGMWLRELEVLCHEPPHGLGLSEEDLEGYLGNNIAKLVGID
FT                   PTPPPRNLEEAQARLTDTYAGLRREERQPTPA"
FT   CDS_pept        complement(152176..153102)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20138"
FT                   /old_locus_tag="SMb20138"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20138"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48538"
FT                   /db_xref="GOA:Q92X24"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X24"
FT                   /protein_id="CAC48538.1"
FT                   /translation="MIIDISCYPTKIVDLAWRHDGEPFTGERLLKMMDGPYYVNGKPRR
FT                   IDKAFIQPPQGNTIYTDGYGDLTGKAAIRDYMSYTVELVQKYPDRFLGCFVYNPRYGTQ
FT                   NGAEEIEHHAKEYGFKMVQLQANMHAYRPDRALDWLRPAMRKCADLGLIVKVHTGDGPY
FT                   SIPTEFYPIIREFPSVNFVLGHFGVQTGGVYVFEPFQMAMDAPNIYVESGWCLQSRIVE
FT                   FAKELPKHKILFGTDTPPNEPGMWLRLLEVLCHEPPQGLNLDEDTLEDYLGNNIARMIG
FT                   LDPTPPPRSVEEAQARLNGTHASLQPA"
FT   CDS_pept        153414..153908
FT                   /transl_table=11
FT                   /locus_tag="SM_b20139"
FT                   /old_locus_tag="SMb20139"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20139"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48539"
FT                   /db_xref="GOA:Q92X23"
FT                   /db_xref="InterPro:IPR018719"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X23"
FT                   /protein_id="CAC48539.1"
FT                   /translation="MDDTAKENAEFPAAAGILLGLGLGGFFDGIVLHQVLQWHHMLSSA
FT                   GFPPDSLENLRLNTFFDGLFHMGTYVFVVLGLIVLWRRGRRRPLLWSAKLIAGTFLIGF
FT                   GGFNLIEGTVNHQILGLHHVNETVSRDQWVYWDTGFLLWGALMLIAGWVLYRSGKRDLS
FT                   R"
FT   CDS_pept        complement(153928..154809)
FT                   /transl_table=11
FT                   /gene="dapA2"
FT                   /locus_tag="SM_b20140"
FT                   /old_locus_tag="SMb20140"
FT                   /product="putative dihydrodipicolinate synthase protein"
FT                   /EC_number="4.2.1.52"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20140"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48540"
FT                   /db_xref="GOA:Q92X22"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X22"
FT                   /protein_id="CAC48540.1"
FT                   /translation="MSKKAFVALVTCFNEDETINYDATRAQVRRQVAAGNNIMCAGTNG
FT                   DFTALTHEEKIRLTEEVVDEVGGRVDVIVNAGMPATFETLQLARAFDRIGVSGIAVITP
FT                   FFIACTQDGLIRHFSTVADAVETPVYLYDIPSRTQNHIEPETALKLSAHGNIAGIKDSG
FT                   GAQDTLEAYLQVARDVPGFEVYSGPDHLVLWSLQNGAAGCISGLGNAMPEVLAGILSAF
FT                   NSGNIAEAERRQAIYTAFRTELYALGFPPALVKRSLYLQDPSVGASRQPALLPSEEQDA
FT                   KIREILVRHRLL"
FT   CDS_pept        complement(154809..156455)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20141"
FT                   /old_locus_tag="SMb20141"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20141"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48541"
FT                   /db_xref="GOA:Q92X21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X21"
FT                   /protein_id="CAC48541.1"
FT                   /translation="MAEHLLEVRNLSVEFHTAAGVVHAVKSISYHLDKGETLAILGESG
FT                   SGKSVSSSAIMNLIDMPPGRISSGEILLDGRDLLTMPAEERREVNGRRVAMIFQDPLSH
FT                   LNPVYSVGWQISEAMTTHGLAGSKAREEALRLLRRVGIPEPERAMRKYPHEFSGGQRQR
FT                   VMIAMALALRPDLLIADEPTTALDVTVQAEVLKLLKELQRETGMAVLIITHDLGVVSEI
FT                   ADRVVVMEKGAIVEAGTVREIYKNPQHPYTQKLIAAAPGKGAMHEPGARAEPLLSVRDV
FT                   RKTYGSFEALKGISFDLMPGETMAVVGESGSGKSTLARALLRLDEPDSGTALWKGRDLF
FT                   ALSPAELYKLRRDLQMVFQDPTQSLNPRMTVYQLISEAWVIHPDILPKAKWRERVAELL
FT                   VQVGLSAEHMSRYPHQFSGGQRQRIAIARALALEPQLIICDEAVSALDVSVQAQVIELL
FT                   DRLRREMGIAFIFIAHDLPVVRDFADYVMVMQQGEVVELGTVREVFDTPRQAYTRALLA
FT                   ASLSPDPDAKAGHLASVPAEAADILIPKRSH"
FT   CDS_pept        complement(156448..157371)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20142"
FT                   /old_locus_tag="SMb20142"
FT                   /product="ABC transporter, permease"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20142"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48542"
FT                   /db_xref="GOA:Q92X20"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X20"
FT                   /protein_id="CAC48542.1"
FT                   /translation="MTLASTDNVIVAEPSFPVRMMRMLLADKFALCAAIFLLVILTIAI
FT                   IGPPWLGDLATKQNLRGRNLPPFDWTRTWVWWMGADALGRPLFARIIVAAQNTLMVAAG
FT                   AVILSSVIGTVLGLIAGFSSPRMSQIIMRLADVIMSFPSLLIAVIVLYVLGSSILNLML
FT                   VLAITRIPVYLRTTRAEVLEIRERMFVQAARVMGASSKRILFRHILPVVLPTLTTLATL
FT                   DFAYVMLAESALSFLGIGIQPPEITWGLMISQGRQYLTNAWWLSFWPGLAIILTTMSLN
FT                   LLSNWMRIALDPVQRWRLEMKGGKNG"
FT   CDS_pept        complement(157386..158300)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20143"
FT                   /old_locus_tag="SMb20143"
FT                   /product="ABC transporter, permease"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20143"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48543"
FT                   /db_xref="GOA:Q92X19"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X19"
FT                   /protein_id="CAC48543.1"
FT                   /translation="MLRFIRQRALASLISLIGLIVMVFFLSRMTGDPAALFLPVEASAE
FT                   MKEQFRELHGLNDPILVQFARYVGDVVTGDLGESLRKARPALDVVLEAFTWTLWLAVIT
FT                   MTLVTGAAIVVGSLGAFRSGGFFDRLSSMVSLIGASVPDFWLAIVAIVIFSINFAILPT
FT                   SGTGSVVHWILPIAVLFVRPFGIIVQVVRGSMVSALSSAYVKTARAKGVKSGPIIFIHA
FT                   LRNAMLPVITVVGDQAASLLNGAVVVETIFGFPGVGKLMIDSILQRDFNVVLAAILVTA
FT                   IAIFLMNVLIDLAYALLDPRIRH"
FT   CDS_pept        complement(158386..159891)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20144"
FT                   /old_locus_tag="SMb20144"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20144"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48544"
FT                   /db_xref="GOA:Q92X18"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X18"
FT                   /protein_id="CAC48544.1"
FT                   /translation="MQMKRTLIMGALMLGSALAPAFAASGPVKIVLPEEADLLEPCMAT
FT                   RSNIGRIIMQNVSETLTELDVREGKGLMPRLAESWEQKEDGSWRFNLRTGVKFSDGTDF
FT                   NAKDVKYSFDRVMSDKNACESRRYFGGMNIKIDVVDDTTVDFTVDPVQPILPLLLSLLT
FT                   IVPEETPMEFVREPVGTGPYKLTDWTPGQQIVLSARDDYWGEKPEVTEATYLFRADPAV
FT                   RAAMVQTGEADLSPSISQTEATNPATDFSYLDSETVYLRIDHNIEPLNDVRIRRALNLA
FT                   IDREAFLGTLVPDSAVLATAIVPPPTLGWNPDVKVFPYDPEQAKKLIEEAKADGVKVDT
FT                   PITIIARTANFPNVTEIMEAIQAQLQEVGLKVELKFVEVAEHEVYYSKPFKEGRGPQLV
FT                   AAMHDNSKGDPSFSMFFKYDSEGTQSGFSDPKVDDLIARASAAVGDERAKLWSEVIAYV
FT                   HDEVVADVLLFHMVGFSRVSERLDFKPTMATNSMLQLSEIKIK"
FT   CDS_pept        160206..161393
FT                   /transl_table=11
FT                   /locus_tag="SM_b20145"
FT                   /old_locus_tag="SMb20145"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20145"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48545"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X17"
FT                   /protein_id="CAC48545.1"
FT                   /translation="MTPDEIANAMTGKLRETGGGRLESLLPSPMVQNHAAFLHRLEDGS
FT                   LVCAWFGGTLEGKSDISIFASVLAPDAAQWGEPQRLSFDAEHSEQNPVLFTAPDGRLWL
FT                   FHTSQPSGNQDECRIRMAAIERDAADPTRLAVSEGRYLDLPRGCFIRAPLVIRDDEAWL
FT                   LPIFRCIQRPGQKWNGSHDNAAVGVSIDGGRSWQLADLNGSIGCVHMSPVRVGDTGYAA
FT                   FFRRRQADQVYRVESVDGGRTWSLPAPTDVPNNNSSIAVVRLRDGRLAMICNPVNAALS
FT                   ADRRASLYDELGDDDGRPDADPSGGCVPIWGVPRAPVSVCLSADDGRTFPDRIAIEDGP
FT                   GTCLSNNSTDGHNKEMSYPWLLEGHDGSLHVAYTYHRRAIKYVRLPPGWADEGRN"
FT   CDS_pept        161393..162358
FT                   /transl_table=11
FT                   /gene="pdxA2"
FT                   /locus_tag="SM_b20146"
FT                   /old_locus_tag="SMb20146"
FT                   /function="Pyridoxal phosphate biosynthesis protein"
FT                   /EC_number="1.1.1.262"
FT                   /note="High confidence in function and specificity"
FT                   /note="4-hydroxythreonine-4-phosphate dehydrogenase 2
FT                   ,(4-(phosphohydroxy)-L-threonine dehydrogenase 2,,
FT                   Pyridoxal phosphate biosynthetic protein PdxA)"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20146"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48546"
FT                   /db_xref="GOA:Q92X16"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92X16"
FT                   /protein_id="CAC48546.1"
FT                   /translation="MSKIIGITMGDPCGVGPEITVRSLAEMSAADREATRIYGNLATLE
FT                   AAREALGLSVDLQPYVVDLTVEGAPLPWGSLSAVAGDAAFRFIERAVRDAEAGNIGCIV
FT                   TAPINKEALNMAGHHYDGHTGMLRSLTGSSAAYMLLASERLKVIHVSTHVSLKEAIGRA
FT                   TTERVLATIRAGNAHLKRIGYEHPRIAVAGINPHCGENGLFGTEDDDQIGPAVAAAREE
FT                   GIDVQGPISADTVFHRAYSGGFDLVVAQYHDQGHIPIKLVAFDTAVNVSVDLPIDRTSV
FT                   DHGTAFDIAGKGIANHGNLNSAIAYARKLVAGQASRKAAS"
FT   CDS_pept        162355..163461
FT                   /transl_table=11
FT                   /locus_tag="SM_b20147"
FT                   /old_locus_tag="SMb20147"
FT                   /product="alcohol dehydrogenase"
FT                   /function="an alcohol + NAD+ = an aldehyde or ketone + NADH
FT                   + H+"
FT                   /EC_number="1.1.1.1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20147"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48547"
FT                   /db_xref="GOA:Q92X15"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X15"
FT                   /protein_id="CAC48547.1"
FT                   /translation="MITIHQPRRLVVGAGSRGEVGAWAGQAGSTLVIATPVTSGFADSL
FT                   KLSGKVTLFDAIPGEPDITTLEAALEAARNARPDLIVGLGGGSVMDVAKLVAVLWDSGQ
FT                   SLADVAGPNRVAGRNTRLAQVATTAGTGSEAGIRSLITDPGKGSKIAVESPHMIADLAV
FT                   LDPELTYSVPPAVTAATGVDAMAHCVEAFTNRKAHTMIDGFARMGFNLVGKYLARAVRD
FT                   GEDTEAREGMMLASYYGGICLGPVNTAAGHAISYPLGTLLHLPHGLANAIIFPHVLAFN
FT                   QPSAAAKTAEVADALGLGQGLSQRDLLSAAKDFCAGLGIEMSLAVNGAKAADLPRFAAD
FT                   AHAIRRLMDNNPVDMSEADVLEIYRAAF"
FT   CDS_pept        complement(163686..164387)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20148"
FT                   /old_locus_tag="SMb20148"
FT                   /product="probable transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="probable transcriptional regulator,, putative pdhR
FT                   gene, GntR family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20148"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48548"
FT                   /db_xref="GOA:Q92X14"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X14"
FT                   /protein_id="CAC48548.1"
FT                   /translation="MGLQEGTPRKGLPDIVFERMHRAIKSGAYKPDERLPTEHELATEF
FT                   EVSRPIVREALKRLRDQGLIYSRRGAGSFVRAVGLREPLGFGQLENVADLLNCYEFRLT
FT                   LEPAAAAAAALRHDETSLASIRRALELLRDATNRQSHREDADFQFHLAIARAAQNSYFS
FT                   TAMEALKEHIAVGMKFHGISVKREASGLSRVFAEHEAIADAIAAGSAEEARMLMLKHLT
FT                   GSRDRLFLASQ"
FT   CDS_pept        complement(164391..165422)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20149"
FT                   /old_locus_tag="SMb20149"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20149"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48549"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X13"
FT                   /protein_id="CAC48549.1"
FT                   /translation="MLVILADDLTGALDSAAPFAGRGLRTEVALALDSVDAALADAPDI
FT                   LVVNVKSREVSADEARKATSDVLKHIPESARIFKKVDSRLKGNIEAELDATPFARAVVA
FT                   PAIPDFGRIVVDGHVRGFGVEAPIPVAERFGRHAGRTLIPDTMSRTDMLAALASAEAAG
FT                   CDLMIGARGLADALAHLMTDSETLPLIPLPRQPILIVVGSRDLITVEQVDVLRENHSTE
FT                   YVPAAGGRVQQPSAPATGTVTIIQATEGVTPLGPAEVSANLADSVVPAFTGGAATLLLT
FT                   GGATAEAVLERMGVSRFRLLGECMPGIALAFADGRYIITKSGGFGGPDTLSDIARQIMG
FT                   EAR"
FT   CDS_pept        165740..166579
FT                   /transl_table=11
FT                   /locus_tag="SM_b20150"
FT                   /old_locus_tag="SMb20150"
FT                   /product="inositol-phosphate phosphatase"
FT                   /function="myo-inositol phosphate + H2O = myo-inositol +
FT                   phosphate"
FT                   /EC_number="3.1.3.25"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20150"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48550"
FT                   /db_xref="GOA:Q92X12"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X12"
FT                   /protein_id="CAC48550.1"
FT                   /translation="MSRQSFSDDLDGRAELCREVIRSAGALILKGFQGEARQNISMKGP
FT                   QDFLTEVDEASEAHIREALAAHFPGDGFFGEEGGGAISDRVWVVDPIDGTANFARGIPH
FT                   FCISIAFVQSGSTEIAAIYNPALDELYFARRGAGATRNGVPIRVAQTIRFDAASLEMGW
FT                   SMRVPNTAYLGVMEALLGMGANVRRAGSGALALAYVADGRLDGYIELHMNSWDCLAGLL
FT                   LVSEAGGVVCPYLEIGSLDAGGPALAVAPGLASDTSRASNIPLAACAMPADRQIAPA"
FT   CDS_pept        166645..167262
FT                   /transl_table=11
FT                   /locus_tag="SM_b20151"
FT                   /old_locus_tag="SMb20151"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20151"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48551"
FT                   /db_xref="GOA:Q92X11"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X11"
FT                   /protein_id="CAC48551.1"
FT                   /translation="MDAPVHTRPAISLIAEGLGPHGSALYIGGSEGARDLGLLRRNGIT
FT                   AVVNCAINLDINYVEVPSDKADGERRASGFAAIRYYKIGMIDDEGSPDTMILGAYYVLD
FT                   GALRQSMPKRPTYPFRDGGNILVNCRGGRSRSVSLVALFLHKQQPNLYPTLDHAVAAIR
FT                   ARRQLMPDEWFETPKPMLYEAARRASVWIDMIERERQKERPC"
FT   CDS_pept        167256..168974
FT                   /transl_table=11
FT                   /locus_tag="SM_b20152"
FT                   /old_locus_tag="SMb20152"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20152"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48552"
FT                   /db_xref="GOA:Q92X10"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X10"
FT                   /protein_id="CAC48552.1"
FT                   /translation="MLKRTRPAVAVIADAHFHDLKADFGFARVEVEGREITMRSWADTR
FT                   QSTRVFNESAEAFLAALAEVRRRGIRHVVLLGDYTDDGQRATTSALRDILREHADAFDI
FT                   SFYALPGNHDIFGPRGRHHTKQFLGRDGRGILVTSDANSAGSGAAVSDRMYCEGYPAGL
FT                   DPMAAFGYFRRSEYLHWETPFGTSDAVEDRRYGVASPDGSNHYELMDASYLVEPEPGLW
FT                   LLMIDANVFEPVNGTFEWGEEAAFIDSTSGGWNAMIRCKPFVVSWIADVCARARRLGKT
FT                   LLAFSHYPVLDPFDGATGAEAALFGETNIARRTPRKDVERALLAAGLSLHFSGHLHVEG
FT                   VTRRGSGDRSLTNIAVPSLVAFPPALKIAHPGEGSVVVETVELSGLPADQRLRSAYERE
FT                   VALLGEEPEAAFSVSTYGAFLRAHKRALVSHRYFPEEWPPAVVERVADLTLEEIACLFT
FT                   EETAGGAPMLSALVHASAIDIAELRSLPMIELVADWYCLRQGASLALPHIEKSRLPLYR
FT                   FLAERFGCEPRTRHSSVKDFVAIFLGALSLFLDRAENGEAQIVVVSNPVRQDAPA"
FT   CDS_pept        169058..170701
FT                   /transl_table=11
FT                   /locus_tag="SM_b20153"
FT                   /old_locus_tag="SMb20153"
FT                   /product="hypothetical protein TRANSMEMBRANE"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20153"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48553"
FT                   /db_xref="GOA:Q92X09"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X09"
FT                   /protein_id="CAC48553.1"
FT                   /translation="MESAIVGINVFGAVALLLYGLAQVKDGMSRAWGARLRTGLAAGTR
FT                   GGLRSFAAGFVATVALQSSTATALMVASFVEKELIAPAMAQVVLLGANVGTAATAWIVA
FT                   LGLGWLSPLLILAGVALGRTRSSARSGAGSAVVGIGLMLLSLHLLANATDPLLQSPALG
FT                   AFLAMLDNAWPVALFFAAALAVLASSSLAIVVLILSLASAGGISTSLVVVLVLGANLGG
FT                   AVPPVLATLGASADARRVTIGNLIVRAIGCVIALPLAGYCAEFMELARLSPQKLAVDAH
FT                   LLFNLAVAMIAFPVSPLLYRLTASLIPQETESDIGPRYLDMEALARPVAALAGAGREVM
FT                   AVGDLIEGMLVRALDALKGNDLSMLADISMLEGRVDRIQHEIKLYVSRVGKDDMTEDDH
FT                   RRARHIVDYAINLEHIGDIIEKGLHPEIAKKISRGLRFSEDGQGELVRLFAITLDNMRM
FT                   AQAVFATGDAELARRLVEVKEEVRRLEKQSAECHLQRLREGRLDSMQTSSLHLDMLRDL
FT                   KRINAHVASVAHPILDDSGLLIESRIRQPV"
FT   CDS_pept        complement(170752..171738)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20154"
FT                   /old_locus_tag="SMb20154"
FT                   /product="probable transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="Conserved hypothetical protein"
FT                   /note="probable HTH lacI-type transcriptional
FT                   regulator,,periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20154"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48554"
FT                   /db_xref="GOA:Q92X08"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X08"
FT                   /protein_id="CAC48554.1"
FT                   /translation="MARTFVTAEEVAKRAGVSRSAVSRTFTPGASVSKTVRRKVLKAAR
FT                   ELGYRVNRLAQVLNNDRSNLIGVVGANLSSPFISKQLDLLSIGLLRQGKQCLLLNAADA
FT                   RQDIAPLIELLFEFRAQAIVVLSGEPPASIVDECIANGVRLILINQRLDRTDTNMVLSD
FT                   DSHGADLAALRLIESRCKKVAVVTSGSQTPAQLRRAKAFTQRMQAEGVDVVAWSGGPTS
FT                   YESGVQAGRELLVDKAIDGAFCVTDLLALGFLDAARLEMNRRVPQDVSIVGFDDIPQAG
FT                   WKSYGLTTVAQSFQALTEKVLSALDSDEPETRMQVVPVTLVERQTAR"
FT   CDS_pept        172249..174099
FT                   /transl_table=11
FT                   /locus_tag="SM_b20155"
FT                   /old_locus_tag="SMb20155"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20155"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48555"
FT                   /db_xref="GOA:Q92X07"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X07"
FT                   /protein_id="CAC48555.1"
FT                   /translation="MALLSEPAKAAAAETRSAAPSAWQAWRYRLKVALREPTTLIGVLT
FT                   ALLFTYLIVVPIISIVLDAVRVQFGHERRLSKDVGDLTLNYLDRALFSPVSADLFWRPL
FT                   FNTLSVAVGAISLSLLVGTVLAWLISRTDMFGRRWFATALIVPYMLPAWTFALAWTTLF
FT                   KNRTVGGQPGWLEATGLTPPDWLAYGQFPITIILALHYTPFVILLFGSALRRFDSQLED
FT                   SARILGAKRHQVALQIILPLMRPALLSSMVLIFAKCLGEFGVPYVLGLPVKFEVLSTSL
FT                   FRSIASRQTGVAGVIAGSIMLIGIITLWIDARLVREARRFVTIGSKGSMNRQSRLGRMR
FT                   LPAAGFAATVFLLSVGLPLLTLLLSTVMKMPARFTLDNFTLDYWIGRDLDTIALKTGIL
FT                   LSSDLWTAARNTLTIVGIASVTSGILGLLVGYVVIRTPVRLLSVYLRQVTFLPYLVPGI
FT                   AFAAAYLSLFAVPRGPLPALYGTVVILVLALIADQMPYASRAGISAMTQLGKDPEEAAQ
FT                   VAGAGWLRRMISIVIPIQKGSLVTGVLLPFISGIKGLSLFVILAVPSTDVLTTYSLRLV
FT                   DYHYTQAANAVVLIIAAIAYCGTLIAQKLTRTNLAEGLGS"
FT   CDS_pept        174099..175232
FT                   /transl_table=11
FT                   /locus_tag="SM_b20156"
FT                   /old_locus_tag="SMb20156"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20156"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48556"
FT                   /db_xref="GOA:Q92X06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X06"
FT                   /protein_id="CAC48556.1"
FT                   /translation="MPTINLRGAQKNYGVNSANAVSNLDLEIRDGEFMCLLGPSGCGKT
FT                   TTLRMIAGLENLSGGEIRIGECVVDCVAGGVFVPPEKREMGLVFQSYALWPHLTIERNT
FT                   DFGLRLRKLPKAEREERVERIMQALDIAKYRDRYPSQLSGGQQQRVALARMLAINPGVL
FT                   LLDEPLSNLDARLRLEMRAELKRLHKEFKTTIVFVTHDQWEAMTLATTIAVMNEGTLQQ
FT                   MGTPNDIYDRPANRFVAEFVGSPPINILTFGQTGTSDVADKADAYLAARCPHLAGVGSV
FT                   GIRPEAIGYATRIEDVPKGSFSGETTVTGVLPTGGNWILELRSESHTLFLTTHVLPRIE
FT                   QGARVFFFAPPEALHVFDTDGRRIAEADARLSGLAYN"
FT   CDS_pept        175274..176398
FT                   /transl_table=11
FT                   /locus_tag="SM_b20157"
FT                   /old_locus_tag="SMb20157"
FT                   /product="hypothetical ABC transporter periplasmic
FT                   solute-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20157"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48557"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X05"
FT                   /protein_id="CAC48557.1"
FT                   /translation="MKRSVRSGRFLLCATAMLYVLGTGTRAEEPFDIDALVEAARKEKP
FT                   ITVYDSTGKIVEMAKNFADRYDVGAEGSKVKASAQLEMIIREARANNIQGDVSIISDAP
FT                   AAMAQLIPQGFAESWLPPDLAANIPAQYQNPLTVVTSANVWAYNTELFDKCPVTNIWQL
FT                   TEPKWKGKVAMQDPLGKASYVDWFNQMAKHGDEEVAAAYKALYGKDIQTEEASATAAWV
FT                   KALAANAPLLTDADAAAADAVGAPGQSEPFMGLMSSAKFRDNAEKGMKLGLCKDLKPWV
FT                   GWLYPGVGLITKGTDSPNAARLFIHYVLTAEGIAPQAVDGKMSTNREVALPSDEPSGIA
FT                   TVLDQLLPYSMETSLDDWDARETWQDFWRVNYQK"
FT   CDS_pept        176427..177551
FT                   /transl_table=11
FT                   /locus_tag="SM_b20158"
FT                   /old_locus_tag="SMb20158"
FT                   /product="hypothetical ABC transporter periplasmic
FT                   solute-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20158"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48558"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X04"
FT                   /protein_id="CAC48558.1"
FT                   /translation="MHIHRIGRTAVAALGVAAGVISTTAAAADGFDLDRVIAAAKNEKP
FT                   ITIYDSTGKIVEMAENFSAKYGLKATGMKVSANSQLEMIIREAQADNVQGDVVLITDAP
FT                   AALAQLLPEEFVQSYLPEDMAAKIPAEFRNPLAISTNANVWAYNTEAYDECPVSNIWEL
FT                   TDPKWKGKVALVDPLTKSTYTDWFNQMEAHGDDKVAAAYKAHFGQDLQTEEKSASAAWI
FT                   KALAENAPLATDGDDPVAEAVGAPGQKAPFFGLLSSAKFRDNEAKGYKLGICKDLDPWV
FT                   GWTYVKLGLIASKTASPNAARLFVHYILTEEGIAPQMKDGKLPTNTDIKMPADEPSGLM
FT                   AVSDRLFGYDSSTGLSDFDRREEWQDFWRANYSK"
FT   CDS_pept        177605..178489
FT                   /transl_table=11
FT                   /locus_tag="SM_b20159"
FT                   /old_locus_tag="SMb20159"
FT                   /product="inositol-phosphate phosphatase"
FT                   /function="myo-inositol phosphate + H2O = myo-inositol +
FT                   phosphate"
FT                   /EC_number="3.1.3.25"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20159"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48559"
FT                   /db_xref="GOA:Q92X03"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X03"
FT                   /protein_id="CAC48559.1"
FT                   /translation="MQHSPPAGPIIADRHAVALSQRLAETARGAALAVRAPLLEAFRSE
FT                   MAVDYKADLHDIVTVHDRRAEAIIRAYIFEHEPNSAVMGEEGGQTGDGEFQWYVDPIDG
FT                   TANFARGIAFWCVSVAVVRDGAVLAGAVYDPVADLMFSADLENAELNGKALASRAAGDE
FT                   KRATLITGYPVARDFRLDGREATLANFGALTETFSTLRRPGSAALSIAHVAAGWADAAA
FT                   GFGVNAWDVAAATLILKNAGGRYEPLTLGKVAVDAADFMCPGYIATGRGADYPTLERVA
FT                   RSISTSRIAKAGQ"
FT   CDS_pept        178551..179168
FT                   /transl_table=11
FT                   /locus_tag="SM_b20160"
FT                   /old_locus_tag="SMb20160"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20160"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48560"
FT                   /db_xref="GOA:Q92X02"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X02"
FT                   /protein_id="CAC48560.1"
FT                   /translation="MQFETDPQSIAAELPKLSLVYEKHPLYGVDLFISGKEAASDLDLL
FT                   RQNGVTTVVNCAVNLDFNYVRQADLVSDHEGSAYGPGEIRYYKIGLIDGSGNPDTQMVA
FT                   AYYILRAALEQILPEKQSYPRRDRGNVLVNCRGGRSRSVIVMALFLHLTLPSEFVTLAA
FT                   AIAHIRERRQLARAEWYKAPKPVLIEAAGRAAEWVRLIEGVR"
FT   CDS_pept        179168..179536
FT                   /transl_table=11
FT                   /locus_tag="SM_b22005"
FT                   /old_locus_tag="SMb22005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22005"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51278"
FT                   /db_xref="GOA:B2FDB9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDB9"
FT                   /protein_id="CAQ51278.1"
FT                   /translation="MALLSATADEEKADRKAMSCRCGRMPPSNLRELKAMIAKKQVVFP
FT                   GERKRVMRAILDHPEIIAFGTATSIAAACGMSSATVVRLAGHLGFRKFRDFKNLFRDHL
FT                   KETRALQQRMLRWRPRSR"
FT   CDS_pept        179533..179883
FT                   /transl_table=11
FT                   /locus_tag="SM_b20161"
FT                   /old_locus_tag="SMb20161"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20161"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48561"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X01"
FT                   /protein_id="CAC48561.1"
FT                   /translation="MTPAPCMPSAFGRRLAHSRVDGYISPCVNFIRTGRSHGAGDARTD
FT                   RMPFNGTRKVPGGNAAVSGPEVVESMHVPVCGVHRRMVRAASGASRQEVAMQGCGCEPP
FT                   RLISWAHPQRGA"
FT   CDS_pept        180077..180766
FT                   /transl_table=11
FT                   /locus_tag="SM_b20162"
FT                   /old_locus_tag="SMb20162"
FT                   /product="probable transcriptional regulator"
FT                   /function="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /note="Conserved hypothetical protein"
FT                   /note="probable HTH luxR-type transcriptional
FT                   regulator,,response regulatory domain"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20162"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48562"
FT                   /db_xref="GOA:Q92X00"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q92X00"
FT                   /protein_id="CAC48562.1"
FT                   /translation="MPRTALPVHSLSIKSALVIDDHPLYCDALAATMESTFNTRRIRTA
FT                   TSLSEALQQLRMRFSPDLIMLDLNLPDASGLSGFLKIKEKMPDIPVIVISAFTSKDVVQ
FT                   SVIAAGAAGFIPKDIDRHNFQEAMQDIWNGKTYVPPGYAVPARATATDQSVETISRKIA
FT                   HLSQQQTRILSLICEGMPNKLIAYEMQLAEATVKAHITALLRRLGVHNRTQAAMLVREV
FT                   SIRHSLQ"
FT   CDS_pept        180811..181980
FT                   /transl_table=11
FT                   /locus_tag="SM_b20163"
FT                   /old_locus_tag="SMb20163"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20163"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48563"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WZ9"
FT                   /protein_id="CAC48563.1"
FT                   /translation="MTAVDDLDRKPAEAVRLATSRADDAFTALAEIRRQLATARPSFIF
FT                   LFVPNRLQPDDLAAALRKSLPNTVVFGCTTAGQITPRGYENDTLLAVAFQRHHFRVASI
FT                   LFQPISPVSIADVVSQTERLATQFRVTPGRKRLALIFADGLSKQEDILVAALEAGLKDI
FT                   PVFGGSAGDGLRFQRTQVLRNGEFHSNAALLLLLETDLEFSGLGFDHFQPTDKRMVVTR
FT                   AVPEERLVLEINGSPAAEEYARLVKVPVGELSPMVFAENPVLVRNGNLYHVRAIQQIQG
FT                   EHGLTFLSAIDDGLLLRLGRGKEIIRTLETGLAVSGHDGEAPDFILGFDCYLRKLEIER
FT                   KGLDSEVSEQLRQRRVVGFNTYGEQHLGVHVNQTFVGVAFFRPKAGAPL"
FT   CDS_pept        181977..184220
FT                   /transl_table=11
FT                   /locus_tag="SM_b20164"
FT                   /old_locus_tag="SMb20164"
FT                   /product="probable two-component response regulator
FT                   receiver"
FT                   /function="Signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Conserved hypothetical protein"
FT                   /note="probable two-component response regulator
FT                   receiver,,putative histidine kinase, autoinducer sensor
FT                   kinase/phosphatase luxQ"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20164"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48564"
FT                   /db_xref="GOA:Q92WZ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WZ8"
FT                   /protein_id="CAC48564.1"
FT                   /translation="MIDPNEPYELQIAKQARIIEALVNRAERGHEVGGSAYSLFESAIA
FT                   LQAEVWEKTKDLEKALDTLDRASSELEVAYQAQERIQRNLADAMVAMEDGFALFSEERL
FT                   QACNAQFRNLLPDVEPLIKPGLGFDDYLAAVNASKYLNREENGLAARPHPVAREQGSGQ
FT                   RFSSFVMVLRNDRWFQISYRQTSSGNITVLQTEITDIVRENRREKNRLIDQQSHLLQAA
FT                   FDHMSLGICTFSSGGELLVRNERFGELLGVPLSLLKKGSPFQRIVEHVERHEILDREGR
FT                   RSRVAGWFKAVRRGEAVQERFRRRDGMSLDIRIHSLPDDGFIVSIMDVTAETQASALLE
FT                   QRVQERTAELTEANRLLQIHADEQTKIEAALRHAKEAAEAAHTSKTRFLAAASHDLLQP
FT                   INAAKLYLSMLTDKVGQPGTEEVVRRLKRSFTSIESLLQALLDISRLDSSGAEFNVTSF
FT                   NLGNLLQGVAEDLAPLATERGIDLRIVPSSRWVSSDQRYLMRCVQNLVVNAIQYTERGR
FT                   VLVGCRLTGDAVRIEVWDTGVGISEEDRTRIFKEFTRASGAAKGPGMGLGLSIVERACR
FT                   HLDHPIRLASQPGRGSVFSIEVPLAAPGHASVSEDPRMEPMLDGSLDLIVMIVENDADE
FT                   LHAMTQVLESWGASVLAADSTADAAALMQEIGTAPDILLVDYQLDDEDNGIETIHTLRA
FT                   LAGAEIPAIIISANRQRQFLQLCNEMSFAVLTKPVQLVRLRALIDWKTRARVA"
FT   CDS_pept        184327..184998
FT                   /transl_table=11
FT                   /locus_tag="SM_b20165"
FT                   /old_locus_tag="SMb20165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20165"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48565"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WZ7"
FT                   /protein_id="CAC48565.1"
FT                   /translation="MRIFLLIALFLLGLGHGPVAAAETYELLFHSAALKGLDAAKHGSE
FT                   AEQSSLVYDKVVSGADAGQRAGSFTVGLKVDDNVAMTLYQGSQSRGLGNYPTSVGNPLI
FT                   MYFLESVLSDLAAQSGGSPFYMRNRVKEALLRDAQIEPVSLRYHDREIAAREVTIRPFE
FT                   HDKARAQMGRISQLSLAVTVSEEIPGWYYSLVATVPSAAGGAEAGYSHAITLKEAAEGR
FT                   R"
FT   CDS_pept        184995..185348
FT                   /transl_table=11
FT                   /locus_tag="SM_b20166"
FT                   /old_locus_tag="SMb20166"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20166"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48566"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WZ6"
FT                   /protein_id="CAC48566.1"
FT                   /translation="MTRAALAALAAALAATPASGQSMSERLNDYPTEVRADYVFGCMAA
FT                   NGQSREVLGKCACSIDVIASILPYDKYVQAETVLSLQQGSGEQLAMFKSAVVPRTMVAD
FT                   LRRAQAEAEMLCF"
FT   CDS_pept        complement(185422..186234)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20167"
FT                   /old_locus_tag="SMb20167"
FT                   /product="hypothetical protein"
FT                   /function="Predicted secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20167"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48567"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030831"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WZ5"
FT                   /protein_id="CAC48567.1"
FT                   /translation="MKLILALIPVTLTASLALAEPEKPNNPLADGTTWRDLKGDVVGEA
FT                   AILDGSALFSVTAPYRANDAATVPVTIEQTDAAADPIESLKLVIDENPAPVAAEIRFGP
FT                   AMAPLKFETRVRVNQYSNIRAIAETPRGIFMHGRFVKASGGCSAPATKDPVAALKDMGE
FT                   MRLKLFGGKGEVQKARREAQIMIRHPNYSGLQRDQITQLFVSAKFITELVVKQGDELLF
FT                   ALDGGISISENPVFRFSYTDNGAPDFTVHAVDTDGNVFDRVLPKTPPA"
FT   CDS_pept        186369..187466
FT                   /transl_table=11
FT                   /locus_tag="SM_b20168"
FT                   /old_locus_tag="SMb20168"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20168"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48568"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR030829"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WZ4"
FT                   /protein_id="CAC48568.1"
FT                   /translation="MYRPLFRKCRGLEVFEAFVTMCILAAAVPDAPPSEMCRAALLPGF
FT                   AAETKAGCEHALHSVIRKPDDWTEKPPFCAPRPKSALSFSEAAPGVFLHRGRVAEPDAE
FT                   NGGDVSNFGFVVGSRSIAVIDSGGARKLGEEIYLAIRERSRLPISHLVLTHMHPDHVFG
FT                   AEPLREAGAAVLGQANLPRALSDRAEDYRASYARRIGEAAFLGSRIVAPDRTIAQQEAI
FT                   DLGGRVLELRAWPTAHTSTDLTVFDRTSGILFAGDLLFDRHTPALDGSLRGWLAVLSEM
FT                   KDLGAPKIVPGHGGPLLDWPQAAAPLERYLRVLESDTKKALDEGLALGEANEVIGQSES
FT                   GRWRLFDLLNPQNATAAYTEMEWDP"
FT   CDS_pept        complement(187595..188236)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20169"
FT                   /old_locus_tag="SMb20169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20169"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48569"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WZ3"
FT                   /protein_id="CAC48569.1"
FT                   /translation="MRVACHALRRMRGLPLNLALGLALCLTQAPGIAGAMDFSDPDWPC
FT                   IQRKVENLSASLMWPAPVTRTPLSPEATDLVEALSLRRVSLEEADAHVRAFVERNKQAD
FT                   GQLLGNIFYGVFDNIAETRQRLIAGIARYSRSQIALSSRIEGARVEMAKLSREKSPDFD
FT                   RIDKLEEQIDWDERIYRDRSQALTYVCETPVLLEKRAYAIAQMLLKHVPD"
FT   CDS_pept        188406..189533
FT                   /transl_table=11
FT                   /gene="fdh"
FT                   /locus_tag="SM_b20170"
FT                   /old_locus_tag="SMb20170"
FT                   /product="probable glutathione-dependent formaldehyde
FT                   dehydrogenase protein"
FT                   /note="Hypothetical protein"
FT                   /note="deleted EC_number 1.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20170"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48570"
FT                   /db_xref="GOA:Q92WZ2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WZ2"
FT                   /protein_id="CAC48570.1"
FT                   /translation="MRTRAALAVQAGKPLVVTEVELEGPRAGEVLVEVKATGICHTDDF
FT                   TLSGADPEGLFPAILGHEGAGIVVDVGPGVTSVKKGDHVIPLYTPECRSCPSCLSRKTN
FT                   LCTAIRATQGQGLMPDGSSRFSINGDKIHHYMGCSTFSNFTVLPEIALAKVNPDAPFDK
FT                   ICYIGCGVTTGIGAVINTAKVEIGATAIVFGLGGIGLNVIQGLRLAGADMIIGVDLNND
FT                   KKPWGEKFGMTHFVNPKEVGDDIVPYLVNLTKRGADQIGGADYTFDCTGNTKVMRQALE
FT                   ASHRGWGKSVIIGVAGAGQEISTRPFQLVTGRTWMGTAFGGARGRTDVPKIVDWYMEGK
FT                   IEIDPMITHTMPLEDINKGFELMHSGESIRSVVLY"
FT   CDS_pept        189530..190372
FT                   /transl_table=11
FT                   /locus_tag="SM_b20171"
FT                   /old_locus_tag="SMb20171"
FT                   /product="carboxylesterase"
FT                   /function="A carboxylic ester + H2O = an alcohol + a
FT                   carboxylate"
FT                   /EC_number="3.1.1.1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20171"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48571"
FT                   /db_xref="GOA:Q92WZ1"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WZ1"
FT                   /protein_id="CAC48571.2"
FT                   /translation="MSAKMELVTQSQCFGGTQSVYRHASEVCGVEMTFGLYMPPQARTR
FT                   SVPLLWYLSGLTCTHENAMIKAGLQRHAAEQGLALVFPDTSPRGEGVADDEAYDLGQGA
FT                   GFYVNATQKPWSPHYRMYDYIVTELPALLQEQLPLNGVNGITGHSMGGHGALTIAFRNP
FT                   ELFRSVSAFAPIVNPTRSDWGRKQFSAYLGDDEADWGSYDACLLLGELGWHGDILIDQG
FT                   AADQFLDELQPEAMARLLAERRQAGVVRLQAGYDHSYYFVASFGEDHVRWHAERLNAA"
FT   CDS_pept        190386..190796
FT                   /transl_table=11
FT                   /locus_tag="SM_b20172"
FT                   /old_locus_tag="SMb20172"
FT                   /product="putative cytochrome c protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20172"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48572"
FT                   /db_xref="GOA:Q92WZ0"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WZ0"
FT                   /protein_id="CAC48572.1"
FT                   /translation="MAFRLGTLLTAFVLFGGTLGAAAPALALDPSVGDPGAGEKVFRKC
FT                   QACHAVGPDAKSKTGPLLNGIIGRSAGKAEGYAYSPAMSKAAEAGLTWTPEKIAEFLTS
FT                   PKGFLPGTKMTFAGLRKDQERADIIAYLATFP"
FT   CDS_pept        190974..192779
FT                   /transl_table=11
FT                   /locus_tag="SM_b20173"
FT                   /old_locus_tag="SMb20173"
FT                   /product="putative methanol dehydrogenase protein, large
FT                   subunit"
FT                   /EC_number="1.1.99.8"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20173"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48573"
FT                   /db_xref="GOA:Q92WY9"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WY9"
FT                   /protein_id="CAC48573.1"
FT                   /translation="MKRLLTMLAIMSIGGGAQVAFANDELQKLIDDPNQWAIQTGDYAN
FT                   LRYSKLDQINKDNVGKLQVAWTFSTGVLRGHEGSPLVIGDLMYVHTPFPNTVYALDLSK
FT                   DGQIVWKYEPKQDPNVIPVMCCDTVNRGVAYADNKIFLHQADTTVVALDAKTGKVIWSV
FT                   KNGDATKGETNTATVMPVKDKILVGISGGEFGVRGHVTAYSMADGKVLWRGYSMGPDSD
FT                   TLIDPEKTTHLGKPVGKDSGLTTWEGDQWKIGGGTTWGWYSYDPEENLVYYGTGNPSTW
FT                   NPTQRPGDNRWSMTIFARDVDTGMAKWLYQMTPHDEWDYDGVNEMILTEQQIDGKDRKL
FT                   LTHFDRNGFGYTMDRVTGELLVAEKYDPTVNWATEVVMDPKSDKYGRPQVVAQYSTEQN
FT                   GEDTNTTGVCPAALGTKDQQPAAYSPKTELFYVPTNHVCMDYEPFRVSYTAGQPYVGAT
FT                   LSMYPPKDSHGGMGNFIAWDNKEGKIKWSLPEPFSVWSGALATAGDVVFYGTLEGYLKA
FT                   VDAATGKELYRFKTPSGVIGNVMTYAREGKQYVAVLSGVGGWAGIGLAAGLTNPTEGLG
FT                   AVGGYSALSNYTALGGTLTVFKLPE"
FT   CDS_pept        192858..193388
FT                   /transl_table=11
FT                   /locus_tag="SM_b20174"
FT                   /old_locus_tag="SMb20174"
FT                   /product="putative cytochrome c protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20174"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48574"
FT                   /db_xref="GOA:Q92WY8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR022411"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WY8"
FT                   /protein_id="CAC48574.1"
FT                   /translation="MTRSRPAVPMILAFLTFMASAAGAEDAPKDNITAVRDENGRYYTA
FT                   DDVPTFKIAEDGTVDWLTYSGFRRYHSECHVCHGPEGEGSSYAPALKTSAINMDYYDFV
FT                   DVVTNGRKKVNAAENSVMPAFGENVNVMCYLDDIYVYLKARGADALPRGRPAKKEAKSD
FT                   AIKEAETACLGHE"
FT   CDS_pept        193345..194211
FT                   /transl_table=11
FT                   /locus_tag="SM_b20175"
FT                   /old_locus_tag="SMb20175"
FT                   /product="hypothetical protein"
FT                   /function="ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /note="hypothetical protein,, putative moxJ gene, part of
FT                   methanol dehydrogenase,, extracellular solute-binding
FT                   protein, family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20175"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48575"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022448"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WY7"
FT                   /protein_id="CAC48575.2"
FT                   /translation="MRSRKLKRLVSVTSSLLAAAGALMAAAGSQQAAAQTSDLVSKTAF
FT                   RVCADPANLPMSDRSGKGYENRIAELMASKLGLPVEYTWFPMATGFVRKTLQANACDVV
FT                   IGFAQGDELVLNTNHYYTSSYVLIVAPEGPLGGVTTLADPLLKDKRIGIVAGTPPATHM
FT                   ARNGLLPKAKGYHLMVDRRYEDPADDMLADLESGALDAAILWGPIGGPLVKASHPKLKA
FT                   TPLLSETTPPKLFYRITMGVRQGEKVWERKLNSLIRRNQSEINAILADAGVPLLNDMGT
FT                   GPLEAQQ"
FT   CDS_pept        194208..194753
FT                   /transl_table=11
FT                   /locus_tag="SM_b20176"
FT                   /old_locus_tag="SMb20176"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20176"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48576"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR022376"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WY6"
FT                   /protein_id="CAC48576.1"
FT                   /translation="MTRLRLHSLVLLLLAAFPAAAAEEPAGYRESEYRAEVPATLSGAT
FT                   VVSTEAAHALWKTGQVAFIDVLPRPPKPTNLPEGTVWNEKPRLSIPSALWLPNVGYGQL
FT                   ADAMHAYFRAGLEKATGGDKDRPVLFFCLDGCWMSWNAGKRALEYGYTRVFWYPQGTDG
FT                   WTAAGYPTERIEPEPGGR"
FT   CDS_pept        complement(194927..195448)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20177"
FT                   /old_locus_tag="SMb20177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20177"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48577"
FT                   /db_xref="InterPro:IPR021698"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WY5"
FT                   /protein_id="CAC48577.1"
FT                   /translation="MRHILTVLVSILVLALLPALARAALDKPLTPGAKVAFLGMTFIDL
FT                   STEGAYNGVRADETARLELMEGAARDRFVQEGFVILTNEPVAAELASTVNPADCNGCDL
FT                   SMGERLGADYVLVGEVRKISNLILSVELVLRDVDSGEMLRGLAVDIRSNTDDSWLRGIR
FT                   YILKNHFFKS"
FT   CDS_pept        195575..196762
FT                   /transl_table=11
FT                   /locus_tag="SM_b20178"
FT                   /old_locus_tag="SMb20178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20178"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48578"
FT                   /db_xref="InterPro:IPR022478"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WY4"
FT                   /protein_id="CAC48578.1"
FT                   /translation="MPNLKLLLAVFWATVLLTSPLPAAEVKTAVLRIDRVVGPPISRLD
FT                   APPADLGFAGAMLGNEDNRTTGAFTGMDYTVKTQAVAPEEAVAALDGLKAEGIGLIAVI
FT                   AEGDILKALSDKAGPEVLLFNAGARDDGLRDADCRANVLHVSPSRSMLSDSIVQFLMWK
FT                   KWQRILLIHGSHPEDKLLADSYRKSAAKFGAEIVEEREFVDTGGSRRTDTGHVMVQKQI
FT                   PVFTQEAEEYDVIVAADEAGVFAPYLPYHSWDPRPVAGSAGLRPVSWHPAHEAWGATQF
FT                   QRRFEKLTGRYMREEDYQAWLAMRVIGEAVTRSGKADPATVRAYALSKDFELAAFKGQK
FT                   LTFRTWNGQLRQPVLLTEGRVTVSVSPQDGYLHQHSPLDTLGIDAPETACHAFGG"
FT   CDS_pept        196764..197738
FT                   /transl_table=11
FT                   /locus_tag="SM_b20179"
FT                   /old_locus_tag="SMb20179"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20179"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48579"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="InterPro:IPR022456"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WY3"
FT                   /protein_id="CAC48579.1"
FT                   /translation="MLRPALAIVSAVLLSAGSAEANKVFVSNERGNNITVLDSESWEVI
FT                   ATFPAGNRPRGITISPDGKELYVCASDDDTVRVFDPETYKELHTLPSGPDPELFALDPS
FT                   GNPLYIANEDDNLVTVVDVKTRQVLAEVPVGVEPEGVAVSPDAKTIINTSETTNMAHFI
FT                   DASTYKIVHNVLVDQRPRYAEFTADGKKLYVSAEIGGTVSVIDVSAAEPKITKKITFEV
FT                   PGVLPEWLQPVGVKATKDGSRIFVALGPANRVAVIDGKTDEVLDYFLVGQRVWQMAFTP
FT                   GEEFLITTNGNSNDVSIIDVKAEKVIRSVQVGEQPWGVVVAPD"
FT   CDS_pept        197742..198221
FT                   /transl_table=11
FT                   /locus_tag="SM_b20180"
FT                   /old_locus_tag="SMb20180"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20180"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48580"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WY2"
FT                   /protein_id="CAC48580.1"
FT                   /translation="MQFANINGEEFIVHKSVLAALAALSLASPAVAAPLCSDLGFAGLL
FT                   AKCNRGEPIEITLASGKPLGKGAITLQSGAYYEMQITADGSAELAITGAPFFRAIWMNE
FT                   IVVNGIEVRPMAIDSLEFDEAGTATLSFIAVKPGSYEVKIPETSGDSQKVSISIQ"
FT   CDS_pept        198276..199247
FT                   /transl_table=11
FT                   /locus_tag="SM_b20181"
FT                   /old_locus_tag="SMb20181"
FT                   /product="putative ABC transporter periplasmic
FT                   solute-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20181"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48581"
FT                   /db_xref="GOA:Q92WY1"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WY1"
FT                   /protein_id="CAC48581.1"
FT                   /translation="MKTLRLIVAACLFAFGPAAAAAEELPQLRAAMLASGTVTWEISTI
FT                   KTHEFDRKNGFELTVQDYADNGATRVAFEGGEADTMVADWIWVANQRASGKDYVFIPYS
FT                   RAVGGLMVKDDSGIKALPDLAGKKIGIAGGPLDKSWLILRAYARQQHDMDLAAETEQVF
FT                   GAPPLIFKSALSGETAGTINFWHFLAKMRAKGMHELVSVSDAAAALKLDPDTPLLGYVL
FT                   KGEYAATHPEIVKGLYKASRAAKDLLRENDEVWEELRDKMNAADDAEFIALRDGYRAGI
FT                   PSGKPIDEAAADLFLRLMAELGGEELVGKATSLPSGLFLHLE"
FT   CDS_pept        199222..200001
FT                   /transl_table=11
FT                   /locus_tag="SM_b20182"
FT                   /old_locus_tag="SMb20182"
FT                   /product="putative ABC transporter protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20182"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48582"
FT                   /db_xref="GOA:Q92WY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WY0"
FT                   /protein_id="CAC48582.1"
FT                   /translation="MDCSCTLNKTLQHPALVRALSLGLLLLLWIAAAGFTDDASVLPQP
FT                   WALWEPFVQAVSSGALPYHLGMTLWRVICAFVPAMVIGVAIGFLMGRVAAVDRWLDPWL
FT                   VVFLNLPALVLIVLCYIWIGLNETAAITAVVLNKIPNVATLLREGARALDPDLDSMAAV
FT                   YRMRPLARLRHVIMPQLAPFIAAAARSGIAVIWKIVLVVEFLGRSSGIGFQIHFYFQLF
FT                   NVAMVLVYALSFIGVMLLVEAFFLQPAERRVRRWRTA"
FT   CDS_pept        199998..200621
FT                   /transl_table=11
FT                   /locus_tag="SM_b20183"
FT                   /old_locus_tag="SMb20183"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20183"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48583"
FT                   /db_xref="GOA:Q92WX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WX9"
FT                   /protein_id="CAC48583.1"
FT                   /translation="MIRIDVRRKAFGEEEVLRDIRFEMEIGETVAILGPSGVGKSTLLR
FT                   LVAGIDTAFEGEITRPENIAMVFQEPVLLPWRSVIENLTLVHPQLGSQAALSALERTGI
FT                   ADRAGLFPGQLSLGQQRRLALARAFAGRPELLVLDEPYVSLDPAMAEDMLALTEALIAE
FT                   TAPAVILVTHSEAEARRLARSCLRLAGKPATIIEEFAAAPGRAS"
FT   CDS_pept        200618..201346
FT                   /transl_table=11
FT                   /locus_tag="SM_b20184"
FT                   /old_locus_tag="SMb20184"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20184"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48584"
FT                   /db_xref="GOA:Q92WX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR022467"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WX8"
FT                   /protein_id="CAC48584.1"
FT                   /translation="MIGLEISHVSYSYGKSRALDDVSFSVRTGRFCALLGPNGAGKSTL
FT                   FALLTRLLATRAGTIGVAGFDIAREPRAALARIGVVFQQPTLDLDMSVRRNLRYFAGLH
FT                   GLSGRQAAVAIEAALTQLGMAERADEQVRALNGGHRRRMEIARALIHKPQILLLDEPTV
FT                   GLDAASRQAITDHVHLLAESGLAVLWATHLVDEIRPEDQVVVLHRGKVLSDGTAAELAG
FT                   GQGLAKAFLSMTAEGREVPA"
FT   CDS_pept        201343..202134
FT                   /transl_table=11
FT                   /locus_tag="SM_b20185"
FT                   /old_locus_tag="SMb20185"
FT                   /product="probable ABC transporter"
FT                   /function="ABC-type multidrug transport system, permease
FT                   component"
FT                   /note="probable ABC-2 type transport system, permease
FT                   component,, putative drrB gene"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20185"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48585"
FT                   /db_xref="GOA:Q92WX7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR022403"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WX7"
FT                   /protein_id="CAC48585.1"
FT                   /translation="MKAWLVALSAIVTRENLRFVRQRGRFLAALVRPLVWLIVFAAGFR
FT                   AALGVSIIPPYQTYITYEVYILPGLCGMIQLFNGMQSSLALVYDQEMGSMRLLLTSPLP
FT                   RWWLLFSKLLAGVIVSILQVAVFLAIAALTGITVPPVGYVAVLPALVISGLMLGAFGLL
FT                   ISSTVRQLENFAGVMNFVIFPMFFLSSALYPLWKMAESSPLLRDICALNPFTYAVELIR
FT                   FALYGELNLTALAWVGACFVLFMLAALWGYNPARAMLRSKG"
FT   CDS_pept        202255..202824
FT                   /transl_table=11
FT                   /locus_tag="SM_b20186"
FT                   /old_locus_tag="SMb20186"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20186"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48586"
FT                   /db_xref="GOA:Q92WX6"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92WX6"
FT                   /protein_id="CAC48586.1"
FT                   /translation="MLKLHPSIDNGFPPASPGFAGGTLKCKCASNPVTVRIGSQTAHNH
FT                   ACGCTKCWKPEGAIFAQIAVVGRDNVNVTSGAEKLQVVDPSATIQRYACRDCGTHMYGR
FT                   IENTKHPFYGLDFVHTELSDETGWSPPEFAAFVSSIIESGVNPESMPEIRARLTELGLQ
FT                   PYDCLSPPLMDAIATHIAKQTGALPA"
FT   CDS_pept        complement(203136..203702)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20194"
FT                   /old_locus_tag="SMb20194"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20194"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48587"
FT                   /db_xref="GOA:Q92WX5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WX5"
FT                   /protein_id="CAC48587.2"
FT                   /translation="MAATPPLCDFGWPAFDARLPGVDGFTHSIFSQAGPKGLVVAFICN
FT                   HCPYVKAVIARIVRDAIDLRAHGIGFVAVNSNDAGNYPQDSFENMKRFASQNALPFPYL
FT                   HDEDQSVARAYRAVCTPDFFGFNKDMKLQYRGRLDASRKEIGPADLRRDLYEAMVMVAL
FT                   FGKGPAEQQPSIGCTIKWKVSAFQV"
FT   CDS_pept        complement(203706..204392)
FT                   /transl_table=11
FT                   /gene="ppe"
FT                   /locus_tag="SM_b20195"
FT                   /old_locus_tag="SMb20195"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /function="D-ribulose 5-phosphate = D-xylulose 5-phosphate"
FT                   /EC_number="5.1.3.1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20195"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48588"
FT                   /db_xref="GOA:Q92WX4"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WX4"
FT                   /protein_id="CAC48588.1"
FT                   /translation="MNEKTIIAPSVLSADFSRLGEEVEAVCRAGADWIHLDVMDGHFVP
FT                   NITFGPPVIKALRDRTDKVFDCHLMIEPPTPYLGAFACAGCDIITVHAEATTHLDRSLQ
FT                   AIRDVGCKAGVSLNPSTPESVIEYVLDRLDLVLLMTVNPGFGGQDFIPAVVDKVRRVRS
FT                   MIGGRPIHIEIDGGVTPETAPLVAAAGADVLVAGSAVFKGGSEEHYARNIAAIRAASDG
FT                   AIRKAA"
FT   CDS_pept        complement(204389..205324)
FT                   /transl_table=11
FT                   /gene="cbbX"
FT                   /locus_tag="SM_b20196"
FT                   /old_locus_tag="SMb20196"
FT                   /product="probable CbbX protein"
FT                   /function="ATPases of the AAA+ class"
FT                   /note="probable ATPase family associated with various
FT                   cellular activities (AAA)"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20196"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48589"
FT                   /db_xref="GOA:Q92WX3"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WX3"
FT                   /protein_id="CAC48589.1"
FT                   /translation="MLMPDAPSNTESLPTSVDLAGEYQASGVAEILDELDRELVGLKPV
FT                   KQRIRETAALLLVERARRAMGLSHEPPSLHMSFTGNPGTGKTTVALRMANLLHRLGYIR
FT                   KGHLVSVTRDDLVGQYIGHTAPKTKEILKKAMGGVLFIDEAYYLYRPDNERDYGQEAIE
FT                   ILLQVMENNRDDLVVILAGYADRMDRFFESNPGFRSRIAHHIDFPDYDNGELLSIAESM
FT                   LSRQGYRFDSKASAVMSDYIARRRRQPHFANARSIRNALDRARLRQANRLFEESAGPVD
FT                   AEQLSTITARDIAASRVFATVEPSHTETSP"
FT   CDS_pept        complement(205336..205725)
FT                   /transl_table=11
FT                   /gene="cbbS"
FT                   /locus_tag="SM_b20197"
FT                   /old_locus_tag="SMb20197"
FT                   /product="putative ribulose-1,5-bisphosphate carboxylase
FT                   small subunit protein"
FT                   /EC_number="4.1.1.39"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20197"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48590"
FT                   /db_xref="GOA:P58349"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58349"
FT                   /protein_id="CAC48590.1"
FT                   /translation="MRITQGCFSFLPDLTDEQITAQVQYCLGKGWAIGVEYTDDPHPRN
FT                   TYWEMWGNPMFDLKDAKGVMMELEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPE
FT                   NEPSLRMTRTESNGRSQHYMWETQR"
FT   CDS_pept        complement(205767..207227)
FT                   /transl_table=11
FT                   /gene="cbbL"
FT                   /locus_tag="SM_b20198"
FT                   /old_locus_tag="SMb20198"
FT                   /product="putative ribulose-1,5-bisphosphate carboxylase
FT                   large subunit protein"
FT                   /EC_number="4.1.1.39"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20198"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48591"
FT                   /db_xref="GOA:P58348"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58348"
FT                   /protein_id="CAC48591.1"
FT                   /translation="MNADAKTEIKGRERYKAGVLKYAQMGYWNGDYEPKDTDLIALFRI
FT                   TPQDGVDPIEAAAAVAGESSTATWTVVWTDRLTACDQYRAKAYRVDPVPGTPGQYFCYV
FT                   AYDLILFEEGSIANLTASIIGNVFSFKPLKAARLEDMRLPVAYVKTFRGPPTGIVVERE
FT                   RLDKFGKPLLGATTKPKLGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYL
FT                   YCMEAVNHASAVTGEVKGHYLNITAGTMEEMYRRAEFAKELGSVIVMVDLIVGWTAIQS
FT                   ISEWCRQNDMILHMHRAGHGTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGD
FT                   PPTVQGYYNVCREMKNEVDLPRGLFFEQDWADLKKVMPVASGGIHAGQMHQLLDLFGDD
FT                   VVLQFGGGTIGHPMGIQAGATANRVALEAMVLARNEGRDIAHEGPEILRAAAKWCKPLE
FT                   AALDIWGNISFNYTPTDTSDFVPSVTAA"
FT   CDS_pept        complement(207260..208339)
FT                   /transl_table=11
FT                   /gene="cbbA"
FT                   /locus_tag="SM_b20199"
FT                   /old_locus_tag="SMb20199"
FT                   /product="putative fructose-1,6-bisphosphate aldolase
FT                   protein"
FT                   /EC_number="4.1.2.13"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20199"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48592"
FT                   /db_xref="GOA:P58336"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58336"
FT                   /protein_id="CAC48592.1"
FT                   /translation="MARITLRQLLDHAAERSYGVPAFNINNMEQGLAIMEAARASDAPV
FT                   ILQVSRGARSYANDVMLAKMMEALEEMYPDIPLCIHQDHGNNVATCLTAIQHGFTSVMM
FT                   DGSLKEDAKTPADYDYNVSITAEVSRLAHMVGASVEGELGCLGSLETGHGEAEDGHGFE
FT                   GALDRSQLLTDPDEAARFVAETGVDALAVAIGTSHGAYKFTRKPTGEVLAMDVIEKIHE
FT                   RLPDTHIVMHGSSSVPQEWQDVFNAHGGQMRETYGVPVEEIVRGIRFGVRKVNIDTDLR
FT                   LAAAAAFRRVADTSRSEFDPRKFLKPAMDAMSAVCKARFEAFGTAGNASRIKVVPMPEM
FT                   ARRYASGSLKPQSARSEAA"
FT   CDS_pept        complement(208342..210426)
FT                   /transl_table=11
FT                   /gene="cbbT"
FT                   /locus_tag="SM_b20200"
FT                   /old_locus_tag="SMb20200"
FT                   /product="putative transketolase protein"
FT                   /EC_number="2.2.1.1"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20200"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48593"
FT                   /db_xref="GOA:P58333"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58333"
FT                   /protein_id="CAC48593.1"
FT                   /translation="MNVSQQIGPRAAASERSMADAIRFLSMDAVEKANSGHPGMPMGMA
FT                   DAVTVLFNRFIRIDPSHPDWPDRDRFVLSAGHGSMLLYSLHHLIGFADMPMAELSSFRQ
FT                   LGSKTAGHPEYGHALGIETTTGPLGQGISTAVGMAIAEQMMAARFGSALCNHFTYVVAG
FT                   DGCLQEGISHEAIDLAGHLKLRKLVVLWDDNRISIDGSTDLSTSMNQLARFRAAGWDAQ
FT                   AVDGHDPDAVAKAIERARRTRKPSLIACRTRIGKGAASMEGSHKTHGAALGEKEIAATR
FT                   EKLGWPHPPFFVPPEIKAAWEKVATRGRTAREAWEIRLDASRSKKRYEQTVERKLDGEV
FT                   GDLLARFRGAHRTRATKVATRQASQMALEVINGATALTIGGSADLTGSNLTLTSQTQPI
FT                   SPGNFKGRYLHYGIREHGMAAAMNGIALHGGFIPYGGTFLVFSDYARGAMRLSALMGLP
FT                   VIYVLTHDSIGLGEDGPTHQPVEHLAMLRATPNLNVFRPADIIETAECWEIAIGEKNTP
FT                   SVFALSRQALPMLRRTDGNENLSALGAYVLREARGDRDITLLATGSEVEIAVAAAERLQ
FT                   AEERIAAAVVSMPCWEKFEAQDAAYHRQVLGDAPRIAIEAAGRLGWDRWMGPDSAFVGM
FT                   TGFGASAPAGDLYRHFGITADHVVAEALELLRRACPETPPIGARTGKPVAHIVRSSEEA
FT                   "
FT   CDS_pept        complement(210437..211306)
FT                   /transl_table=11
FT                   /gene="cbbP"
FT                   /locus_tag="SM_b20201"
FT                   /old_locus_tag="SMb20201"
FT                   /product="putative phosphoribulokinase protein"
FT                   /EC_number="2.7.1.19"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20201"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48594"
FT                   /db_xref="GOA:P58347"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58347"
FT                   /protein_id="CAC48594.1"
FT                   /translation="MSAKFPIISITGSSGAGTTTVKDTFEKIFKRENISASFIEGDAFH
FT                   RFDRETMRSKIAEEKARGVDFTHFSAEANELEILESVFAEYGRRGVGRTRHYVHDEAEA
FT                   AKFGSDPGTFTDWEEFRDSDLLFYEGLHGCAVTDTVNLAQHCDLKIGVVPVINLEWIQK
FT                   IHRDKATRGYSTEAVTDTILRRMPDYVNYICPQFSLTDINFQRVPIVDTSNPFIARWIP
FT                   TPAESILVIRFAKPQSIDFPYLLSMLHNSYMSRANSIVVPGDKLDLAMQLIFTPLIHKL
FT                   LERKHRMS"
FT   CDS_pept        complement(211317..212366)
FT                   /transl_table=11
FT                   /gene="cbbF"
FT                   /locus_tag="SM_b20202"
FT                   /old_locus_tag="SMb20202"
FT                   /product="putative D-fructose-1,6-bisphosphatase protein"
FT                   /EC_number="3.1.3.11"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20202"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48595"
FT                   /db_xref="GOA:Q9EXV4"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EXV4"
FT                   /protein_id="CAC48595.1"
FT                   /translation="MSGATLEAYLASCTARGDDLSRDVAAVIQRLAKAALDIRKLVNQG
FT                   ALGTAFNGTHGGSNTDGDLQKDLDILCDDQFLTCLQGAPVACYASEELENPVLLDPSAR
FT                   LAVAIDPLDGSSNIDNNVSIGTIFSVLPAAKGPDVDPSQSFLQPGNRQLAAGFFIYGPQ
FT                   TALVLSLGKGTEIFIFSSRLGCFVEAYKSAIIPERAHEFAINMSNYRHWEEAIRLYVDD
FT                   CLAGSEGPRERDFNMRWIASLVAETYRILIRGGIFLYPADGRKGYSQGRLRLVYEANPI
FT                   AFIIENAGGAATTSIDRILDLVPENLHQRVPLVFGSRREVARITRYHVDPNMIGERAPL
FT                   FGKRGLFRA"
FT   CDS_pept        212468..213409
FT                   /transl_table=11
FT                   /gene="cbbR"
FT                   /locus_tag="SM_b20203"
FT                   /old_locus_tag="SMb20203"
FT                   /product="probable transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20203"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48596"
FT                   /db_xref="GOA:P58332"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58332"
FT                   /protein_id="CAC48596.1"
FT                   /translation="MRNVTFRQLRTVEAVCRLGKINLAAEALGLTGPALTLQIQHLERD
FT                   AGIALFDRTRGGMVPTAYGLAFLEAARAIEDSLIALEDSIDAIKGLRTGRLRLGVVSTG
FT                   KYFAPQLIAAFRDQVPAVEINLFIGNRAEIIAKLRDHEIDIALMGRPPRDFEVRAQVFG
FT                   DHPLVFIAPAGHPLAGVLEISRERIAQEQFLVREKGSGTRISLEIFLSDTPHELEELGT
FT                   EIASNETIKQAVIAGLGIAFISAHTIEQEVKLGRLVILDVIDTPIRRQWFTVSRLDRVA
FT                   TPAMQAFERFVLASGARYLPVVSKPYPANAFG"
FT   CDS_pept        213692..213787
FT                   /transl_table=11
FT                   /gene="pqqA"
FT                   /locus_tag="SM_b20204"
FT                   /old_locus_tag="SMb20204"
FT                   /product="putative pyrroloquinoline quinone synthesis
FT                   protein A"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20204"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48597"
FT                   /db_xref="GOA:Q9EXV2"
FT                   /db_xref="InterPro:IPR011725"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EXV2"
FT                   /protein_id="CAC48597.1"
FT                   /translation="MAWHKPKFIEVSCAMEITRYAPADGDEPILF"
FT   CDS_pept        213829..214740
FT                   /transl_table=11
FT                   /gene="pqqB"
FT                   /locus_tag="SM_b20205"
FT                   /old_locus_tag="SMb20205"
FT                   /product="probable pyrroloquinoline quinone synthesis
FT                   protein B"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20205"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48598"
FT                   /db_xref="GOA:Q9EXV1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EXV1"
FT                   /protein_id="CAC48598.1"
FT                   /translation="MNKTSDLRIIVLGAAAGGGLPQWNCGCRNCAMARDPASGLRPQTQ
FT                   SSLAVSLDGESWTVFNASPDIRQQVQDNCPLQPRRLRHSPIESVVLTNGDIDHLAGLLV
FT                   LREKQAFTLFSTGAVGRIVSDNPVFQVLDPELVSRKTIEIDEAFSPLSGLDARLFAVPG
FT                   KVPLFLEDGEPDLGIEGEHTVGLELEATGRRVYYVPGCAMMTDSLAARLRDADAVFFDG
FT                   TLFSDDEMILTGTGRKTGRRMGHMPIDGEGGSLDALDLLNIRRKIYVHINNTNPIWRAG
FT                   SERERVEARGFEIGYDGMEVRL"
FT   CDS_pept        214737..215507
FT                   /transl_table=11
FT                   /gene="pqqC"
FT                   /locus_tag="SM_b20206"
FT                   /old_locus_tag="SMb20206"
FT                   /product="probable pyrroloquinoline quinone synthesis
FT                   protein C"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20206"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48599"
FT                   /db_xref="GOA:Q9EXV0"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EXV0"
FT                   /protein_id="CAC48599.1"
FT                   /translation="MTTATDRQAFHARLLEIGKERYHDKHPFHAMLHGGGCTTTQVRAW
FT                   VINRYYYQSRIPMKDAAFLSRCDDPDMRRAWRSRIEDHDGGVEEGGGIRRWLRLAEAVG
FT                   LDPAYVGSARGVLPSTRFAVDAYVSFVREKPLLEAVASSLTELFAPKIHSERIAGLLEH
FT                   YAFADDAALAYFRQRLAEVPRDVEFGLAYVLDHADTREKQDAAAQALTFKTDVLWAQLD
FT                   ALYSAYVTPGRIPPGAWDGREGVIREPRAREAAE"
FT   CDS_pept        215504..215800
FT                   /transl_table=11
FT                   /gene="pqqD"
FT                   /locus_tag="SM_b20207"
FT                   /old_locus_tag="SMb20207"
FT                   /product="putative pyrroloquinoline quinone synthesis
FT                   protein D"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20207"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48600"
FT                   /db_xref="GOA:Q9EXU9"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EXU9"
FT                   /protein_id="CAC48600.1"
FT                   /translation="MTADAPVISGSSVVKLARGVRLHEDPVRGQTVLLAPERAMAVDDI
FT                   AVAIVQALDGERNLDRIAADFAEKFDAPVEEIAEDVRTFVQELSVRRMLEIVQ"
FT   CDS_pept        215797..216924
FT                   /transl_table=11
FT                   /gene="pqqE"
FT                   /locus_tag="SM_b20208"
FT                   /old_locus_tag="SMb20208"
FT                   /product="probable pyrroloquinoline quinone synthesis
FT                   protein E"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20208"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48601"
FT                   /db_xref="GOA:Q9EXU8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EXU8"
FT                   /protein_id="CAC48601.1"
FT                   /translation="MSDTIARPAETARTLPRILPPMAMLAELTHRCPLACPYCSNPIAL
FT                   TQAKEELSTEEWTGVFAQAADLGVLHLHLSGGEPAARRDLVELTQAASSLGLYTNLITS
FT                   GVGLTEARMNSLADAGLDHIQLSIQGVSPESADRIGGYKGGYERKMAVAGWAADAAIPL
FT                   TLNAVCHRQNMGEIDEMIELAIRLKARRIEVATVQFHGWAERNKEVLMPTREQVECATR
FT                   TVAEAREKYQGILVIDYVPADYYSKYPKACMGGWGRVGLNVTPSGRVLPCHAAETIPSL
FT                   SFENVRENSLSSIWYESNAFNAYRGEDWMPELCRSCERKKVDFGGCRCQAMALAGDASA
FT                   TDPVCIRSPLRDRLTLEVEQLSAPSVVPMNYRGRA"
FT   CDS_pept        complement(216993..217232)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20209"
FT                   /old_locus_tag="SMb20209"
FT                   /product="probable tautomerase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20209"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48602"
FT                   /db_xref="GOA:Q7ANT1"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANT1"
FT                   /protein_id="CAC48602.1"
FT                   /translation="MPIVTVQVTREGSAPGRNSVTAEEKAAIIKGVSEVLLDVLNKPLE
FT                   STYVVIEEVELDNWGWGGFPTVQFRRQRAETARS"
FT   CDS_pept        complement(217287..218000)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20210"
FT                   /old_locus_tag="SMb20210"
FT                   /product="probable oxidoreductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /note="probable oxidoreductase,, putative short-chain
FT                   dehydrogenases/reductases family (SDR)"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20210"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48603"
FT                   /db_xref="GOA:Q7ANT0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3UN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANT0"
FT                   /protein_id="CAC48603.1"
FT                   /translation="MRNQQKVVVITGASQGIGAGLVRAYRDRNYRVVATSRSIKPSADP
FT                   DIHTVAGDISKPETADRIVREGIERFGRIDSLVNNAGVFLAKPFVEMTQEDYDHNLGVN
FT                   VAGFFHITQRAAAEMLKQGSGHIVSITTSLVDQPMVGMPSALASLTKGGLNAVTRSLAM
FT                   EFSRSGVRVNAVSPGVIKTPMHPAETHSTLAGLHPVGRMGEIRDVVDAVLYLEHAGFIT
FT                   GEILHVDGGQNAGRW"
FT   CDS_pept        complement(218142..219074)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20211"
FT                   /old_locus_tag="SMb20211"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20211"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48604"
FT                   /db_xref="GOA:Q7ANS9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANS9"
FT                   /protein_id="CAC48604.1"
FT                   /translation="MDRIDAMKVFVAAIDEGSLAGAARRLKRSPTAVSRALSFLEAHVG
FT                   VELLHRTTRTLKLSEAGQRYAAACRRVLTDLEEADMLAGGERSAPRGMLTISSPPILGE
FT                   EILRPILDDFLDLYPTVSVRLLLLDRFVNLVDEGVDIALRIGQLADSSLISTRLGGDVR
FT                   RVVVASPRYLANHPRIEEPADLDKHQILAFTNFGLESWSFTPAKGSSVPRTIQFTPRCI
FT                   VNSVRAAAASAAAGRGLTRLYSYHVAEYVRDGRLEIVLADAEHPPLPAHLIAPQGRMSV
FT                   PKVRAFVDFAAPRLRSEFARMAAEAGTLT"
FT   CDS_pept        219262..219942
FT                   /transl_table=11
FT                   /locus_tag="SM_b20212"
FT                   /old_locus_tag="SMb20212"
FT                   /product="hypothetical protein"
FT                   /function="Putative intracellular protease/amidase"
FT                   /note="hypothetical protein,, putative intracellular
FT                   protease, PfpI family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20212"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48605"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WX2"
FT                   /protein_id="CAC48605.1"
FT                   /translation="MTMKILMVLTSHDRLGNTGKPTGFWLEEFAAPYYVFKDAGAEVTL
FT                   ASPKGGQPPIDPKSDEPASQTAAMGRFKDDPAARKALANTLKLGEVKQEDYDAVFYPGG
FT                   HGPMWDLVNDRNSIALIEGFYDAGKPVAAVCHGPAVLTQVTHLGEPIVKGRRVTGFTNS
FT                   EEEAVQLTDVVPFLVEDELKRLGGRYEKAADWADFTVVDGRLVTGQNPSSSTSAASELL
FT                   KLLQ"
FT   CDS_pept        219980..221863
FT                   /transl_table=11
FT                   /locus_tag="SM_b20213"
FT                   /old_locus_tag="SMb20213"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20213"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48606"
FT                   /db_xref="GOA:Q92WX1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WX1"
FT                   /protein_id="CAC48606.1"
FT                   /translation="MRPSAIRYRSPCYETQSGYLALVPCSACQARPPPQEAQVQCRGTK
FT                   MILFTIAYLAGALTILSPCILPVLPFVFSRAGQPFARSVLPMLIGMVLTFAGVATLAAL
FT                   GGDWAVQANVAGRYAAIAVLAGFGVTLLSTRAAALFTRPAVALGSRLSQKMAGQPPSVG
FT                   ASLLLGVATGLLWAPCAGPILGLVLTGAALHGANVETTLLLAAYAAGAATSLALAVLAG
FT                   GRVFAAMKRSLGLGERLRQGLGIAVLAGVAAIALGLDTGQLARLSYASTAAIEQSLLDG
FT                   VRGDSVEDRASTAVGGEGPAYRSDLPVEGMFPPLDGAVEWVNSKPLSVEQLRGKVVLVD
FT                   FWTYSCINCIRTIPYVRAWAEKYRDQGLVVIGVHAPEFAFEKRIANVRSAVTDFDIRYP
FT                   VAIDNDFAIWRAFGNSYWPAHYFIDAEGRIRHHHFGEGDYARSERVIQELLAEAAGSRR
FT                   GDSGFVQPDATGAEAAPDLANLQSGEDYVGYMRASNFVSPERVAADAAHEYTAGEPRLN
FT                   QWSLAGNWTVGAEQATLNRAGGAITYRFSARDLHLVLGPGENGRRVRFQVKVDGAAPGP
FT                   DHGSDIDSDGYGTVGETRLYQLVRQSGEVRERTFEIRFLEPGVEAFVFTFG"
FT   CDS_pept        222127..222930
FT                   /transl_table=11
FT                   /locus_tag="SM_b20214"
FT                   /old_locus_tag="SMb20214"
FT                   /product="probable oxidoreductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative short-chain dehydrogenase/reductase
FT                   (SDR),,putative 3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20214"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48607"
FT                   /db_xref="GOA:Q92WX0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WX0"
FT                   /protein_id="CAC48607.1"
FT                   /translation="MTQHSKGTALVTGASSGIGAIYADRLARRGYDLILVARNQTRLDQ
FT                   LARRLTDETGRSVEVVAADLGKRTDAARIEKVLRTDASITMLVNNAGVGATGPLLASDV
FT                   DKMEEMIALNVNALTRLTYAAVPGFVARGSGAIINIASIVGIAPEVLNGVYGGSKAFVL
FT                   AFTLSLQKELEGRNIRIQAVLPGATATDFWGIAGTPVEHLPNEIVMPAEDMVDAALVGF
FT                   DLGEPITIPSLPDAADWEAYEAARQKLVPNLSLSVPAARYRAAAA"
FT   CDS_pept        222993..223973
FT                   /transl_table=11
FT                   /locus_tag="SM_b20215"
FT                   /old_locus_tag="SMb20215"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20215"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48608"
FT                   /db_xref="GOA:Q92WW9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WW9"
FT                   /protein_id="CAC48608.1"
FT                   /translation="MRRRIPARKSPMHRIGFVVFPRFQLMGFAAVTAFEMANLALGETV
FT                   YEIELLSEAGGEVKSSAGFGVLTKTFDHTAYDTVMFGAGVQIEPMTPGLVEFARRSFET
FT                   ARRVAAPCTGAFVLAESGLLDGRRATTHWAFARQLQDRFPAVKVEEDRIFIVDGSVWTS
FT                   AGMTASIDLALAMVEKDYGQGVARSVARKLVVYHRRAGGQSQFSALLELEPKSDRIQRS
FT                   IDYAKANLRRGLSVEELADAAGLSARQFSRAFRAETGQSPAKAVETLRVEAARLMMEQG
FT                   RHSMDVIAEETGFAIADRMRRAFLRTLGQPPQTIRRNARESASVP"
FT   CDS_pept        224114..225160
FT                   /transl_table=11
FT                   /locus_tag="SM_b20216"
FT                   /old_locus_tag="SMb20216"
FT                   /product="epoxide hydrolase"
FT                   /function="an epoxide + H2O = a glycol"
FT                   /note="High confidence in function and specificity"
FT                   /note="deleted EC_number 3.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20216"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48609"
FT                   /db_xref="GOA:Q92WW8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WW8"
FT                   /protein_id="CAC48609.1"
FT                   /translation="MTGEFNLRRRRFMGVAALTVAAAHFRVGRAALAKSTSDARIPATT
FT                   PGTNTSFAAIKQIDAGVLNIGYAEAGASDAPVVILLHGWPYDIHTYVDVAPLLAKAGYR
FT                   VVVPHLRGYGTTRFLSPDTPRNGQQAAIAADIVALMDALGIEKAVIAGCDWGARTANII
FT                   AALWPERCKALVSVSGYLIGSRETNKKPLPPKAELAWWYQFYFATERGRAGYEQYRKDF
FT                   AKLIWQLASPKWNFDDATFDRSAAALDNPDHVDITVNNYRWRISLADGESKYDGLENRL
FT                   AELPVIGVPTITLEGDANGAPHPEPAAYAKKFSGKYEHRLISGGIGHNLPQEAPQAFAQ
FT                   AVVDVDRL"
FT   CDS_pept        225378..226043
FT                   /transl_table=11
FT                   /locus_tag="SM_b20217"
FT                   /old_locus_tag="SMb20217"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20217"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48610"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WW7"
FT                   /protein_id="CAC48610.1"
FT                   /translation="MTTAINSERARPVDMKLEVIVVPVSDVDRAKEFYASLGWRLDADF
FT                   AGADGYRVIQFTPPGSGASVIFGRHVTDAEPGSAQGLYLIVSDIEAAREELRGRGVDIS
FT                   EVFHAGDVNAGSDEPYLFGTHRAGGRDPERRSYRSYASFRDPDGNGWLFQEVTARLPGR
FT                   VDPDGTAFSSAADLAAAFRRAEAAHGEYEKQLGHRDEDWSIWYADYIVREQTGEAQPA"
FT   CDS_pept        complement(226214..227578)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20218"
FT                   /old_locus_tag="SMb20218"
FT                   /product="putative sensor histidine kinase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20218"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48611"
FT                   /db_xref="GOA:Q92WW6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WW6"
FT                   /protein_id="CAC48611.1"
FT                   /translation="MAARSILHGIHLWPRTLRARLFVILLAGLTIAHAMSFAALFSERY
FT                   IAARSVMFNTLETDVATSIAILDRLPATERAAWLGRLERGSYRFVLGRGLPGSRVLNEV
FT                   DVEVADKVRAAIGAKYPIEVESIPGGVRRLQAHLRLSDGEPLTIDITPRGVMPVADWLP
FT                   YVLVAQLSLLVLCSWFAVRQATRPLADLAKAADTLDPNSRTPRLSETGPREVAYAATAF
FT                   NAMRDRIAQYLEERVQILAAISHDLQTPITRMKLRAEMAEASIERDKLITDLDEVERLV
FT                   KEGVAYARSAHGKDEKASRIDLASFIESLAYDYQDTGKAVTVAELGDGAIVTRPHALRR
FT                   ILTNLIDNALKFGGSAEIEVQRRPEGTVTIKVLDRGPGIPEDQLEAVLQPFFRLEQSRS
FT                   RDTGGTGLGLAIAQQLATVIGGSLTLRNRDGGGLAAELSLESSTVSMKQWNSLAL"
FT   CDS_pept        complement(227578..228315)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20219"
FT                   /old_locus_tag="SMb20219"
FT                   /product="putative response regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20219"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48612"
FT                   /db_xref="GOA:Q92WW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WW5"
FT                   /protein_id="CAC48612.1"
FT                   /translation="MEHIDHILIVDDDREIRELVSAYLKKNGLRVTAVADGRQMRTFLE
FT                   ANTVDLIILDLMMPGDDGLVLSRELRVGRHKATPIVMLTARSDEMDRIIGLEMGADDYI
FT                   AKPFSARELLARIKAVLRRARMLPANLQVSEAGQLLRFGQWKLDTTARHLIDADGTAIA
FT                   LSGAEYRLLRVFVDHPQRVLNRDQLLNLTQGREAELFDRSIDLLVSRVRQRLGDDAREP
FT                   TYIRTVRSEGYVFSVPVEIMEPR"
FT   CDS_pept        complement(228407..228829)
FT                   /transl_table=11
FT                   /locus_tag="SM_b22002"
FT                   /old_locus_tag="SMb22002"
FT                   /product="epoxide hydrolase"
FT                   /function="an epoxide + H2O = a glycol"
FT                   /note="deleted EC_number 3.3.2.3"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22002"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51279"
FT                   /db_xref="GOA:B2FDC0"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDC0"
FT                   /protein_id="CAQ51279.1"
FT                   /translation="MGTRPQTVGYGLADSPAGLAAWFYDKLADWVFTRGEPERVLSRDE
FT                   ILDNITLYWLTNTATSSGRIYWENNAVGNKLAEIVIPAAVTVFPGEVYRPPKSWAARAY
FT                   RNLIYYNRVDRGGHFAAWEEPDLFSAELRAAFRSLR"
FT   CDS_pept        complement(228706..229740)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20221"
FT                   /old_locus_tag="SMb20221"
FT                   /product="epoxide hydrolase"
FT                   /function="an epoxide + H2O = a glycol"
FT                   /note="High confidence in function and specificity"
FT                   /note="deleted EC_number 3.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20221"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48613"
FT                   /db_xref="GOA:Q92WW4"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WW4"
FT                   /protein_id="CAC48613.1"
FT                   /translation="MDAENLRESGATTNGGSVLSRRSLLLNGATVAALATFRPSAAVAQ
FT                   AGTAVPFKDGDIRPFRVDVPAAELAGLRRRLAATRWPDPETVEDRSQGVQLAKLQALLD
FT                   YWETAYDWRKAEAKLNALPQFLTDIDGLDIHFIHVRSPHANALPLIMTHGWPGSIFELL
FT                   KVVGPLTDPTAHGGTAGDAFHLVLPSLPGFGFSEKPKGTGWNPERVARAWDVLMKRLGY
FT                   TRYVSQGGDWGAIISDAMGRQAPSGLLGIHVNRLERSTTIPPEIAKALRSGDPAPANLT
FT                   AEERAVFDEARAFLKTASDMRRSWERVRKQSAMVLPTRPPGWLHGSMTSSRTGCSPAAN
FT                   RNAY"
FT   CDS_pept        complement(229750..230172)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20222"
FT                   /old_locus_tag="SMb20222"
FT                   /product="hypothetical protein"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20222"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48614"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WW3"
FT                   /protein_id="CAC48614.2"
FT                   /translation="MRERMTSMKTSRILAAALLVVGSGLALQAAKAQQAGLHRTDLLQH
FT                   DLGQPGRETVQVRVDFDPGAVSIKHSHPGEEVAYVLEGSLEYQLEGRAPVTLHAGDALF
FT                   IPAGAAHLAKNVGNGKASELATYIVEKGSPLVVPVK"
FT   CDS_pept        230872..231375
FT                   /transl_table=11
FT                   /locus_tag="SM_b22001"
FT                   /old_locus_tag="SMb22001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22001"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51280"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDC1"
FT                   /protein_id="CAQ51280.1"
FT                   /translation="MRTLNATLAAIVLCLAPFLAVSARGEPLQPQEFARRMSMSNLFEM
FT                   EAAKLARQRGKGREVLEFAERMLADHARAGKELTEAARKDGVEFSQSLDKAGEEKLAAL
FT                   RALSGAAFDPAYLSSQVTAHEDALELLKNYAEQGEAGALKAFAESTYPTVRTHLLQVQS
FT                   MTSQ"
FT   CDS_pept        complement(231657..232343)
FT                   /transl_table=11
FT                   /gene="smc22-1"
FT                   /locus_tag="SM_c22-1"
FT                   /old_locus_tag="SMc22-1"
FT                   /product="probable osmotically inducible sensory protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_c22-1"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48616"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANS8"
FT                   /protein_id="CAC48616.1"
FT                   /translation="MARNRSWSRDVYESYPESDRRRRGRSYEDERRRALTAGPRLTDYG
FT                   SPEYFAGAEPGRSGTYRGHDDSWERERAYGPGYFGGGGYYRDDDYGEGYPDRGRGYGER
FT                   GFLERASDEVASWLGDEDAERRRELDQHRGKGPKGYTRSDARIQEDVSDRLSDEGMLDA
FT                   SDIAVSVTNGEVQLSGLVDSKWAKRRAEDCAEAVSGVKHVQNNLRIRPSGGSPGWNAGN
FT                   TDRNIA"
FT   CDS_pept        232509..232682
FT                   /transl_table=11
FT                   /locus_tag="SM_b20226"
FT                   /old_locus_tag="SMb20226"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20226"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48617"
FT                   /db_xref="GOA:Q92WW1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WW1"
FT                   /protein_id="CAC48617.1"
FT                   /translation="MLTNYFWLFVTGGGAFILGAAVAYAILKQRPLSRAEKQAQKQKVE
FT                   ELYEQSPENRPR"
FT   CDS_pept        232839..233417
FT                   /transl_table=11
FT                   /gene="ndiA-1"
FT                   /locus_tag="SM_b20227"
FT                   /old_locus_tag="SMb20227"
FT                   /product="NdiA1"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20227"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48618"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WW0"
FT                   /protein_id="CAC48618.1"
FT                   /translation="MTNDTSGRGSGDPLGRPLTAAQGIERVSGVQAGDTGGQGEAGDRS
FT                   LENAVREDVNEFKEFASEQTEHAKAAVGRAVEDEKNVAARQLSGVAAALEKVGNELEQS
FT                   DQRAIGRYAKQIGTSLQGFARKAEGRNLGEIAGMVEDFGRKQPLAFLGMAAIAGLAASR
FT                   FLTASPPRRDGRDASGRTRRSSEKEPYNG"
FT   CDS_pept        233410..233829
FT                   /transl_table=11
FT                   /gene="ndiA-2"
FT                   /locus_tag="SM_b20228"
FT                   /old_locus_tag="SMb20228"
FT                   /product="putative nutrient deprivation-induced protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20228"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48619"
FT                   /db_xref="GOA:Q92WV9"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WV9"
FT                   /protein_id="CAC48619.1"
FT                   /translation="MANHRDERPLTELMTGLVADISGLFRKEIDLAKAEASENLNRAVG
FT                   SLETLLVGLIFAIGAVGVLLSAVVQGLGAFLVAQGMTEANADALSAAIVGVVVALLAWA
FT                   MISRGLSALKGSSIQFDRTAASLQRDANVVKERLQ"
FT   CDS_pept        233826..234800
FT                   /transl_table=11
FT                   /gene="ndiB"
FT                   /locus_tag="SM_b20229"
FT                   /old_locus_tag="SMb20229"
FT                   /product="NdiB"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20229"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48620"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANS7"
FT                   /protein_id="CAC48620.1"
FT                   /translation="MNDSAHTHSAAELQREIEADRQRIEEKLHEIQERMSPGELMDELL
FT                   EYAKTSGGSEYLSNLGVALKSNPIPVALMGVSLAWLIANPASRAPRQGEGNDGADDYPL
FT                   APVRGSVRRVGPVEASFGERYSHFTDESGSRFRALTDEAGRRAGHFVDPAGKVYRGFTD
FT                   AAGKQIEDIRDETGALFDEASGWASRTWRQVSAAAGRMSDSVTGAGRSLAGSMQNAGRS
FT                   LEEQGAHLNAAILRHFRDQPLVGGALAFAVGAAIGAALPHSEAEDEAIGEMAEDVRSNL
FT                   AARANAGVAQAMEAGQEILDKAGDAALEAHDAAKDRLQQSVRE"
FT   CDS_pept        235032..236036
FT                   /transl_table=11
FT                   /gene="smc22-r"
FT                   /locus_tag="SM_c22-r"
FT                   /old_locus_tag="SMc22-r"
FT                   /product="probable smc22-r protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_c22-r"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48621"
FT                   /db_xref="GOA:Q92WV8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WV8"
FT                   /protein_id="CAC48621.1"
FT                   /translation="MTTIAKVAKRAGVSLTTVSHVLNHADRVSAEMRRRVEVAIAELGY
FT                   VPNPQAQSLRTGRTNLVAMLIPDIRNPFYPELVKAAQSDLQAMGLDLLIFNTDVPGGHS
FT                   QEHSRQYLRHIRNRRIDGLIVGDFALHDMHDALIGIDVPTVFIGDLPNAAVDSVKIDDF
FT                   GGGYQMGAYLAKRGHKRIAHVTGPSFFAEAMARAAGFEQGLRDHGVEPLAELRREGTYL
FT                   SPSGREAVEWLLATSGDHLPSVVFFGNFLMAAGAIAEFHDRGVRIPDDVSIAVFGDQPQ
FT                   LEYVRPRIARVGNTPSLLAHRATAMLLERLSGEYSGSPRSEVIPCILHAFDTA"
FT   CDS_pept        236096..237451
FT                   /transl_table=11
FT                   /locus_tag="SM_b20231"
FT                   /old_locus_tag="SMb20231"
FT                   /product="putative ABC transporter sugar-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20231"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48622"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WV7"
FT                   /protein_id="CAC48622.1"
FT                   /translation="MSDREKVFTTLTRRGLLKGGAAVAGGVVGLGGFPYINRFAVRAQE
FT                   TPLKFWQFYAPGGPVASQVAWFEKTVADWNDSHPQKIELEFIPNSEYISGPKLATAFAS
FT                   GEGPDIFIISPGDFLRYYNGGVLKDLTPFIDDKAKADFPESVIANRMVDGKIFGIPMEV
FT                   EPMAMYYSVKAFEEAGLNENDVPKTWEALLEVAKKLTTPERFGVMFETQPGYYQNFTWY
FT                   PFLWQGGGEFQTADGKSSFDSPATVQALKFWQDAINSGVAPRQIMGAGGHDTIANLASG
FT                   YVAMQNVGIWGISQLQSNAKDFQYGVFRLPTPPNGKYVTVGGGWAFVANANGHNSDAAG
FT                   EFCAWALASMDQGSVNRVANWCTKGKSDMPPRNSALKSGGGAFSTGMIGKFAEEIHPGT
FT                   RAEPRVPPEVYKIISDAIQQTQLGGADPQATATAASQQLDAFLTSYQGAPIL"
FT   CDS_pept        237509..238453
FT                   /transl_table=11
FT                   /locus_tag="SM_b20232"
FT                   /old_locus_tag="SMb20232"
FT                   /product="putative suagr ABC transporter permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20232"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48623"
FT                   /db_xref="GOA:Q92WV6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WV6"
FT                   /protein_id="CAC48623.1"
FT                   /translation="MTTIAQSAARRRHAGRTRLSAKHREWIAGYLFVLPDALGLFIFLG
FT                   VPMALSLVLSVFEVNGFGGYSFVGARNYLRMWNDPLFWKGARVTALYAAMLVPLLYVCG
FT                   LGLALLVQRTDRFNAIMRSMFFAPHMVSLVVVALVWQFMVVDKIGVVSRLTAALDIGGI
FT                   SLLGDPNFALITIVLVSVWFLMGFYMLIFLGGLQDIPRQYYEAAMIDGAGAIARFWFIT
FT                   LPLLKPTSFFVIMVSMVAAVAGAQAFDIIYVMTKGGPANATSVLIVYIYQQAFGFGAFG
FT                   YAAAMASILVVALMIVTAVFFALTRGGRFHHEQ"
FT   CDS_pept        238443..239291
FT                   /transl_table=11
FT                   /locus_tag="SM_b20233"
FT                   /old_locus_tag="SMb20233"
FT                   /product="putative sugar ABC transporter permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20233"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48624"
FT                   /db_xref="GOA:Q92WV5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WV5"
FT                   /protein_id="CAC48624.1"
FT                   /translation="MSSKRPQPFFSRSQVTLVRGLWMVVTAILAFMTLFPLLWIVSIAF
FT                   KPAAESFSSNLIPQAPTLDNFIYVLTGVPFIRYMVNSFLVSATVTVVALFFHTMAGYAL
FT                   ARLRFPGREVMFLSIFSTFLVSLPVIIVPLFVIVKAMGMLNSYAGLIIPAIFNAFGIFL
FT                   LRQYYLSLPKEIEEAARIDGAGYWRIYWSVILPLSRPIMSALAILFFLANWNSFLWPLT
FT                   ITSDPDLWVVQLGIANFKSQYSASWNYMMAASTIVAIPTLILFVIFQRQIMDSLKTSGL
FT                   K"
FT   CDS_pept        239322..240518
FT                   /transl_table=11
FT                   /locus_tag="SM_b20234"
FT                   /old_locus_tag="SMb20234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20234"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48625"
FT                   /db_xref="InterPro:IPR021345"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WV4"
FT                   /protein_id="CAC48625.1"
FT                   /translation="MTNAGLSPLRGLAKLRKAKTRRFSSHDRTGGNDDRLHIEPGKTVV
FT                   IGEYEGAGIVTHIWATLACESEDFLRKIVLRAYWDGETEPSIEAPVGDFFGMGHARTAN
FT                   YTSLPMQASPEDGKAFNCYFPMPFGSQMKFTVTNEAEHDVLFYYYIDLELHDVLEEDMG
FT                   RFHAHYRQARPAGMSEAGLTNEQFLFGGENVDGRENYTILEAEGRGHYVGVLYSVYSRR
FT                   RSEVWDWYGEGDDMIFIDGEQGLSVPDTVRKPDPRIGSKAALIEPRPESEPGANDAWPP
FT                   TLHGTGTEDYFNTAWCPTQDYSAPYHGIIAAGGPNWTEPVTLYRWHIEDPAIFHKAIRV
FT                   TIERGHANRRGDDISSVAFWYQAEPHKPFGKFPDVADRVPTYRRPFHNMEAAMKKARG"
FT   CDS_pept        240520..241611
FT                   /transl_table=11
FT                   /locus_tag="SM_b20235"
FT                   /old_locus_tag="SMb20235"
FT                   /product="putative sugar ABC transporter ATP-binding
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20235"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48626"
FT                   /db_xref="GOA:Q92WV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WV3"
FT                   /protein_id="CAC48626.1"
FT                   /translation="MASVEIRNVVKRFGALEVVHGVSAEIADGEFVALVGPSGCGKSTL
FT                   LRMIAGLEEISDGAVVIGGDIVNEVAPKDRNISMVFQNYALYPHMTVAENMAFALRLAR
FT                   LPKDEQKRKVGEAATMLGLGGLLDRYPGQLSGGQRQRVAMGRAIVRRPEVFLFDEPLSN
FT                   LDAKLRVQMRAEIKGLHQRLRTTSIYVTHDQIEAMTMADRIVVMRDGNVEQIGTPLEIF
FT                   DYPRNLFVASFIGSPSMNFIEGEVVGGTFRAPGGIIIPAPDLAHKGPTVAGIRPNKLQI
FT                   GATGPSAKVLIVEPTGDETHLLVELGGAQLAMLLRERTSLAPGDEIGLAFASADVHFFD
FT                   GQTTLRLGALPGEVRNGFPPASA"
FT   repeat_region   complement(241587..241602)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        241731..242075
FT                   /transl_table=11
FT                   /locus_tag="SM_b20236"
FT                   /old_locus_tag="SMb20236"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20236"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48627"
FT                   /db_xref="GOA:Q92WV2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WV2"
FT                   /protein_id="CAC48627.1"
FT                   /translation="MSKPASNSAQVRGDIQHGRTGDKKRGFDPAAAPLETDDEAGGMPP
FT                   GSEAVRTARAGQSEGRSADTSTEYNDAMRPLAAAETAGPNRQRLGLSLAIVAMAIVIGG
FT                   LIYAGGLLSP"
FT   CDS_pept        complement(242403..243197)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20238"
FT                   /old_locus_tag="SMb20238"
FT                   /product="3-demethylubiquinone-9 3-O-methyltransferase"
FT                   /function="S-adenosyl-L-methionine + 3-demethylubiquinone-9
FT                   = S-adenosyl-L-homocysteine + ubiquinone-9"
FT                   /EC_number="2.1.1.64"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20238"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48628"
FT                   /db_xref="GOA:Q92WV1"
FT                   /db_xref="InterPro:IPR027554"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WV1"
FT                   /protein_id="CAC48628.1"
FT                   /translation="MVQQTKDRTVIAQEISALGPWFHNMRIGGIETAPGHFLGDYPAVK
FT                   WKAFRHVVPEDLEGRSVLDIGCNAGFYAQEMKRRNAGRVLGIDSDPHYLRQAKFAAEQA
FT                   GLDIEYRLMSVYDAAGLRERFDLVIFMGVLYHLRHPLLALDLLYEHVVGDQMLFQCMQR
FT                   GSDSVASLKGDYDFREWEIFERPDYPKLFFVEHRFADDPTNWFIPNRAGVEAMLRSAGF
FT                   VIEANPEREVYLLRRGERPYLDEPTLRILGGSADIGNKARLD"
FT   CDS_pept        complement(243200..244240)
FT                   /transl_table=11
FT                   /gene="rmlB"
FT                   /locus_tag="SM_b20239"
FT                   /old_locus_tag="SMb20239"
FT                   /product="putative dTDP-glucose 4,6-dehydratase protein"
FT                   /EC_number="4.2.1.46"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20239"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48629"
FT                   /db_xref="GOA:Q92WV0"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WV0"
FT                   /protein_id="CAC48629.1"
FT                   /translation="MAKRNKASRGKIILVAGGAGFVGSHLCTALLGAGNRVICLDSYLT
FT                   GSPANLIGLQANPYFAMVEQDVCDEIDIDEPVDQIYNLACPASPPSYQADPIHTMMTSV
FT                   TGTGNLLRLAERHGATFLQASTSEIYGDPEEHPQQENYWGHVNCTGPRACYDEGKRAAE
FT                   ALCFDSLRAGSVDTRVARIFNTYGPHMRPNDGRIVSNFIVQALKNEPLTVYGSGEQTRS
FT                   FCYVSDLVDGLIRLMNRKENPAVPVNLGNPGEFTVIELAELVLSRIETASTIVHEPLPA
FT                   DDPQRRRPDIARARKLLGWEPKVPLEDGLTHTIAWFQSALGGSRAERRSGRTRRQPQLS
FT                   VVSQDL"
FT   CDS_pept        complement(244260..245378)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20240"
FT                   /old_locus_tag="SMb20240"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20240"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48630"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WU9"
FT                   /protein_id="CAC48630.1"
FT                   /translation="MKRPLDIVILGLSLSSSWGNGHATTYRALLRALDAAGHKVTFLER
FT                   DVPWYASNRDLAAPDFCDLVFYTDPYELVSKHAHRLFGADAVVIGSYVPDGVEVIDVVA
FT                   DLGPKRLCFYDIDTPVTLAKLERGDEEFLARRQVAAFDIYFSFSGGRTLDRLRDEFAAR
FT                   RPVPLYCAVDLDAYRDTGAATEWDLGYLGTFSPDRQPALERLLIEPARRLPDMRFVVAG
FT                   PSYPDDIDWPANVQRIEHLPPGKHAEFYSRQRFTLNVTRADMVAAGWSPSVRLFEAAAC
FT                   RTPLVSDWWEGIESFFPAGEAVIIAQNSADVVTALTRLGEEQRKALADCAYRRVAAAHS
FT                   SAARARTFVEAIESVAARTGLATRRSERRLPV"
FT   CDS_pept        complement(245375..246460)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20241"
FT                   /old_locus_tag="SMb20241"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20241"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48631"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WU8"
FT                   /protein_id="CAC48631.1"
FT                   /translation="MRLAFYGSSLVSAYWNGAATYYRGLLRALAERGYQITFYEPDVYD
FT                   RQKHRDIDPPSWCRVVVYDGTVEALKRVAQEAAKAEIVVKASGVGFEDELLLAEVMAAA
FT                   DSAALKIFWDVDAPATLAELKAAPDHSLRRALSSLDLVLTYGGGDPVVDAYRVLGAREC
FT                   VPIYNAVDPETHHPVPPDPRFAADLAFLGNRLPDREERVETFFLEPAQKLWQRRFLLGG
FT                   SGWHDKSLSPNVAYIGHVPTADHNAFNTTPNAVLNISRASMAENGFSPATRVFEAAGAG
FT                   ACLITDYWEGIELFLKPGEEVLVARDGRDVAELMQKLTAAGAREIGERALRRVLAEHTY
FT                   AHRAEEVDRVLRRAHRMEAAE"
FT   CDS_pept        complement(246457..247587)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20242"
FT                   /old_locus_tag="SMb20242"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20242"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48632"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WU7"
FT                   /protein_id="CAC48632.1"
FT                   /translation="MRFLFYTHSLVSDWNHGNAHFLRGIMRELIRRGHEAVALEPGDSW
FT                   SRRNLIVDQGNGAIAAFRKAFPDLRVGIYGTDFEHEAAACEADMVIVHEWTDPALVAEL
FT                   GRIRLKGGRFTLAFHDTHHRAVSAERDIARLDLSGYDFVLAFGEALRERYLQAGWGRHV
FT                   HTWHEAADTSLFHPMPEVEKRGELIWIGNWGDDERSSEIMSFLVEPAKKLKLRTTVRGV
FT                   RYPKAALRALRSAKIDYGGWLANAAVPRAFAEHRVTVHIPRRPYVEALPGIPTIRVFEA
FT                   LACGIPLISAPWTDAEGLFRPGKDFCLAKDGKEMTRLLRQLLAEPDFAAEMTACGLETV
FT                   RARHTCSHRVDELLAIVASYRPRSGARQIISEEVEV"
FT   CDS_pept        complement(247592..248743)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20243"
FT                   /old_locus_tag="SMb20243"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20243"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48633"
FT                   /db_xref="GOA:Q92WU6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WU6"
FT                   /protein_id="CAC48633.1"
FT                   /translation="MSLPPFSAAGFDDRHNVSGPLPRRVLMTVDAVGGVWRYAMDLAAA
FT                   MRGSDVETLIVGLGPQPSPEQRREAKSIGRLEWLSTPLDWMVEDESELDRVPQLLSELA
FT                   LRHSVDLLHLNLPSQAARITAEVPVVTVSHSCVATWFAAVRGSGLPEAWRWQKRLNRLG
FT                   FDRADLVLAPSRSHAAALTRTYGEIHDLAVVYNASRNACFVSARENFVFAAGRWWDEGK
FT                   NGAVLDRAAADIDWPVVMAGACEGPNGQHLAIMHADHEGELSHDRTMTLMSRAAIVVSP
FT                   SVYEPFGLVALEAARAGAALVLADIETYRELWEGAALFADPGDPAAFAEAVNRLTEDAK
FT                   LRADLGRRARLRSADFTVEAQRDAVLAAYRRVMSGSDRLAAAE"
FT   CDS_pept        complement(248740..249861)
FT                   /transl_table=11
FT                   /gene="tyv OR Smb20244"
FT                   /locus_tag="SM_b20244"
FT                   /old_locus_tag="SMb20244"
FT                   /product="putative CDP-tyvelose-2-epimerase"
FT                   /function="Nucleoside-diphosphate-sugar epimerases"
FT                   /EC_number="5.1.3.-"
FT                   /note="putative CDP-tyvelose-2-epimerase,, NAD-dependent
FT                   epimerase/dehydratase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20244"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48634"
FT                   /db_xref="GOA:Q92WU5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WU5"
FT                   /protein_id="CAC48634.1"
FT                   /translation="MSGRTVGTDRHLAAPALSGKAAPILVVGGSGFLGCNLADSFLRDG
FT                   EHVIVLDNLSRPGVERNLEWLVDGHGRAVEALIADIRDLGAIEAAFRDAKAVFHFAAQT
FT                   AVTTSLERPTDDFETNARGTLNVLEAARLAGRRAPVIFASTNKVYGALGHIEMQDMRGR
FT                   YMPADEATREHGVSETQPLDFCTPYGCSKGVADQYVLDYARSFGLPTAVLRMSCVYGPR
FT                   QFGTEDQGWVAHFLIRALAGEPISIYGDGKQVRDILHVTDAVAAYRALLNSIDRLKGRA
FT                   FNLGGGPGNAVSIVDVLNEIELLTGRKLATAKSDWRAGDQLYFVADTRAIADALGWKAG
FT                   MPWREGLRDLYAWLHDDRGAVSGIRRQPRRVTA"
FT   CDS_pept        complement(249858..250964)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20245"
FT                   /old_locus_tag="SMb20245"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /function="UDP-glucose = UDP-galactose"
FT                   /EC_number="5.1.3.2"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20245"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48635"
FT                   /db_xref="GOA:Q92WU4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WU4"
FT                   /protein_id="CAC48635.1"
FT                   /translation="MTKVLVTGGCGFIGRHVVEELLSRNYDLRVLDALNDQVHADAQVT
FT                   LPPEVDMRRADICDADAVKSALKDVDHVIHLAAEVGVGQSMYEISRYVGVNDLGTAVLL
FT                   EAMIGMPIRRIVVASSMSVYGEGLYETTAGERRAHIRRSPAEIKAGAWNPSGPDGERLR
FT                   PIATDENKPVDLASIYALTKYAQERQVLIFGEAYGTDAVALRLFNVYGAGQALSNPYTG
FT                   VLANFASRLANGQSPMVFEDGRQKRDFVHVRDVARAFRLALEQPHAAGHVINIGSGNAY
FT                   AIADIASLLAEAMGVPDIEPEIINKARSGDIRNCFADIAKARDLLGFEPAHRLEDSLAD
FT                   FAQWVRSAGAIDRGAEMKRHLEARGLVL"
FT   CDS_pept        251298..252290
FT                   /transl_table=11
FT                   /locus_tag="SM_b20246"
FT                   /old_locus_tag="SMb20246"
FT                   /product="putative oxidoreductase"
FT                   /function="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /EC_number="1.1.1.1"
FT                   /note="putative Zinc-containing alcohol dehydrogenase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20246"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48636"
FT                   /db_xref="GOA:Q92WU3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WU3"
FT                   /protein_id="CAC48636.1"
FT                   /translation="MNISISQRTDTMSAAIVTGPGTVRIETLPLPQPGRGQVRIRLEGC
FT                   GVCASNLVPWAGPEWMQFPTEPGALGHEGWGIIDAVGEDVHGFAPGDRVAALSYHAYAT
FT                   HDIADQSAIAPLPASLAGQPFPGEPLGCAFNIFRRSAISPGETVAIVGIGFLGILLTEL
FT                   ASAAGARVIAISRRPSSLAAAKQAGASQVIPMDDHWRIIEEVKQLTGGRFCDCVIEAVG
FT                   KQWPLDLAGELTKERGRLVVAGYHQDGPRQVNMQLWNWRGLDVINAHERDPAVYMRGMN
FT                   EAIEATAAGRFSPSRLYTHRFPLEELGAALDITRDRPEGFIKALVICHE"
FT   CDS_pept        252295..253308
FT                   /transl_table=11
FT                   /locus_tag="SM_b20247"
FT                   /old_locus_tag="SMb20247"
FT                   /product="probable oxidoreductase"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /EC_number="1.-.-.-"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative dehydrogenase,, putative ycjS
FT                   gene,NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20247"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48637"
FT                   /db_xref="GOA:Q92WU2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WU2"
FT                   /protein_id="CAC48637.1"
FT                   /translation="MQLSTSPKAIIRPRVGFLGVGRIGFHRMKAVVETGSVETVAIFDP
FT                   SPEMAAAARELTPEASVVNSLEALLDHELDGIVIASPSALHAAQSIVALEQGVAVFCQK
FT                   PLGRTRDETAAVVETARHVDRLLSVDLSYRYTDGMRQIRDLIASGELGTVFAVDLTFHN
FT                   AYGPSKPWFYDKALSGGGCVIDLGVHLVDLLLWVLGFPDVARVESRLFAKGLPIRRDGD
FT                   EVEDYAVATVELANGVLARIACSWHLQAGCDAVISADFYGTEGGASLRNVNGSYLDFTA
FT                   ERYRGTQGEVLAVPPDAWGGRAAAGWAERLAAGERFDPDNEYLVTVADVLDRIYGR"
FT   CDS_pept        complement(253338..255086)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20248"
FT                   /old_locus_tag="SMb20248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20248"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48638"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WU1"
FT                   /protein_id="CAC48638.1"
FT                   /translation="MLVYGDAKRLERADMLCAEIASRLQAAQHLPAGIERHTELVAILL
FT                   RAGELVQGLADLELAQMGADEISASRQTGECLLLDLAGLVARSWRQGFAGPVVVPARVA
FT                   RSLANSQAPLSLSIREPEGYAFYALYPESYLEAAAGSGLPADTVVIGLRSIGTTLSAIV
FT                   AASIGAAPPVTLRPIGDPFQRRLAVAPQLAERLLRDRAANFAIVDEGPGLSGSSFGCVA
FT                   DWLEDHGVSGRRIHFFPGHKGGLGPQSCGRHRERWAARPRNVIDVDDLLIRPSNSARHL
FT                   ADWIAHLVGPLEKPLEDVSAGLWRKTLPGDRWPPVDGRFERRKFLAHTADGPWLVKFAG
FT                   LGDAGQRKLVKARLLADAGFTPPVAGLCHGFLVQKWVSARLMAPPEFRRPAFIAHLGRY
FT                   LSFRARSLPPPAAQGASMAKLCEMAMINTEEALGRAAASRLKTRFGDAERYNSTILPVD
FT                   TDNRLHRWEWLVEGERHILKTDALDHSSAHDLIGCQDIGWDIAGASIEFDLTREERAEL
FT                   RAAVSEGWSRGPNAGLMELLEICYLAFQLGLWMSAKSAAAPEEVPRLEAAAARYARLLR
FT                   RRIDGD"
FT   CDS_pept        255238..256341
FT                   /transl_table=11
FT                   /locus_tag="SM_b20249"
FT                   /old_locus_tag="SMb20249"
FT                   /product="putative myo-inositol-1-phosphate synthase"
FT                   /function="Myo-inositol-1-phosphate synthase"
FT                   /EC_number="5.5.1.4"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20249"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48639"
FT                   /db_xref="GOA:Q92WU0"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WU0"
FT                   /protein_id="CAC48639.1"
FT                   /translation="MRSNSIRVGLVGVGNCASSLVQGLTFYRDAKEDEPVPGLMHTNLG
FT                   GYHVGDIEVSAAFDVAASKVGRDVAEAIYAAPNNTFRFADVPATGVVVERGRTLDGIGR
FT                   YLREEIEESDAPAADVAEVLRQTGTDVLVSYLPVGSEVATRWYAEQALAAGCGFVNCIP
FT                   VFIASDKSWQRKFAERGLPLIGDDIKSQVGATIVHRLLANLFRDRGVRIDRTYQLNFGG
FT                   NTDFLNMLERERLESKKISKTQSVVSQMDIPLAAGDIHVGPSDHVPWLADRKFAYIRVE
FT                   GTTFGNVPLNVELKLEVWDSPNSAGVVIDAVRCAKLAIDRGIAGPLIAPSSYFMKSPPQ
FT                   QFTDAEARRRLEEFIAGDTDALLGAAE"
FT   CDS_pept        256338..256937
FT                   /transl_table=11
FT                   /locus_tag="SM_b20250"
FT                   /old_locus_tag="SMb20250"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20250"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48640"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WT9"
FT                   /protein_id="CAC48640.1"
FT                   /translation="MTTTFLLVRHAAHDRVGCFLAGRTGDVPLGIAGREQAQRLAARLA
FT                   GEGIGSIYASPRKRTQETAAAIAAASDVAEVVTTEALDEVDFGDWSGKTFDVLDTDPLW
FT                   RRWNAMRSLVRAPGGETMLDVQCRAVGLVAALAQRHGQEKVALVSHADVIKTLVCHILG
FT                   LSSDAWPRFDIAPASVSVLVMGDWGAKIQTLNENVS"
FT   CDS_pept        257009..257971
FT                   /transl_table=11
FT                   /locus_tag="SM_b20251"
FT                   /old_locus_tag="SMb20251"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20251"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48641"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WT8"
FT                   /protein_id="CAC48641.1"
FT                   /translation="MIEAAMIWNEPNNKSHWDPEIDPDWSRFAHMAKLAAAAIREVNPG
FT                   LTRVLGGISPIDPNFLALMKSQGVLDHVDAVAAHGFPLDWNLWQIHEWPQKLDELKSVT
FT                   ELPVWVSEVGVSTFGAEEVQLWGLKRTAELLKGRADRIQWYSLYDLPRAWPATTRHREA
FT                   EGSSYYRHFYMGLLREDGSPKLAFEEFARHTPEIGLVQWFHFEDPRLDDAVAWMKRLGV
FT                   TYLRTGLSWADRFRPNALDWFDRQMEALEDFDVTVTFCFTPEHRGLAPHHTSAPLVPEE
FT                   FAEFCAEMTARYAPAPSSFEPLRPGLAMASTSLPIEPRE"
FT   CDS_pept        complement(257884..259248)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20252"
FT                   /old_locus_tag="SMb20252"
FT                   /product="putative oxidoreductase"
FT                   /function="Coenzyme F420-reducing hydrogenase, beta
FT                   subunit"
FT                   /EC_number="1.12.98.1"
FT                   /note="putative coenzyme F420-reducing hydrogenase, beta
FT                   subunit homolog"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20252"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48642"
FT                   /db_xref="GOA:Q92WT7"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WT7"
FT                   /protein_id="CAC48642.1"
FT                   /translation="MAKSGLCIGCGTCMAQSGGSAAMSLDRYGQLKPAAAHRPDGFAEL
FT                   CPFSPHARSEDQIAEARFGSAQFYDPRIGRFEAAYVGHVSEGSFRADGSSGGMASWTAA
FT                   ELLKRNLVDAVAHVVPCSGAGERLFQYQVSRTADDLRKGAKSRYYPVELSRVIAEMKRQ
FT                   PGRYAVVGIPCFIKAIHLLCLNDPVLEERLAFTLGLFCGHMKSTRFVESFAWQMDTEMN
FT                   AVAGVDYRLKDTARPANWYTAHLRLKDGSTRSKDWWHLVDGDWGAGFFQNSACNFCDDV
FT                   VAETADISFGDAWVEPYSSDGRGTNVVVVRSPLLQALVADAIEEGRLELSAVDSAFVVE
FT                   TQAAGFRQRREGLAFRLAWPRSGIKPRKRVAPKWSGLPARRMLVYWLRSAISANSHRVF
FT                   WLARALNMPAAYLRWASAMLALYQGVTYSRGSIGRLVDAIARPGRKGSKDDGAGA"
FT   CDS_pept        complement(259295..260200)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20253"
FT                   /old_locus_tag="SMb20253"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20253"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48643"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WT6"
FT                   /protein_id="CAC48643.1"
FT                   /translation="MQPLLPERTPRGDIPLYASKIRKFQSALASVPMSAPFALDDPDGA
FT                   EECDIVVVGSDEVWNLRHPWYGGCSLFYGEGLSAKRTVSYAATFGNHPAANGLEPYWAE
FT                   RLRKFDGISVRDDNSRAIIEKDVGREATLVLDPCLQFPETISFGPNTLVSRPYIAVYGH
FT                   SFPSWFQHAVRHWATTRSLPLVSIGYRNEWADEQWLDAGPYEFAACIAGAEAVATNFFH
FT                   GCIFSLLNAKPFVTVLSDYRSNKIADLAHTAGAERHVVSQATPQAGYETLLAEAPSPAI
FT                   ARRLAELRRQSRTYLTDVLA"
FT   CDS_pept        complement(260409..260684)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20254"
FT                   /old_locus_tag="SMb20254"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20254"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48644"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WT5"
FT                   /protein_id="CAC48644.1"
FT                   /translation="MEESQAISRPQRASDYPGRQMDCIAALRPAVSELAATSQESIVAA
FT                   MGGELTDDLLALARRAEAAGWTFEEASAAIEELAREYEGAKGTIFD"
FT   CDS_pept        complement(260759..261310)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20255"
FT                   /old_locus_tag="SMb20255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20255"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48645"
FT                   /db_xref="GOA:Q92WT4"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WT4"
FT                   /protein_id="CAC48645.1"
FT                   /translation="MASRRNSAEERASAARTMPRLERNINAILKRREEDERGRRAHDRV
FT                   AQAITNFAGSMTFVGLHVLAFGAWIALNLELVPGIPVFDPTFAVLAMVASVEAIFISTF
FT                   VLISQNRMAERDDERSDLNLQISLLAEQEATQLLTLLREIAARLGVKVDGEEDIRELTK
FT                   EITPEEVLNRLEDQKVRSGD"
FT   CDS_pept        complement(261442..261891)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20256"
FT                   /old_locus_tag="SMb20256"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20256"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48646"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WT3"
FT                   /protein_id="CAC48646.1"
FT                   /translation="MQEGLVVRRETHVSAPPAAVFALLTDPEKILRWMGTEADVEPKPE
FT                   GLYLVNVTGARFARGSFREVVPVHRLAYSFGWDDSDVVPPGSSLVEIDLIEQPDGTLVR
FT                   LTHSGLPNAEQCAGHAEGWAHYLDRLSEVAAGRDPGPDPWHGRTG"
FT   CDS_pept        262074..263132
FT                   /transl_table=11
FT                   /gene="cyaM"
FT                   /locus_tag="SM_b20257"
FT                   /old_locus_tag="SMb20257"
FT                   /product="adenylate cyclase"
FT                   /function="ATP = 3',5'-cyclic AMP + diphosphate"
FT                   /EC_number="4.6.1.1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20257"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48647"
FT                   /db_xref="GOA:Q92WT2"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WT2"
FT                   /protein_id="CAC48647.1"
FT                   /translation="MDLPAPLAWLLDEAGTSSGPDPFLAELGTRLLADGLPLAGGALTL
FT                   AVPHPIIARRTWLWRAEDGAVIEALGFAEGPVDHAGREWLAGFGPVQEDVVGQTAEKVV
FT                   LGWAGARQFDPAEVARLRQTARFAAAPLAVLAERATRAALLEAYLGRRSAARVQAGALS
FT                   RGTGESIRAALLYADLRNFTGLSEEHEPARVIAALNDWFDRLAGAIHAFGGEVLKFIGD
FT                   GVLAIFPVNDLPAEACDRALRAVVAARAGMAHLEGLRLEQELPPLRFGAALHLGEILWG
FT                   NVGSIDRLDFTAIGPAVNLVSRLEGLCRPLGRSVLISGALAAGTRTPLVPLGEHALRGI
FT                   AAPCAVFTLPET"
FT   CDS_pept        263237..263947
FT                   /transl_table=11
FT                   /locus_tag="SM_b20258"
FT                   /old_locus_tag="SMb20258"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20258"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48648"
FT                   /db_xref="GOA:Q92WT1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WT1"
FT                   /protein_id="CAC48648.1"
FT                   /translation="MTNKDTDTNSAPERKRGSGVKMVYDLLRDEILDLVLPPGCPIDEV
FT                   QLAERFKMSRTPIREALVRLAGEGLIATLPNRSTMVSNIDFLNLHTFFDALVLMYRVTT
FT                   RLAAEHHRSDDLEVIRARQAEFAAAVQAQDALAMIATNAAFHSAIAEAGRNPYFIGLFN
FT                   RLLDEGRRILRLYYQSYNDRLPQRFVDEHEDMIAVIAARDAEAADRLARAHAEQIVEQI
FT                   QKLFARNDRLEIAL"
FT   CDS_pept        264068..265030
FT                   /transl_table=11
FT                   /locus_tag="SM_b20259"
FT                   /old_locus_tag="SMb20259"
FT                   /product="dihydrodipicolinate synthase"
FT                   /function="L-aspartate 4-semialdehyde + pyruvate =
FT                   dihydrodipicolinate + 2 H2O"
FT                   /EC_number="4.2.1.52"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20259"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48649"
FT                   /db_xref="GOA:Q92WT0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:5CZJ"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WT0"
FT                   /protein_id="CAC48649.1"
FT                   /translation="MKAKIFSGVIPALMTPGREDRTPDFDALVRKGKALIADGMSAVVY
FT                   CGSMGDWPLLTDAQRMEGVERLVKAGVPVIVGTGAVNTALAAAHAAHAQKVGAQGLMVI
FT                   PRVLSRGPSIVAQKAHFKAILAAAPDLPSVIYNSPYYGFATRADLFFALRAEHPNLVGF
FT                   KEFGGNADMRYAAEHITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIH
FT                   LCNLSRAAAAGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFN
FT                   ETDALTESQRGYVEAQFKLFNTWYAEWSKLPGAVEKYKA"
FT   CDS_pept        complement(265078..265470)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20260"
FT                   /old_locus_tag="SMb20260"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20260"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48650"
FT                   /db_xref="GOA:Q92WS9"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WS9"
FT                   /protein_id="CAC48650.1"
FT                   /translation="MKWLDRARRWARGIRRDVVVLWLAARDRRVPWYAKLAAGAVAAYA
FT                   LSPIDLIPDFIPVLGYLDDLIIVPVGIIVVLKLIPVDVLADLRAAAMKHTERPVSRAGL
FT                   VAVISIWVLLAALLLWVALGPAAAVR"
FT   CDS_pept        complement(265534..266571)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20261"
FT                   /old_locus_tag="SMb20261"
FT                   /product="malate dehydrogenase"
FT                   /function="(S)-malate + NAD+ = oxaloacetate + NADH + H+"
FT                   /EC_number="1.1.1.37"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20261"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48651"
FT                   /db_xref="GOA:Q92WS8"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WS8"
FT                   /protein_id="CAC48651.1"
FT                   /translation="MSETTTLTTTALQERVEAIFRKGGLNVVQAGALARVIVAGERDAC
FT                   KSHGIYRIEGALRTVKAGKVKPDAEPEIVAQEASAIVKVNAGGGFANPAFELGLPVLAE
FT                   RARKHGIAALAINDCTHFSALWPEAEALTGEGLAGLVMCPSYATVAPTGGNKPLLGTNP
FT                   FAFGWPRAGKPPYVFDFATSVAARGEIELHRRAGKPLPEGWAIDAQGNPTTDPEAALAG
FT                   AMLPFGGHKGSAIGTMIELLAGIMIGDLTSPEVLDYLGTTTLAPFHGELIVAFSPQAFA
FT                   AGRPGDPFARAELLFEAIVGQGARLPSQRRFAARAKSEAEGITLSAAEIEQLDRLLALG
FT                   LDAVA"
FT   CDS_pept        266814..268331
FT                   /transl_table=11
FT                   /locus_tag="SM_b20262"
FT                   /old_locus_tag="SMb20262"
FT                   /product="aldehyde dehydrogenase (NADP+)"
FT                   /function="an aldehyde + NADP+ + H2O = an acid + NADPH +
FT                   H+"
FT                   /EC_number="1.2.1.4"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20262"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48652"
FT                   /db_xref="GOA:Q92WS7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="PDB:3V4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WS7"
FT                   /protein_id="CAC48652.1"
FT                   /translation="MIFTPKGKHLVAGEWLDGAGTFASAPAHGPAHDFAVGTVELVNRA
FT                   CEAAEEAFWTYGYSSRKERAAFLRAIADEIEARAEAITEIGSQETGLPEARLNGERGRT
FT                   TGQLRLFADHIEKGDYLDRRVDAAMPERQPAPRQEIRLVQRPVGPVAVFGASNFPLAFS
FT                   TAGGDTAAALAAGCPVVVKGHSAHPGTGEIVAEAVDAAIRKTGVHPGVFSLIQGGSRDV
FT                   GHALVQHPHIKAVGFTGSLAGGRALFDLCAARPEPIPFFGELGSVNPMFLLPEALKARA
FT                   ETLGQGWAGSLTMGAGQFCTNPGIAVVIEGADADRFTTAAVEALAKVAPQTMLTDGIAK
FT                   AYRDGQARFATRNAVKPLLATESSGRDASPNLFETTGAQFLADHALGEEVFGPLGLVVR
FT                   VGSPAEMEELARGFQGQLTATIHMDAGDLETARRLRPVLERKAGRVLVNGFPTGVEVVD
FT                   SMVHGGPYPASTNFGATSVGTMSIRRFLRPVAYQNMPEDLLPEDFLG"
FT   CDS_pept        268518..269324
FT                   /transl_table=11
FT                   /locus_tag="SM_b20263"
FT                   /old_locus_tag="SMb20263"
FT                   /product="putative ABC transporter periplasmic amino
FT                   acid-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20263"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48653"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WS6"
FT                   /protein_id="CAC48653.1"
FT                   /translation="MKTSVLAFGLVAATALTSPAHADKLDDIIASGTLRCAVVLDFPPM
FT                   GSRDENNEPIGFDVDYCNDLATALGVTAEIVETPFPERIPALMSGRVDVGVASTSDTLE
FT                   RAKTVGMTVPYFAFEMAVTANEKSGIKSFEDMKGKVVGATAGTYEAIALENQVKAWGEG
FT                   EFRPYQTQADVFLALSQGQLDATVSTSTVAQSNVKGGKFPGISVVDKAPFDIDYVALFT
FT                   NREEYGFLNYLNLFVNQQVRTGRYAELYEKWVGGEAPSLAVNGVYR"
FT   CDS_pept        269391..270056
FT                   /transl_table=11
FT                   /locus_tag="SM_b20264"
FT                   /old_locus_tag="SMb20264"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20264"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48654"
FT                   /db_xref="GOA:Q92WS5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WS5"
FT                   /protein_id="CAC48654.1"
FT                   /translation="MFNYTFHWNQALRALPQMLDGAVVTLQVAVLSMVIGVACAIALTV
FT                   FRLSGSRILGGIATTWVEVARNTPALFQIYMAHFGLGNFGIHLSPYTALLVGIAFNNAG
FT                   YLAENFRGALKAIPDTQARAGRSLGMTSLQAFRLIVLPQMLRVAFLPATNQMVWAILMT
FT                   SLGVTVGMNTDLAGITQELNARSFRTFEFFALAAVIYYLIAKAVTLAARAFAWRMFRY"
FT   CDS_pept        270069..270722
FT                   /transl_table=11
FT                   /locus_tag="SM_b20265"
FT                   /old_locus_tag="SMb20265"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20265"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48655"
FT                   /db_xref="GOA:Q92WS4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WS4"
FT                   /protein_id="CAC48655.1"
FT                   /translation="MFDTALTWNDLAFLAQGAGMTLAVTAVAVTAGTVLGILFGVIRFQ
FT                   IGPYWSAPLTLLLDVFRSVPLLIQLVLGNAFQSIAKLGWGAFTTSGVVLSLYTAAFCAE
FT                   IVRGGISSVPVTTRRAARSLGMTWWQDMRYIVAPLATRVSLPSWIGLTLGVMKDSALVL
FT                   WLGLVELLRASQILVTRLQEPLFILLICGAIYFLLSFPVARLGGYLEKRWSPND"
FT   CDS_pept        270715..271437
FT                   /transl_table=11
FT                   /locus_tag="SM_b20266"
FT                   /old_locus_tag="SMb20266"
FT                   /product="putative amino acid ABC transporter ATP-binding
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20266"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48656"
FT                   /db_xref="GOA:Q92WS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WS3"
FT                   /protein_id="CAC48656.1"
FT                   /translation="MIEIENVRKSFSSLEVLKGIDLTVEKGEVVTIIGGSGSGKSTLLT
FT                   CINGLEPIDSGRIVIDGTDVHAKGTDLNRLRRKVGIVFQQWNAFPHLTVLENVMLAPRK
FT                   VLGLPKDKAEEIAVKQLTHVGLGEKLKVYPNRMSGGQQQRMAIARALAMSPEYMLFDEV
FT                   TSALDPMLVGEVLDTLKMLAEEGMTMICVTHEMTFARDVSDRVAFFHQGIMAEIGSPDQ
FT                   IFASPQNPETQKFLASVR"
FT   CDS_pept        271438..272679
FT                   /transl_table=11
FT                   /locus_tag="SM_b20267"
FT                   /old_locus_tag="SMb20267"
FT                   /product="putative D-amino acid dehydrogenase protein"
FT                   /EC_number="1.4.99.1"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20267"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48657"
FT                   /db_xref="GOA:Q92WS2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WS2"
FT                   /protein_id="CAC48657.1"
FT                   /translation="MAAPDVIVIGAGVVGLTAAIAAVASGLSVTVLDREGPAAGASAGN
FT                   AGAFAFTDILPLASPGILKKAPKWLLDPLGPLTVPPAYALKIAPWMFRFWRACQPGRVA
FT                   HSTAAQTALMDLSKAELEPFLGATGTASMLRKEGNLQVYEGEAEFKASLAGWKARADHG
FT                   IEFRHLDAAGIAEIQPGLAARFTHATFTPGWYSIADPKLYTLALADHFRTIGGVIERAE
FT                   VTALKPVDGGVEVLSADGRRRRAAQVVLSAGAFSHRVARTLGESIPLETERGYNTTLPA
FT                   DAFDLRTQITFGGHGFVVTRLSTGIRVGGAVELGGLDLPPNFRRSEAMLKKAQAFLPGL
FT                   KPEGGVQWMGFRPSLPDSLPAIGRARATPRVIFAFGHGHLGLTQSAGTARIVADLLTGR
FT                   TPAIDIAPFSPQRF"
FT   CDS_pept        272694..273695
FT                   /transl_table=11
FT                   /locus_tag="SM_b20268"
FT                   /old_locus_tag="SMb20268"
FT                   /product="putative proline racemase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20268"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48658"
FT                   /db_xref="GOA:Q92WS1"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92WS1"
FT                   /protein_id="CAC48658.1"
FT                   /translation="MATHTFSCIDGHTCGNPVRLVSGGGPRLEGANMLEKRAHFLKEFD
FT                   WIRTGLMFEPRGHDMMSGSILYPPTRPDCDVAVLFIETSGCLPMCGHGTIGTITMGIEN
FT                   GLITPREPGKLSIDAPAGKVDITYRQEGRFVEEVRLTNVPSFLYAEGLAAEVEGLGEIV
FT                   VDVAYGGNFYAIVEPQKNFRDMADHTAGELVGWSPKLRAALNAKYEFVHPEHPEIRGLS
FT                   HIQWTGKPTQPEAHARNAVFYGEKAIDRSPCGTGTSARIAQLAAKGKLKVGDEFVHESI
FT                   IGSLFKGRVEAAAKVADRDAIIPSIAGWARMTGINTIFIDDRDPFAHGFVVR"
FT   CDS_pept        273692..275383
FT                   /transl_table=11
FT                   /locus_tag="SM_b20269"
FT                   /old_locus_tag="SMb20269"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20269"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48659"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="InterPro:IPR012047"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WS0"
FT                   /protein_id="CAC48659.1"
FT                   /translation="MSGLDPARSILQGSAEGPVIATGEALSFWGGVDPATGCVIDVHHP
FT                   LHGVPLTGSILMMPSSRGSCTGSGVLLDLVLTGRGPAALVFSEPEDVLTLGALIASEMF
FT                   GKPLPVLRLAPEAFAALARAKTARIGDRAIEAEGLTIPVVPPATVALDLTDGDRAMLDG
FT                   AESVAVAQAMRIISAMAAQQGALGLVDVTQAHIDGCIYASPANLTFAEKMVEMGAKVRI
FT                   PATMNAISVDHANWQRQGVPPSFGDPAARLADAYVRMGCRPTFTCSPYLLDSAPGAGEA
FT                   VAWAESNAVIFANSVLGARTAKHPDFLDLCIALTGRAPLSGVYLDEHRKARRIIDVELP
FT                   AGADDAFWPLIGYLAGRAAPDRIPLIRGLAPAEPSRDDLKALCAAFGTTSAAPMLHVEG
FT                   VTPEAGGAAAEDADHATITRAELTAAWSALNEGPDEVELVAIGSPHASLAECRALAEAL
FT                   GGRKRHPDVAVIVTAGHEVIAKARGEGILARLQESGVQVLPDLCWCSISEPVFPTRTRA
FT                   VMTNSGKYAHYGPGLSGRTVRFGSLADCVSAALSGRVPPRLPEWLS"
FT   CDS_pept        275434..276462
FT                   /transl_table=11
FT                   /locus_tag="SM_b20270"
FT                   /old_locus_tag="SMb20270"
FT                   /product="probable proline racemase"
FT                   /function="Proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20270"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48660"
FT                   /db_xref="GOA:Q92WR9"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92WR9"
FT                   /protein_id="CAC48660.1"
FT                   /translation="MRSTKTIHVISAHAEGEVGDVIVGGVAPPPGDTIWEQSRWIAREQ
FT                   TLRNFVLNEPRGGVFRHVNLLVPPKHPDADAAFIIMEPEDTPPMSGSNSICVSTVLLDS
FT                   GILPMKEPVTEITLEAPGGLVRVRAECRDGKAERIFVENLPSFAERLDAKLEVEGLGTL
FT                   TVDTAYGGDSFVIVDAAAMGFALKPDEAHDIARLGVRITNAANAKLGFHHPENPDWRHF
FT                   SFCLFAGPVERTAEGLRAGAAVAIQPGKVDRSPTGTALSARMAVLHARGQMGLSDRLTA
FT                   VSLIGSTFSGRILGTTEVGGRPAVLPEISGRAWITGTHQHMLDPSDPWPEGYRLTDTWG
FT                   AR"
FT   CDS_pept        276546..276977
FT                   /transl_table=11
FT                   /locus_tag="SM_b20271"
FT                   /old_locus_tag="SMb20271"
FT                   /product="hypothetical protein"
FT                   /function="Predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /note="hypothetical protein,, OsmC-like gene"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20271"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48661"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WR8"
FT                   /protein_id="CAC48661.1"
FT                   /translation="MKARIKWVEGRTFVGESGSGHKIVFGTATGPDSPTPGPSPMEMVL
FT                   IGTGGCSAFDVVHILEKGREAVEDCVVEMDADRADQDPRVFTRIHMHFIVKGRGLAAKK
FT                   VERAVALSIEKYCSASAMLAKTATITHDFEVVDTSDTAA"
FT   repeat_region   complement(276995..277022)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        277378..278586
FT                   /transl_table=11
FT                   /locus_tag="SM_b20272"
FT                   /old_locus_tag="SMb20272"
FT                   /product="putative transporter protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20272"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48662"
FT                   /db_xref="GOA:Q92WR7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WR7"
FT                   /protein_id="CAC48662.1"
FT                   /translation="MIDAHYRWVIVAAGGLLGCIAIGAMFSLPVFLVPISRDTGWSVTG
FT                   ISSAMTVGFIAMALASMVWGSASDRWGPRSVVLIGSALLAASLALSSLVTSLIAFQLVF
FT                   GVVVGGACAAIFAPMMACVTGWFDTHRSLAVSLVSAGMGMAPMTMSPLAGWLVTIYDWR
FT                   TSLQIIAALAAVTMIPAALLLRRPPVLEDTNAVSASEGQPDMSLGQALRSPQFVILLLT
FT                   NFFCCATHSGPIFHTVSYAVSCGIPMMAAVSIYSLEGLAGMGGRVAFGVLGDRYGAKRI
FT                   LVSGLLLQAFGALAYFFVRDLGAFYAVAAVFGFIYAGVMPLYAVIARENFPLRMMGTVI
FT                   GGTAMAGSLGMAIGPVAGGLIYDVFASYGWLYIGAWGLGIGAFLIALTFKPFPRERPAL
FT                   AAA"
FT   CDS_pept        complement(278659..278844)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20273"
FT                   /old_locus_tag="SMb20273"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20273"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48663"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WR6"
FT                   /protein_id="CAC48663.1"
FT                   /translation="MTHAEEVIERAMAAVAQARRRREREQEWRRKTFGRIQVGIPLPPL
FT                   KRGVQLSLQLDRPSTQ"
FT   CDS_pept        complement(279100..279285)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20274"
FT                   /old_locus_tag="SMb20274"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20274"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48664"
FT                   /db_xref="GOA:Q92WR5"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WR5"
FT                   /protein_id="CAC48664.1"
FT                   /translation="MLTHDDRNMPERRATAAFPIGLILLAICAIFAYLAIGGAMLEGET
FT                   ETVVYTPPIADAPEPR"
FT   CDS_pept        complement(279463..280323)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20275"
FT                   /old_locus_tag="SMb20275"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20275"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48665"
FT                   /db_xref="GOA:Q92WR4"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WR4"
FT                   /protein_id="CAC48665.1"
FT                   /translation="MNAGDALQGISIAVAPNGGRRTKADHPAIPLTPEELALTARDCLD
FT                   AGAAMIHVHVRKGDGSHLLDADAYRAATAAIRAAVGDRMVIQITSEALGIYSPGEQIAV
FT                   VKAVRPEAVSLALRELVPDETHEAAFADLLSWAAREKVTPQIILYDPEEAVRLDGMRRR
FT                   GLLSRDDIPVLYVLGRYTPGQRSLPRDLLPFLAPDMPAFTHWSVCAFGRHEAACVTVAA
FT                   LLGGHVRVGFENNLWLPEGTAAGSNADLVRTVTAALLPLSVPLLQGPALAEMFARIGSA
FT                   GMPED"
FT   CDS_pept        280415..281305
FT                   /transl_table=11
FT                   /locus_tag="SM_b20276"
FT                   /old_locus_tag="SMb20276"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20276"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48666"
FT                   /db_xref="GOA:Q92WR3"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WR3"
FT                   /protein_id="CAC48666.1"
FT                   /translation="MDKGPLSDAIITAFDGLSSQLRTAARYIVDHPRDVALLSMREQAR
FT                   QAGVQPATMTRLAKQLGFDGYDAIRERYAEALREGDAGFAGKAGEQARSQKLRGDHALA
FT                   ADMLRTIGTQISRLAEPAALDRIVAAATRLARARRVYCLGLRSSHAVAWQFHYILSLVG
FT                   EKSVMLDGIGGTGADAVGRATSADVLLVASVLPYTRATIEIAEYARDNGVPVVAVTDSE
FT                   VAPLAQIAEAIIVVPTESPSFLHAMAPAFAVAEVLGALIAGRGGEATLAALERFDGQLA
FT                   ALNTHLQSRNSKRAP"
FT   CDS_pept        281302..282645
FT                   /transl_table=11
FT                   /locus_tag="SM_b20277"
FT                   /old_locus_tag="SMb20277"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /function="L-glutamate 1-semialdehyde =
FT                   5-aminolevulinate''"
FT                   /EC_number="5.4.3.8"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20277"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48667"
FT                   /db_xref="GOA:Q92WR2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WR2"
FT                   /protein_id="CAC48667.1"
FT                   /translation="MTHLLHRAIHAKLPVAVRGEGIRLFDAEGRAYIDASGGAAVSCLG
FT                   HAHPDVLAALHAQLDRIAYAHTGFFTTEAAERLADRLVADAPDGLDHVYLVSGGSEAVE
FT                   AALKMARQYFVEKGEPQRRHIIARRQSYHGNTLGALAAGGNEWRRAQFRPLLVETHHID
FT                   PCFAYRLQQAGESDTDYAARAAGQLEAKILELGADQVIAFVAETVVGATAGAVPPVADY
FT                   LKRVRAICDKYGVLLILDEVMCGMGRTGTLHACEQDGVVPDLMTIAKGLGGGYQPVGAV
FT                   LLSSAIFQAFSEGSGFFQHGHTYMGHPMAAAAGLAVQEVIRRDGLLENVVSMGDYLERC
FT                   LVERLGNHHHVGDIRGRGLFRAVELVADRATKSPFDPGLKLNARIKKEAMARGLMVYPM
FT                   GGTIDGQRGDHVLLAPPFILNREDVGQIVERLGDAVDAAIASLTKAAG"
FT   CDS_pept        complement(282954..283532)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20278"
FT                   /old_locus_tag="SMb20278"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20278"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48668"
FT                   /db_xref="GOA:Q92WR1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WR1"
FT                   /protein_id="CAC48668.1"
FT                   /translation="MSETVHEFTLEPLDWQPYVKPVKLDEATPEQLEALKVTPSNTKVS
FT                   NYVLVLANEAEMLAERTPLFNDIMYSEGGLSRGGREIGALAASFVNRCIYCASVHANRY
FT                   IQLEKRPEVVDEIYRRGLDADLPDFEQALFNFGVDLTAHPDNVGVYQFYHLREIGLDDL
FT                   EILDLIHSIAIFGWANRLMHTLGEPHLKE"
FT   CDS_pept        complement(283534..284037)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20279"
FT                   /old_locus_tag="SMb20279"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20279"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48669"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WR0"
FT                   /protein_id="CAC48669.1"
FT                   /translation="MTVPPKTDVIDAVLGLDSSSPVLALRERRAKLKHFTQTSHDAALL
FT                   PAEPGNFSYAMRAALAARITGLWKATELQAHYKAQLEEKGSKPELRSIADPAFRPEGDK
FT                   RLATMLAHVDLVTLKPKEATRANIEALYSVGLDDRDIVTLAGLIAFVNYQVLVVAGLKM
FT                   LRDN"
FT   CDS_pept        complement(284069..285535)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20280"
FT                   /old_locus_tag="SMb20280"
FT                   /product="putative oxidoreductase"
FT                   /function="Predicted flavoprotein involved in K+ transport"
FT                   /EC_number="1.1.1.-"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative oxidoreductase,, FAD binding
FT                   domain,,pyridine nucleotide-disulphide oxidoreductase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20280"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48670"
FT                   /db_xref="GOA:Q92WQ9"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WQ9"
FT                   /protein_id="CAC48670.1"
FT                   /translation="MTNEQHGRLAELNARVKQDLDYLNYPAANWSKPVTTADGQPVSDV
FT                   VIIGGGMCGMVAWLALTRAGIANLRIVDRAPKGQEGPWVTFARMETLRSPKNLLGPALG
FT                   MASLTFRAWYTACFGEAAWETLFRIPRPMWMDYLKWYREVLSIPVENDTHVTRVRPRED
FT                   GLLELEIAGGSKSSIVTRKLVLATGREGLGEPVVPDFVKGMKRHTSWAHSADDIDFEAL
FT                   KAKRVVVIGVGASAVDNAAEALESDAGEVRLLARRKEMPTVNKLMGIGSYGVTAGFARI
FT                   DAEWRWRIMDYSVKQQTPAPHNSTLRVSRHPNAFFHFDCAIGSMREEGGEVVITTKKGR
FT                   IFRTDFVILGTGFTVDPLSRDELAPYQDRIACWDDRYTPPVGEENAGLGRFPWLDDDFS
FT                   FTEKEPGTAPWLKDIHCFNYGASISIGKVSGDIPAISEGALWLARGIAASLFIRDVDYH
FT                   WEALLAYEKPELDGSEWTDADAPEPAHRTA"
FT   CDS_pept        complement(285617..286687)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20281"
FT                   /old_locus_tag="SMb20281"
FT                   /product="probable spermidineputrescine ABC transporter
FT                   ATP-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20281"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48671"
FT                   /db_xref="GOA:Q92WQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WQ8"
FT                   /protein_id="CAC48671.1"
FT                   /translation="MQPVVHFKNVNKYYGGLPAVDDLDLAVESGQFVTLLGPSGCGKST
FT                   TLRMLGGFEQPSSGEIYLEGKPITHLPPNRRNVNIVFQDYALFPHLNVGRNIAFGLELK
FT                   GLSSDAIHKRTMELLALVKLQDFADRMPDQLSGGQRQRVALMRALAPDPNVLLLDEPLS
FT                   ALDAKLRQQMQIELKTIQRTTGKTFIFVTHDQEEALTMSDVIVVMNKGRIEQMGGPNEL
FT                   YSRPRSRFVANFIGQSNFLEGKLLSHDGTTAAIDWNGSIIHADLNGTKLPAGSGATVAL
FT                   RPEALYCMAEQPKDRFALRGRIVQRVFKGAHTSLTIELENGAELALQLDPVALSHLERD
FT                   EVWVGWRERDAVVLAD"
FT   CDS_pept        complement(286691..287482)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20282"
FT                   /old_locus_tag="SMb20282"
FT                   /product="probable spermidineputrescine ABC transporter
FT                   permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20282"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48672"
FT                   /db_xref="GOA:Q92WQ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WQ7"
FT                   /protein_id="CAC48672.1"
FT                   /translation="MRPYFADLPKTALGAAYWLFAVYLLLPLALMTAMSFKDASFVAFP
FT                   ITDWTLNWYAQVLNDKQFIEASLYSIGIALATTAAATVIGVWIALLVSTEGIWGKAIIF
FT                   ALACLPAVVPGLINAISMRIFIRTVDIPTGTAAIILSHAVHAVPFVVIMVLTRLRSMPA
FT                   NLVDAARDLGADRFVAFLRVTIPYLMPALLGGMIFCVLTSIDDFVRTFFLGGYKPTLPM
FT                   LIFAKVQGGMSPEINAMATIVLVVTAAVGVYAEHLTRRSRN"
FT   CDS_pept        complement(287493..288476)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20283"
FT                   /old_locus_tag="SMb20283"
FT                   /product="probable spermidineputrescine ABC transporter
FT                   permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20283"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48673"
FT                   /db_xref="GOA:Q92WQ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WQ6"
FT                   /protein_id="CAC48673.1"
FT                   /translation="MVDTTTMQARSAGSRRVPRYAGWIGKAVGSGLYRHTIGRLADSRR
FT                   ARLALLAGVPLFWIAALHIGPIFQMGRISFMADYPQAPDGGSPYTLANYELFFSDQLYF
FT                   MPFIRSLIFAAVVTISTLVIVYPVAYYVAKIVQPKNRMRALLLLLIPFWAGELIRTFSV
FT                   IMLLANRGAVNVALRELGFIDRPIPMLYTSFSLSFGVIYLLALYMLLPLYSAIEKIPTP
FT                   LIHAAADLGAGPFQRFRRVILPLSKDGIVSGCSLVYLTSVGVFAAPLLLGGPNTVIFPE
FT                   VIATLFHSSNDKWPEGAAFAMLLLAVSLSTVGLFMRVIGGRSVRLM"
FT   CDS_pept        complement(288561..289661)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20284"
FT                   /old_locus_tag="SMb20284"
FT                   /product="putative ABC transporter periplasmic
FT                   spermidineputrescine-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20284"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48674"
FT                   /db_xref="GOA:Q92WQ5"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WQ5"
FT                   /protein_id="CAC48674.1"
FT                   /translation="MKDFTATRRSTLKFLAAGTGVLAAPAIIRPAFSQSKVVNITTYDK
FT                   FVPQSFIDQFQKDTGIEVRIRLTDDQGKQYNVLSAEGETPSTDIVTVTGHRLSQFIGSK
FT                   LLTPLDTGRLKNWDKLASAYKGAPQLTVDSSVYGVPLLAGFEGLARNTDYTKASDSWAI
FT                   MFDQEYKGLTSYIISDFLQITMRYQGNDGDFVTYEGKPEEAQAATNKARDYLIQNKDMV
FT                   RKYYDAGSEVQQMFVNEDIYVAHSWSGPAAKLIMDGHPIEISVPKEGTYGFLYSFNVVK
FT                   NGPNTDAAYTFLDAILSSPEIGAAMSRQSGFASAFDGVDKVLNDKERAAMTLPQEQTER
FT                   IQFFSSVNRDMKNEMVDKAVAEIKAA"
FT   CDS_pept        complement(289741..290718)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20285"
FT                   /old_locus_tag="SMb20285"
FT                   /product="probable transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="probable transcriptional regulator,, probable HTH
FT                   lysR-type regulator family, putative nocR gene"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20285"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48675"
FT                   /db_xref="GOA:Q92WQ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WQ4"
FT                   /protein_id="CAC48675.1"
FT                   /translation="MIVMEIRELEAFLAVMSTGSITAAARLLDRSQSQVTRLIQDLEIS
FT                   VGFALLDRNGPKIAPSEKGIAFHAEAERFLSGIGHLRERARTIAEKEPQPIEIVAIPAF
FT                   ASGIIPLALAALPEKLLPRKIHLRSLPAEAAVQSVLARTADFCVTSLPADQPGLEVHGV
FT                   FQGPCVAAVAEDDPLAACEVISIADLAGRNIITMANPFRLRRRVDIALEAANIRPARII
FT                   ATSVSVNAVQIASTGLGVAIVEPATAYGLKLANVAVRALDVDIPFPWAIFSAAARPLSD
FT                   SSRELIQEIIQIASACIPGFTAHDPRSANRAAEMTLGGDQADAR"
FT   CDS_pept        290921..292000
FT                   /transl_table=11
FT                   /locus_tag="SM_b20286"
FT                   /old_locus_tag="SMb20286"
FT                   /product="opine dehydrogenase"
FT                   /function="(2S)-2-{[1-(R)-carboxyethyl]amino}pentanoate +
FT                   NAD+ + H2O = L-2-aminopentanoic acid + pyruvate + NADH +
FT                   H+"
FT                   /EC_number="1.5.1.28"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20286"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48676"
FT                   /db_xref="GOA:Q92WQ3"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WQ3"
FT                   /protein_id="CAC48676.1"
FT                   /translation="MRIGILGAGAIAFGMAAFLAKAGHHPVLWSPSGARTRKLAAREPL
FT                   TATGAVEFSGPVVVAHDGREAVADVDAVIVALPANGHRVAFDAAVPHLKSGQPVIVSSH
FT                   SSFGALYLSKRLAERGVSLPIIVWGTTLLTGRQQPDGASVSVNTVRQKIDVATLPKAAA
FT                   AEGKALCTELFGDRFVERDGLLAISLSNLNPQNHLGIALLNLTRMEKGEKWGQGEHVTP
FT                   AVGQLIEALDAERLKIAESFGLSVRTVREHFSLSFHVPIGTVSDMNQQMHLEGRGGFGP
FT                   ATADSRYIYEDVPFGLVPTSLLGRIAGRPAVLHEAGTSLFSAAMNRNLAADNDLLPELA
FT                   LDSFSPAALRELCDQGFTA"
FT   CDS_pept        complement(292019..292726)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20287"
FT                   /old_locus_tag="SMb20287"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20287"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48677"
FT                   /db_xref="GOA:Q92WQ2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WQ2"
FT                   /protein_id="CAC48677.1"
FT                   /translation="MTLGLIAILSAVTLVSSFIQGALGIGFALIVAPVVGILKPDLLPV
FT                   TLLLLMLPLNFHVAWRERSAVDWSGAKWITLGRFAGTFAGVWLLAALSTQQLDLAVGWF
FT                   TVIAAAAALFAPPFEPGRPSALGVGLFTGVTETATGIGGPPLALLYQHAQGPILRATVA
FT                   VCFFVGEIMSLVILAFAGRLGADQLLAALYLAPAVLLGSALSRLTHDHIRGRGLRLGVL
FT                   TFALASGAFLIVR"
FT   CDS_pept        complement(292723..294123)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20288"
FT                   /old_locus_tag="SMb20288"
FT                   /product="putative hydrolase"
FT                   /function="Cytosine deaminase and related metal-dependent
FT                   hydrolases"
FT                   /EC_number="3.8.1.8"
FT                   /note="putative atrazine chlorohydrolase, , amidohydrolase
FT                   family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20288"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48678"
FT                   /db_xref="GOA:Q92WQ1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WQ1"
FT                   /protein_id="CAC48678.1"
FT                   /translation="MTELRDKLPGSGDFLLHPGKVLLPDGPRSGMGVVVRDGRFTDIGA
FT                   AGLVGSRNPDLTPIELPHHLVMPGFIDTHTHLTQSLGKSLVFGEPSEIFRRIWVPLEGS
FT                   LDERMVYLSAKLAALECLRGGFTAAVDAGTRSAGHINALIRAARQTGLRSVIGLICNDL
FT                   GGAAVVPERATILKNAARHLAAFEGDPLVHASLAISIPEAASDHMLADVSRMAREAGAV
FT                   FQTHVNEHLVAVERSLVANGRRPLEHLAHLGALGPHVLIAHSTLVTPHELNLLRDSGTA
FT                   VAYNPVASLWKGNAIAPALQMAALGIRFGLGTDGTRADGFRLMDAAEGLQRAGFGLATG
FT                   DSSCGGGWLWVERATAQAADAAALAGVTGAIREGLAADFLLVDLDRPEFTPSHDLMWEL
FT                   VRYGNRDQIDAVFTAGQLRLWQGWPVGWDARALLAEVREVTADAIARAPIQRVHKPSAE
FT                   HRALGHFA"
FT   CDS_pept        complement(294233..295582)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20289"
FT                   /old_locus_tag="SMb20289"
FT                   /product="putative permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20289"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48679"
FT                   /db_xref="GOA:Q92WQ0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WQ0"
FT                   /protein_id="CAC48679.1"
FT                   /translation="MTGNKIDSIDPTDEVLPPRSLVLFGLQHVLVMAASPITAVFLVSK
FT                   ALGFSDALTVSLISATFLICGLGTILQSFGPAGFGARLPFIMVPGGAPIAIFLAIAQQT
FT                   DVQTAVGAVILTAGFYFLALPVFRRLLRYFPPIVVGTMLLLVSVNLVRIYGGTITGKQG
FT                   SEGFADPMNVGLALATIALTVIFARVFTGTLQRISVMFGLIAGSAIAIGAGYMDLSGIF
FT                   DGPVIAMPQLLPFGMPKFDFFAALPLIVFSIISMAEATGQTIATAEIVGRRGDAHAIVP
FT                   ATIRGDAVASLVGGLFGTSLIITSGENVGIVRATNVKSRYVTATAGVILVLIALFAPVG
FT                   RLASALPGPVVGGTAVIVFSIIGVIGIDLLRRVDLREHGPMFTLAAALSMGLLPILVPG
FT                   VYSQFPPWSQMILANGLAAGTITAVIVNAFFQHLPLEQFQEKCAAVFRPE"
FT   CDS_pept        295734..296729
FT                   /transl_table=11
FT                   /locus_tag="SM_b20290"
FT                   /old_locus_tag="SMb20290"
FT                   /product="putative transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="Conserved hypothetical protein"
FT                   /note="probable HTH lacI-type transcriptional
FT                   regulator,,periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20290"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48680"
FT                   /db_xref="GOA:Q92WP9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WP9"
FT                   /protein_id="CAC48680.1"
FT                   /translation="MTRSTIVELAKAAGVSPTTVSHAFSGRRYVDPETKARIVALADKM
FT                   GYRANPRARRLRTGGAGIIALASSMPFAVAAGPARLGFLMEIAAAAAVTALSRHLALCL
FT                   VPPLEPDSNLDALEVDGAIIVEPMVEDRLLEFFSARGVPVVSIGRAPGREDIPSVDIQS
FT                   TATARLMLEHLGANSRRVGLITGEQRRNSYIETEAAYAAFAAERGYSPVALRVDESGGE
FT                   SEAAAAAERLLRNNPDIDALCVPVDAFARGVLDAARLLDRPVPQGLRLATRYDGMRAKL
FT                   ATPQLTAVNLHLDQVAEAAIDLLIAAMEGKEPQPHAIAPPQLVVRESSAA"
FT   CDS_pept        complement(296737..299220)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20291"
FT                   /old_locus_tag="SMb20291"
FT                   /product="hypothetical protein TRANSMEMBRANE"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20291"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48681"
FT                   /db_xref="GOA:Q92WP8"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="InterPro:IPR021814"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WP8"
FT                   /protein_id="CAC48681.1"
FT                   /translation="MAWSLFQLWYASPLPFVFGFGILNDTEARAIHLGFALFLTFLAYP
FT                   ALKSSPRDRVPLADWVLGALGAFAGAYLFLFYGELAGRPGQPSTLDLVTGTAGILLLLE
FT                   ATRRALGLPMVFVAGVFIFYTFAGQYMPDVIQHRGASLVKFINHQWLTTEGVFGIALGV
FT                   STSFVFLFVLFGTLLEKAGAGNWMMQISIALLGHLRGGPAKVAVVSSALNGVVSGSSVS
FT                   NVVSGGIFTIPLMKRTGLSGVKAGAIEASASINGQIMPPVMGAAAFLMVEYVGIPYSEI
FT                   VKHALLPAVFSYIALLYMVHLEAVKLNMQPIPQRPTPMRERWLRMGLGLAGSVLAICLL
FT                   YYGIIAIRAAFGESAPLLLAIAGVALYIATIWYSSRYPDLELDDPDAPILELPRAWDVT
FT                   RTGLDFLIPIVVLLWCLMVEQLSPGLSAFWATLTIIAIVATRKPLMAIFRKEDVAGSVR
FT                   AAAWDLTDGLALGARNMIGIAVATATAGIVVGTITLTGLGLMMTELVEFISGGNVIMML
FT                   ILIAAISLVLGMGIPTTANYILVATLMAPVVVELGSQAGLAIPLIAVHLFVFYFGIMAD
FT                   ITPPVGLAAFAAAAISKEDPIATGFQGALYSLRTAILPFVFIFNPAILLIGVDTWAHTI
FT                   WVAAISLAAILIFSAATMNWFVTKSRLWESAVLLLVCFTLFRPDWWLNQISPPYEELPA
FT                   SEFLRAVEEAPAKSRINFVVQGFDLMGDEVRKTVNVPLGEPGEPLQRLQSIGLTVTPAG
FT                   ESLMISNVDFGSYAKRIGLDVGFDIVAVLRKAEQPSSAIPVGIALAVTAGIAGLQFARK
FT                   RADRSEAGLTGAARK"
FT   CDS_pept        complement(299408..300391)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20292"
FT                   /old_locus_tag="SMb20292"
FT                   /product="hypothetical immunogenic protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20292"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48682"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WP7"
FT                   /protein_id="CAC48682.1"
FT                   /translation="MKHERITLRGAQIAALSAALFFSGGAAAQQKFVTIGTGGVTGVYY
FT                   AAGGAICRLLNKDRKSHGIRCSVESTGGSAFNVNTIKEGELDFGMAQSDVQYNAMKGEE
FT                   SFKEGGAHADLRAVFSIHPEPFTVLAHPNAGVTKFEDFKGKRFNVGNPGSGTRASMERL
FT                   LGAMGWTLADFSLASELKADEHGPALCDGKIDGFFYGVGHPSANIQDPTTTCAAKLVPL
FT                   TGEVVDKLVADNPYYAKATIPGGLYNNNPEDTETFGVLATLVTSANVPEESVYALTKAV
FT                   FENFDEFKSLHPAFANLEPAKMIKDGLSAPLHPGAEKYYKEKGWLK"
FT   CDS_pept        300703..301062
FT                   /transl_table=11
FT                   /locus_tag="SM_b20293"
FT                   /old_locus_tag="SMb20293"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20293"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48683"
FT                   /db_xref="GOA:Q92WP6"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WP6"
FT                   /protein_id="CAC48683.1"
FT                   /translation="MATIRYEIVEHDGGWAYKVDDVFSETFPTHDDALAAAEIAARHHE
FT                   LPGSTEAIEFQDPAGRWHEQVASGFDRPHTRVVDTQDARDAAERPDSPEPRRPLQTVLV
FT                   LAGLGLAIGYFLRRH"
FT   CDS_pept        301194..301895
FT                   /transl_table=11
FT                   /locus_tag="SM_b20294"
FT                   /old_locus_tag="SMb20294"
FT                   /product="putative transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="putative FADA-type transcriptional regulator,, HTH
FT                   gntR-type DNA-binding domain,, putative yhcK gene"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20294"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48684"
FT                   /db_xref="GOA:Q92WP5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WP5"
FT                   /protein_id="CAC48684.1"
FT                   /translation="MSTLAVRKKLSDEVRLKLEEMIRDEIYPLGATLPSERDLMELFGV
FT                   GRPSIREALYALERMGLVKVSTGERAKVTRPTPDHFLSSLAGAARMLLGHPEGVANFEQ
FT                   ARLFLEEGCARHLAAHATAEQIEAIDAALARNEAAIGKARAFAATDVAFHRTLTQMVSN
FT                   PIFVAVHDAFVDWLIGQRPLPVRPEISNRESFEEHVAIVEAIRSRDPERAGRVMREHLE
FT                   SAARKYRQTSP"
FT   CDS_pept        301924..302895
FT                   /transl_table=11
FT                   /locus_tag="SM_b20295"
FT                   /old_locus_tag="SMb20295"
FT                   /product="putative ABC transporter"
FT                   /function="TRAP-type C4-dicarboxylate transport
FT                   system,periplasmic component"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative TRAP dicarboxylate transporter,,periplasmic
FT                   binding protein, DctP TRAP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20295"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48685"
FT                   /db_xref="GOA:Q92WP4"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WP4"
FT                   /protein_id="CAC48685.1"
FT                   /translation="MKTGMISLALAGLLMASQAMAQEARTLRLGMQGTAGDPQFEGVTE
FT                   AARIIKEKSGGRLTLEIFPNSQLGTFTEMMEQVTLGELDFTLNPFGGMDAWVPRAVLAS
FT                   TAYVVGDFDHLQKIIASDWGKGIVDEMRTEHKWRMVDSWYFGTRHTTAKKPIEKPADFA
FT                   GMKLRVPNSAPLLTWAKAMGASPTPVAFAEVYLALQTNQVDGQENPLPIIDSMKFTEVQ
FT                   SHVSLTGHLVQDQVILMSEDTWNALEPADQKVVMEAFEAGGALNDKLVSDKEANLVSDF
FT                   RERGITVVEPDKAAFQEAMKPVYADLDAKFGADTVKTLLDLR"
FT   CDS_pept        302951..303469
FT                   /transl_table=11
FT                   /locus_tag="SM_b20296"
FT                   /old_locus_tag="SMb20296"
FT                   /product="putative TRAP dicarboxylate transporter"
FT                   /function="TRAP-type C4-dicarboxylate transport
FT                   system,small permease component"
FT                   /note="C4-dicarboxylate transport system, permease small
FT                   protein,, tripartite ATP-independent periplasmic
FT                   transporter, DctQ TRAP subunit"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20296"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48686"
FT                   /db_xref="GOA:Q92WP3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WP3"
FT                   /protein_id="CAC48686.1"
FT                   /translation="MANPSRWRSFAHIEETLAAILLVFAFVVIALQIVTRFVFHDPMFW
FT                   TEEAARYAFVWLVALGAAEGVTSRTHITMDIVPRMLPERAQLFLRLVLDVLVLTALLVL
FT                   VYYGFFGAMRAHKVMSIAIGVPESWLYGALPVFGLLAAVRIMLVMGRDVRLLFGARSPS
FT                   VDAPFERYL"
FT   CDS_pept        303470..304750
FT                   /transl_table=11
FT                   /locus_tag="SM_b20297"
FT                   /old_locus_tag="SMb20297"
FT                   /product="putative TRAP dicarboxylate transporter"
FT                   /function="TRAP-type C4-dicarboxylate transport
FT                   system,large permease component"
FT                   /note="C4-dicarboxylate transport system, permease large
FT                   protein,, tripartite ATP-independent periplasmic
FT                   transporter, DctM TRAP subunit"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20297"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48687"
FT                   /db_xref="GOA:Q92WP2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WP2"
FT                   /protein_id="CAC48687.1"
FT                   /translation="MATLFGGWFALLIAGMPVGFTLIVAALAYMLWQGTGLNFAGQRMI
FT                   AGLNSFPLLAVPFFILTAQLMNLSGVTERIFDFAKALVGHIRGGLGHVNIMASVLFSGM
FT                   SGSAVADAAGLGQLEIKAMRDAGYDEQFSGSITAASAIIGPLIPPSIPLVVYGVIANTS
FT                   IGGLFLGGIVPGLLCAASLMIMVYVIAWRRNYATAQRAGFRRVWSTFWHALLPLITPFI
FT                   IIGGIFAGVFSPTEAAVVAASYALFLGVVVYREITFAKLVTVLRETVSHTAAVGLLIMG
FT                   VSLFGYVIAREQVPQHVATFFLTYAEDPLTFLILVNLMLLALGTFIEALAILLLIVPVL
FT                   VPTALQFGVDPVHFGVMVVFNLMIGILTPPMGVALFVVSKVADIPFGVLARGILPLLIP
FT                   LVVVLVLITIFPALVTFIPDQMLGAAR"
FT   CDS_pept        304747..305682
FT                   /transl_table=11
FT                   /locus_tag="SM_b20298"
FT                   /old_locus_tag="SMb20298"
FT                   /product="hypothetical protein"
FT                   /function="Dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase"
FT                   /EC_number="4.2.1.52"
FT                   /note="hypothetical protein,, putative dihydrodipicolinate
FT                   synthase (DHDPS)"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20298"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48688"
FT                   /db_xref="GOA:Q92WP1"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WP1"
FT                   /protein_id="CAC48688.1"
FT                   /translation="MSLQARPPEGIWGAVLLPVDRRGEIEWSALDEQLSALLESGIQGV
FT                   YTNGTAGEFHSQTEREFDRLSQLVSEFCHSVALPFQIGVSHSNARVARERLARVASLRP
FT                   DAVQITLPDWWAPSYDEAEVFFAGMAATAPDTPLILYNPPHAKRRLNLDEIARLKARLP
FT                   MLIGAKLPGGDEVWYGELRRKLPDLAVFIPGHFMASGCLGGGRGSYSNVACLSPAGAVR
FT                   WWHQLREDPAGALAFEARVVGFMNEHVLPLAVRHGLSNAALDKAMAAAGRWCPIGPELL
FT                   WPYRSAPGEAVIELGTAARRQLPELFSTSQ"
FT   CDS_pept        305696..306595
FT                   /transl_table=11
FT                   /gene="nanA"
FT                   /locus_tag="SM_b20299"
FT                   /old_locus_tag="SMb20299"
FT                   /product="N-acetylneuraminate lyase"
FT                   /function="N-acetylneuraminate = N-acetyl-D-mannosamine +
FT                   pyruvate"
FT                   /EC_number="4.1.3.3"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20299"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48689"
FT                   /db_xref="GOA:Q92WP0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92WP0"
FT                   /protein_id="CAC48689.1"
FT                   /translation="MKLEGIYSALLTPFSEDESIDRQAIGALVDFQVRLGIDGVYVGGS
FT                   SGEAMLQSLDERADYLSDVAAAASGRLTLIAHVGTIATRDALRLSQHAAKSGYQAISAI
FT                   PPFYYDFSRPEVMAHYRELADVSALPLIVYNFPARTSGFTLPELVELLSHPNIIGIKHT
FT                   SSDMFQLERIRHAVPDAIVYNGYDEMCLAGFAMGAQGAIGTTYNFMGDLFVALRDCAAA
FT                   GRIEEARRLQAMANRVIQVLIKVGVMPGSKALLGIMGLPGGPSRRPFRKVEEADLAALR
FT                   EAVAPVLAWRESTSRKSM"
FT   CDS_pept        306932..308845
FT                   /transl_table=11
FT                   /gene="cyaF7"
FT                   /locus_tag="SM_b20300"
FT                   /old_locus_tag="SMb20300"
FT                   /product="putative adenylate cyclase protein"
FT                   /EC_number="4.6.1.1"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20300"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48690"
FT                   /db_xref="GOA:Q92WN9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WN9"
FT                   /protein_id="CAC48690.1"
FT                   /translation="MERKLAAIVAGDIVGYTRLMSEDESSTYAALRATFSGLIIPSVEK
FT                   HGGRTFKTTGDGFLATFPSVNEALDAAIEIQNGFSEQPFDMRLGINLGDVIEADGDMFG
FT                   DGVNVASRLEAMAEPGGIFVSEAVVRSADRNRSKLFYSIGRRQAKNIPEPFVVYAVRLD
FT                   ADEKNRRGWLGRIARGRRAALPYAIGAAALVLAAAAAQAPEVRAVGADLAGRLARLAGG
FT                   ELADARPTVAVLPFDNMSGDAEQSYFADGLTEDIIANLARNPELQVIARNSTFALRGQA
FT                   EDIRLIGERLGAGYVVEGSARRAGDQLRVVAQLIDARSGAHLWSRSYDRRVEDIFAVQT
FT                   ELTAEIVSHLVSYVRESEVSNAAERPTENLQAYDLVLKARDRYKHGSKDAEALIAARAL
FT                   LHRALELDPGYAAARANLGMTYIVDFVQNLSGRATTTDVETGLSEARQAVRLDPNLAAG
FT                   FQVLSFGLSATGDYPGAMQAAQRAVELNPNDPDSLMALAKAQVRFGSYDEAVQNAERAR
FT                   RLHPMAPEYYTYVYGQALYAAGRLDEADEVLRECLIRAPQEADCLLIRTAVLSQRGDVE
FT                   GAQRTMARLTEVDPEFSLASERSMRRFGDSALMEQFLSRLAEANAPDVTSGFLHPRTQS
FT                   RT"
FT   CDS_pept        complement(308842..309972)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20301"
FT                   /old_locus_tag="SMb20301"
FT                   /product="putative oxidoreductase"
FT                   /function="Glucose/sorbosone dehydrogenases"
FT                   /note="putative quinoprotein glucose dehydrogenase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20301"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48691"
FT                   /db_xref="GOA:Q92WN8"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WN8"
FT                   /protein_id="CAC48691.1"
FT                   /translation="MRAAVFLALAAAVAVARHETATAQDSPRMLDTESGPVSVEVFAGG
FT                   LEHPWGAALLPDGDMLVTERPGRLRLVSAEGAVGEPIEGVPDVFAQGQGGLLDVALDPD
FT                   FATNRTVYLSFAEEREGGAATSVGRGRLNDDATALSDFKIIFRQEPAASGENHFGSRLA
FT                   FAPDGKLFITLGERFDMQEAQDPANHLGTIVRLNPDGSIPDDNPFVGREGADEIWSYGH
FT                   RNVQSAAIHPETDVLWTAEMGPMGGDELNIPEAGKNYGWPAVSWGRHYTGERIPDPPSR
FT                   PEFAGSIHSWTPVISPSGMMFYTGDLFADWRGDLLIGGLSVGGIVRVQTDGQKVTGEEV
FT                   LSLEARIRDLLQASDGSVLALIDAASGRILRLRPAN"
FT   CDS_pept        complement(310120..310281)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20302"
FT                   /old_locus_tag="SMb20302"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20302"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48692"
FT                   /db_xref="GOA:Q92WN7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WN7"
FT                   /protein_id="CAC48692.1"
FT                   /translation="MSVLISILITFLVVILVLYLVNRLPLDGRTKQIVQVIVIIIGILS
FT                   LLRYLAVF"
FT   CDS_pept        310478..310705
FT                   /transl_table=11
FT                   /locus_tag="SM_b20303"
FT                   /old_locus_tag="SMb20303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20303"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48693"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WN6"
FT                   /protein_id="CAC48693.1"
FT                   /translation="MSVRFSDLAIDDDEILMLRRVHVYACSSRELEPESEHGAELGKML
FT                   FHLYRQGVRSELALMQMLTAGEAPPAPEAG"
FT   mobile_element  complement(310746..311804)
FT                   /mobile_element_type="insertion sequence:ISRm2011-2/ISRm11
FT                   OR SMb21616"
FT                   /note="this element seems to be partial or inactive"
FT   CDS_pept        complement(310762..311358)
FT                   /transl_table=11
FT                   /gene="TRm2011-2C"
FT                   /locus_tag="SM_b20304"
FT                   /old_locus_tag="SMb20304"
FT                   /product="probable ISRm2011-2 transposase
FT                   protein,C-terminal portion"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20304"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48694"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANS6"
FT                   /protein_id="CAC48694.2"
FT                   /translation="MVASERERPDVARHRARWLKHCPGIDPARLVFIDETWTKTNMAPL
FT                   RGWAPRGERLVGYAPFGHWNTMTFVAALRADRVSAPFILDGPINGERFRIYVQQVLVPE
FT                   LKAGDIVILDNLGSHKGQEIRAAIRKAGARLFFLPKYSPDLNPIEKLFAKIKHWLREAQ
FT                   ARSRDAIHDELRHILQAVTPQECAAYFKEAGYERA"
FT   CDS_pept        311002..311373
FT                   /transl_table=11
FT                   /gene="TRm2011-2"
FT                   /locus_tag="SM_b20306"
FT                   /old_locus_tag="SMb20306"
FT                   /product="putative TRm2011-2 protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20306"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48695"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANS5"
FT                   /protein_id="CAC48695.1"
FT                   /translation="MGAEIVQDDDVAGFEFRHQNLLDIDAEAFAIDRAIEDKGSADAVG
FT                   PECGDKGHGVPMAEGGVAHQSFAARRPAPQRRHVRLRPGLIDENEAGGINSGAVLQPSC
FT                   PVAGDVGPLPFAGDQRLFL"
FT   CDS_pept        complement(311301..311708)
FT                   /transl_table=11
FT                   /gene="TRm2011-2N"
FT                   /locus_tag="SM_b20305"
FT                   /old_locus_tag="SMb20305"
FT                   /product="probable ISRm2011-2 transposase
FT                   protein,N-terminal portion"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20305"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48696"
FT                   /db_xref="GOA:Q926A8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q926A8"
FT                   /protein_id="CAC48696.1"
FT                   /translation="MARPFSNDLRERVVDAVTGEGLSCRAAAKRFGIGISTAIDWVRRF
FT                   RETGSAAPGQMGGHKPRKLSGPHRAWLLCRCRERDFTLHGLVAELSERGLKVDYRAVWT
FT                   FVHEEGLSYKKRRWSPANGSGPTSPATGHDG"
FT   CDS_pept        complement(311801..312448)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20307"
FT                   /old_locus_tag="SMb20307"
FT                   /product="putative dihydroxyacetone kinase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20307"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48697"
FT                   /db_xref="GOA:Q92WN5"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WN5"
FT                   /protein_id="CAC48697.1"
FT                   /translation="MMSESAVRRLIEVFEAISSAIEAERDHLSELDGAIGDADHGITMA
FT                   IGFSAVTGELARTDAGSAGLSGVMTAAASAFLNAVGASTGPLYATAFRRAAQALEGRDT
FT                   LDIEACSLLIQAVASGIGERGKGQRGDKTMLDVWLPAADAAAQAVAAAKSTAAFWADVT
FT                   AAAENGASATRSMVATKGRAARVGERSLGHMDPGAASAVLIIRAMAQTLREG"
FT   CDS_pept        complement(312527..314614)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20312"
FT                   /old_locus_tag="SMb20312"
FT                   /product="probable dihydroxyacetone kinase"
FT                   /function="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="High confidence in function and specificity"
FT                   /note="probable dihydroxyacetone kinase (Dak
FT                   kinase),,probable DhaK subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20312"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48698"
FT                   /db_xref="GOA:Q92WN4"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WN4"
FT                   /protein_id="CAC48698.1"
FT                   /translation="MTIKTPSARKGAANRSGTIDASDAIPLRYGDDPYVWACWLYYEDG
FT                   MTQGEIAEAMGVSRATVNSYLADAREKGIVNISIEPARLASLTIAQELKRHFGLTDCLV
FT                   VPSDDNARPLIDRLGAAGAQALPKLLKSGDTLAVAWGRTVLSVGEHAGIASLQDMTVVQ
FT                   ATGGTTASFAYTPELCASAVARAISARCVNITAPAVVKSPELLHMLLEEPLVQEQFATL
FT                   ARANRVLFGISSLRPNSTIHTSGFFESVSLQDYLAAGAVGVVAGRFIDERGRPVAGPLD
FT                   HRTVGISLDLLRKIGTRIAVAGGFDKVPALLAALRGGYVNVLITDAATGHGILRADGVT
FT                   ALDAKLWHRPKLVPTPSSYRTHVKKFLNNPNEVVEEMLDGAVKAHEIYLQPINGSHRAL
FT                   VARNGPRPGKVGLVIGGGTGHEPCFLGYVGKGLADAVAVGNIFSSPPPDPIVQCAEAAS
FT                   GGEGVLFVYGNYAGDVMNFEMAAEIAEEKGIKVKTVLTTDDVASSPVEDREGRRGVAGN
FT                   FFIFKIAGAACDRGLSLEACEAVTRKANLRTYTVGVALEPGSMPQTRRHNFEIGPDDME
FT                   VGMGIHGEPGVTRERIRSADEITDSIMDRIFKEMKTAPGERVAVLVNSFGATPLMELYI
FT                   LFRRVQQRLAAKDILIEANWIGHYCTSLDMAGASITILHLDQELSDLLHHPCETAFLKV
FT                   N"
FT   CDS_pept        complement(314728..315411)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20313"
FT                   /old_locus_tag="SMb20313"
FT                   /product="glycerone kinase"
FT                   /function="ATP + glycerone = ADP + glycerone phosphate"
FT                   /EC_number="2.7.1.29"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20313"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48699"
FT                   /db_xref="GOA:Q92WN3"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WN3"
FT                   /protein_id="CAC48699.2"
FT                   /translation="MSRSAAPPFSEEMDMQTFENARAGDIVLTLADRIIENRAYLSEID
FT                   GKIGDGDHGVNMAKGFGLAAERLKGKDASLAEALDTLGTVLMTEIGGSMGPLYGVMFTE
FT                   FAEKIEGADAIDAAAYSRMLHAGLEGIRSIGSAKVGDKTLLDTLVPAVDAFDAATADGR
FT                   PFAEALDALVSAAEAGRDSTRDLIARIGRASRLGERSLGVLDAGATSCAIILRELSHGA
FT                   RARLA"
FT   CDS_pept        complement(315380..316372)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20314"
FT                   /old_locus_tag="SMb20314"
FT                   /product="glycerone kinase"
FT                   /function="ATP + glycerone = ADP + glycerone phosphate"
FT                   /EC_number="2.7.1.29"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20314"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48700"
FT                   /db_xref="GOA:Q92WN2"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WN2"
FT                   /protein_id="CAC48700.1"
FT                   /translation="MQRFINNPDEVVEDTVKGFVKAHADIVRLGENPRVIVAKGAPVAG
FT                   KVGVVTGGGSGHEPAFIGYTGRNMLDAVAVGELFSSPTAKSFHDAIREADGGKGVVCLY
FT                   GNYAGDNMNVKMAVKLAAKAGIEVATVVANDDVCSAPPEEREKRRGVAGEIFMWKIGGA
FT                   KAAAGASLEEVRAAAQKAIDNCRSIGVGLGPCTLPAVGHPNFRIEPGTMEVGIGHHGEP
FT                   GLRVEALKTAEEVAVDMCKIVLDDHDLPQGTEVAVLVSGLGATPLNELYILNDTIEREI
FT                   TARGLKIYRTFVGNYFTSLEMVGATLTVMALDDELKALLDVEVRCTAVL"
FT   CDS_pept        316763..317749
FT                   /transl_table=11
FT                   /locus_tag="SM_b20315"
FT                   /old_locus_tag="SMb20315"
FT                   /product="ABC transporter, permease"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20315"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48701"
FT                   /db_xref="GOA:Q92WN1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WN1"
FT                   /protein_id="CAC48701.2"
FT                   /translation="MKSVFADRQFNFLVATNVLVVALAVVFAGETFLSLYNFQSMSAQV
FT                   PELALLALGVMLAMIAGGGGIDLSGIALANLAGVGSYLLVRDWVSADEAPLAFSWLFAA
FT                   MALLIGLAGGLLNGALIAFAGLTPIIATLGTQLFFTGLAVAFTNGSAITLGYIEPLDNF
FT                   GNTPVLGVPMCFTLFVVIAALIGVVLRFTPFGFKLYLMGSNAKAARYAGIPQRRMLLLT
FT                   YTVCGVLASIAGIIIAARTSSVKWDYGSSYVLIAILIVVMAGVRPDGGYGRTVCVVLSA
FT                   TALQMLSSLFNFLDISNFFRDCAWGLLLIVFLATSRVDLRAYLSPRR"
FT   CDS_pept        317829..318830
FT                   /transl_table=11
FT                   /locus_tag="SM_b20316"
FT                   /old_locus_tag="SMb20316"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20316"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48702"
FT                   /db_xref="GOA:Q92WN0"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WN0"
FT                   /protein_id="CAC48702.1"
FT                   /translation="MSVYKKIAACTVALGALCAAQLAVAQDAPSVVTVVKVTGENWFTR
FT                   MEEGVVAYGKDNPAVSTSQIGPAKADAAQQLRLIEDLVAKNVNAIAVVPMDPSALEGVF
FT                   KRAMNRGIKIITHEADSLKNTQVDIEAFDNKVFGARFNEKLAECMGKSGKWTSFVGSLG
FT                   SLTHVQWADGGAENAKKYPEMELVSEKNESFNDANKAYEKAREILRKYPDIKGFQGGSA
FT                   IDVIGIGRAVEEAGLVGKVCVVGLGLPKDTAKYLESGAVQSISFWDPKDAGYVMNKVAQ
FT                   LVIEGKEITDGMDLGVPGYNKVSVKNGPGDGIIVVGEAWVDVDKSNYSQYPF"
FT   CDS_pept        318948..320498
FT                   /transl_table=11
FT                   /locus_tag="SM_b20317"
FT                   /old_locus_tag="SMb20317"
FT                   /product="ABC sugar transporter, ATP-binding protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20317"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48703"
FT                   /db_xref="GOA:Q92WM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WM9"
FT                   /protein_id="CAC48703.1"
FT                   /translation="MPSAGARSDTMPFLEVRDLEKRFGGVRALKGVSFTIERGRTYHLM
FT                   GENGCGKSTLIKIISGAQPADGGELTINGKKVEGLTPIGALAAGIETVYQDLSLLPNLS
FT                   VEENVALTQQLVASNGSLARRLDLKGLRETAVRALKDVGLPTEPAFLSTPVEELPIATR
FT                   QLIAIARAIASDAGLVIMDEPTTALTRREVDNLIRVVHGLHAKGVSVLFVTHKLDECKA
FT                   IGGQAIIMRDGLKVAECDVATQSKTELGFWMTGKNLDDTRYRVDTHGDETLLSVERLGG
FT                   AGFDDVSFTVSKGEIFGITGLLDSGRNELALSLAGVESARRGSVLLAGRRADLSSPASA
FT                   IEAGIGYVPEDRLSEGLFLGKSIRENIVMAVLDRLRGAFGLLDSRRAKALAQKTVDDLQ
FT                   VATPDIDNPVMSLSGGNQQRVLIGRWLTIEPSLLILHGPTVGVDVGSKDTIFRIIQRLA
FT                   GDGMSVVIISDDLPELLQNCDRVMVMRKGRVADIFPAEGLEEDAIYKSMMAEDGQGVQ"
FT   CDS_pept        320500..321531
FT                   /transl_table=11
FT                   /locus_tag="SM_b20318"
FT                   /old_locus_tag="SMb20318"
FT                   /product="ABC transporter, permease"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20318"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48704"
FT                   /db_xref="GOA:Q92WM8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WM8"
FT                   /protein_id="CAC48704.1"
FT                   /translation="MADVAATPVSGSEEVPAAIRTMRWFIRHPPAVTFLLVVIVCIVVG
FT                   TINPDFWQVSNLFDMARSTVVRGLFALGVLVVLASGGLDVSFTAIAALVMYVITMLVTN
FT                   YVPDLSIWPILGIAAAGGAILGICNGLLVHALQAPSLIVTIGTQYAIRGFLLTFIGTAL
FT                   FMNIPESMDAFGKLALFRYEGANGAVSTLPAYFLVLVVAALATWYILKRTLIGRAIYAV
FT                   GGNASIASRLGYNLRTVHVFVFAYAGLLAGIAGIMHVSSNRLANPFDLAGSELDVIAAV
FT                   VLGGARITGGSGTVLGTLLGVLLITLVNNVLILVGIPSTLQLAIIGLFIVVAGAMFSIR
FT                   PKS"
FT   CDS_pept        complement(321582..322799)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20319"
FT                   /old_locus_tag="SMb20319"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20319"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48705"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR022460"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WM7"
FT                   /protein_id="CAC48705.1"
FT                   /translation="MERKEIAIIGGGPAGLMAAEVLSRSDHAVTVYEAMPTAARKFLLA
FT                   GKSGLNITHSEDYRDFATRFGDASARLRPGLDAFTPRDVRVWAAGLDAETFVGSSGRVF
FT                   PKAMKASPLLRAWLRRLEAQGVRLLTRHRWSGFAENGYIFDTPEGKTVVRCDAALLALG
FT                   GASWPRLGSDAAWMPLLRARGVPISDFRPANCGFDVAWSEIFRERFAGQPLKGVTATSD
FT                   AGTVSGEFVVTRHGIEGSLVYAHAASLRDRLDRDGTAALLLDLTPGRTAGRLARDLARQ
FT                   DRKASFSNRLRKGAGLDPVKAALLRELSPEAARAAAEQLAAEIKALPLPVLATRPIAEA
FT                   ISSAGGIRLDAIDDRYMLKALPGLFAAGEMLDWEAPTGGYLLTACLAMGRAAARGVEAW
FT                   LADSLR"
FT   CDS_pept        complement(322940..323935)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20320"
FT                   /old_locus_tag="SMb20320"
FT                   /product="TRAP-type periplasmic solute-binding protein"
FT                   /function="TRAP-type C4-dicarboxylate transport
FT                   system,periplasmic component"
FT                   /note="Involved in transport of hydroxyproline."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20320"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48706"
FT                   /db_xref="GOA:Q92WM6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WM6"
FT                   /protein_id="CAC48706.1"
FT                   /translation="MTFSRRTFLGGVAAGAALSLATPSLVRAQETRTLRLGIVTPPGHP
FT                   WNNAALKVGEALKAETNGRLSISVFPAGQLGNEAAMLQQMQSGALDLGWIMTAELGSRI
FT                   PAVAAINAPWVVDSTAKVAKLVREPVAMKLLDVLPAETGTVGLAWGITTMRVVFSAKEI
FT                   AGLDDINGMKLRINTTPAYRDFYQLLGAAPTPIPTPAVFDAMSNGQVDGLEADLDFSWN
FT                   QRFDKVSKTMLKMNAIFMPCVALASGRVWQTLPEADREIIARLTKSALDEQIDATVANE
FT                   PALLEKFAGAGIPIKDVTVADAGRIIAEYDKIWLPKAPVLAELRKVGATL"
FT   CDS_pept        complement(323964..325229)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20321"
FT                   /old_locus_tag="SMb20321"
FT                   /product="TRAP-type large permease component"
FT                   /function="TRAP-type C4-dicarboxylate transport
FT                   system,large permease component"
FT                   /note="Involved in transport of hydroxyproline."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20321"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48707"
FT                   /db_xref="GOA:Q92WM5"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WM5"
FT                   /protein_id="CAC48707.1"
FT                   /translation="MVTTAAFLAFMLVGVPIGVCLCLGSIVYIFASGNPLLFQSFPTQL
FT                   FGGVDNYGLISIPLFVLIGEIMNGGGITRRIIDMTMAFVGAMRGGLAYVNLLANMFVAS
FT                   ILGSATAQVAVMAQMMVPEMEKKGYDKTFAAGLTAYSGMLGPIIPPSIMFVVYSVLAQV
FT                   PVSDMLAAGIVPGILLTVAFCLVIAAMGFVYNYPRGERMKLQERVRIVLDALPTLLIPF
FT                   VIVGSILSGLANATEAAAVGAVAAVLVGCFWIGELKFSDLPRMMLRAGIYSAVVLFLVA
FT                   AAAVFSWVLVYGMVPQQVAGWVQTVASDPVTFMLLVNVILLVIGTVIDGAPGLIMTVPI
FT                   LLPIATEVYGIDPIHFGVVVVVNLVLGFLSPPVGLCFFVAAAVTGAKPGKMFLVTLPFF
FT                   FVSCLMLVLLSLIPSLSTFFAR"
FT   CDS_pept        complement(325229..325834)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20322"
FT                   /old_locus_tag="SMb20322"
FT                   /product="TRAP-type small permease component"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20322"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48708"
FT                   /db_xref="GOA:Q92WM4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WM4"
FT                   /protein_id="CAC48708.1"
FT                   /translation="MNQSVAPPLYARAIVSLSEAILALEKRAVAGLMCVLLALIILNVV
FT                   TRYSGHPLYWVDESAVYAMVWLAFLGGSALTRLRLDFAVTLLTDYLPPAAARWMRAAST
FT                   LLVLLFALALAAFCWMWMDPVGIIRAGFDAKAFAAESFNFLYTERSQTLNWPIWAISLV
FT                   IPLFAVTMTVHCAANLVEDLGLSPQRERRELSSAEGVN"
FT   CDS_pept        325922..326581
FT                   /transl_table=11
FT                   /locus_tag="SM_b20323"
FT                   /old_locus_tag="SMb20323"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20323"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48709"
FT                   /db_xref="GOA:Q92WM3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WM3"
FT                   /protein_id="CAC48709.1"
FT                   /translation="MASHLKHRTLSGALIEEIRQAILSGRYPAGSQLRQDALAETYGVS
FT                   RIPVREVLFQLEAEGLVRIVPQKGAIVSELSLAEINDVFELRALLEPRLFRKSAPLLDG
FT                   DDFARVEEVQNRFLKATAAGEIDSYGQLNAELHLALYRRAEMPRTQQIVASLLQTSDRY
FT                   TRVQLSSVAAMTRAMEEHAELIRLCRAGVFEEAAGFLVFHLKAVHEDLLFRLKGRE"
FT   CDS_pept        complement(326603..327619)
FT                   /transl_table=11
FT                   /gene="thuR"
FT                   /locus_tag="SM_b20324"
FT                   /old_locus_tag="SMb20324"
FT                   /product="ThuR transcriptional repressor"
FT                   /function="Transcriptional regulators"
FT                   /note="Likely regulates trehalose transport and
FT                   catabolism., Contains a LacI-type helix-turn-helix domain
FT                   and a pfam00532, Peripla_BP_1, Periplasmic binding proteins
FT                   and sugar binding domain of the LacI family. This family
FT                   includes the periplasmic binding proteins, and the LacI
FT                   family transcriptional regulators."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20324"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48710"
FT                   /db_xref="GOA:Q7ANS3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANS3"
FT                   /protein_id="CAC48710.1"
FT                   /translation="MKLKEFAKQLGLSPTTVSRALSGYPEVSEKTRKRVAEEAVRLGYR
FT                   PNINAVRLVTGRAGAIGVVMGRNEFQFSEFMSGMAERLDSEDIDILVSPVADHDMKAEL
FT                   QLYSRLATSGRVDAVIIHSPKPNDERILLLHKLGIPFLVHGRSETNVPHAWLDIDNEGA
FT                   IRRATSHLLDLGHRRIALINGRDGLTFTLHRDKGYREALEQRGLPFDPRLVTHGQFTDE
FT                   IGFRSARSFLEQSPRPTAFVAGSMMTALGVYRAVRSVGLVVGKDISVIAHDDVFPYLTA
FT                   DNMVPSLSTSRSSLRAAGARSADLTLQLLTGRPATEIHELWPVELILRESTGPAPEA"
FT   CDS_pept        328098..329369
FT                   /transl_table=11
FT                   /gene="thuE OR Smb20325"
FT                   /locus_tag="SM_b20325"
FT                   /old_locus_tag="SMb20325"
FT                   /product="ThuE, ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /function="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="Transports trehalose"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20325"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48711"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANS2"
FT                   /protein_id="CAC48711.1"
FT                   /translation="MNVKPFVRTLISCAAIAGAIDLAAAAELSMAANSTGKNLSFLRDQ
FT                   IARFEKETGHKVNLVTMPASSSEQFSQYRLWLAAGNKDVDVYQTDVIWAPQLAEQFVDL
FT                   TEATKDVVGEHFPSIIQSQTVNGKLVALPFYTDAPALYYRKDLLDKYGKTPPKTWDELA
FT                   ATAKEVQDKERAAGSADIWGFVFQGNAYEGLTCNALEWIKSSGGGQIIEPDGTISVNNE
FT                   KAAAAVEKVKEWIGTIAPKGVLAYQEEESRGVWQTGNAVFMRNWPYAYALGNGDDSAVK
FT                   GKFEVAPLPAATDGDQPSSTLGGWNLAVSKYSDEQEAAIAFVKFLGSAETQKVRAIELS
FT                   NLPTIAALYDDPEVAAAQPFMPHWKPIFQSAVPRPSAVAKVKYNEVSSKFWSAVHNTLS
FT                   GNGTAAENLELLEVELTELKGDAW"
FT   CDS_pept        329457..330443
FT                   /transl_table=11
FT                   /gene="thuF"
FT                   /locus_tag="SM_b20326"
FT                   /old_locus_tag="SMb20326"
FT                   /product="ThuF, ABC transporter, permease"
FT                   /function="ABC-type sugar transport systems, permease
FT                   components"
FT                   /note="Transports trehalose"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20326"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48712"
FT                   /db_xref="GOA:Q7ANS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANS1"
FT                   /protein_id="CAC48712.1"
FT                   /translation="MTDLSLADRPAALAHGGRIGSDLQAQRVRSAWLFLAPTFLVLALV
FT                   AGWPLIRTIYFSFTNASLTNLSGAEFVGFANYLSWITLKSGRTIYRGLLADPAWWNAVW
FT                   NTLKFTVLSVSIETALGLIVALVLNAQFPGRGLVRAAILIPWAIPTIVSAKMWAWMLND
FT                   QFGILNDMLIGLGLIGEKIAWTASPDTAMIAELIVDVWKTTPFMALLILAGLQMVPGDI
FT                   YEAAKIDGVHPVRVFWRVTLPLIRPALMVAVIFRMLDALRIFDLIYVLTPNNAQTKTMS
FT                   VMARENLFDFDKFAYGAAASTMLFLIIATITILYMWLGRLNLSGGER"
FT   CDS_pept        330443..331273
FT                   /transl_table=11
FT                   /gene="thuG"
FT                   /locus_tag="SM_b20327"
FT                   /old_locus_tag="SMb20327"
FT                   /product="ThuG ABC transporter, permease"
FT                   /function="ABC-type sugar transport system, permease
FT                   component"
FT                   /note="Transports trehalose."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20327"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48713"
FT                   /db_xref="GOA:Q7ANS0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANS0"
FT                   /protein_id="CAC48713.1"
FT                   /translation="MVVAIAKRTAFYALVAVIILVAVFPFYYAILTSLKSGTALFRIDY
FT                   WPTDISLANYAGIFSHGTFVRNLGNSLLVATLVVAISLLLAVTAAYALARVRFRGRGLL
FT                   LLTILSVSMFPQIAVLAGLFELIRFVGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLP
FT                   IEIEEAAIVDGASPWVVITRVFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRT
FT                   VPVAIALLSGGSQFEIPWGNIMAASVIVTVPLVVLVLIFQRRIISGLTAGGVKG"
FT   CDS_pept        331283..332311
FT                   /transl_table=11
FT                   /gene="thuK"
FT                   /locus_tag="SM_b20328"
FT                   /old_locus_tag="SMb20328"
FT                   /product="ThuK ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /note="Transports trehalose."
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20328"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48714"
FT                   /db_xref="GOA:Q7ANR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANR9"
FT                   /protein_id="CAC48714.1"
FT                   /translation="MAELQLRDIRKSFGAFDVIKGVSMEIKPGEFMVFVGPSGCGKSTL
FT                   LRLIAGLEEITSGTLAFDGQIVNQLTPSRRGIAMVFQSYALYPHMTVYENMAFGMQLAG
FT                   KDKQQCRKRVEAAAEMLQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSN
FT                   LDAALRVATRLEIAKLHRSMHKTTMIYVTHDQVEAMTLADRICVLRDGLVEQIGTPLEL
FT                   YETPNSVFVAGFIGSPKMNFLSGAFAEPYKADTIGIRAEHLEIDEQGGEWSGTVIHSEM
FT                   LGSDSYIYLDIGTGEPVIVRESGIAKHQPGQTIRISPAAGQVHRFDAGGRALGRMQMRG
FT                   AA"
FT   CDS_pept        332477..333289
FT                   /transl_table=11
FT                   /gene="thuA"
FT                   /locus_tag="SM_b20329"
FT                   /old_locus_tag="SMb20329"
FT                   /product="ThuA trehalose catabolism protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20329"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48715"
FT                   /db_xref="InterPro:IPR009381"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANR8"
FT                   /protein_id="CAC48715.1"
FT                   /translation="MPQITRRMTLSINAIVWGENIHEQTNAVVREIYPDGMHNTIAAAL
FT                   NSDPGIDATTATLQEPEHGLSETRLAAADVLLWWGHKDHGAVDDAIVERVAKRVWEGMG
FT                   LIVLHSGHFSKVFKRLMGTPCALKWREAGERERVWVVNPRHPIAEGLGENFVIENEEMY
FT                   GEQFSVPEPLETVFISWFAGGEVFRSGLTWRRGAGNIFYFRPGHETYPTYHDATVHKVL
FT                   RNAVKWAYNPQGTYKAIHDAPNVPVEKALEPIVERGPRLHRAGEAGYR"
FT   CDS_pept        333286..334383
FT                   /transl_table=11
FT                   /gene="thuB"
FT                   /locus_tag="SM_b20330"
FT                   /old_locus_tag="SMb20330"
FT                   /product="ThuB"
FT                   /function="Predicted dehydrogenases and related proteins"
FT                   /EC_number="1.1.1.18"
FT                   /note="putative oxidoreductase,, trehalose catabolism
FT                   protein,, PMID: 16042015"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20330"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48716"
FT                   /db_xref="GOA:Q7ANR7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANR7"
FT                   /protein_id="CAC48716.1"
FT                   /translation="MKGTPMRLLILGTGGMANSHAKAFAEIEGVEMVGAVDVDPSRAKA
FT                   FAVTHGIENTFTSLDDAIAWGEFDAATNVTPDKAHHPTTLALIAAGKHVLCEKPLAENY
FT                   EKAAEMAAAAERAGLVTMVNLTYRNVAPLQKARELVVAGEIGRVRHLEASYLQSWLVSR
FT                   AWGDWASESKWLWRLSTKHGSNGVLGDVGIHILDFAGYGANSSVERVFARLKAFDKAPD
FT                   NRIGEYDLDANDSFAMTAEFENGAMAVIHASRWATGHLNELRLRLHGDRGALEVIHTPD
FT                   GSSLRGCMGPDVEKAVWRTVDAGTVPTNYQRFVEAVKAGRTVEPGFRHAADLQRVLDLA
FT                   IETERSRRELGVPDIDAVVQERAVG"
FT   CDS_pept        complement(334596..334952)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20331"
FT                   /old_locus_tag="SMb20331"
FT                   /product="hypothetical membrane spanning protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20331"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48717"
FT                   /db_xref="GOA:Q92WM2"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WM2"
FT                   /protein_id="CAC48717.1"
FT                   /translation="MPNTLMAGRRSQDWANLVLAACLFLSPWVIGFAAEAAPTWNAWIA
FT                   GIVLGALAVATLSAFAEWEEWANMIIGLWLIVSPWLLGFMGNVNAMWTHVILGVLVAAI
FT                   AAWAVWDYRHHSHA"
FT   CDS_pept        335644..336585
FT                   /transl_table=11
FT                   /locus_tag="SM_b20332"
FT                   /old_locus_tag="SMb20332"
FT                   /product="putative arylsulfatase"
FT                   /function="Arylsulfatase A and related enzymes"
FT                   /EC_number="3.1.6.1"
FT                   /note="putative arylsulfatase A (Aryl-sulfate
FT                   sulphohydrolase),, putative arsA gene"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20332"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48718"
FT                   /db_xref="GOA:Q92WM1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WM1"
FT                   /protein_id="CAC48718.1"
FT                   /translation="MGSRAAPQGASFILGQEQFRMGLLTIGMPGDPHGIRDWMPTIADV
FT                   VKSKGYATGQFGKNHLGERDEHLPTNHGFDEFFGNLYHLNAEEEPEGYFYPKDEEFREE
FT                   LRAAREFIESSADGKIEDTGALNTKRMETVDASSSLPRRISSNAKRRPTSRSSGDKDFK
FT                   VHLDGYNLTELKGEAKEPPREAVYYFDQGGNLNAIRWNDWKLSFAINSEGNIATATRET
FT                   PSWANITNLRMDPYERGAKEGGGAMEFIGRNMWLLVPIQGKIKEFSQDFDQYPYQPGST
FT                   LNASGISYTWLQQQAALKRLGELGELESLAPR"
FT   CDS_pept        complement(336729..338849)
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="SM_b20333"
FT                   /old_locus_tag="SMb20333"
FT                   /product="BetT"
FT                   /function="Choline-glycine betaine transporter"
FT                   /note="High confidence in function and specificity"
FT                   /note="high-affinity BCCT (choline/carnitine/betaine)
FT                   transporter,, transcription activated by osmotic
FT                   shock,,PMID:11976294"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20333"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48719"
FT                   /db_xref="GOA:Q92WM0"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WM0"
FT                   /protein_id="CAC48719.2"
FT                   /translation="MQNRVVSCRFTGSTARRATMPEGIRGRSHILFLVPLSRAESVGRL
FT                   HQVQRFKVNLPVFVGSVAVIALFVGIGVIAPKRAESIFSGMQTAILSGFGWLYLLSVAV
FT                   FLFSMLFLAFSRYGELKLGPDDSEPEFRYLSWIAMLFAAGMGIGLMYFAVGEPMTHFAS
FT                   PPEAEPLTIAAQREAMSVTFFHWGVHAWAIYSVVGLSLAYFGYRYNLPLTVRSGLYPLL
FT                   KEGIHGPIGHVVDIFAICGTMFGLATSLGFGILQINSGLNYLLGIPQSIYVQLLLVTVV
FT                   TAIATISVVTGVEKGVRILSETNLFLAVLLMLFVLVVGPTGTLMRDFVQNIGLYLDSLV
FT                   LRTFNIYAYEPRPWIDSWTLFYWAWWISWSPFVGMFIARISRGRTVREFVTAVLFVPAM
FT                   FTFLWMTVFGNTAIYVDTTIANGELARDVKADLSVALFQFFEYLPWPAVTSTLAVLLVS
FT                   IFFVTSSDSGSLVIDTIASGGETATPALQRIFWCSLSGIVAAVLLSTGGLTALQSATIS
FT                   TALPFSLVMLILVWSLFVGMRADLARTQSPGSLGPRAYPASGVPWQRRLAMTLSTPDRR
FT                   AVEKFLQASVLPALEAVARELTRRSRPASVGRDAETGALTLTVPAEGHRDFVYGVQMSE
FT                   HKLPAFTAYDATVADVRYEARTFFSDGSRGYDIMGMADNQIINDVLFQFERYTGFVRSP
FT                   ESSLLATSPEER"
FT   CDS_pept        339465..340376
FT                   /transl_table=11
FT                   /locus_tag="SM_b20334"
FT                   /old_locus_tag="SMb20334"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20334"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48720"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WL9"
FT                   /protein_id="CAC48720.1"
FT                   /translation="MVWVPGATFMMGSNDHYPEEAPVHPVTVDGFWIDVTPVTNRQFLE
FT                   FVNATGHVTFAERKPRAEDYPGAPPSNLRAGSLVFTPPKRPLQGTDISQWWIFTLGANW
FT                   RHPLGRKSSIGAILDHPVVHVAYSDAKAYAEWAGKDLPTETEWELAARGGLDGAEFSWG
FT                   GELAPGGNHMANTWQGSFPVENSMDDGFARTSPVRFYPPNGYGLYDMIGNVWEWTTDYW
FT                   SVRHPEAAAKPCCIPSNPRNADADASIDPAASVKVPRRVLKGGSHLCAPNYCRRYRPAA
FT                   RHAQEIDTTTSHVGFRCVRRVR"
FT   repeat_region   complement(340437..340461)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        340597..341877
FT                   /transl_table=11
FT                   /locus_tag="SM_b20335"
FT                   /old_locus_tag="SMb20335"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20335"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48721"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WL8"
FT                   /protein_id="CAC48721.2"
FT                   /translation="MRRGLSDVSSRGDGFRVAKAGGSALSALLALALLAGCGGHPKGVM
FT                   TPVALAQPSNTSQVDMLVATTRQPSGDPATLFSGERSPTLSMTDVAVSIPPDSRRAPGT
FT                   VQWPRKLPPNPETDFAVTRVREMASEDEARTWFRAHNKDGHVLLFVHGFNNRYEDGVFR
FT                   LAQIVHDSGAQATPMLFTWPSRARVFDYNYDKESTNYSRTALEDTLRTLANAPNVKDVT
FT                   ILAHSMGTWLTMEALRQMGIRDGKIAPKIENVILASPDIDLDVFAKQWTDMGDERPKFT
FT                   IFVSQDDRALALSRLISGDVSRLGAIDPSAEPYRTQLETAGITAIDLTKVETDDGLHHG
FT                   KFAESPEIVQLIGQRIIKGQTLTDSEITLGEGITAVVAGTAKNVGTVAAATITAPVTII
FT                   EGRGTPPKQVRLNETLASDERSQRAVP"
FT   CDS_pept        341927..342718
FT                   /transl_table=11
FT                   /locus_tag="SM_b20336"
FT                   /old_locus_tag="SMb20336"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20336"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48722"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WL7"
FT                   /protein_id="CAC48722.1"
FT                   /translation="MTSWLVRNLAFAASCLLGSSALAADIYSPMTPQAREITTESGWTF
FT                   SFAPYFWAAGLSGDIGQFGLSAVDVDASFSDVFDHLDFALMATAEARNGPYSIFGDAIY
FT                   IKLSGQGATPRGFLADDVELATETFAGLLGAGYAIYDDGSSRLDIVGGLRVWSVESELS
FT                   ISGGALGTRSRTDDAAWVDGMAGFRGTYSITPEIYLTGWGLVGAGGADLDWDVAAAIGY
FT                   RFSDTVSAVAGYRALGVDYSDDGFVFDVVEQGPILGLVVRF"
FT   CDS_pept        complement(342776..343387)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20337"
FT                   /old_locus_tag="SMb20337"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20337"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48723"
FT                   /db_xref="GOA:Q92WL6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WL6"
FT                   /protein_id="CAC48723.1"
FT                   /translation="MQAGDMMNKPRSEMIAETRAKLIAAARRAFGTVGFAESSMDDFTA
FT                   EAGLTRGALYHHFGDKKGLLQAVIREIDAEMTARLNKVSSEAPTRWQGFVDECVAYIRM
FT                   ALEPEIQRIMFRDGPAVLGDISQWQMTEGCIAALAGSLDRLKADGEVIDIDTEAAARLI
FT                   NGASSHAALWIANSDDPQETSHKAVEGFRALLDGLRTAKD"
FT   CDS_pept        343485..344708
FT                   /transl_table=11
FT                   /locus_tag="SM_b20338"
FT                   /old_locus_tag="SMb20338"
FT                   /product="putative transporter"
FT                   /function="Sugar phosphate permease"
FT                   /note="putative transporter,, major facilitator superfamily
FT                   MFS_1"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20338"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48724"
FT                   /db_xref="GOA:Q92WL5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WL5"
FT                   /protein_id="CAC48724.1"
FT                   /translation="MSNPYGEIFRAPGAKGFSAAGFFARLPIAMAPIGIVAMLSQTHGE
FT                   YWLAGAVSATFALTNALVAPQISRLVDRVGQTAVVVPTTIISVLAFLVLILAANRDWPA
FT                   WTLFASAFLAAAMPSIPALVRARWTEIFRNRPELNTAFAFESSADELVYIAGASLSVGL
FT                   AVVMFPEAGMLISTIFLALGTAAFILQRSTEPKVRPLEAGVSRASAIRQRPVQIITLAL
FT                   IFVGSIFATAEVSAVAITKELGQPQAASLVIGVYAVGSFLVGLALGALNPTMPLHRQLL
FT                   IAVSVIAITSVPLLLADTVPLLALAVFVSGIAISPTFITAFGLIERRVPESMLTEGVTW
FT                   VMTGIGIGMALGAFVSGWVVDNFGAQNGFWVSVAAGTATVATIAMGQRSLAGHKGASVA
FT                   GSIPQPAE"
FT   CDS_pept        344797..345279
FT                   /transl_table=11
FT                   /locus_tag="SM_b20339"
FT                   /old_locus_tag="SMb20339"
FT                   /product="hypothetical TRANSMEMBRANE protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20339"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48725"
FT                   /db_xref="GOA:Q92WL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WL4"
FT                   /protein_id="CAC48725.1"
FT                   /translation="MARGSLIAVSGLFAGLAAVAALTVSAERRNESPWRPINATSHWIH
FT                   GRRAGSQSRLDLAHTGTGFVTHMLASLWWALPFSAMVGRSARPSPQRVIAAAFGTTVLA
FT                   ALVDYGLVPKRLTPGWELALPKSDLAAAYMAMGIGLALGASLHGAAAARGQEHPPV"
FT   CDS_pept        345349..345528
FT                   /transl_table=11
FT                   /locus_tag="SM_b20340"
FT                   /old_locus_tag="SMb20340"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20340"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48726"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WL3"
FT                   /protein_id="CAC48726.1"
FT                   /translation="MSSRPPPIPPDNRSDKGTGEPGTVSAESKKPDVAENPEKKGQQGN
FT                   TKVNTTHQGYQQDR"
FT   CDS_pept        345733..345918
FT                   /transl_table=11
FT                   /locus_tag="SM_b20341"
FT                   /old_locus_tag="SMb20341"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20341"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48727"
FT                   /db_xref="GOA:Q92WL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WL2"
FT                   /protein_id="CAC48727.1"
FT                   /translation="MTIATASDEQFLIAGVLLDPQRVEEFAMRRGLRHHPMVDLIVFIA
FT                   AVGLVSAIMVVSLFFG"
FT   repeat_region   complement(346244..346289)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(346305..348518)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20342"
FT                   /old_locus_tag="SMb20342"
FT                   /product="putative isoquinoline 1-oxidoreductase"
FT                   /function="Aerobic-type carbon monoxide dehydrogenase,large
FT                   subunit CoxL/CutL homologs"
FT                   /EC_number="1.3.99.16"
FT                   /note="probable aldehyde oxidase and xanthine
FT                   dehydrogenase, a/b hammerhead domain,, putative
FT                   isoquinoline 1-oxidoreductase, beta subunit"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20342"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48728"
FT                   /db_xref="GOA:Q92WL1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WL1"
FT                   /protein_id="CAC48728.1"
FT                   /translation="MIPKLMQSITLPVARAEASRRQFLLGALAAGTGVAIGYRILSASP
FT                   ALAGEAATESGSHAFSPYLTIGGDGKVTVLSSQFEMGQGSYNGIATLVAEELDSDWSAI
FT                   DVIGAAGNIKAYGNIAFGGTMQGTGGSTSMSTSWERYRRAGAAARAMLVAAAAAEWGVD
FT                   AAEIAVENGVLSHPSGKSGGFGAFAAKAATMPVPADVKLKEPGDWKLIGNDELKRFDSA
FT                   RKANGTEQYTIDVKLPGMLTAVMIHPPLFGAKAKSFDASAARAIKGVVDVVETPRGIAV
FT                   VGEHMWAAIKGREAVTVEWDETGAEKRGTPELMSTYRDLAGKSPAAFARKDGDTDAAFT
FT                   SAAKVIEATFEFPYLAHAALEPLNAVARRNDDGTIEIWGGHQLPDVYQNLASEIAGVPV
FT                   EKVRLNVMKTGGSFGRRAVFDGDVVVEAVHVAKALGFRAPVKVQWTREEDTRAGRYRPA
FT                   YVHRLKAGIDEAGKLVAWSDHIVGQSIMAKTAWDGMVQNGVDPTSVEGANNLPYAIANQ
FT                   TVGLTTTDVRVPVLWWRSVGSTHTAFAAEAFLDEVAEAAGRDPLEFRLSMLEPDSRHAT
FT                   VLKLAAEKAEWQKPLPEGRFRGVAVAESFGSVVAQIAEVSVDGDGIKVERVVAAVDCGL
FT                   AINPDQVRAQVEGGIGFGLSAILGEEITLTDGKVDQGNFDMYTPLRIDAMPKVEVHIVA
FT                   SANPPSGIGEPGVPPIGPAVANAAFKALGKRIRVMPFAKSLNA"
FT   CDS_pept        complement(348520..348978)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20343"
FT                   /old_locus_tag="SMb20343"
FT                   /product="putative isoquinoline 1-oxidoreductase"
FT                   /function="Xanthine dehydrogenase, iron-sulfur cluster and
FT                   FAD-binding subunit A"
FT                   /EC_number="1.3.99.16"
FT                   /note="probable aldehyde oxidase and xanthine
FT                   dehydrogenase, a/b hammerhead domain,, putative
FT                   isoquinoline 1-oxidoreductase, alpha subunit"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20343"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48729"
FT                   /db_xref="GOA:Q92WL0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WL0"
FT                   /protein_id="CAC48729.1"
FT                   /translation="MVTVKINGVEHKIEAEADMPLLWAIRDLVGLTGTKFGCGMAQCGA
FT                   CTVYVDGSPTRSCQTFIGDIEGAEVTTVEGLKGKVAETVQAVWADLDVPQCGYCQSGQI
FT                   MSATDLLANNPKPTDADIDAAMSGNLCRCATYHRIRAGIHEAAKRLEA"
FT   CDS_pept        complement(349255..350211)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20344"
FT                   /old_locus_tag="SMb20344"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20344"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48730"
FT                   /db_xref="GOA:Q92WK9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WK9"
FT                   /protein_id="CAC48730.1"
FT                   /translation="MSTIMFPQKDLREETAALRAQILDRLSKLPWDGLSFAHPVPGLSL
FT                   YRIVEPAGPFSSVYEPSLSFIIKGSKNVRVGNETLVYDEGCFFLTAIGVPVTAQICAAS
FT                   EGEPYVAAALRLDMGKVRRIIADHDIHPTDIPERDLGVAVGTATRELFDALFRLISLAS
FT                   SPADIPFLAGHIQNEILYRLLTGEQGARLRRFALAGTHSNRVAKAVLWLKENYTKPLRV
FT                   EELAEIANMGVSTLHHHFRAMTAMSPLQFQKHLRLHHARELMLSKSLDAATAALQVGYE
FT                   SPTQFNREYRRAFGHPPLRDIRAILNSNDSTRRNSAG"
FT   CDS_pept        complement(350348..353497)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20345"
FT                   /old_locus_tag="SMb20345"
FT                   /product="probable acriflavine family protein"
FT                   /function="Putative silver efflux pump"
FT                   /note="probable acriflavine family protein (AcrB/AcrD/AcrF
FT                   family)"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20345"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48731"
FT                   /db_xref="GOA:Q92WK8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WK8"
FT                   /protein_id="CAC48731.1"
FT                   /translation="MHASTEDKKPFNLSRWAIGHPSIARFLLALIIITGGLGLLRMGQR
FT                   EDPEFTFRVMVVQAVWPGASIQEMEDQVVNKIERKLQETPHLDFVRSYTRAGSAIITVQ
FT                   IEGDTNADEVADAFYQVRKKVGDIANELPEGVLGPYFNDEFGDTFITLHSISGDGFSYP
FT                   ELKRFAIEGRDMLLATPGVEKVVVLGDQPEKIYIDLSSKVLAERGLTFNDLRNAIAGQN
FT                   NVDYAGSVDTGTRSVRISVEGDVTKVEDIRELRLRAGDRTIRLGDIATVTSGLEDPYAR
FT                   KFRFNGHDSVQIGVVMAKGFNVTDVGKAVEATYDRFESALPYGVSVDQVSNQPEVVTEA
FT                   ITEFSHALIEALIIVLIVSFLSIGWRSGLVIAIAIPLVLAATFAIMYELGIDLQRISLG
FT                   ALIIALGLLVDDAMIVVEMMERKLEEGLEKIDAASFAYSSTAFPMLTGTLITTAGFIPV
FT                   GFAESTAGEYVRSLFYVVGIALVVSWFVAVYFTPWLGYMILKQRHHAGTHHDVFDTRFY
FT                   RRLRTTVGWAVRHRVVVLLMTLAIFVTSLWAFQFIPKNFFPQSSRPEILVDLWLPEGTS
FT                   IKEVEKQAKALEERMMDDEDKRFIATYIGEGAPRFFLPLDQQLRNPNFAQLLVMAKDEP
FT                   ARERLIAKLRTILAEDFPSIRAKVDRLFLGPPTGWPVQMRVMGPDREEVRRIADQVKTK
FT                   FQENPMLGAIHDDWLEPVPAMKLVIDQDRARALGITSQRIRQMLQAAMSGVPLDSFRDG
FT                   EETVSIMAREPGGNRHLLSAVQSVYVPTDFGGFVPVSQIAKVVPVMEQGIEWRRDRLPT
FT                   ITVRGTLPDGVQPNDVAMQLFDELKGLRDGLAPGYKVEIQGGAEDSAESQASIAAKAPI
FT                   MLVVIVILLMVQLQHFGKAMLVLATGPLGIIGAAAALLISGAPFGFVAILGVIALLGII
FT                   IRNSIILVDQIDQDIAAGMERSEAIIGAAVRRFRPIILTALTAVLALIPISRGVFWGPL
FT                   AYAMMGGILVATVLTILVLPAGYALFFGKEPKSRKTDPEPLAAQDNADEQEHYSTPLAA
FT                   E"
FT   CDS_pept        complement(353526..354680)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20346"
FT                   /old_locus_tag="SMb20346"
FT                   /product="putative efflux transmembrane protein"
FT                   /function="Membrane-fusion protein"
FT                   /note="Hypothetical protein"
FT                   /note="putative efflux transmembrane protein,, RND
FT                   family,MFP subunit,, putative multidrug export protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20346"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48732"
FT                   /db_xref="GOA:Q92WK7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WK7"
FT                   /protein_id="CAC48732.1"
FT                   /translation="MFSGSALNRPFVARLLTAILLGAVLSGCSQEKVETKETIRPVKVV
FT                   EIAAAGEPRELHYSGSVRARTEMNLGFRVGGKITERLVNIGDRVKPGDILARIDATDYR
FT                   LAVTSAEANLLAAEKQVQTTALAKLRAEQLFTKSFSSQAQLDQATLLYDQAVSTRDAAA
FT                   SSLSQAKNQVSYTDLKADQNGIVTAVNADIGQVVGTGTPVVTVAVDGEKEVEIAVPEID
FT                   VTEFKPGKPVGVRFWSNDMLVLDGHVREVSGSADQRSRTFSVRVSLPNDERVLLGMTAT
FT                   VEAAAASSAPLVSIPLSALSKKDGQNIVWIVDRDFSTVHARPIKLADFADNGVRVVDGL
FT                   GAGDLVVAAGTQFMAEDLKVRLQAGEQQSAEQQSARAETPEILR"
FT   CDS_pept        complement(354773..355381)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20347"
FT                   /old_locus_tag="SMb20347"
FT                   /product="putative transcriptional regulator"
FT                   /function="Transcriptional regulator"
FT                   /note="putative HTH tetR-type regulator family,"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20347"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48733"
FT                   /db_xref="GOA:Q92WK6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041478"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WK6"
FT                   /protein_id="CAC48733.1"
FT                   /translation="MSDLADNAIDAARQENVARILEAAERLFRHYGYAKTNVADIAREL
FT                   DMSPANIYRFFASKTEIHQTLCLRMLGASYQQALEIAHLPLSASERLRRYALGQHKLTV
FT                   ETMLDEQKVHEMVVVAIERDWHVIEKHISRLDDLLAGIIREGIEAGEFADVDPAVAARC
FT                   FGASLVTLCHPQIVAQCLAKENRATPDELVEFAIRALKK"
FT   CDS_pept        355568..356395
FT                   /transl_table=11
FT                   /locus_tag="SM_b20348"
FT                   /old_locus_tag="SMb20348"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20348"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48734"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR031663"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037161"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WK5"
FT                   /protein_id="CAC48734.1"
FT                   /translation="MTSIALFGAGGKMGCRLAKNLKGSRFDVRHVEVSEAGKTRLADEL
FT                   GLQAVAADEALDGAEVVILAVPDTAIGKVASGIVDRLKSGTMVIVLDAAAPYAGHLPER
FT                   GDLTYFVTHPCHPPIFNDETDAAAKRDFFGGVAAKQHIVSALMQGPEEAYALGEEIAKI
FT                   IWAPVMRSHRVTVEQIALLEPGLSETVCASLLVVMREAMEECVKRGVPKQAARDFLLGH
FT                   MNVLGAVIFEETPGVFSDACNKAIEFGKPMLMREDWKRVFEPQEIADSIRRIT"
FT   CDS_pept        356464..357405
FT                   /transl_table=11
FT                   /locus_tag="SM_b20349"
FT                   /old_locus_tag="SMb20349"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /function="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="Possible erythritol transport protein. Similar to
FT                   EryG of Rhizobium leguminosarum."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20349"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48735"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WK4"
FT                   /protein_id="CAC48735.1"
FT                   /translation="MKLTRRMTITAFAAVLAASSAVPAYAADLIAIITPSHDNPFFKAE
FT                   AVGAEAKAKELGYETLVLVHDDDANKQSQLIDTAIGRGAKAIILDNAGSEASIAAVQKA
FT                   KDAGVPSFLIDREINATGVAVSQIVSNNYQGAQLGAEEFVKLMGESGNYVELLGREADL
FT                   NAGIRSKGYHDVIDEYPEMKMVAQQSANWSQTEGYSKMETILQANPDIKGVISGNDTMA
FT                   MGAIAALQAAGRKDVIVVGFDGSNDVRDSIKSGGIKATVLQPAYAQAQMAVQQAHEYIT
FT                   TGKAPAEEKQLMDCVLINSENADQLETFALAD"
FT   CDS_pept        357571..358215
FT                   /transl_table=11
FT                   /locus_tag="SM_b20350"
FT                   /old_locus_tag="SMb20350"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20350"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48736"
FT                   /db_xref="InterPro:IPR014582"
FT                   /db_xref="InterPro:IPR036215"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WK3"
FT                   /protein_id="CAC48736.1"
FT                   /translation="MPKFKVAAALVVAGVMALSGCKIIKTPTAEEAAEAASGGFNPGRM
FT                   VAEIWDVKVLPYLDRKAGPFAEVAALAESDPQAAGAKYGHKEKQGSAPWTFAARLSGTV
FT                   VKAETKSRSAYVEVDANGDGKADARVQIGPAIRGTAIRDSLDFVNFNEFKNQIEWAQFG
FT                   KAFNTHVNGLVLEKLSRDGLVGKKLDAVGAYPLPAKGQLPLFVPAQLTVGG"
FT   CDS_pept        358212..359762
FT                   /transl_table=11
FT                   /locus_tag="SM_b20351"
FT                   /old_locus_tag="SMb20351"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20351"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48737"
FT                   /db_xref="GOA:Q92WK2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WK2"
FT                   /protein_id="CAC48737.1"
FT                   /translation="MIMHPADDDDCVLRLEDVTKVYSGIIAVRHANLSLRRGAVNVLVG
FT                   ENGAGKSTLMRIIAGVEKPSLGRILLDGQQVEFHSPADAQRHGIGMVFQELNLFGNLSV
FT                   AENIFATRELTRGIRGIDHRAQVERATGFLDRLDAGIDAETLVEDLPIGQQQLVEIAKA
FT                   ISLDTRILILDEPTSALSAAEVDVLFKVIRELKAQGVAIVYISHRLEELMRIGDYITVL
FT                   RDGQITGHAMVKDIDTKWIVRSMIGSDAKDFAKSVDHRLGEEAFRAEEICLPRRTGGLA
FT                   VDHVSISVRAGEVLGIYGLMGAGRSEFFECVMGQHPHSSGRVFVGGTEVDASDTSGRIS
FT                   AGLALIPEDRQREGLVQALSIASNLTLASLDRFVRFGFHIVGAREQASIAAAIRDLSIK
FT                   APNPDFEVTSMSGGNQQKVVIGKALMTKPKVLLMDEPSRGIDVGAKADVFRTMRRLAGE
FT                   GLAILFSTSDLEEVMALSDRIAVMSNGRLVTVIDRADATEEMIIKASAEGHKTTREHA"
FT   CDS_pept        359762..360826
FT                   /transl_table=11
FT                   /locus_tag="SM_b20352"
FT                   /old_locus_tag="SMb20352"
FT                   /product="ABC transporter, permease"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20352"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48738"
FT                   /db_xref="GOA:Q92WK1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WK1"
FT                   /protein_id="CAC48738.1"
FT                   /translation="MTTATTTTNATDATSGSVLLTLMKLRTFIALFAVVAFFSIFAPNF
FT                   LSTANLILMSKHVALNAFLAMGMTFVIITGGIDLSVGSIVGLCGMVAGGLILNGIDLQF
FT                   GYTVYFNVVEVCLITLAVGIVIGAVNGLLITKLNVAPFIATLGTLYVARGFALLSSGGQ
FT                   TFPNLVGKPELATTGFAFLGSGRLLGLPVSIWVLIVVALAAAYVARYTPIGRHIFAVGG
FT                   NERAARMSGIRVDRVKMFVYMFSGFCAAIVGLVISSELMASHPATGNSFELNAIAAAVL
FT                   GGTSMSGGRGTIGGTIIGAFVIGILSDGLVMMGISSFWQMVIKGIVIIVAVVVDQAQRR
FT                   LQQQVTLMQLAKKG"
FT   CDS_pept        360832..361866
FT                   /transl_table=11
FT                   /locus_tag="SM_b20353"
FT                   /old_locus_tag="SMb20353"
FT                   /product="putative oxidoreductase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20353"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48739"
FT                   /db_xref="GOA:Q92WK0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WK0"
FT                   /protein_id="CAC48739.1"
FT                   /translation="MTDLKGALIGCGFFAVNQMHGWRDAEGARIVAICDRDPERLKAVG
FT                   DAFGIQRRYTSAEDLFADGGFDFVDIATTVGSHRGLVEMAARHGVATICQKPIAPTMED
FT                   AKAMVSACAKSGVAFMVHENFRWQSPIRAVKAAIDSGAIGEVFWGRVSFRSGYDVFSGQ
FT                   PYLATGKRFIIEDLGIHALDVARYIFGDATAVTARTRRVNPAIAGEDVATMLLDHDGGI
FT                   TSLVDCSYATKLPIEPFPETLMEVDGSKGTLRLTQGYHLAVHSKGATKLTNVEPPALSW
FT                   ASPPWHNIQESVALIQQHWIEALRAGREPDTSGRDNLETFALVEASYLSAAEGRTVSLA
FT                   EVLG"
FT   CDS_pept        361863..363782
FT                   /transl_table=11
FT                   /locus_tag="SM_b20354"
FT                   /old_locus_tag="SMb20354"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20354"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48740"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WJ9"
FT                   /protein_id="CAC48740.1"
FT                   /translation="MTVSRAFLLLGTDEREPEARRIEVGRLSADFAGGNLRTIRLAGKE
FT                   VLRAISFLVRDRDWGTCEAEIGDLTVEEGKTGTVVRYSARFRSPDGALLDCSATIDLKP
FT                   DRLVFDARFTPDRDFETARAGFAVLHPIVGVAGRPVEVEHGDGTVERSVFPDLIEPWQP
FT                   FKDIAAITHEVSPGIEAECRFAGDVFEMEDQRNWTDGSYKTYVRPLELRWPYLLQARET
FT                   VHQSVMLSIRTSGEALALEERGQENIRLSLRHNAGRLAQMGIGLRPDAAAEELRNAGLL
FT                   KQVGARHLVCHFDQDAGHGLADLRHFRGVADASGCAVTLECFVPCKRPLDEELGEIAQL
FT                   VRQSGIELASLAVSPSVDRQSTPPGSVWPECPPLEDIYAAARKAFPGVPLGGGMFSYFT
FT                   ELNRKRVPAEGLSYVTHCTNPIVHAADDTSVMQTFEALRDVARSVRAIYGAKRYRIGPS
FT                   TIAMRQNPYGSATKDNPFGKRIAMAARDPRHNALFGAAWTLAYAATVADAEPELLTLST
FT                   LAGPSGLIAGAGEPVEAGRARPLFHVVNWLAQLSDGLRIAVETSAPECVAGLGATLNRT
FT                   TTLLLANLTPDLQRVMLPEAGARRLTLLDETWLRDGAGEPEAIAHQSDSLDLPAYAAAR
FT                   IDIL"
FT   CDS_pept        363905..364663
FT                   /transl_table=11
FT                   /locus_tag="SM_b20355"
FT                   /old_locus_tag="SMb20355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20355"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48741"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WJ8"
FT                   /protein_id="CAC48741.1"
FT                   /translation="MEALAALARNCIVTLLCGCALFAPSLAAEEADDVATGTRLAELLR
FT                   AARNVLSNYQSLINDPALGDKKLDGERFTAEAIALYGERTGHPLISDDLGDRDRKLLQA
FT                   QVEAMREVVNEQQDDINRPGIGFKGFVPAIFARLMNEKFAVKAGNEALVRVTAPEVLVR
FT                   NRKSLPDAWEARVINEVFSDPERPKGELYREVTQVNGRPAFRMLLPEYYTESCLSCHGS
FT                   PKGEIDVTGYPKEGGKAGDLGGAISIVLFK"
FT   CDS_pept        364660..367413
FT                   /transl_table=11
FT                   /locus_tag="SM_b20356"
FT                   /old_locus_tag="SMb20356"
FT                   /product="putative two-component sensor histidine kinase"
FT                   /function="Osmosensitive K+ channel histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="two-component hybrid sensor and regulator histidine
FT                   kinase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20356"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48742"
FT                   /db_xref="GOA:Q92WJ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WJ7"
FT                   /protein_id="CAC48742.1"
FT                   /translation="MSALGHELRSTEAARPAKRLDSRITDLPISARVAALTAAGLISLV
FT                   LSSLFLTQALYRSAERMAETRELFDRAASAASAHVAFGDLRYWLTDLSVSLLMNSQRNA
FT                   DEARERLQEQLAGLAKHAPEAVEAIRTEVDAYVETALQAADSYTQDNRIVGNALLAKAR
FT                   THSGKVDADLNRLVEQVKAEAEAARNEVVVQTEKTATTAAILVGGVVLIGSLLTLLVLR
FT                   SIVGPLRRLNRVIGDLTEGRYDVDIPEEGGDELGAMARTLSLFRESAIEKKKLEDEAER
FT                   QRRTIAAALEVISDGFVLYDSEDRILVANSKYCEIFPSHKPNTLRGRSFREIVEQNLEM
FT                   GQVDLEGKSPQEWVDERVRLHRDPAGLVDEKRFGDKWVRISKRKIPDGGTVAVYTDITQ
FT                   LKQRQVELERAKSHAESANEAKSRFLASMSHELRTPLNAIIGYSEMLIEEARDHEDEEL
FT                   VPDLDKIASAGRHLLSLINDILDLSKIEANKMEVFLETFSVADLLRDVAATVAPLMARN
FT                   GNEFTQDFEADLGEMHSDQTKLRQNLFNLLSNAAKFTNGGRVTLRVRREQRPDRDWLVF
FT                   QVTDTGIGMSPEQQERLFNAFTQADASTTRNYGGTGLGLSITRSFCRMIGGVVTVESEV
FT                   GKGSVFTMEVPAQCEREADGSPAEPVPQVGSGRTALIIDDEPAARSLIAKALAEAGLAS
FT                   IEASNGQEGLAAARKHRPDAIILDIIMPHQDGWSVLRALKNDPELCTIPVILATILADR
FT                   ELGLSLGAVEYLTKPIDTDKLVRTIETFGGGKHDVLVVDDDQASREFLRRILVKRKWTV
FT                   HEAGDGIRGLEMMKRILPRLVLLDLLMPEMDGFQTLSEMQRIPELQNIPVVVVTSKDLS
FT                   ASELKWLRDRAVAVVNKGANSRSQLVAALERQIGSGASVGKALADG"
FT   CDS_pept        367438..367803
FT                   /transl_table=11
FT                   /locus_tag="SM_b20357"
FT                   /old_locus_tag="SMb20357"
FT                   /product="putative two-component response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /EC_number="2.7.3.-"
FT                   /note="putative two-component response regulator,, response
FT                   regulator receiver domain"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20357"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48743"
FT                   /db_xref="GOA:Q92WJ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WJ6"
FT                   /protein_id="CAC48743.1"
FT                   /translation="MTKILLVEDNEMNRDMLSRRLSRRGFDVLIAENGRAGVELAESQK
FT                   PDLILMDMSLPVMDGWEATRRIKANPLTSAIPVIALTAHAMASDREMALEAGCDDYDSK
FT                   PVDLPQLVRKIEQLLAI"
FT   CDS_pept        367812..369374
FT                   /transl_table=11
FT                   /gene="cyaL"
FT                   /locus_tag="SM_b20358"
FT                   /old_locus_tag="SMb20358"
FT                   /product="guanylate cyclase"
FT                   /function="GTP = 3',5'-cyclic GMP + diphosphate"
FT                   /EC_number="4.6.1.2"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20358"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48744"
FT                   /db_xref="GOA:Q92WJ5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WJ5"
FT                   /protein_id="CAC48744.1"
FT                   /translation="MTAGNDFQHQAIAAHVAQRLAGPARAILGFQELLVEQARDLGLIH
FT                   IKGDLDRIGAAARQLNGFIDRLLEGAACPLEEGEAEAEARLRHDLRTPLNAIIGYSEMI
FT                   LEEASDAPEHALKEDLHVILSAAAELLTQVDAIASLSRGETVEMLQPGERAEIDAAGLE
FT                   RLLFKAQEVACPEQGGRILVVDDVASNRDLLSRRLRREGHRVVTAESGLSALARLAEDE
FT                   FDLILLDILMPDMNGIEMLSRLKSEERWQHVPVIMISGLSDVTAVARCIEAGADDYLTK
FT                   PFNPILLRARINSTLEKKRWLDREHRYLQQIKTEKLRADSLIRAILPDQIVARLQDGEE
FT                   IIADRFDEVSILFADIVGFSPIAASLTASDLVRRLDRMFRRFDLLTEQHRVEKIKTIGD
FT                   AYMAACGIPEPAPDHADRIVALGKSMLRSLQDMEAGPDRFRVRIGIHTGPVVAGLIGRL
FT                   RFVYDVWGETVNIASRLESQGVADVIQISEATRRALRGPWTLERRCALELRGIGAVETY
FT                   LVR"
FT   CDS_pept        369491..370786
FT                   /transl_table=11
FT                   /locus_tag="SM_b20359"
FT                   /old_locus_tag="SMb20359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20359"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48745"
FT                   /db_xref="GOA:Q92WJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WJ4"
FT                   /protein_id="CAC48745.1"
FT                   /translation="MALGASQRLHDGVAAVETMTRFALAVLALASGVYTYLGVRSILDG
FT                   SPTSVFFAAIIYSASVSVGIYAFWSYMARFYPHVTNHTGRAAMLGVMALGAAMIIAMSS
FT                   WLNAAALAGSAALEQHLAETVEDYTADLDQAHQNALAAQSLLPDIQRASERFAQLAASE
FT                   RQSGALTGTTGSGSVVQLLSQMSAQMKDLENGINASREQVAMLFNQGQKRLETMRTLVS
FT                   APGAVAPRADQFSSEVVALTGVITSLGQTSIAPSIRRAADDLSLGFIAPVADGGDADLV
FT                   NRQDRVMETVRASVATQSKVLSEAADEILARAPVAERRFVPLSSAEAVLRYATDFIPAW
FT                   AGAISIDLLPGVLVFILAAVHSAIRKQEEKLPFAERITAAELLQALEVQRAVTANGGQL
FT                   GDIVAQAEAEEPNNITSLDPRTRAKDRTHEDR"
FT   CDS_pept        370827..371558
FT                   /transl_table=11
FT                   /locus_tag="SM_b20360"
FT                   /old_locus_tag="SMb20360"
FT                   /product="hypothetical protein"
FT                   /function="Protease subunit of ATP-dependent Clp proteases"
FT                   /note="hypothetical protein,, putative protease subunit of
FT                   ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20360"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48746"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WJ3"
FT                   /protein_id="CAC48746.1"
FT                   /translation="MRGAFFAMLAAAGVFLLIDLREISAMNAGLPGFDPMLEDRPVLPP
FT                   AVTEAAPNGPPVQPGSSDEVLRQPMRFDLRSGGVLVAEGTLDLGAGSRFADEIEARGEY
FT                   VTTVALNSPGGSVDDALAMSKLIREKKLDTKVASKALCASSCPIVFAGGVARVAERDAL
FT                   IGVHQVFSGGEERPTPAQAMSFAQSTTARVARHLDSMGVGPGLWINALETPPDRLYYLT
FT                   EKEMVDFHLTTEPVATAKTDG"
FT   CDS_pept        complement(371644..372441)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20361"
FT                   /old_locus_tag="SMb20361"
FT                   /product="putative ionic voltage-gated channel protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20361"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48747"
FT                   /db_xref="GOA:Q92WJ2"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WJ2"
FT                   /protein_id="CAC48747.1"
FT                   /translation="MDMTDQPRAHSKLNSTRLALQRLERGRDPWALRWQALLAVIDLSI
FT                   LAFFILGPYLRAGPSYLIIDYIIAAWIGCELIARAFAAPSIERFLRRPMTWVDVIILGT
FT                   LLFPDLLFNFAFLRVMRIWAIGKSPLLLEGLRRAGWSHLQDVFRACLNFLVFLFVVTGF
FT                   VYTTFFYHREGGEGFVDALYFTVATITTTGFGDITLPGTLGKLTSVITMIVGISLFVRL
FT                   AQAVVRPYKVSFPCPQCGLQRHDTDAVHCKACGHLLNIPDEGD"
FT   CDS_pept        complement(372532..373332)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20362"
FT                   /old_locus_tag="SMb20362"
FT                   /product="inositol-phosphate phosphatase"
FT                   /function="myo-inositol phosphate + H2O = myo-inositol +
FT                   phosphate"
FT                   /EC_number="3.1.3.25"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20362"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48748"
FT                   /db_xref="GOA:Q92WJ1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WJ1"
FT                   /protein_id="CAC48748.1"
FT                   /translation="MTSHVVPGLEARLALAETIGREAGAMALDFFARRETLIIETKRDP
FT                   QDLVSIADREVENLIRDRIAEAYPEDGVLGEEYGLVPGRSGFTWAVDPIDGTSPFVNGM
FT                   PNWCVSIALVHAGIPVVGVIAAPCHGELYAAALGLGARLNGKALTLDGSRTIRNHVTGL
FT                   GANNYVKPAFVGQMVESLLEAGGTFMRNGSGALMLAYVAAGRLVGYYEPYMHAWDCLAG
FT                   YCLVQEAGGWYLPFPTEGESLTRGSIVLAAAPGAVEDLRKLAGV"
FT   CDS_pept        complement(373363..374424)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20363"
FT                   /old_locus_tag="SMb20363"
FT                   /product="putative iron ABC transporter ATP-binding
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20363"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48749"
FT                   /db_xref="GOA:Q92WJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92WJ0"
FT                   /protein_id="CAC48749.1"
FT                   /translation="MTVVAPGSVVFRNICKQFGAFTAIPDLSLTIEPGTLVTLLGPSGC
FT                   GKTTTLRMLAGLEHPTSGRILIGGKDVTMLPANERDVSMVFQSYALFPHMNALDNVAYG
FT                   LESSGMRRKEARERAEEGLALVGLPGMGQRLPAELSGGQQQRVAVARALVLEPQVLLLD
FT                   EPLSNLDARLRRRVRTEIRELQQRLGFTAVYVTHDQDEALAVSDRIIVMKDGNIAQEGP
FT                   PRELYETPASAFIADFMGEANVVACDVIDVDGHEATIRVERLTHRVSGRGMRPGPAKLA
FT                   VRPNAITLEPSAAGSFSGEITHTAYLGDHVEYEVKTAAGTLFVVDPAVERALAPQTNVA
FT                   IAFKERGIALING"
FT   CDS_pept        complement(374421..376649)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20364"
FT                   /old_locus_tag="SMb20364"
FT                   /product="putative iron ABC transporter permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20364"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48750"
FT                   /db_xref="GOA:Q92WI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WI9"
FT                   /protein_id="CAC48750.2"
FT                   /translation="MKTHYRRLDIALALGLAAFVLLPWYRIDGGFFGFGWLSAFPEEPV
FT                   AAPGLVQIASFGKWWLMLPALAMMVAAAARFIGDPARRGSFLAWTGAGGIVVLALQGLA
FT                   IGFSGWNWTVSEALFGALAEGQPSMGAGAVLAALVFVLIFAFGIAERGVMKGDAFVVSA
FT                   ISLLVFLVAVFVFYPVGSMLVGAFQDFDGSFNPEGFTRNIVDPSIWSLDCVVGGGRCGI
FT                   AWRTFWLAVMTAGGSTILGLAFALLATRTGFRYKRSLRLLTVLPIITPPFVVGLALTLL
FT                   FGRSGVITEALSTLIGVEPGRWLYGLTGIWIAQVLSFTPISFLVLIGVVEGVSPSMEEA
FT                   SQTLRADRWRTFWRISLPLMKPGLANAFLIGFIESMADFGNPLVLGGSHGVLSTEIFFA
FT                   VVGSQNDPSRAAVLAIILLCFTLTAFLAQRFWLSGKNFATVTGKGDSGAHAALPRTVSI
FT                   AVHVLVIPWALFTLVVYGMILVGGFVRTWGLDNSLTLAHYIKAFSVEIRDGGIAWTGVA
FT                   WNSFWTTMEIALISAPLTAAVGLLTAYLIVRQRFAGRELFEFALMMSFAIPGTVIGISY
FT                   IMAFNLPPLEITGSALILVACFVFRNMPVGVRGGVAAMSQLDRSLDEASLTLRADSFRT
FT                   IRKVILPLLRPAITAALVYSFVRAVTSISAVIFLVSAEYNMATAYIVGLVENGEYGVAI
FT                   AYSSMLIVVMISVIAGFQLVVGERRLRRENRVQAVARAPVPLPQEKTA"
FT   CDS_pept        complement(376824..377852)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20365"
FT                   /old_locus_tag="SMb20365"
FT                   /product="putative ABC transporter iron-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20365"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48751"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WI8"
FT                   /protein_id="CAC48751.1"
FT                   /translation="MGLVKLAAAALAAGATFFAFSARADGNLNLICSADVVICEQMEGA
FT                   FEKKTGISVNMVRLSSGETYAKIRAEARNPKTDIWWAGTGDPHLQAASEGLTLEYKSPM
FT                   LGELHEWAVKQAESAGYRTVGVYAGALGWGYNTEIFKQKNLKEPKCWADLLDPSFKGEV
FT                   QIANPNSSGTAYTALATLVQIMGEAEAFDYLKKLNANVSQYTKSGSAPVKAAARGETAI
FT                   GIVFMHDAVAQTVEGFPVKSVAPCEGTGYEIGSMSIIKGTKNLDNAKKWYDWALSADVQ
FT                   SSMKEAKSFQLPSNKTAKVPEEAPKFEDIKLIDYDFKTYGDPAKRKELLERWDREIGAA
FT                   AN"
FT   CDS_pept        378030..379034
FT                   /transl_table=11
FT                   /locus_tag="SM_b20366"
FT                   /old_locus_tag="SMb20366"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20366"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48752"
FT                   /db_xref="GOA:Q92WI7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WI7"
FT                   /protein_id="CAC48752.1"
FT                   /translation="MPQKPFVSAQEVAERAGVSRSAVSRTFTPGASVSPETRRRVVEAA
FT                   EALGYHVNHLARGLMRNESGIVCLIVSEMSTPYRANLIRAMTQQLQNAGKVAMLINTDR
FT                   SDDSVDLALRQAIRYRADASIILSGMPDRSITQLCLKNGQRLVLINRDDDQQGPLRINL
FT                   DDAEAAGRVVTAFVRAGCRRLAFANSQAGTPSLMAREHGFVATARAMGLPVLVERHGPT
FT                   NYESGRVLAQRLLTLGERPDAVFCATDLLACGFMDAARHQFRVSIPDLLCVAGFDDIEQ
FT                   AAWSSYDLTTFAQPVDRIAQEAVAWLVNERQEPVDHSVRFQPDLVWRSSIRGG"
FT   CDS_pept        complement(379530..380222)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20367"
FT                   /old_locus_tag="SMb20367"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20367"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48753"
FT                   /db_xref="GOA:Q92WI6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WI6"
FT                   /protein_id="CAC48753.1"
FT                   /translation="MPRVKKSPDVRTNELIGCAERLFFEQGYENTTVNDVIREANVSKG
FT                   AFYHYFVSKEALLEAVAARMAHHSLKELQTVFEDPSLDAVGQLNALFAGSRRLKVEMAP
FT                   QLKNTFNALFKPENIVLYHRIDAAVSAVTLPFLTELLRRGHKEGSLDAPDPEALAPMLL
FT                   YLRLGVAKTMHRALQQTEAGDLDGAARTLDGWMRTYGMAVERLLKIPEGTIEVTEPGFS
FT                   RAFLEASV"
FT   CDS_pept        380366..381379
FT                   /transl_table=11
FT                   /locus_tag="SM_b20368"
FT                   /old_locus_tag="SMb20368"
FT                   /product="putative efflux transporter"
FT                   /function="Membrane-fusion protein"
FT                   /note="putative efflux membrane protein,, RND family, MFP
FT                   subunit"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20368"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48754"
FT                   /db_xref="GOA:Q92WI5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WI5"
FT                   /protein_id="CAC48754.1"
FT                   /translation="MQQMRRYAAGIAIAAAVGAVAFWYATRAVPVSIVTPKRGDAAEIV
FT                   YASGVVEPRVWAKVTSTVRERIVEQCNCEGERVEKGAVLARLDDTEARAILSELQARLS
FT                   LAQEEYRRKLALAERNTISEQTVDRARTDVAQLEALIAGQEARLAAYVLRAPSDGRVLR
FT                   QDGEIGEVAEPGTVLFWVGEPRPLIVEAEVNEEDIPRVEVGQNAYLRSDAFPERALEAV
FT                   VDSITPKGDPVTKTYRVRLRLPEDTPLRIGMSTDVNVVVRLSRNALVIPAAAVSGTRVA
FT                   VVEGGTAKLREIETGIRGTDGVEVLSGLEETARIISPLSPDFADGTRVDVVQTATN"
FT   CDS_pept        381385..382626
FT                   /transl_table=11
FT                   /locus_tag="SM_b20369"
FT                   /old_locus_tag="SMb20369"
FT                   /product="putative ABC transporter"
FT                   /function="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /note="putative inner-membrane ABC transporter, permease
FT                   component,, involved in lipoprotein release, LolC/E family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20369"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48755"
FT                   /db_xref="GOA:Q92WI4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WI4"
FT                   /protein_id="CAC48755.1"
FT                   /translation="MRLIFDIALTHVAGRGRQTLVAVIGVAVGVGFSIAMAALMQGGQD
FT                   DFVRQLVDTMPHVDVTDEQRSARRQPAEDLFEAVAISGLRPRDDRRGIINPTKAASWLE
FT                   EWMPGRLAAVLNVQGVIRYSGREVGAVVIGIEPEKEVKVSHIVEDFESGSFAALAAGGN
FT                   NVVIGDTMASRLGAGLGDTITAVSSEGLARNFKIVGLFHTGTTARDEGEAYVLLKNAQI
FT                   LSNRPNAINEIRIKLDDPNAAPTIARRVEAELGYKTVAWQEANESILEALVVRNVIMYT
FT                   VVAAIMLVAGFGIFNIVSTITHEKARDIAIMKSLGFSQADMRRLFVMEGLAIGIAGSLL
FT                   GWALGFAITYALSRVRFEIAATGQEMTRLPIAWSILHYAVATAFALSSAAVAGYLPARR
FT                   AARVNPVDIIRGAT"
FT   CDS_pept        382623..383303
FT                   /transl_table=11
FT                   /locus_tag="SM_b20370"
FT                   /old_locus_tag="SMb20370"
FT                   /product="putative ATP-binding transport protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20370"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48756"
FT                   /db_xref="GOA:Q92WI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WI3"
FT                   /protein_id="CAC48756.1"
FT                   /translation="MSPLIEARGLTRILHETVPVTLVKDIDLIIEEGEFVAVTGPSGSG
FT                   KSSLLYLLGLLDRPTEGRLRVRGRDTEPMSEKERAETRLATMGFVFQFHFLLPEFTARE
FT                   NVEIPMRKLARLGRDEMRGRATDLLSSLGLADHLDKRPDQLSGGQRQRVAVARALANDP
FT                   PLILADEPTGSLDSRSSEQVFAILDGLVRERGKTVVAVTHDLDMAARMDRRIHLVDGEV
FT                   SKEE"
FT   CDS_pept        complement(383348..383794)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20371"
FT                   /old_locus_tag="SMb20371"
FT                   /product="putative ribose-5-phosphate isomerase"
FT                   /function="Ribose 5-phosphate isomerase RpiB"
FT                   /EC_number="5.3.1.6"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20371"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48757"
FT                   /db_xref="GOA:Q92WI2"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WI2"
FT                   /protein_id="CAC48757.1"
FT                   /translation="MRIVIGSDHAGFHLKATIIDHVTSLGHEVYDAGSYDANPVDFPDI
FT                   AKMVTSSIIEGKADRGLMVCGTGVGASIAANKVKGIRAAVCHDVHSAHQSVEHDDVNVM
FT                   CIGAQIVGAWLARDLVAAYLAAEFSTDEDFRRRVRKLAEMDEQR"
FT   CDS_pept        complement(383818..385095)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20372"
FT                   /old_locus_tag="SMb20372"
FT                   /product="putative protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20372"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48758"
FT                   /db_xref="GOA:Q92WI1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WI1"
FT                   /protein_id="CAC48758.1"
FT                   /translation="MGFLVVAAFLGLFMLGFPVVYAILLPSILYVLVEGLPFGLLAQRI
FT                   TYALDSFPLVAVPLFIFVGNLMNLSGITDRIFRFAYTLVGRMPGGLAQVNVFGSLIFSG
FT                   MSGAALADIGGLGRIEIDAMKKRGFDPSFAGAVTAASATLGPIFPPSIPLIVYGSVTSV
FT                   SIVQLLVAGIMPAVLCTALLMLTVLIVAIRHGHARAERWPTAGELVGTLVPALPAILAP
FT                   ALMVGGMTAGAFTPTEAAAITAVYVIFISGVLYRELTPAHLWHSAVLTARSSSAILIIV
FT                   ASAALFGWILAVEQVPQTFAAALLGWSKDPLMLLIIANLIFFVAGMFLDSTTATLLLVP
FT                   IIAPPLVMAGVDPVQLGIVTIFNLMLGLLTPPMGLSLFLVSDIAKVSIRQLLRALVPFY
FT                   IPLVSTLVILTLAKDFTLWLPRLIAQ"
FT   CDS_pept        complement(385107..385574)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20373"
FT                   /old_locus_tag="SMb20373"
FT                   /product="putative TRAP dicarboxylate transporter"
FT                   /function="TRAP-type C4-dicarboxylate transport
FT                   system,small permease component"
FT                   /note="Hypothetical protein"
FT                   /note="TRAP-type C4-dicarboxylate transport
FT                   system,,permease small protein, DctQ subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20373"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48759"
FT                   /db_xref="GOA:Q92WI0"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WI0"
FT                   /protein_id="CAC48759.1"
FT                   /translation="MRLPERVLTIVVVAVMAGLVIVPTAQVIMRSVFGLPFIGAEELTR
FT                   FLLICLVFLAYPLVVGHGENIVMGEFKAAMSRKARAIVNVAISICAIGVTGFIGWVTAM
FT                   NITRNLTNATPTLGIPFWIFLGATLFGFAGAALVHLLHLRKPPQADKNVAV"
FT   CDS_pept        complement(385654..386646)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20374"
FT                   /old_locus_tag="SMb20374"
FT                   /product="putative periplasmic substrate-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20374"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48760"
FT                   /db_xref="GOA:Q92WH9"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WH9"
FT                   /protein_id="CAC48760.1"
FT                   /translation="MLNFLKHGRVAGAMLGAALLAGAASATELRYAHVGAEGDIQTVYA
FT                   AQAAEGIAAATGGEVTVTVYPASQLGGVAEMVDGVRMGSISMGHHDFASLARLVPEVAV
FT                   FNAPFIYRDGAHALAATDPQSSPALQAINEKLIAQGVRIVGRIYRGDRHISSNFPVKTP
FT                   ADLAGKPFRAVPLELWVSMVKGFGAIPTPVEVAELPTALMTGVVVGQENPLTRIASNNL
FT                   NEVQSHLSMTGHMRAVLAVFINEEVWQGLSEEQRTALTKVLDEEAQKSLKMATESEADL
FT                   VKELKGRGMTVITEAEGLDVAAFREKVGAQIGQDFPNFAPLIEQIEAVK"
FT   CDS_pept        complement(386667..387437)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20375"
FT                   /old_locus_tag="SMb20375"
FT                   /product="putative transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="putative HTH gntR-type regulator family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20375"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48761"
FT                   /db_xref="GOA:Q92WH8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WH8"
FT                   /protein_id="CAC48761.1"
FT                   /translation="MNPVLSDSADELAGTEKVLSFFREQLLSGALKVGDRLLGERELCL
FT                   ALGVSRPVLREALRSLANLGFLDIRHGKGAFVRKADVGVFGDFLTFCLAQQPDMLDDIM
FT                   QARVAIECQAIRLACIRATDSDLSRIGGLLTRLMDTLHNAEDGGAADFAFHMAIVEASR
FT                   SPALVTVYRSISDLLKRSHVQRRAETSDAPGITDYLVEAHREVFLSILARDPDKADRML
FT                   REHFAIGDELRRKSYIAAFTRKGAPQEEEKEADS"
FT   CDS_pept        complement(387641..388021)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20376"
FT                   /old_locus_tag="SMb20376"
FT                   /product="hypothetical protein"
FT                   /function="Putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /note="hypothetical protein,, putative translation
FT                   initiation inhibitor"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20376"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48762"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WH7"
FT                   /protein_id="CAC48762.1"
FT                   /translation="MFEKIETGIAATRAPLSGTVKVGRIVRSAHIAKTPETGELVTGDI
FT                   ECQARQVFSNLRQALEAAGSTLAAVVQIQVYLIDRADAPGMNKIYREFFAPPFPVRATV
FT                   VTELLSPGIRLEILATAVCSLD"
FT   CDS_pept        complement(388065..388448)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20377"
FT                   /old_locus_tag="SMb20377"
FT                   /product="putative translation initiation inhibitor
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20377"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48763"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WH6"
FT                   /protein_id="CAC48763.1"
FT                   /translation="MFEVIDTGADPSDVPVSEAVHAGGLFWSVHVSEDPVTGEPVFGDI
FT                   ETQARRTLQNLEIAIKAAGGSLANVVQMQVFLTERADAPGMNRIYTEFFREPYPVRATV
FT                   VVKELITPGLRIEVLAHAVLEGA"
FT   CDS_pept        complement(388482..389945)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20378"
FT                   /old_locus_tag="SMb20378"
FT                   /product="succinate-semialdehyde dehydrogenase [NAD(P)+]"
FT                   /function="succinate semialdehyde + NAD(P)+ + H2O =
FT                   succinate + NAD(P)H + H+"
FT                   /EC_number="1.2.1.16"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20378"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48764"
FT                   /db_xref="GOA:Q92WH5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WH5"
FT                   /protein_id="CAC48764.1"
FT                   /translation="MNPETTAVPYERLGILIDGRWIYEAERSTEVVDPATGQTIARLPF
FT                   AADGEIAEAVASSQRAFESWKDRSPLERGRILRRFADLARKHADEIARNMTRDQGKPLS
FT                   EAIGEIRFAADHADWHAEEARRIYGRVIPARDPRVQQMVLREPVGVCIAFTPWNFPFSQ
FT                   ALRKVVAALASGCTIILKGPGESPSSTVAIGRLMQEAGLPDGCLNILWGDPAHLSETLL
FT                   AAPEVRKISFTGSVEVGKHLASLAGRHMKRSTMELGGHAPVILFDDADIEAAADALAGQ
FT                   KVRNAGQVCISPTRFYVQAKGHDRFLARFAEKIASTRVGNGFQESVQMGPLCHGRRVAA
FT                   MEGFIQDAREQGAEIVTGGERVGNAGFFYAPTVVAAGTDELRLMKEEPFGPIAVVTPFG
FT                   DFDEVIRRANSLPFGLASYVFTGSSSRAQNAARALAAGMVSVNHFGLALPETPFGGIND
FT                   SGYGSEGGSETFDGYLNTKFVTRFDQIPQ"
FT   CDS_pept        complement(389955..391340)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20379"
FT                   /old_locus_tag="SMb20379"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoatetransami
FT                   nase"
FT                   /function="S-adenosyl-L-methionine + 8-amino-7-oxononanoate
FT                   = S-adenosyl-4-methylthio-2-oxobutanoate +
FT                   7,8-diaminononanoate"
FT                   /EC_number="2.6.1.62"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20379"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48765"
FT                   /db_xref="GOA:Q92WH4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WH4"
FT                   /protein_id="CAC48765.1"
FT                   /translation="MNDRPNSLHALDKQSLVHPYTNLAVHQETGPHVITGGDGIYVVDD
FT                   EGKRYIEGLAGLFCAGLGFSEQRLVEAATRQLKTMPFYHSFAHKSTEPGIRLAEKLLSI
FT                   APVPMSKVFFAGSGSEANDTAIKLIWYYNNALGRPEKKKIISRRKAYHGVTVATASLTG
FT                   LPFNHRDFDLPIANILHTDCPHYWRFAETGETEEDFATRMANNLEAIILEEGPETIAAF
FT                   FAEPVMVSGGVITPPKTYFEKVQAVLRKYDILLIADEVICGFGRTGNMFGSETYGLKPD
FT                   MISCAKQLSAAYMPISALMINAKIADALVDQSRKIGTFSHGFTYGGHPVAAAVALEALT
FT                   IYEEIDIVGHVRSVAPAFQDRVRKLGEHPLIGEARGVGLVAGLEFVKDKATRENFPPAW
FT                   QVANQAGKFATARGVLTRGLGDMVSLCPAMIIDDEQIDDLMTRMGLALDDTLAWARAQG
FT                   HVG"
FT   CDS_pept        complement(391371..392420)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20380"
FT                   /old_locus_tag="SMb20380"
FT                   /product="polyamine-transporting ATPase"
FT                   /function="ATP + H2O + polyamineout = ADP + phosphate +
FT                   polyaminein''"
FT                   /EC_number="3.6.3.31"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20380"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48766"
FT                   /db_xref="GOA:Q92WH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WH3"
FT                   /protein_id="CAC48766.1"
FT                   /translation="MIARSLTLRNITKTYDGRHMAADDVSLDIKAGEFVSFLGPSGSGK
FT                   TTTLMMIAGFQHPTSGEIRLGERAIDNLPPHKRNIGMVFQNYALFPHMTVADNVGFPLR
FT                   MRGVAKQDKERRCREALAKVGLQGFEGRVPAELSGGQQQRVALARALVFEPDIILLDEP
FT                   LGALDKALREHMQVELKRIHKDLGVTMVYVTHDQSEAMTMSDRIAVFNQGRIEQVGTPN
FT                   EIYRAPKTRFVASFIGDSNLIEGSSLGNGRFDTPVGIVEARSRQADRNRRADLLLRPEM
FT                   IRIAETSQDGRQTLKIDSTINYGDNLLVIGKLGTQPIRMRVPGADARRLEGISECHVTW
FT                   RAEDVHVIA"
FT   CDS_pept        complement(392436..393266)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20381"
FT                   /old_locus_tag="SMb20381"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20381"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48767"
FT                   /db_xref="GOA:Q92WH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WH2"
FT                   /protein_id="CAC48767.1"
FT                   /translation="MSVWIRSLAILIAAFVAAPMFIVIPMSFSSAASLAFPPPGYTLQN
FT                   YVNFFSDPNWTQPLTNSLLIGFGTVCVTMLVAVPASFALVRHVFIGRTVFNLLIMLPMI
FT                   VPTIVMALGYYIYFGQLRLVQSYLGVILAHSCIALPMSTLILTAALKGFDRSVERAAMN
FT                   LGASPFATFRLITFPILRPAFTVAGLFAFIASFDEAVIALFISGRDKATLPRQMFNAVR
FT                   QEADPTISAASSFLFLLVLAGVCIWLAPQLVRRRTRPLGQTDGNGAAEPAAAAS"
FT   CDS_pept        complement(393263..394114)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20382"
FT                   /old_locus_tag="SMb20382"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20382"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48768"
FT                   /db_xref="GOA:Q92WH1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WH1"
FT                   /protein_id="CAC48768.1"
FT                   /translation="MKHRTSPVLVEGPMPLMAPAVIFLALFFLVPLGYVIWMSLSQPVI
FT                   GLQNFGRLLNSSLFASVLYNTFKTALLVTLLSLLFAYPLAYAAANGSKRFATFLLTVVA
FT                   LSFWTSYLVRTYAWMVILGNQGPVTALLSWFGWDPTPKILFTTFSATLAMTHALIPFMT
FT                   MSLFAVMKRIDPLYVRAAENLGAHPFRAFVSVYLPLSAPGIVNGCTLVFITCLGFYVMP
FT                   VLLGSPRDQMIAGIIGDQIEQTLDFGLGSAISIVLLALTLAVYGLYNRFFGLDRLWAGG
FT                   DR"
FT   CDS_pept        complement(394240..395313)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20383"
FT                   /old_locus_tag="SMb20383"
FT                   /product="putative ABC transporter"
FT                   /function="Spermidine/putrescine-binding periplasmic
FT                   protein"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative putrescine-binding periplasmic
FT                   protein,,extracellular/periplasmic substrate-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20383"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48769"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WH0"
FT                   /protein_id="CAC48769.1"
FT                   /translation="MEMFKKASATPLSRRKVLGAGLFGAAMLASPYIRRASAEENVLYV
FT                   NTWGGDWEASVKKFLFGPFTKDTGIEIRTVSPISFAKLAAQKTTGVYEFDVTTLGVADV
FT                   ARANGAGLLETLEGHVDTSKLWEGAIYQNGLATHGFATQMAYNAAKFPEGLKNWSDFFN
FT                   VEKFPGNRSLQRHAARVLAIALLADGVPADQLFPYDLDRAFASLDRIKDHVRVWWTAGP
FT                   QARQILTDGEVDMAGLWDSDAFGAKEASKDPIEIVWDQAVVDKACWIVAKDSPRAENGF
FT                   KLISHIGQNAEGLAKFCIADQNGPMNPKSFDFIPAEVAARMPTHPEHLARAVMLDGAKL
FT                   LPQLDELSTRFESWVGI"
FT   CDS_pept        complement(395419..396390)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20384"
FT                   /old_locus_tag="SMb20384"
FT                   /product="membrane dipeptidase"
FT                   /function="Hydrolysis of dipeptides"
FT                   /EC_number="3.4.13.19"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20384"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48770"
FT                   /db_xref="GOA:Q92WG9"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WG9"
FT                   /protein_id="CAC48770.1"
FT                   /translation="MIIDALQCGHFNRESFEALRRGGYSAVTPTLGFWEGTMESLDSLA
FT                   RWRDMERDNADLILIARTAADIERAEREGKLAVVLGYQNSNLFEDRIAFVEFFAELGVR
FT                   VVQLTYNNQNELGGSCYEENDSGLARFGRDVVREMNRVGMLVDLSHVGDRTTLDAIEWS
FT                   EKPVAITHANAASLFAHKRNKSDKVIKALAERGGVIGCVAYRNITPDAACATVDGWCEM
FT                   VARTVDIAGIDHVGIGTDISHNHTPRDYDWMRKGRWTRSVQYGAGSPQRPGAVAKPEWL
FT                   LKPESLQDVAPALLRVGFNQEEANKILRGNWLRLYAEVFRPN"
FT   CDS_pept        complement(396404..397132)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20385"
FT                   /old_locus_tag="SMb20385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20385"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48771"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WG8"
FT                   /protein_id="CAC48771.1"
FT                   /translation="MSSCQSNLPSNLTVSLRELRMVFERLIQVTRLDAGLVPSLRDCAL
FT                   YSAALGLGGFARLAHNLEAVRSANPHALRLTADAERLIVDCGGQHAWIAADAVLDLAAE
FT                   RLRTQGSGRVEVRSATEIGELRVVEALAQRFRLQAEVAIDETAGSAEIVVSPARKGMDV
FT                   TVLERIRRNGLTVDAALWWQLFHRSAEALAPDSYVSRRHAGPIIVEADGKVIGRQDEDE
FT                   TDLSLLIAGAAQHGTTAINN"
FT   CDS_pept        complement(397129..398865)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20386"
FT                   /old_locus_tag="SMb20386"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20386"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48772"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WG7"
FT                   /protein_id="CAC48772.1"
FT                   /translation="MSALKKPAPESEAHRIARLMRSPAEIMKPERLAAIQPSRISASRA
FT                   LMSRAVRQRWQILCKRFDIDAKGNGVAEYRIDIGGWRFSFPVYSFEPSPHGRTGRIIGR
FT                   AWDMMGALVEGDMSERDFETTRAELPKLYEGRATPATLIWCRSNRSGRFFEGAKAALQA
FT                   GRQPNVGELAQTCYLMRNTGLDGNGTFGTKSFLAYEADHPLRWSLAAQMLCAYMMRVFA
FT                   QDLLAHLVRLEAPAAPQMAIELRRFLGVGNGSALGLMLFVNNHPRLIERWLFIREEAIA
FT                   RAKALTPDEAGSEIAKLLSLVDKAITFRSEDRVQYENVTRSDVVARELGVIRDAVANLL
FT                   ARWQSGSRFESEPFAELAASLECRVHAEAIETLHSLLIELVAEEADQLVEGLVIDEELT
FT                   GRPEMPVARLREILRNDYAWAFGLDLDIESAKRYVWYKSVSAEEPRRGPAAEVGDNVVN
FT                   LGLDLPRLVVALDRDLAAADPTLSTARFLLAHPEHRAIATRVQALAGTGLHSPHADIMS
FT                   AAFTPAHITRLLNVGIHGIDKTRDFLDRNLRGVLFHGAPVPEDIAAGSADDLWFYPSEP
FT                   SL"
FT   CDS_pept        complement(398867..399586)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20387"
FT                   /old_locus_tag="SMb20387"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20387"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48773"
FT                   /db_xref="GOA:Q92WG6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WG6"
FT                   /protein_id="CAC48773.1"
FT                   /translation="MSVRPLSSVLKTLAAFDCIAAAPEPLRLVDIARQLGEARGAAHQR
FT                   LVTLVEAGWIEQTPDGRYRLTLRIVGHAAMALEQSNLGVRFAGVLEEMVTESGETASLA
FT                   VLDGKSAVIVRRVESRGVLRADLRIGTQLRLDRTAFGRVLVSFSRPEIVDRLRAQGVEL
FT                   PDDETITGVRKCGYAISEVEGPRTVSAVAAPIIDAQGECIGALALSGPFTGFDTDKCAR
FT                   IVVAAAAASAARLRGEQ"
FT   CDS_pept        complement(399980..400960)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20388"
FT                   /old_locus_tag="SMb20388"
FT                   /product="putative NADPH:quinone oxidoreductase protein"
FT                   /EC_number="1.6.5.5"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20388"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48774"
FT                   /db_xref="GOA:Q92WG5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WG5"
FT                   /protein_id="CAC48774.1"
FT                   /translation="MRAAWYGKNGAARDVLEVGGLPDPLPGPGEVRVRIHASGVNPSDV
FT                   KARAGRPLIAPRMIPHSDGAGIIDAVGTGVAGERIGERVWTWNAAWRRSNGTAAEYVVL
FT                   PQDQAVHLPDNVSFEEGACLGIPALTALRAVTTDGGVFGKTVLVTGGAGAVGAYAIQFA
FT                   RLYGAACIITTVSSSEKAEICTRLGADHTINYRTEEVVDRIGGITHGRGVDRVIEVDAA
FT                   TNVAMLPGIIARDGLCVIYGSSKPVVSFEFFPMILAGAAARFFIVYEMSPEARTETVSA
FT                   LQGQLASGLLRHHIAGTYALDDIAAAHEAVESGKTIGNVVVSLGQ"
FT   CDS_pept        complement(400975..402000)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20389"
FT                   /old_locus_tag="SMb20389"
FT                   /product="Diguanylate cyclase"
FT                   /function="FOG: GGDEF domain"
FT                   /note="GGDEF: diguanylate cyclase (GGDEF) domain"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20389"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48775"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WG4"
FT                   /protein_id="CAC48775.1"
FT                   /translation="MGQAVRIPTNERQRLLAVRSLNSIGSAPTPELATLAELAKGIFDV
FT                   SYAAINIIDEDWQRIAGQAGLRIGECSREMSICTRVVFADELLIVPDLAEDRELKTRPY
FT                   VVGSPHFRFYAGTPVYLENLPVGSFCILDVRPRHLSDGQAQNLRRFAAVASALLSLQKA
FT                   NLVMGLAHNQLQNAAITDPLTGLFNRSALSSIVDGALHNAIAAGQTFGALYLDMDGFKA
FT                   INDELGHHAGDEVLYEAANRIRSVIRAGDIAIRMGGDEFAVFIPNPPNAPALAAVSQRL
FT                   VAAFREPFQVDGKAVLARISIGGALAPLNGQRRAELLNSCDKALCSAKRDGRDRFVILD
FT                   A"
FT   repeat_region   complement(402121..402165)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   repeat_region   complement(402183..402232)
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        402436..403668
FT                   /transl_table=11
FT                   /locus_tag="SM_b20390"
FT                   /old_locus_tag="SMb20390"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20390"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48776"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WG3"
FT                   /protein_id="CAC48776.1"
FT                   /translation="MILNHRLTRITVGILLLALAIAVLLPGLTGYSSLDGTVNARLAVI
FT                   NAPIDGEIEKPAPRIGTPVAEGETLATIRNQRVNRAILASLRTDHRTAVERVAALRRER
FT                   DELARLRDDLAGRLDIFRNATIASLEREVQILQKRVEVSRAQDVVARVDLVRRQDLESK
FT                   GIFTRKMVEAAQAAGAAAGGELEISNLTVELLQQRLNAVRQGIFLVGDGQNDVPYSRQR
FT                   QDEVIVRIHDLNTRIAENEARAKQTDQQIAEEERRVLSLEAATIPSPFDGVVWSRNVIS
FT                   GSNVVLNNEMMRILDCRELFVDILVPEVDYDEIYPGREAEVRLFGRGDVFRGRVQAVKG
FT                   SSAVVEKDSLAANEPETEERNARIRVTLAPSALNTDFANFCQVGRTAQVRFSKRSLHLA
FT                   QWVQSLWFSLF"
FT   CDS_pept        403650..405644
FT                   /transl_table=11
FT                   /locus_tag="SM_b20391"
FT                   /old_locus_tag="SMb20391"
FT                   /product="cellulose synthase (UDP-forming)"
FT                   /function="UDP-glucose + (1,4-beta-D-glucosyl)n = UDP +
FT                   (1,4-beta-D-glucosyl)n+1"
FT                   /EC_number="2.4.1.12"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20391"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48777"
FT                   /db_xref="GOA:Q92WG2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WG2"
FT                   /protein_id="CAC48777.1"
FT                   /translation="MVQSLLALAPTLIVIAFFLLGPFNWSRHRSWSRAVTCAFVAAIAL
FT                   RYMLWRFTETVLPYPNDGPNFYWVWFVFIVEFLAFSEVVLFLILMSRYVDRSAEGNRLE
FT                   RQFFERDERELPTVDVFIPTYNEPLDVLERTIVGALALDHPKDKLNVYVLDDGRRDWLR
FT                   TFCEGRGAIHVTRSDNAHAKAGNMNNGLRVSSGDFIAVFDADFVPYRSFLRRTLPFFMD
FT                   DTIGIVQTPQHFFNVDPIQSNLGLENLWPDEQRLFFDEIAPSRDGWDVSFCCGSCSIAR
FT                   RKAVDAIGGFPTESITEDLLTTLSMLNRGFKTRYLNERLSMGLAAENLTGYFVQRERWC
FT                   QGGIQTLYLHNGPLRGPGLSLFQRVMFLPMSWLVQYLVRFIVLLIPIVYLWFGALPLYF
FT                   TDVADYVSNQVPLLAAYFLLMFWLTPTRYLPLVSTAVGTFSTFRMLPTVLSSLVRPFGK
FT                   PFKVTPKGSSNEANVFDAYTFTWIAGFIVVTALGLLINIVPETARVEGSFSAIAALWSG
FT                   INIVVLIIASLICFEKPRRLLQAFKLDEPVDVDGVEGRLVSLSLDKAVVAVSTETRFKS
FT                   TKVRLNIEGFAPLEADLKQVTQRRGDITRTGDKQRYYLHLHYDLRGVERDKMIIKLYTG
FT                   RYSRDVPDIDKIAVSVNLLLRAFGRTRTA"
FT   CDS_pept        complement(405680..406387)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20392"
FT                   /old_locus_tag="SMb20392"
FT                   /product="putative transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="putative HTH gntR-type regulator family,, putative
FT                   FADA-type, FCD domain"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20392"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48778"
FT                   /db_xref="GOA:Q92WG1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WG1"
FT                   /protein_id="CAC48778.1"
FT                   /translation="MQSEPIIRRKLSDEVFARLKALIETGELQPGDEMPSERMLMERFQ
FT                   VGRPAIREAMQALANMGLIEISHGERAKVLQPTARSLLRQVDAAAKIMLAASSDSLEHL
FT                   KSARIFFERGMAREAASRADAGDIAALEETLKRQQAALEDSDAFIAADMAFHTRIAQIS
FT                   GNPIYTAVSEAMLGWLKEYHTEMLIWTGRENVTLTEHEEIIDCIRSGNPDEAEQAMIRH
FT                   LERSRTLYAPKGR"
FT   CDS_pept        406532..407788
FT                   /transl_table=11
FT                   /gene="rbcL"
FT                   /locus_tag="SM_b20393"
FT                   /old_locus_tag="SMb20393"
FT                   /product="putative ribulose bisphosphate
FT                   carboxylaseoxygenase, large subunit protein"
FT                   /EC_number="4.1.1.39"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20393"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48779"
FT                   /db_xref="GOA:Q92WG0"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WG0"
FT                   /protein_id="CAC48779.1"
FT                   /translation="MLRITYRIETPGDVEFLAKKIASDQSTGTFVPVPGETEELKARVA
FT                   ARVLAIRHLEPADRASWPDEAGSATRFNRADAEIAFPLDAVGTDLSALMTIAIGGVYSI
FT                   KGMTGIRIVDMKLPPEFAAAHPGPQFGVVGSRRLTGVEGRPIIGTIVKPALGLRPEETA
FT                   VLVGELLSSGVDFIKDDEKLMSPAYSPLSARIAAIMPRILDHEQKTGKKVMYAFGISHT
FT                   DPDEMMRNHDLVVAAGGNAAVVNINSVGMGGVAFLRKRSGLVLHAHRNGWDILTRHGGL
FT                   GMEFSVWQQFWRLLGVDQFQINGIRVKYWEPDESFVKSFEAVSTPLFTKDDCPLPVVGS
FT                   GQWGGQAPETYARTGHTTDLLYLCGGGIVSHPGGPGAGVRAVRQAWEAAVAGIPLADYA
FT                   RDHPELAQSLEKFADGKGA"
FT   CDS_pept        407812..409140
FT                   /transl_table=11
FT                   /locus_tag="SM_b20394"
FT                   /old_locus_tag="SMb20394"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20394"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48780"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WF9"
FT                   /protein_id="CAC48780.1"
FT                   /translation="MHIPLLSYYGDDLTGSTDVMEALSSQGVETALFLKVPEPSLFERF
FT                   ARCRAFGLAGTSRSQTPGWMAENLPPAFLWLKALKAEIAHYKVCSTFDSSPGVGNIGKA
FT                   IEIGRDVFGAAPVPLVIGAPQIRRYTAFGNLFAAFRGETYRIDRHPVMSRHPVTPMNEA
FT                   DIRLHLSRQTSLSAALVDLVQLASPDVDAFADRALADHQLVLLDVADEGSQAVVGRQLW
FT                   RTRTAEGQFVCGSSGIEYALVREWRRLGLIGEAPAFAPPGPVDRIAVVSGSVSPTTERQ
FT                   IRHAIQNGFDGIALDAVALAATDAGSALEDAVARGLASLEKGRSVLLYTALGPSADRGD
FT                   AIPVEDGSRHRIGERLGSLLRELVTRAGLRRAVVAGGDTSSHALGQLSVDALTLRLPLP
FT                   QSPGSPLCTAHSADPRVDGMEVALKGGQVGLDDYFSMIRDGRA"
FT   CDS_pept        complement(409180..411429)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20395"
FT                   /old_locus_tag="SMb20395"
FT                   /product="putative dehydrogenase"
FT                   /EC_number="1.17.1.4"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20395"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48781"
FT                   /db_xref="GOA:Q92WF8"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WF8"
FT                   /protein_id="CAC48781.1"
FT                   /translation="MPDKAPDPLLHKHGYLGTPVSRVDGQRKVKGEARFAAEFEIENLA
FT                   YAVPVCSTIAKGRITTIDASDAERSPGVIATVTAQNAPKMKRPPLMDVRHMDKGFAASD
FT                   LAVLQDGEISWDGQPVAVVVAETLEQAEHAASLVRVEYVEKTARVSFEDLKAEATVPSA
FT                   VMGEDPELAIGNPEKAFAAAAFKVDNVYRTPHYNHNAIEPHAAIAAWDEDGRLTVFDST
FT                   QFVNGCKHALAGIFGLNAENVRVIAPFVGGGFGGKAALWNHTALCAAAAKVANCPVKMA
FT                   LSREEVFRLIGGRTPSEQRVALGADEDGKFAAIIHTGVTATTTHAKFPEQFSLTPRHLY
FT                   ASRTMSVGQKVVNLDTVANTWMRAPGESIGTFALESAIDELAYEMKIDPVELRRLNEPE
FT                   KDPTKGTEFSSRHLVEAFRRGAEKFGWSGRPAEPCSQRDGKWLIGQGVATAYYPVFRFP
FT                   AAVRLRISADGSAVVQAAANEMGMGTATVQIQHAADRLGLPLEMVSFRYGDSDLPDSPI
FT                   IAGGSSQTGSIAAAVQVAVEKAHRELVKLAGNGSPLAGANVEIEARDGGLFVSGEESRG
FT                   ETYASILKRAGRDFIEVEETSGMPFEVMKYSMASYGAQFCEARVNHESGEVRISRWLGS
FT                   FDCGRILNPKTAVSQLRGGIVMGIGMALAEETLLDTRRGRIMNPSLAEYHVPVHLDVPH
FT                   IEIIYNDIPDEHTPLGAHGVGEIGITGAAAAIANAIFHATGKRIRDLPITLDKLL"
FT   CDS_pept        complement(411473..412456)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20396"
FT                   /old_locus_tag="SMb20396"
FT                   /product="probable oxidoreductase"
FT                   /function="Aerobic-type carbon monoxide
FT                   dehydrogenase,middle subunit CoxM/CutM homologs"
FT                   /EC_number="1.17.1.4"
FT                   /note="putative xanthine dehydrogenase,, putative yagS
FT                   gene, FAD binding subunit"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20396"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48782"
FT                   /db_xref="GOA:Q92WF7"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WF7"
FT                   /protein_id="CAC48782.1"
FT                   /translation="MKSFAYARAADLEAAVKLLSKTPNAKLLGGGTNLVDLMRENIEQP
FT                   DALVDVTGLPLDRIEERPDGGLVIGATVRNTAVAGHPVVRDRYPLLAQAIVFGASGQIR
FT                   NMATVAGNLMQRTRCLYFYDHAARCNKRAPGAGCDAIGGFNRMHAILGASDSCIATHPS
FT                   DMCVALAALDAKVNVIGPSGARTIAFEEFHRLPEDTPDIETDLQPGELITGIEIPPLGF
FT                   ARRSLYRKVRDRASYAFALVSVAAALEVDSGKVRNVRLALGGVAHKPWRATEAERVLAG
FT                   ANAGAESFRQAAEAELAPARGLAHNEFKIELAKRTIVGVLGELAGG"
FT   CDS_pept        complement(412453..413019)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20397"
FT                   /old_locus_tag="SMb20397"
FT                   /product="probable oxidoreductase"
FT                   /function="Xanthine dehydrogenase, iron-sulfur cluster and
FT                   FAD-binding subunit A"
FT                   /note="putative xanthine dehydrogenase,, putative yagT
FT                   gene, iron-sulfur binding subunit,, [2Fe-2S] binding
FT                   domain"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20397"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48783"
FT                   /db_xref="GOA:Q92WF6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WF6"
FT                   /protein_id="CAC48783.1"
FT                   /translation="MPSPDRTPKAAPIPPAGSALILLKINGVDHSLSIDPRTSLLDVLR
FT                   EHLSLTGPKKGCNQGACGACTVLVDGQRVLSCLSLAVQLEGREITTIEGIASGELHRLQ
FT                   VAFIEHDGFQCGYCTPGQICSAMGMFQEFQNGLPSAVTGDMAAARIEFSDAEIKERMSG
FT                   NLCRCGAYVGICEAIHSAFDREVAK"
FT   CDS_pept        413186..413680
FT                   /transl_table=11
FT                   /locus_tag="SM_b20398"
FT                   /old_locus_tag="SMb20398"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20398"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48784"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WF5"
FT                   /protein_id="CAC48784.1"
FT                   /translation="MIYFTGDTHFGDPRVLRIDRRPFSNMAEHDAALIANWNETVSPQD
FT                   EVWHLGDFAAKRNGLAEDILSRLNGRKHLIVGNNDPNDTTGAGGWHSVQHYAELMVDGR
FT                   LLVLCHYPFRTWNQMGKKSINLHGHSHGRLKPMPRQFDVGVDARGLRPVSLVDILPQSA
FT                   R"
FT   CDS_pept        413764..414354
FT                   /transl_table=11
FT                   /locus_tag="SM_b20399"
FT                   /old_locus_tag="SMb20399"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20399"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48785"
FT                   /db_xref="GOA:Q92WF4"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WF4"
FT                   /protein_id="CAC48785.1"
FT                   /translation="MQGDLFGNPPGNLPEGFRYQAGIVPRKLQEALLEALPELPFKPFD
FT                   FHGYEGKRRVVSFGWKYDFDTETVRRIDAIPPLLLPLRQLAADFAGLPAEGLQQALVTE
FT                   YDVGAPIGWHRDKAVFGDVVGISLLTSCTFRLRRKRAGRWERTSVILEPGSAYLLSGAA
FT                   RSEWEHSIPPVERLRYSVTFRELRSGIGAGGRA"
FT   CDS_pept        complement(414364..414627)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20400"
FT                   /old_locus_tag="SMb20400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20400"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48786"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WF3"
FT                   /protein_id="CAC48786.1"
FT                   /translation="MPVYQRLPVRPVPGAMVVKLYHSGDAVRGYVRKVTDPSEDDVIFP
FT                   GEEMEAESAFRLAASHSEGSIPIYVELVEDVEWDPSWGTLTG"
FT   CDS_pept        complement(414654..414827)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20401"
FT                   /old_locus_tag="SMb20401"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20401"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48787"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WF2"
FT                   /protein_id="CAC48787.1"
FT                   /translation="MTKINVEQAQKDARKQAENTSGGGHLGGTYYGQEPDAKTATTVKK
FT                   KGDKARPNDGRN"
FT   CDS_pept        414971..416359
FT                   /transl_table=11
FT                   /locus_tag="SM_b20402"
FT                   /old_locus_tag="SMb20402"
FT                   /product="putative alcohol dehydrogenase cytochrome c
FT                   subunit precursor protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20402"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48788"
FT                   /db_xref="GOA:Q926H9"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q926H9"
FT                   /protein_id="CAC48788.1"
FT                   /translation="MRALRVAIGIAAVILVAAAAFFLFAWRSEIPEDTTAAEARFAAEL
FT                   VAKGAQLAALGNCIACHTVPGRPAFAGGLALPTPFGTIYSTNITPDRETGIGGWSEAAF
FT                   ERAMREGVDREGSHLYPAFPYEHFTRVSADDNRALYAFLMTRVAVKAEALENDLPFPLK
FT                   FRPLLAGWKLLFLDSGEREPDPGQSDAWNRGRYLAEGLGHCGACHTPRNPFGAEDRDRH
FT                   FGGGEAEGWQAYAINTESKAPIPWDEQSLAFYLRNGWHEFHGVSRGPMAEVTGNLAFLP
FT                   DSDIAAIATYVRSIMGAPTPEREQRAAQLREAFEGQRPEQAADSQRSPVSASGSQPGEA
FT                   IYLAACASCHEGGRRQPFGGLNFELSTAVNAPNPQNIVNVVLFGLPPADGEASAVMPAF
FT                   RHLLNDQQVADLLAYMRERFSEEPPWAGLVEQTARTRSGTYKVAVRPSDGIERAPHHVG
FT                   AEED"
FT   CDS_pept        416362..416859
FT                   /transl_table=11
FT                   /locus_tag="SM_b20403"
FT                   /old_locus_tag="SMb20403"
FT                   /product="putative oxidoreductase subunit protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20403"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48789"
FT                   /db_xref="GOA:Q92WF1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WF1"
FT                   /protein_id="CAC48789.1"
FT                   /translation="MISLTVNGSPHQIDADPATPLLYVLRDELALNGAKYGCGLGQCGS
FT                   CTVVVDGEAVLSCMVPIMLLEGREITTIEGLGTIDEPGPLQEAFIELQAAQCGYCIPGM
FT                   MMSAHALLRRNAQPSEEEIREALATNLCRCGTHMRILAAIRRAGELMRAASLPATDQGR
FT                   AG"
FT   CDS_pept        416859..419099
FT                   /transl_table=11
FT                   /locus_tag="SM_b20404"
FT                   /old_locus_tag="SMb20404"
FT                   /product="putative aldehyde dehydrogenase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20404"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48790"
FT                   /db_xref="GOA:Q92WF0"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WF0"
FT                   /protein_id="CAC48790.1"
FT                   /translation="MGILQEEITRRSVIASAGGLVVGFSLGRAFAQELPPATPPAPPVS
FT                   LPGSLDDERFLDSWIRIDPDSSVTVFTGKAELGQGIRTALLQVAAEELEVDPAEIRLIT
FT                   ADTGRTPNEGFTAGSQSMQNSGAAIRNAAAQVRALLLAEAARRFGLAATELRAENKAVL
FT                   AKDGRRATYGELVSGRMLHVEAQPQSALKPPGTFRVIGKTLPRVDIPGKVTGQPAYVHD
FT                   LRLEAMLHARVVRPPSPAARLTEVDASAAEALPGVASVVRDGNFLAVVASKEFQAVNAM
FT                   RALAAAARWQESETLPDQTDLPAELQRLESEAGTVAETGMLSSDGKIFEATFSRPYQIH
FT                   GSIGPSCAVAQMKADGTLDVWSHTQGVFPDRAAIAEMLAMPEDKVHVIHMEGSGCYGHN
FT                   GADDAAADAALIASKLPGKPIRVQWMREQEHSWEPYGPAMLMKISAALDDQGRIASWAY
FT                   DLWSNTHSTRPGGAGALLAARHKAEAIQPKPAKLNISPSGNGDRNADPLYVIPNKRVLW
FT                   HFLADMPLRVSALRALGAYANVFAIESTIDELALMADADPVEFRLRHMEDPRARAVIEL
FT                   AAQRFGWDKAQMPRNRGRGFGFARYKNLAAYLAVAMEVDVEPETGSVHVIRAVSAIDSG
FT                   EIVNPDGIRNQTEGGILQSISWTLYEAVAFDRTRITSTDWSSYPILRFASVPESVEIHI
FT                   VERPGEPFLGTGEAAQGPAAAAVANAIRDATGKRLYDLPFTRDRIRSAVGRA"
FT   CDS_pept        complement(419112..419891)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20405"
FT                   /old_locus_tag="SMb20405"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20405"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48791"
FT                   /db_xref="GOA:Q92WE9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WE9"
FT                   /protein_id="CAC48791.1"
FT                   /translation="MSGDGFWKILAQAISATGTDRHVDRLIDMIGAVVPQNLITVTRYS
FT                   ATRKPEFVKHRGYSDEMVARYLDTYYVFDPFYAYWRLNRRAGIVPLKSLADDAPKRGRY
FT                   IAEFLAQSEICDEVGILLEDGDDWCLGIFLDRSTSMFSDGEVAALCSRFPVFEALHATD
FT                   TRTRDPNLRRTSTPEAMGEAPVSAVQASLILWPDLTVRERELVALILQGHPNATIASRL
FT                   GIAPGTVKNHRARIYEKLDITTERELFLQVFQQYRLS"
FT   CDS_pept        420019..422133
FT                   /transl_table=11
FT                   /gene="hyuA"
FT                   /locus_tag="SM_b20406"
FT                   /old_locus_tag="SMb20406"
FT                   /product="5-oxoprolinase (ATP-hydrolysing)"
FT                   /function="ATP + 5-oxo-L-proline + 2 H2O = ADP + phosphate
FT                   + L-glutamate"
FT                   /EC_number="3.5.2.9"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20406"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48792"
FT                   /db_xref="GOA:Q92WE8"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WE8"
FT                   /protein_id="CAC48792.1"
FT                   /translation="MIGIDAGGTMTDTILVDQNGHFKIGKAATTPKNEAEGFISSAADA
FT                   ADAWGISLDSLFSGLDVVLYSGTGMLNTLLSRTGRKLGLITTKGMEDMVLMGRGLQAWA
FT                   DYSYADRLHAVTHAHPDPLVPRRRTHGVTERVDHFGDIVLPLYEHEVTAAARALIRDKV
FT                   DAICIMTIFSHVNPVHEKRIAEICREEVAAAGVEINVYTSHEVRPVIREQSRLNSVLIE
FT                   AYATSRGRMQLRSIEEATHKYGFKYGVQTLLSFGGLTSINHPRLHETMISGPIGGILGA
FT                   AYVGKLIGNNSLICSDMGGTSFDMGVISRGQTRIENEPLMDRFKLNVPTLHLDTIGAGA
FT                   GMILKVDPLTRKVSLGPESAGADPGPICFAKGGTEPTIADCDAILGRLNPYYFLGGKVV
FT                   LEVEKARAAFKEKCADVLGVGVEEAAEGMIDMLEQDANNALRRVISGQGVHPSEFTLLS
FT                   YGGSGPLHLAGCSRGIGFKDIITFQFAAAFSAFGCTTADYMRRHSVSTQIDIGARASDD
FT                   RLAAAGAQVTRVWQDLEKAAVDEMLTDGHAREKIRTVPFFMARYTGQLEDVEVIAPLSS
FT                   INGPDDMRAVLAQFEEVYAKANHRVSKYGEAGFSLMELGVIATAEKIKPVLVRRPLGTA
FT                   DPQSAHKGVREAYIGGRWHRANLYEMDLLEPGHEVIGPAIIEHPATTLVVHPNDRVFID
FT                   EWTLLHYNHA"
FT   CDS_pept        422142..424343
FT                   /transl_table=11
FT                   /gene="hyuB"
FT                   /locus_tag="SM_b20407"
FT                   /old_locus_tag="SMb20407"
FT                   /product="5-oxoprolinase (ATP-hydrolysing)"
FT                   /function="ATP + 5-oxo-L-proline + 2 H2O = ADP + phosphate
FT                   + L-glutamate"
FT                   /EC_number="3.5.2.9"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20407"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48793"
FT                   /db_xref="GOA:Q92WE7"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WE7"
FT                   /protein_id="CAC48793.1"
FT                   /translation="MTNMLDKTANSLQRRLLESERLMDETGCYDGITELRLRRQDPLKF
FT                   ETLHTKLRAYCVSAREMARRISASPGVREVGEMVVAIYTPEGDAIALSNGIMVHVHTMS
FT                   RFIKWMIRNGYEQNPCIRDGDIFANNDAFIGTVQVPDVMDVVPIFHRGTLVGWAGAVCH
FT                   ELEAGGITPGGDVCLAQERFTEGLFVCAEKIGENDEIRRDYVIRCERNLRMPIYWVLDE
FT                   KAKVAACIDMRESVKQLIDEVGLEYWQRLSKEFIEEGRRAQLARTRQLTVPGIYRGHTF
FT                   YGHVTEGKPGFQPLADPNWLYNIPIEMEITSEGKIRLDFDGTQPWGYHSMNCTPAGMDG
FT                   GMFVTLTQHMNFEGLVNDGAWMATEINIPHGTWTNPDNEMAATATSWALLLPAYGVFQR
FT                   LLSRGFIARGFVEEAFVGQVNSPMIEMGGTSQYGTGFGMAHFECAAAGSGALAIKDGLD
FT                   TAYVGWNPESDMGNIEIWEQNMPMVYIGRSIVPNSGGAGKYRGGCAFISTWLINKTDHL
FT                   RLVTSEHSSRVFDNGGLCGGYPAPTCERHHAVRNSDIHERAERREPLAHTPGTDPLVSD
FT                   FERTYKGEQVWEEGPYITRPHKAGDIFSHAYNGGGGFGDVLERDPIKTAWDVENGFLTR
FT                   EAAEKVFGIILKEDAEGYPQADIDATVARRAELRKKRLKQAIPVSEWIAREQRRVEASD
FT                   FAPEVAKMYRSAMKLSPRFSRDFKEFWGLASDFAIAGEN"
FT   CDS_pept        424347..424844
FT                   /transl_table=11
FT                   /locus_tag="SM_b20408"
FT                   /old_locus_tag="SMb20408"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20408"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48794"
FT                   /db_xref="InterPro:IPR016750"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WE6"
FT                   /protein_id="CAC48794.1"
FT                   /translation="MTEYSKEVINDLVNGTLPWPQTRRIMSAYKDHDRFFKYLAVLQDR
FT                   VAWSDPILLPVGDRLFICDSAEGRVARCECGYSFGDYRRNWKLNAVINVRDTEESLREI
FT                   YPNSDIPDPRWMEIREFFCPECAHLHEVEAAAPGYPIVHDFEPDLEGFYRDWLGKPLKD
FT                   LS"
FT   CDS_pept        424841..425671
FT                   /transl_table=11
FT                   /locus_tag="SM_b20409"
FT                   /old_locus_tag="SMb20409"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="(3R)-3-hydroxyacyl-[acyl-carrier protein] +
FT                   NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+"
FT                   /EC_number="1.1.1.100"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20409"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48795"
FT                   /db_xref="GOA:Q92WE5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WE5"
FT                   /protein_id="CAC48795.1"
FT                   /translation="MTGRLKGRSAVITGGLTGQGLAIAEALAAEGANVAVGSFVREAAG
FT                   RGGDAAAYPDPQEIVEVRERFAAAGTAVYAGHLDVRDSEAIEQFVSAAEAACGPADILV
FT                   NAAGTTAEQPVAGHSDELWLKIIDTNLNGAFRMTRRLLPGMIGRKWGRIINIGSTAATV
FT                   GWKDNPAYCASKSGLLGLTRCVALEGAPHGVTCVMISPTWVETELMRRNVQQVVEREGR
FT                   GRTMEEAMSDIAAQNPQNRIIQPYEIAALAAFLCGEGARGITMENIQITGGALW"
FT   CDS_pept        425740..426678
FT                   /transl_table=11
FT                   /locus_tag="SM_b20410"
FT                   /old_locus_tag="SMb20410"
FT                   /product="ABC transporter, periplasmic solute-binding
FT                   protein"
FT                   /function="ABC-type proline/glycine betaine transport
FT                   systems, periplasmic components"
FT                   /note="Expression is induced by mannose and dulcitol"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20410"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48796"
FT                   /db_xref="GOA:Q92WE4"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WE4"
FT                   /protein_id="CAC48796.1"
FT                   /translation="MLKQITAMTAGLLMTIGVAAAAEPESCKTVRFSDVGWTDITSTTA
FT                   VASTILEALGYAPQSKLLSIPVTYASMKNKDIDVYLGDWQPSMEADRKPFLEDKSIEVI
FT                   GPNLTGAKYTFAVPKYVADAGVKDISDLQKFPDKFGRKIYGIEPGNNGNRMILDMINKG
FT                   DFGLTGWELVESSEQGMLAEVERATKDDQWIVFLGWAPHPMNTRYQIDYLSGADAYFGP
FT                   NYGGADIYTNIRAGYAQECPNVARFVTNLRFTLEMENEIMNGILNDGNDPKDAAADWLK
FT                   AHPEAVAPWLEGVTTFDGAPAKEAVESALKS"
FT   CDS_pept        complement(426694..426942)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20411"
FT                   /old_locus_tag="SMb20411"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20411"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48797"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WE3"
FT                   /protein_id="CAC48797.1"
FT                   /translation="MEIVAKLRSLPGHVFWPDDVSLVGSSDIIPSKILTSGQVTDTYLL
FT                   ALAKARGGKLATFDRKLSAAAVTKGNSALHLIATNRS"
FT   CDS_pept        complement(426973..427137)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20412"
FT                   /old_locus_tag="SMb20412"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20412"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48798"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WE2"
FT                   /protein_id="CAC48798.1"
FT                   /translation="MTFLLDVNVLIALIDPSHIGHDDAHEWFASIGQTAWATCPITENG
FT                   VIRIVGNPE"
FT   CDS_pept        complement(427134..427361)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20413"
FT                   /old_locus_tag="SMb20413"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20413"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48799"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WE1"
FT                   /protein_id="CAC48799.1"
FT                   /translation="MRTTLAIDDDVLIAAKAMATQQQRSVGEVISELARRSLRRPRSGG
FT                   ERNGIPLLSPRPDAPPVTLEIVNALRDELA"
FT   CDS_pept        complement(427542..428015)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20414"
FT                   /old_locus_tag="SMb20414"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20414"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48800"
FT                   /db_xref="GOA:Q92WE0"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WE0"
FT                   /protein_id="CAC48800.1"
FT                   /translation="MLYFVLKFLHIIGASVLLGTGAGIAFFMLLAHRTGRTETVAAVAR
FT                   IVVIADFLFTATAVVLQPVTGIALAWNVGYSLAEGWILLSLLLYVVTGAFWLPVVWMQM
FT                   EMRRLAETASKAGEPLPKRYHQLFRLWFAFGFPAFGAVLAIFWLMITRPALEW"
FT   CDS_pept        complement(428015..429304)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20415"
FT                   /old_locus_tag="SMb20415"
FT                   /product="putative oxidoreductase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20415"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48801"
FT                   /db_xref="GOA:Q92WD9"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WD9"
FT                   /protein_id="CAC48801.1"
FT                   /translation="MTRVLVVGASGLIGSAVCAGLHGRGSEIVRVVRPGSAPSSHTAGK
FT                   ALELDLRSVGPEDWLPHLSGIDAVVNCAGTLQDGPGEDTTAVHARGPASLFKACEQAGV
FT                   RRVIHFSAMGVDRAQPSPFSRTKLQGDEALMACDLDWVILRPSVVLGPGAYGASALFRG
FT                   LAALPWLPVMPNTGLLQVVRLEDVVRTVEMFVKPNAPSRLTLEVAGPEALSFKDVVGTY
FT                   RRWFGWPAARVVNMPTPLANLTYKLSDIAGALGWRPPTRSTAQKEIGRGAVGDNRAWVE
FT                   KTGIEPAALADTLARTPVSVQERWFAKLYLLKPVIFVVLPLFWITTGVISLTSGYEIGV
FT                   DLMERGGAGVLAGPSVIAGALADILIGMAIAFRRTSRIGLYGAVGLSLFYAIAGTALLP
FT                   ELWNEPLGPLLKIWPILVLHLAALAILEER"
FT   CDS_pept        429673..430965
FT                   /transl_table=11
FT                   /gene="ugpB"
FT                   /locus_tag="SM_b20416"
FT                   /old_locus_tag="SMb20416"
FT                   /product="probable ABC transporter periplasmic
FT                   glycerol-3-phosphate-binding protein precursor"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20416"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48802"
FT                   /db_xref="GOA:Q926H8"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q926H8"
FT                   /protein_id="CAC48802.1"
FT                   /translation="MRLISISTTIAFGFAFQAQAATELQWWHAMTGANNEMIEELTKEF
FT                   NESQSTYKVVPVFKGTYPETLNAGIAAFRSKQPPAIIQVFDAGSGTMMAAEGAIVPAAE
FT                   ILQKGGFTFDKSQYLPGIVAYYSKPDGTMLSFPYNSSSPILYYNKDAFQKAGLNVDNPP
FT                   KTWPEVFEAAKKIKTSGAAPCGMTSTWLTWIQTENFAAWNNVPYGTNENGLGGTDVKLQ
FT                   INAPLYVEHFQAIADLAKDGAFRYGGRTSEAKQLFTSGECAILTESSGGLGDIAKSGVN
FT                   YGIGQLPYYEGHGPQNTIPGGASLWVFAGKSDEEYKGVAEFFNFLSQTEIQAKLHQVSG
FT                   YMPVTMAAYEETKKSGFYEKNPGRETPLLQMMGKAPTENSKGVRLVNLPQVRDILNEEF
FT                   EAMLSGQQDAKTALDKAVERGNAAIAAAISN"
FT   CDS_pept        431083..431964
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="SM_b20417"
FT                   /old_locus_tag="SMb20417"
FT                   /product="probable glycerol-3-phosphate ABC transporter
FT                   permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20417"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48803"
FT                   /db_xref="GOA:Q92WD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92WD8"
FT                   /protein_id="CAC48803.1"
FT                   /translation="MQRVVFPNKILPYLLVAPQIVLTIVFFFWPASQALYQSVIREDPF
FT                   GLKSGFVGFANFSAVLSEANYLNSLKVTVIFSVLTALLAMGVALLLATAADRVVRGKTF
FT                   YRTLLIWPYAVAPAVAGMLWLFMFNPAMGTFAYMLRRNGFHWDPLLNGNHAMILIVVAA
FT                   AWKQISYNFLFFVAGLQAIPKSLIEAAAIDGARGTRRFWTIIFPLLAPTTFFLLVVNTV
FT                   YAFFDTFGIIHSVTGGGPARATETLVYKVYNDGFVNLNLGSSAAQSVILMAIVIGLTAF
FT                   QFRFVEKRVHYG"
FT   CDS_pept        431973..432821
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="SM_b20418"
FT                   /old_locus_tag="SMb20418"
FT                   /product="probable glycerol-3-phosphate ABC transporter
FT                   permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20418"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48804"
FT                   /db_xref="GOA:Q92WD7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92WD7"
FT                   /protein_id="CAC48804.1"
FT                   /translation="MIEKRPISNLIGHLMLIIGIIIVVFPIYYTFVASSMSSVEIIRPP
FT                   MPLVPGTRLAENYSEALSGGVERVVGVSLERLLFNTFVVAIAIAVGKIVISFLSAFAIV
FT                   FFRFPLRMAFFWMIFITLMLPVEVRILPTYKVIVDLGLIDTYAGLTLPLMASATATFLF
FT                   RQFFLTIPGELVEAARIDNAGPFRFMRDILLPLSKTNIAALFVILFIYGWTQYLWPLLV
FT                   TNDSRMNTIIIGLRKMVDFTDASTPWNYVMVTAILAIIPPVAVVVLMQRWFVKGLVETE
FT                   K"
FT   CDS_pept        432821..433870
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="SM_b20419"
FT                   /old_locus_tag="SMb20419"
FT                   /product="glycerol-3-phosphate-transporting ATPase"
FT                   /function="ATP + H2O + glycerol-3-phosphateout = ADP +
FT                   phosphate + glycerol-3-phosphatein''"
FT                   /EC_number="3.6.3.20"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20419"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48805"
FT                   /db_xref="GOA:Q92WD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92WD6"
FT                   /protein_id="CAC48805.1"
FT                   /translation="MATITLKDVHKTYHGDIAAIRGVSLAIADGEFIVLVGPSGCGKST
FT                   LLRMIAGLESITSGEISIGDRVVNGLEPSERDIAMVFQNYALYPHMTVRQNLSYGLKNR
FT                   NTPKEEIERRIAKAAKSLEIEPFLDRKPRQLSGGQRQRVAMGRAIVREPAAFLFDEPLS
FT                   NLDAKLRVQMRVEIKRLQRALGTTSVYVTHDQLEAMTLADRLVVLNGGRIEQVGTPIEL
FT                   YENPATAFVATFIGSPSMNLLDLNTGNAAWSAPAALVGKPGLATIGIRPEDITLAGDTD
FT                   GGERFRARVRVGAVELVGAESYVHGTLANGEPLVFRVAGRSRMMIDEEVEVAAVAGSLH
FT                   WFDAAGRRL"
FT   CDS_pept        433992..434618
FT                   /transl_table=11
FT                   /locus_tag="SM_b20420"
FT                   /old_locus_tag="SMb20420"
FT                   /product="glutathione transferase"
FT                   /function="RX + glutathione = HX + R-S-glutathione"
FT                   /EC_number="2.5.1.18"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20420"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48806"
FT                   /db_xref="GOA:Q92WD5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WD5"
FT                   /protein_id="CAC48806.1"
FT                   /translation="MMKLYGLGPTRSLRARWALQELDAEFEFVAVNILAGEAHHPDFLR
FT                   LNPAGKLPVLVDGDFVLTESAAIVMYLAEKYGGKGLMPADLKERAQAYRWSLFAVTELE
FT                   QPLWRMAKHTFLYPEEKRLPEDIALAKEEFLAMAAVLEQHMKGREFIVGDRISIADCVT
FT                   AYVLDWGNENGLLDDFPNLRAYLERMYARPKAPQRIAEAFASLQS"
FT   mobile_element  434687..435854
FT                   /mobile_element_type="insertion sequence:SMb21660"
FT   CDS_pept        434771..435847
FT                   /transl_table=11
FT                   /gene="TRm21"
FT                   /locus_tag="SM_b20421"
FT                   /old_locus_tag="SMb20421"
FT                   /product="putative Transposase for insertion sequence
FT                   ISRm21 protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20421"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48807"
FT                   /db_xref="GOA:Q7APA1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q7APA1"
FT                   /protein_id="CAC48807.1"
FT                   /translation="MSRFAACFEDLPDPRGRNARHPLTSILFIAVAAIVCGAESCTDMA
FT                   DFGVAKKKWLKTIVPLPYGIPSHDTFSTVFRHLDPDAFDAAFRRLTASFAQGLEGVVAI
FT                   DGKAVRGAYRRAAKATPLHFVNVWAAGPGLVIGQKLAPGRNEVQGALDALALLALEGSI
FT                   VTADALHCRPDTARAILAAGGDYALALKANQPGLLAQALARIEDADHVESIQIAAETAH
FT                   DRTETRRASVVAVDDINFPGLQAIGCVETTSRHTNGHLTSHVRYFLLSTTMSPSALIEV
FT                   VRTHWQIENKLHWVLDVHFREDAARNRKDNGPQNIAFLRKIALNLLRSHPDKASIRRKI
FT                   KKAGWDDQFLTSLIAHMR"
FT   CDS_pept        complement(436049..437128)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20422"
FT                   /old_locus_tag="SMb20422"
FT                   /product="putative alcohol dehydrogenase"
FT                   /function="Zn-dependent alcohol dehydrogenases"
FT                   /EC_number="1.1.1.1"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative zinc-binding alcohol
FT                   dehydrogenase,,putative adh gene"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20422"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48808"
FT                   /db_xref="GOA:Q92WD4"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4J6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WD4"
FT                   /protein_id="CAC48808.1"
FT                   /translation="MRMMHSVPKTMTAVLLTGHGGLEKLVYSRDVPVPAPAAGEVLIKV
FT                   TACGMNNTDVWVREGAYGTEDDPSAVSTWRRHGNTLTFPRIQGTDTVGHIVAVGEGVDR
FT                   ARIGERVMVDFSIYNRDDDSLADIDYMGHGRDGGYAEYMALPAENAHVVATDLTDIELA
FT                   TFCCAYLTGERMLERARLAAGETVLVTGASGGVGSAIIQLARARGAVPIAVAGPGKEAA
FT                   MLDIGAQAVVTRGQGDLAEAVEAASGGRPIDVVADLVGGPLFNDLLKILRPEGRYTTAG
FT                   AIAGPVVQLDLRTMYLKQLELHGSSQGSRADFRRLVRYIEEKKIRPLVGGVYPLSEFHR
FT                   AQTDFMAKNFVGKLVVVPD"
FT   CDS_pept        complement(437134..438510)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20423"
FT                   /old_locus_tag="SMb20423"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoatetransami
FT                   nase"
FT                   /function="S-adenosyl-L-methionine + 8-amino-7-oxononanoate
FT                   = S-adenosyl-4-methylthio-2-oxobutanoate +
FT                   7,8-diaminononanoate"
FT                   /EC_number="2.6.1.62"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20423"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48809"
FT                   /db_xref="GOA:Q92WD3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WD3"
FT                   /protein_id="CAC48809.1"
FT                   /translation="MLERSNELTAWDRDHFFHPSTHMGMHARGETPTRVIGGGEGVYIT
FT                   DISGKRSLDAFAGLYCVNVGYGRQKIADAIAEQAKNLAYYHAYVGHGTEASIRLSKMII
FT                   DRAPEGMSRVYFGLSGSDANETNIKLIWYYNNILGRPEKKKIISRWRGYHGSGVMTGSL
FT                   TGLHLFHNAFDLPRAPILHTEAPYYFRRPDRSMSEEQFSQYCADKLEEMILAEGPDTVA
FT                   AFIGEPILGTGGIVPPPKGYWEKIQAVLQKYDILLVADEVVTGFGRLGTMFGSDHYGIK
FT                   PDLITIAKGLTSAYAPLSGTIVSDKLWQVLVKGSDELGAIGHGWTYSAHPICAAAGIAN
FT                   LELIDELGIVENAGSTGAYFRAELQKAVGDHRHVGEVRGDGLMAAIEFVEDRDDRAFFD
FT                   PGRKVGPQVAAALLERGVIGRAMPQGDILGFAPPLCLTRDEADIVVKAAADTIQSVLGR
FT                   "
FT   CDS_pept        complement(438630..440126)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20424"
FT                   /old_locus_tag="SMb20424"
FT                   /product="succinate-semialdehyde dehydrogenase [NAD(P)+]"
FT                   /function="succinate semialdehyde + NAD(P)+ + H2O =
FT                   succinate + NAD(P)H + H+"
FT                   /EC_number="1.2.1.16"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20424"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48810"
FT                   /db_xref="GOA:Q92WD2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WD2"
FT                   /protein_id="CAC48810.1"
FT                   /translation="MTAVFARTAFHDALKNLSDRQLLRELAYVGGRWVAGRDGTCLEVS
FT                   DPASGAALAFVASLDAAQTSEAIDAAQKAFRSWHNMLPQARAAILRKWHDLMLEAREDL
FT                   ALLMTLEQGKPLAESRGEIDYAASFIEWYAEEGKRLNAESVTSHLAGAEMIVRREALGV
FT                   VGIVTPWNFPSAMITRKAAAALAAGCTVVAHPSSETPLSALALAELGERAGLPAGVFNV
FT                   VTGKAATIVGRMCEDARVRAMSFTGSTEIGRLIASQCAPTMKRLVMELGGHAPLIVFAD
FT                   ANVEKAADIAIAAKFATSGQDCLAANRIYVERPALKAFQEAFAARIAGLKVGSGMEPDT
FT                   DIGPLMHERAVAKVEEQVADALKLGARLAVGGKRHAAGPLFFQPTLLTDVPDDALIMRE
FT                   ETFGPVAAVTAFDSEEEVVARANDTEYGLVAYVVTENGARQMRLARALEYGMVAVNRVK
FT                   ITGGPIPFGGWKQSGLGREGSRHGMEAFTELKYLCIDTAA"
FT   CDS_pept        complement(440290..440784)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20425"
FT                   /old_locus_tag="SMb20425"
FT                   /product="putative transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="putative leucine-responsive regulator,, putative lrp
FT                   gene, AsnC family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20425"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48811"
FT                   /db_xref="GOA:Q92WD1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WD1"
FT                   /protein_id="CAC48811.1"
FT                   /translation="MKLDAIDLRILEAIQADGRITKLALAEKAGLSPTPCWMRLRKLEK
FT                   AGIVTGYHARVALRRVAPVASVMMEVTLGNHRQADFDRFERAIAAIPEIVACWSVGGGV
FT                   DYILKIMTADIDAYQRLVDGLLERELGIDRYFTYIVTKTVKEETVLPFGSLLPQAPAGQ
FT                   E"
FT   CDS_pept        440994..442274
FT                   /transl_table=11
FT                   /locus_tag="SM_b20426"
FT                   /old_locus_tag="SMb20426"
FT                   /product="aspartate transaminase"
FT                   /function="L-aspartate + 2-oxoglutarate = oxaloacetate +
FT                   L-glutamate"
FT                   /EC_number="2.6.1.1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20426"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48812"
FT                   /db_xref="GOA:Q92WD0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WD0"
FT                   /protein_id="CAC48812.1"
FT                   /translation="MRLPTHRKLADDLKLSVQTVSRAYDELIRRGLISGEVGRGSFVQT
FT                   RPREPEPPYLPERLGELIDLSILKPVCEQYHLEKMRQGFAWLAENLPPSSALSFRPNMV
FT                   FPRHRNVAAEWLLRCGLDVSPLNINLTNGATSAMTVALMSVAPPGSTVATEAISHHTLV
FT                   PLSTYLGIHLQGLAIDGDGMIPDALDEACRKGVIRAVFLQPSVINPTATLMSAGRRAAL
FT                   AEVARRHDIAIIENDILGPLVEERLPPVAALAPERTLYVTSFTKITVPGLRIGYLVAPD
FT                   RYVAAVANRHLVSNWMATPAIAEIATQWVSDGTAIELVNWQRRALAARHAIAKEVLASL
FT                   GHHTHPQSLHVWLPLPEGHQEDAFVSQARLRGVAIAPGASFRTADSGWRPAVRISLGST
FT                   TEQELKSGLGIVASLALGEPEALLLVI"
FT   CDS_pept        442445..443230
FT                   /transl_table=11
FT                   /gene="ehuA OR SMb20427"
FT                   /locus_tag="SM_b20427"
FT                   /old_locus_tag="SMb20427"
FT                   /product="EhuA"
FT                   /function="ABC-type spermidine/putrescine transport
FT                   systems, ATPase components"
FT                   /note="ectoine/hydroxyectoine ABC transporter, ATP-binding
FT                   protein,, PMID: 15687193"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20427"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48813"
FT                   /db_xref="GOA:Q92WC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014343"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WC9"
FT                   /protein_id="CAC48813.1"
FT                   /translation="MSQPIIRIDNIVKRYGPLTVLDGLSMEVMPGEKLALIGPSGSGKT
FT                   TILRILMTLETISDGFIQVDGEQLYHMKKAGSLVPADERHLHKMREKIGMVFQHFNLFP
FT                   HKCVLDNVTLAPMLTKGMARAQAEKRAMELLDMVGLADKAKSMPAQLSGGQKQRVAIAR
FT                   ALALSPKIMLFDEVTSALDPELVEEVLNVMRKLASETDMTMLLVTHEMGFAHDFADRVL
FT                   FFDRGKIVEEGKPEDIFRHPKQERTQTFLRKIIAAGHRV"
FT   CDS_pept        443289..444140
FT                   /transl_table=11
FT                   /gene="ehuB"
FT                   /locus_tag="SM_b20428"
FT                   /old_locus_tag="SMb20428"
FT                   /product="Cystine-binding periplasmic protein precursor"
FT                   /function="ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /note="High confidence in function and specificity"
FT                   /note="ectoine/hydroxyectoine ABC
FT                   transporter,substrate-binding protein,, induced by
FT                   ectoine/hydroxyectoine,, PMID: 15687193"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20428"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48814"
FT                   /db_xref="GOA:Q92WC8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR014337"
FT                   /db_xref="PDB:2Q88"
FT                   /db_xref="PDB:2Q89"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WC8"
FT                   /protein_id="CAC48814.1"
FT                   /translation="MKLRDFMAMAAGATALMAVAAATPAAADENKLEELKEQGFARIAI
FT                   ANEPPFTAVGADGKVSGAAPDVAREIFKRLGVADVVASISEYGAMIPGLQAGRHDAITA
FT                   GLFMKPERCAAVAYSQPILCDAEAFALKKGNPLGLKSYKDIADNPDAKIGAPGGGTEEK
FT                   LALEAGVPRDRVIVVPDGQSGLKMLQDGRIDVYSLPVLSINDLVSKANDPNVEVLAPVE
FT                   GAPVYCDGAAFRKGDEALRDAFDVELAKLKESGEFAKIIEPYGFSAKAAMSTTREKLCA
FT                   AK"
FT   CDS_pept        444243..444902
FT                   /transl_table=11
FT                   /gene="ehuC"
FT                   /locus_tag="SM_b20429"
FT                   /old_locus_tag="SMb20429"
FT                   /product="EhuC"
FT                   /function="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="ectoine/hydroxyectoine ABC transporter, permease
FT                   component,, PMID: 15687193"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20429"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48815"
FT                   /db_xref="GOA:Q92WC7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014342"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WC7"
FT                   /protein_id="CAC48815.1"
FT                   /translation="MIDWSGYIGLILQGAWVTVQLTLMGSALAVVVAFAAGLGRLSRFM
FT                   AVRALATTYIEFFRGTSIFVQLFWVYFVLPFAGITLTPLQAGVLALGLNVGAYGAEVVR
FT                   GAVKAIGREQREACIALNLTRFQAMRHIVLPQALPLMLPTFGNNAIELLKGTAVVSLIS
FT                   LSDMTFQAQVVRAQTGSTLIPFATILLLYFVMAWLISLGMRWLERRVSRGLDGVRV"
FT   CDS_pept        444905..445567
FT                   /transl_table=11
FT                   /gene="ehuD"
FT                   /locus_tag="SM_b20430"
FT                   /old_locus_tag="SMb20430"
FT                   /product="EhuD"
FT                   /function="ABC-type amino acid transport system, permease
FT                   component"
FT                   /note="ectoine/hydroxyectoine ABC transporter, permease
FT                   component,, PMID: 15687193"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20430"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48816"
FT                   /db_xref="GOA:Q92WC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014341"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WC6"
FT                   /protein_id="CAC48816.1"
FT                   /translation="MEWDWEFVRQIMPTLIEGLKITILATALGSVVAAVIGLVFAILRM
FT                   TAPTPIARVTSFAVEFIRGTPLLVQLYFIFYVLPDIGIRLPALVAGVIGLGIHYGTYAA
FT                   EVYRAGIENVPRGQWEAAKATNLTARQTWIHVILPQAIPPMIPALANYLIAMFKETPLL
FT                   SAITVLELMNQAKSIANSNYRYIEPMTLVGVFFLIMSLISVFFLRWLEARYSRVEER"
FT   CDS_pept        445567..446352
FT                   /transl_table=11
FT                   /gene="EutA"
FT                   /locus_tag="SM_b20431"
FT                   /old_locus_tag="SMb20431"
FT                   /product="EutA"
FT                   /function="Glutamate racemase"
FT                   /EC_number="4.1.1.76"
FT                   /note="putative arylmalonate decarboxylase or maleate
FT                   isomerase,, involved in ectoine utilization,, PMID:
FT                   15687193"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20431"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48817"
FT                   /db_xref="GOA:Q92WC5"
FT                   /db_xref="InterPro:IPR014332"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WC5"
FT                   /protein_id="CAC48817.1"
FT                   /translation="MRTAVALSLAARRPRLDDRPLDKRIGLVILATDHTTEVDFQRMVA
FT                   SDRIGVYVTRIPYANPVTPENLRAMQPSLTEAAALILPDETLDVVMYSCTSASVVIGDR
FT                   EVAAAIKAAKPEAAVVTPTAASVQGLRALSANRISVLTPYTIETSRPMADYFAERGFAI
FT                   DRFTCLGLTDDREMARISPKEIVAFAKEAAAPASDALFISCTAVRAAGVIAEIEQAIGK
FT                   PVVSSNYATAWACLRLCGDREARPQLGRLMELPLEEERP"
FT   CDS_pept        446349..447353
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="SM_b20432"
FT                   /old_locus_tag="SMb20432"
FT                   /product="EutB"
FT                   /function="Threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="putative threonine dehydratase,, involved in ectoine
FT                   utilization,, PMID: 15687193"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20432"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48818"
FT                   /db_xref="GOA:Q92WC4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR014333"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WC4"
FT                   /protein_id="CAC48818.1"
FT                   /translation="MSVSLPVTIDDIEVAARRISGRVLTTPLAMSGSLSELCGVPVGLK
FT                   LEHHQTTGSFKLRGATNAVLSLSAGDRALGVIAASTGNHGRALAHAAKAEGSVATICMS
FT                   HLVPVNKVSEIRRLGANVRIVGNSQDEAQEEVERLVAENGLVMVPPFDHRAIVAGQGTL
FT                   GLEVVAQMPDVAMVLVPVSGGGLAAGVAAAVKARRPATRVIGLTMERGAAMKASFAAGG
FT                   PALVDEQPSLADSLGGGIGLDNRVTFRMCRELLDDIILLTEAEIAAGMRHAYAEEREIV
FT                   EGAGAVGISALLAGKIKDIDGPIAVIISGRNVDMDLHLRVMNGETDPFREEAA"
FT   CDS_pept        447350..448339
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /locus_tag="SM_b20433"
FT                   /old_locus_tag="SMb20433"
FT                   /product="EutC"
FT                   /function="Predicted ornithine cyclodeaminase,mu-crystallin
FT                   homolog"
FT                   /EC_number="4.3.1.12"
FT                   /note="probable ornithine cyclodeaminase,, involved in
FT                   ectoine utilization,, PMID: 15687193"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20433"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48819"
FT                   /db_xref="GOA:P58338"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR014334"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58338"
FT                   /protein_id="CAC48819.1"
FT                   /translation="MTRMKILTEAELRGIVPLDREAVACVEDAFRALATKAVAMPPILR
FT                   LDIPEHRGEVDVKTAYVPGLDGFAIKISPGFFDNPKIGLPSTNGMMVLLSSKTGLVQAL
FT                   LLDNGYLTDVRTAAAGAVAARRLSREDSSVAAVFGAGMQARLQLEALALVRPIREARIW
FT                   ARDAAKAEAAAIALGGKLGFAVKAETDPRAAITGADIIVTTTPSETPVLKAEWLEPGQH
FT                   VTAMGSDAEHKNEIDPHAIARATYVADSLKQTRRLGELHHAIAAHLMSAEAEFPELGQV
FT                   IAGLKPGRTRADEITIADLTGTGIQDTAIATLAFARANAADAGTTFES"
FT   CDS_pept        448384..449565
FT                   /transl_table=11
FT                   /gene="eutD"
FT                   /locus_tag="SM_b20434"
FT                   /old_locus_tag="SMb20434"
FT                   /product="EutD"
FT                   /function="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="probable Xaa-Pro dipeptidase,, involved in ectoine
FT                   utilization,, PMID: 15687193"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20434"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48820"
FT                   /db_xref="GOA:Q92WC3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR014335"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WC3"
FT                   /protein_id="CAC48820.1"
FT                   /translation="MTQPNLKFSLGEYEARLAKTRKAMEAKGVDLLIVSDPSNMAWLTG
FT                   YDGWSFYVHQAVIVPPSGEPIWFGRGQDANGAKLTAYLDHKNIVGYPDHYVQSTERHPM
FT                   DYLSGILADRGLGSLSIGVEMDNYWFSAAAFASLQKHLPNARFSDATALVNWQRAVKSE
FT                   TEIKYMRNAARIVEAMHQRIFDKIEVGMRKCDLVAEIYDAGTRGVDGIGGDYPAIVPLL
FT                   PSGVEASAPHLTWDDRPLKRGEGTFFEIAGCYNRYHVPLSRTVFLGKPTQAFLDAEKAT
FT                   IEGMEAGLAVAKPGNTCEDIANAFFAVLKKYGIVKDNRTGYPIGLSYPPDWGERTMSLR
FT                   PGDKTELKPGMTFHFMTGLWLEDMGFETTESILITESGVECLASVPRKLMVKD"
FT   CDS_pept        449585..450580
FT                   /transl_table=11
FT                   /gene="eutE"
FT                   /locus_tag="SM_b20435"
FT                   /old_locus_tag="SMb20435"
FT                   /product="EutE"
FT                   /function="Predicted deacylase"
FT                   /note="probable succinylglutamate
FT                   desuccinylase/aspartoacylase,, involved in ectoine
FT                   utilization,, PMID: 15687193"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20435"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48821"
FT                   /db_xref="GOA:Q92WC2"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR014336"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WC2"
FT                   /protein_id="CAC48821.1"
FT                   /translation="MRPSPISATVDFEANGVQHGFLRLPYSRDDSAWGSVMIPVTVVKN
FT                   GEGPTALLTGGNHGDEYEGPIALFDLARKLDASDVEGRVIIVPAMNYPAFQAQTRTSPI
FT                   DKGNMNRSFPGRPDGTVTEKIADYFQRVLLPLADIVLDFHSGGKTLDFLPFCAAHILPD
FT                   KAQEAKAFDFVRAFGAPYSMKMLEIDAVGMYDTAAEEMGKIFITTELGGGGSATARTAS
FT                   VAKRGVANVLRHAGILKGEIEAEPTKWLDMPSEDCFAFAEDGGLVEFLIDLGGAVDRGA
FT                   AIALIYPIGRTGVEPIEVRAKMDGVLVARHNPGLIKSGDCCAVLGVEVQI"
FT   CDS_pept        450978..452252
FT                   /transl_table=11
FT                   /locus_tag="SM_b20436"
FT                   /old_locus_tag="SMb20436"
FT                   /product="probable nitrate transporter"
FT                   /function="Sugar phosphate permease"
FT                   /note="probable nitrite extrusion protein,, putative narK
FT                   gene,, major facilitator superfamily"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20436"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48822"
FT                   /db_xref="GOA:Q92WC1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WC1"
FT                   /protein_id="CAC48822.1"
FT                   /translation="MSALHQTQSTYKGAPGRALWVSTGAFTVCFAIWTIFSIIGVRIKD
FT                   ELGLSEAEFGLLIGMPILTGSLVRIVLGIWTSRYGGRLVYTLTMLAAALATFLLAYATT
FT                   YPQMLLAGLGVGLAGGSFAVGVAYVSPFFPPEKQGTALGIFGAGNVGAAVTKFLAPFVL
FT                   VAFGWQAVAEVWAAALLVTAVVFWFSTEDDPQFRARRDVGAPRKSFLSEFEPLKNIQVW
FT                   RFSLYYFFAFGGFVALALWLPRYLVGVYGFDIETAGMIAAAYSIPGSIFRAYGGALSDK
FT                   LGARRIMYAMFAVSAVATAILSIPAGAAGGAMPILVTPIVFVVVTFVLGFVMSLGKAAV
FT                   YKHIPVYYPSHVGAVGGIVGMMGGLGGFVLPIAFGFLKDVTGLWSSCFMLLFVIVAVSM
FT                   VWMNVSIRQIKREADRGVPAGALAR"
FT   CDS_pept        452507..453247
FT                   /transl_table=11
FT                   /locus_tag="SM_b20441"
FT                   /old_locus_tag="SMb20441"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /function="Transcriptional regulators"
FT                   /note="Possible repressor, with mannose as an inducer, for
FT                   expression of SMb20442-SMb20446."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20441"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48823"
FT                   /db_xref="GOA:Q92WC0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WC0"
FT                   /protein_id="CAC48823.1"
FT                   /translation="MFSAVESRRLYRQVADQMRALIERGELAHGSRLPAERELAQMFGV
FT                   SRPTIREALIVLEVEGFIDIRMGSGIYVTARPAPAADAPPEDFEGPFELLRARAVVECA
FT                   IAEEAARLARPEHISVLDDNLARMAAALEDRRLALAIDREFHVIVSSIIANQTLNRFVG
FT                   SIHDMRMTPYFEKLASYFENTETWRAAMEEHRVIRDAIALGDPAAARAAMRAHLDQSQL
FT                   RLSASFGEEPSDSTIPAAWRRVGR"
FT   CDS_pept        453287..454261
FT                   /transl_table=11
FT                   /locus_tag="SM_b20442"
FT                   /old_locus_tag="SMb20442"
FT                   /product="TRAP-type periplasmic solute-binding protein"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20442"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48824"
FT                   /db_xref="GOA:Q92WB9"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WB9"
FT                   /protein_id="CAC48824.1"
FT                   /translation="MTIRLLTLLGATATILASALSAHAQTALKWAHVYETSEPFHTESV
FT                   WAAEEIAKRTEGRYKIDVFPASQLGKEADINQGLKLGTVDIIISGSSFAARDHAPIGVT
FT                   YFPYIFRDPAHMIAYTKSDVFKRLAAGYEEASGNHITAVTYYGTRHTTSNRPIAKCADM
FT                   QGLKMRVPDVPAYLAMPRACGANTTPIAFAEVYLALQNGTVEAQENPLTTIEAKKFFEV
FT                   QKHIVLTGHIVDHLNTVVSKNLWSQLSDADKQIFTEVMQEAAVRATKIIEEREKELVAT
FT                   FKERGIEVTEVDRADFEKTVNEKVKLEDFGYNKEDWEAIRAIK"
FT   CDS_pept        454329..454901
FT                   /transl_table=11
FT                   /locus_tag="SM_b20443"
FT                   /old_locus_tag="SMb20443"
FT                   /product="TRAP-type small permease component"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20443"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48825"
FT                   /db_xref="GOA:Q92WB8"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WB8"
FT                   /protein_id="CAC48825.1"
FT                   /translation="MSQEVHLQTTPEEIAHAFDEAPPAADLSNYAFEDWVTLAVFWLMA
FT                   GCVFLQFFTRYVLNDSYAWTEEIATNCLIGVVFLGSVMCVRLSRHIQVDVLYHYLPLPV
FT                   ARALAIFVDLVRIVFFAYACWLMWRYVAIVAHERMVTVDLPRNIVFYSVMAGFVLMLIR
FT                   SIQVFVANQRRGYSVLEKPEEFHKVED"
FT   CDS_pept        454907..456313
FT                   /transl_table=11
FT                   /locus_tag="SM_b20444"
FT                   /old_locus_tag="SMb20444"
FT                   /product="TRAP-type large permease component"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20444"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48826"
FT                   /db_xref="GOA:Q92WB7"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WB7"
FT                   /protein_id="CAC48826.1"
FT                   /translation="MLLLVGSFLVLMLVGVPVAISMAAASVLYLVSYNVAPDIIAAQRM
FT                   IAGVESFPLLAVPFFILAGNLMNSAGVTGRIYSFAVALVGWMKGGLAQVNIVGSVIFSG
FT                   MSGTALADAAGIGTIEIKAMKDHGYPVDAAVGVTAASATLGPIFPPSLPFVIYGMMANV
FT                   SIGALFMAGVVPGVVMTVLMMLTVAIFAYKRGWGSDTPFEMKRLLAASLEVVVVLAVPL
FT                   FIYLLMAAGLSMNLAVGIALVVLLALDWYFDFSAVMALMTPIILIGGMTMGWFTPTEAA
FT                   VAAVIWSLFLGLVRYRTMTMSTLARATFDTIETTASVLFIVTAASIFAWLLTVSQAAQM
FT                   LSGAILTITDNKWVFLILVNLLMLFVGCFLDTIAAITILVPILLPLTAQFGIDPVHFGL
FT                   IMTLNLMIGLLHPPLGMVLFVLSRVAKLSVERTTMAILPWLVPLFIALILITFVPAVVL
FT                   WLPQSVGLIR"
FT   CDS_pept        456313..457371
FT                   /transl_table=11
FT                   /locus_tag="SM_b20445"
FT                   /old_locus_tag="SMb20445"
FT                   /product="zinc-binding deydrogenase"
FT                   /function="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /EC_number="1.1.1.-"
FT                   /note="Belongs to the family of threonine dehydrogenase and
FT                   related Zn-dependent dehydrogenases. Is possibly involved
FT                   in fucose or mannose metabolism."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20445"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48827"
FT                   /db_xref="GOA:Q92WB6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WB6"
FT                   /protein_id="CAC48827.1"
FT                   /translation="MSGAPTRTRFARLYGPRDLRLEVADVPAPGDGEVLLKMAAGGICG
FT                   SDLHYYQDGGFGPVRVREPIIPGHEASGRVAVLGAGVSGLAIDDLVAVNPSQPCGTCRF
FT                   CGEGLPVHCLDMRFLGSAMRLPHTQGMFRDWLVVPAVQCHPAGSQVSPGEAACAEPLAV
FT                   CLHAAAQAGEIRGKKVLVTGAGPIGALVVAAARHAGADEIVVTDLADAALDRAKAMGAT
FT                   RIVNVHRDPAGLAAYEADKGKFHVAFECSAAEPALRGAVAAVRPRGTIVQVGVTGEITL
FT                   PLHALVGKELRLVGSQRFDGEFALAVALISDRRIDVRPIISHQFPVDEAVRAFEQAGDR
FT                   SAACKVQLTFLS"
FT   CDS_pept        457381..458589
FT                   /transl_table=11
FT                   /gene="uxuA"
FT                   /locus_tag="SM_b20446"
FT                   /old_locus_tag="SMb20446"
FT                   /product="D-mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20446"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48828"
FT                   /db_xref="GOA:Q92WB5"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92WB5"
FT                   /protein_id="CAC48828.1"
FT                   /translation="MRHTWRWFGPVDRVSVQDAAQAGAHGIVSALHHIPTGDVWPVDEI
FT                   GKRQEEVRAGGLEWEVVESVPVSECIKTQTGPWREHVANWQETLRRLSAAGIRTVCYNF
FT                   MPVLDWTRTDLRWTARHGAKAMRFDRIDFAAFDIHLLERPAAHEDYDTATREAAERRFR
FT                   EMTEERRLALSRNIGAGLPGSADGYSLPQLREHLRTYDGVSREKLQRHLVEFLAEVAPV
FT                   AERTGINICAHPDDPPWALLGLPRILSNAEDYAFMLREVDSPANGVTLCTGSLGALAAN
FT                   DLPAMTRQFASRIHFVHLRNVLREEVRTPCSFYEDEHLEGDTDMVAVIAELLQEEQRRR
FT                   AAGRVDHQIPMRPDHGQEILDDLSRGAQPGYPAIGRLKGLAELRGIERALSHATYGLSA
FT                   ATR"
FT   CDS_pept        458865..460559
FT                   /transl_table=11
FT                   /locus_tag="SM_b20447"
FT                   /old_locus_tag="SMb20447"
FT                   /product="Diguanylate cyclase/phosphodiesterase"
FT                   /function="Predicted signal transduction protein containing
FT                   a membrane domain, an EAL and a GGDEF domain"
FT                   /note="Diguanylate cyclase (GGDEF domain)/phosphodiesterase
FT                   (EAL domain)"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20447"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48829"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WB4"
FT                   /protein_id="CAC48829.1"
FT                   /translation="MPDGDTTLPASSSIEADFFAHSDELVSLYDESFQLVECTPRHRQT
FT                   YAVDSLVETSLWHTYPELLAPGPKSAIEFVVASGLPRTVEIAHPSTGSRRTLVIFRSAG
FT                   GIGVVEAESSSTYRETFSQGESDRALLLHQATHDVLTGLPNRRQFSDQLRGALPVPNGA
FT                   RLALMQIDLDDFKPINDTLGHGAGDAVLKMAADRIRSVLRDREFAYRLAGDEFAVIQWR
FT                   ADQPREAERLADALINAFKEPFTVEGINVFVGASVGIAVAPADGNEVEQLMKAADIALY
FT                   AAKKDGRGRSSTFTRSMLIVLEQREMLRRSLRTALQEGQFFLEYQPLVKPSSSVVGFEA
FT                   LLRWRHPLVGIIPPNVFIPMAEADGLMSDIGRWLLERACRAAMDWPSHFTIAVNLSPAE
FT                   FLHEGLTDRVAQTLDLVGMRADRLELEITESVLLERTINNLDTLNTLNVLGVQISLDDF
FT                   GTFYSSLSYLKNFPFDTIKIDQYFIRDLERDEKSQTIVRSIIALAHGLGMNVTAEGVET
FT                   AEQAIWLQKEGCDRLQGYFLGVPMRAEAIADFLRKTPAIPAAGLQRT"
FT   CDS_pept        460635..461153
FT                   /transl_table=11
FT                   /locus_tag="SM_b20448"
FT                   /old_locus_tag="SMb20448"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20448"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48830"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WB3"
FT                   /protein_id="CAC48830.1"
FT                   /translation="MHGAENQPTEAAFEPLLHFEMEMGAFLSDWNHCDQLSTFMARMIS
FT                   HNRTDPIRHSNFFSSALNELLEVSFRSGSPDGRIGCAVYRWGPTERVELTFPCPPGQRQ
FT                   FYREAVSKTRDADAHARYLDSISTDLAPSREAVLLDLSINFDADVRLDESDPPSIRLVV
FT                   DLPLEGVVR"
FT   CDS_pept        461270..462328
FT                   /transl_table=11
FT                   /locus_tag="SM_b20449"
FT                   /old_locus_tag="SMb20449"
FT                   /product="probable methyltransferase"
FT                   /function="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /EC_number="2.1.1.-"
FT                   /note="putative menaquinone biosynthesis methyltransferase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20449"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48831"
FT                   /db_xref="GOA:Q92WB2"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WB2"
FT                   /protein_id="CAC48831.1"
FT                   /translation="MLKGAIEEVRGVLYINVKRLVQMNNTAYHAFARVLLDACRTRSDI
FT                   RFVVVTSSVVGWTERMFAHLNKIEPQVTVEVYDSKFYPGQSFVENTSFIPILRTQTKMT
FT                   WRHERKILPRHGLRPGMTMADICCGIGDFAMLVRKEFQPARIVALDHSKASLAYARDVA
FT                   SGFGVTDIEYTYGDASEMLLEDNQFDFVTCRHSLQIFNQPDVLLKELFRICKPGGRVYI
FT                   TNEKNSHCLGEPRAQSIQWTYNEVARLFSHFEMDVEFGPKSKRYLVDAGFDDISVESFM
FT                   VTNLDGDPQDFADIIAAWENVYAGEMAVKRGDPPEFIERFRQGFRDHIFAALHPKGYAG
FT                   WPIWAASGRKPL"
FT   CDS_pept        462325..464685
FT                   /transl_table=11
FT                   /locus_tag="SM_b20450"
FT                   /old_locus_tag="SMb20450"
FT                   /product="putative regulatory protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20450"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48832"
FT                   /db_xref="GOA:Q92WB1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WB1"
FT                   /protein_id="CAC48832.1"
FT                   /translation="MSLPGENTTRLGLRSFRAKFVLVVGSAVLFDLLVTGGLALWNVQR
FT                   LSRDAAAEVGRGLEEANQDYIRSYAATTAARVNLLLNQVHSDVGTLAGVLQEQIDRPVR
FT                   KSQIGEAMARGAPGTVTVAYDQKGGWAQNLPGPPSVVSVWGYLLDQNHLPLPDVQTDIE
FT                   NSAVLDLVAPSLLANGQSKLQMYYIGPKERPIFRTAPYTDQAQTFDKLYPGHNSAEFWS
FT                   FFFPGLYESWEQWARDPKSRPVNGDITQTAPYTDAITGKLIVSFFQPLWSRDRSRVLGA
FT                   AGTDITLDQLAEIVENVKVAETGFGFLTMSDGNVVAINPVGEKVIGLRASNAAASGGVT
FT                   GLDRSLRRSVQPEIAQLPLGEDGLLKHIFLEENGERVPYLVVLKQLQPTNLWASGPVRR
FT                   EAMLLGIAVPEREIYASLFAAQAGISEATNRILIYQVLALLVSLFFVIAAVFAISKRIT
FT                   GGISALANAAKRIEAKDYSVRVDIPTRDEVGDAGAAFNRMAEEISFHTENLEQLVEDRT
FT                   KEIEEANLQISALNQQLRSENLRLGAELAVARRIQMMVLPKAGELEEIAELEIAAYMRP
FT                   ADEVGGDYYDVLQDGKRLKIGIGDVTGHGLESGVLMLMVQSVARALQEMGEMEPAQFLN
FT                   RVNRAIYKNLVRTRTNKHLSLAFLDYDGARLTLSGQHEELIVIRDLERVERIDTLDLGL
FT                   PIGLEPDISAFVATREISFGRGDMIILHTDGVTEAESGTGELFGIERLCESARCRYGSS
FT                   AEDVKSGIIEDLMAHIGTQKIHDDITLVVMRHR"
FT   CDS_pept        464690..465253
FT                   /transl_table=11
FT                   /locus_tag="SM_b20451"
FT                   /old_locus_tag="SMb20451"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20451"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48833"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WB0"
FT                   /protein_id="CAC48833.1"
FT                   /translation="MTTLYGLEDLAVGTGENSTKLRLFDGPLDLGWKHCAMTSDFVAEF
FT                   AALRYKTSRGLYKEVRHNVGYLTNELIENAVKFRAGGEIVVEASIASTTFRTKVSNLVD
FT                   KGTADKFRHLLSEITIGDPSDLLIERIEANATGSGSGSGSGLGLLTLMSDYGAHFAWIF
FT                   GSGEADGKIPLETYASIAIPDLSN"
FT   CDS_pept        465268..465606
FT                   /transl_table=11
FT                   /locus_tag="SM_b20452"
FT                   /old_locus_tag="SMb20452"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20452"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48834"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WA9"
FT                   /protein_id="CAC48834.1"
FT                   /translation="MEIKEDDYRVWSEDKDIYFDGTMRLPSTEAYAPIFSLVMDMLEAE
FT                   PERMTVDLTGLQFLNSSGINLLAKLTIEARKRPNIQFTVRGSSEFPWQTKSLPNLKKLH
FT                   PGVDLRLS"
FT   CDS_pept        complement(465642..466553)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20453"
FT                   /old_locus_tag="SMb20453"
FT                   /product="putative gluconolactonase precursor protein"
FT                   /EC_number="3.1.1.17"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20453"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48835"
FT                   /db_xref="GOA:Q926B8"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q926B8"
FT                   /protein_id="CAC48835.1"
FT                   /translation="MADSPHYDIRDERFRSLIVGSAALEELYRGCRWAEGPVWFSDLDC
FT                   LIWSDIPNQRMMRWTPDGGASVFRSPSNYVNGNTRDREGRLISCEHGGRRVTRTEHDGR
FT                   ITVLADIYEGKRLNSPNDAVVHSDGSIWFTDPTYGILSDYEGHKAEPEQPTRNVYRIDP
FT                   LSGAIKAVVRDFIQPNGLAFSPDEARLYIADSGSAKHEVPSHIRVFDVAADGVLANDRY
FT                   FCSIDNGNPDGFRFDVAGNLWCSAADGVHCFDTGGTLLGKILVPQTVSNLTFGGPKKNR
FT                   LFITATQSLYSIYTATNGVQYP"
FT   CDS_pept        466834..467253
FT                   /transl_table=11
FT                   /locus_tag="SM_b20454"
FT                   /old_locus_tag="SMb20454"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20454"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48836"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WA8"
FT                   /protein_id="CAC48836.1"
FT                   /translation="MKDLIVKGAIVLGLGLGCFAIPAAAQSTTKNSTVTGAAGGAAAGA
FT                   VIGGPVGAAVGGVAGAVAGAAIDPPPPKVIEYVEAQPLPAEPVVVQQEIVVGKPLPETV
FT                   VVTPIPDDTRYAYAVVNEKRVIVEPKSRTVVQVVQ"
FT   CDS_pept        complement(467358..467972)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20455"
FT                   /old_locus_tag="SMb20455"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20455"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48837"
FT                   /db_xref="GOA:Q92WA7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WA7"
FT                   /protein_id="CAC48837.1"
FT                   /translation="MSDKGRPRSFDRADALMRAMKVFWEKGYEGASLTALTAAMGINAP
FT                   SLYAAFGCKEALYLEAMELYAQTVGTEIWAALETAPTAREAVSQILLATAEAYSQPDTP
FT                   HGCLIALGGLHQAAIPEAVCEALTRHRKENIDKLRQRLEAAIAGGELPDRVDAGAVATF
FT                   YATVQHGMSILARDGGSYEALKNVTDGAMAAWGVLAQDPAP"
FT   CDS_pept        468077..468823
FT                   /transl_table=11
FT                   /locus_tag="SM_b20456"
FT                   /old_locus_tag="SMb20456"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="(3R)-3-hydroxyacyl-[acyl-carrier protein] +
FT                   NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+"
FT                   /EC_number="1.1.1.100"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20456"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48838"
FT                   /db_xref="GOA:Q92WA6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3V2G"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WA6"
FT                   /protein_id="CAC48838.1"
FT                   /translation="MTSISLAGKTAFVTGGSRGIGAAIAKRLALEGAAVALTYVNAAER
FT                   AQAVVSEIEQAGGRAVAIRADNRDAEAIEQAIRETVEALGGLDILVNSAGIWHSAPLEE
FT                   TTVADFDEVMAVNFRAPFVAIRSASRHLGDGGRIITIGSNLAELVPWPGISLYSASKAA
FT                   LAGLTKGLARDLGPRGITVNIVHPGSTDTDMNPADGDHAEAQRERIATGSYGEPQDIAG
FT                   LVAWLAGPQGKFVTGASLTIDGGANA"
FT   CDS_pept        complement(468904..470052)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20457"
FT                   /old_locus_tag="SMb20457"
FT                   /product="putative transcriptional regulator TRANSCRIPTION
FT                   REGULATOR protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20457"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48839"
FT                   /db_xref="GOA:Q92WA5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="PDB:5NLA"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WA5"
FT                   /protein_id="CAC48839.1"
FT                   /translation="MTKDSGSGDDPVEVPAWPAHMERRRWPRDPTARKDRLAERSPALV
FT                   PSRFSTRDLPPQEQFRSWRAHMAPLVDVRLPDGVSEEDGFPAELTGWHLGDLLIVQQVT
FT                   PAHSYERSQTMLRSSPIDHWNVGLFRSGRSWTEADRRVTETGPGEFFFRSLGYPYRGRM
FT                   TDAASILLFMPYELLADDAGKLEGANNSVLSGNLADLLANYINGMEENLGNITVEEVPR
FT                   IVRTIRDMVVACVAAVRPDAGGSQAKMGVMERAHRYIHLNLNSGDLTPETICRELGISR
FT                   TRLYQLFEPSGGVLNYIRRRRLLQAYAELSDPTNNRPIGEIAEAAGFDLAANFTRAFSH
FT                   EFGASPREIRKAAATERLATPVAPRERDRGATIGDWLKSVQG"
FT   CDS_pept        470412..471458
FT                   /transl_table=11
FT                   /locus_tag="SM_b20458"
FT                   /old_locus_tag="SMb20458"
FT                   /product="putative dTDP-glucose 4,6-dehydratase protein"
FT                   /EC_number="4.2.1.46"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20458"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48840"
FT                   /db_xref="GOA:Q92WA4"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WA4"
FT                   /protein_id="CAC48840.1"
FT                   /translation="MNYFRNDFRGTLFGTNEATDSLRRRSLQKRILVTGGAGFLGSHLC
FT                   ELLLGAGHEVICLDNFSTGLRRNIAPLKRFDTFRVIAHDVVEPIDLEVDEIYNLACPAS
FT                   PPHYQADPIQTTKTCVIGSLNLLDLAARRGARIFQASTSEIYGDPHVHPQVESYWGNVN
FT                   PFGPRSCYDEGKRCAETLFFDFHKSHGVEIKIVRIFNTYGPRMRPDDGRVVSNFIVQAL
FT                   KGEDITIYGDGSQTRSFCFVEDLIDGFVRLMASPPSLTGPVNLGNPAEFTIGELAEEVI
FT                   RLTGSRSKIVRRPLPVDDPRQRRPDISLATEELGWRPKVNLAEGLAHTIRYFDDLLSRS
FT                   MRESAELV"
FT   CDS_pept        471458..472444
FT                   /transl_table=11
FT                   /locus_tag="SM_b20459"
FT                   /old_locus_tag="SMb20459"
FT                   /product="putative UDP-glucose 4-epimerase protein"
FT                   /EC_number="5.1.3.2"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20459"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48841"
FT                   /db_xref="GOA:Q92WA3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WA3"
FT                   /protein_id="CAC48841.1"
FT                   /translation="MVAPRILVTGGAGYIGSHTAKLLRLEGIEPVVYDNLTTGNRSAVR
FT                   WGPFVQGDILDGRRLIEVIEAHQPDAVIHFAASAYVGESVADPAKYYNNNVRGTLSLLD
FT                   ACRQTGVDKVIFSSSCATYGVPAVLPIDEATPQAPINPYGKTKLVAEHMLADYAAAFAL
FT                   NYVSLRYFNACGADPEGDLGEWHDPETHLIPRALMAAAGRIPHLEIFGEDYDTPDGTCV
FT                   RDYIHVADLASAHVLAYRHLAKGGGNVALNLGTGRGFSIKEVLRTIGEITGHDVPVVFR
FT                   RRRAGDPPALYADAGLACRTLGFLPRYSDLETIVRTAAPFFGLEVRS"
FT   CDS_pept        472441..474306
FT                   /transl_table=11
FT                   /locus_tag="SM_b20460"
FT                   /old_locus_tag="SMb20460"
FT                   /product="cellulose synthase (UDP-forming)"
FT                   /function="UDP-glucose + (1,4-beta-D-glucosyl)n = UDP +
FT                   (1,4-beta-D-glucosyl)n+1"
FT                   /EC_number="2.4.1.12"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20460"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48842"
FT                   /db_xref="GOA:Q92WA2"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WA2"
FT                   /protein_id="CAC48842.1"
FT                   /translation="MTVLSTNGPTRISEDGEPRLVPVLTRERRMEFLLGAGLWVAALVH
FT                   FWAWWLEPRHHVDALGSTIVTAVLAWVTLLPAYFIAVFYGALKPNGPLRLPAGSRIAMV
FT                   VTKAPSEPFSVVAETLEAMLAQDVPHDTWLADEDPSEATLDWCRSHGVLVSTRKGREDY
FT                   HRATWPRRTRCKEGNLAFFYDHYGYDRYDFVAQLDADHVPAPGYLFEMLRPFADQDVGY
FT                   VSAPSICDRNASESWSARGRLYAEASMHGALQAGYNGGLAPLCIGSHYAVRTAALKEIG
FT                   GLGPELAEDHSTTLMMNAAGWRGIHALDAIAHGDGPRTFADLVTQEFQWSRSLVMLLLQ
FT                   YSPRLVGRLPLRLKFQFLFSQLWYPLFACFMALMFAMPIIALARGETFVAVTYPEFLAY
FT                   FAPLSIILVLLAYRWRSTAAFRPYDAKILSWECMLFLFARWPWALAGTLAALRDWITGS
FT                   FVDFRVTPKGSSEVDPLPLRVLAPYFFLAVAAVLPVLFVDDAANAKGFYLFAILNAAIY
FT                   CLLLLVIVLRHSRENAVGTASRFYRPAIGAGLLAIVALPGIATAEHGKDGLEALAWGSG
FT                   HLRLFEERYAVAGAGQGGTALRKIVFRPRWISAPAEQRDGNLERG"
FT   CDS_pept        474317..474925
FT                   /transl_table=11
FT                   /locus_tag="SM_b20461"
FT                   /old_locus_tag="SMb20461"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20461"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48843"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WA1"
FT                   /protein_id="CAC48843.1"
FT                   /translation="MKVPFFGKEGRGTRRALLGRHFVLGILPAALFLWNSPASAEVAVP
FT                   ENARTMTGVELYMIFQGKTWTWESGAGRMESEDRAFRAWAQSATGESWAEGRWSVNDRG
FT                   QLCLMAVWHSQSAAAPDKTCFSHRTLDGTIYQKREPSGDWYVFKHAEAQGGDEFNRLVR
FT                   EDLVAAKLAAVKERLEGQVKETKNSVRRKAGMNAVGGVQ"
FT   CDS_pept        474922..475899
FT                   /transl_table=11
FT                   /locus_tag="SM_b20462"
FT                   /old_locus_tag="SMb20462"
FT                   /product="probable endoglucanase H"
FT                   /EC_number="3.2.1.4"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20462"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48844"
FT                   /db_xref="GOA:Q926B7"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:Q926B7"
FT                   /protein_id="CAC48844.1"
FT                   /translation="MNRKSKAITFASLGLLLSGTVLAANMPRGIPEPNSPTMATPSDKR
FT                   PVLTENSVDFGAYDPHGDFGTPGSSKIEHLFLPWEDVDLSTLTLADDYAQARGRSLMIT
FT                   IEPWSWSPEWRVTEGELLRSILSGERDENMARVCSAAAALKSPVIIRWGQEMDETDNQF
FT                   SWSHWRGEDFKAAYRRVVNVCRSHLKNAKFMWSPKGNEGLEAFYPGDDVVDIVGLSVFG
FT                   YQPYDQGTTGRDQTFAERLAPGYGRVMNYGKPIMVAELGYEGGGSYVASWAATVAERHA
FT                   EFPQLTAVVYFNDREIYDWPQGYGRPDWRVVRDTISGQVPDGGM"
FT   CDS_pept        475899..476408
FT                   /transl_table=11
FT                   /locus_tag="SM_b20463"
FT                   /old_locus_tag="SMb20463"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20463"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48845"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:Q92WA0"
FT                   /protein_id="CAC48845.1"
FT                   /translation="MKSIYRGIPLAIALAASIAGASFAEAAAGRAERKTTPLTHAELYQ
FT                   LYGQKSWLWKEGAGYFSVQARRFIAWSKENGKPSYGVGRWFITGPGKLCFRAEWHARDG
FT                   SSPATTCFSHAKRGGVIYQRREPDGAWYVFKNARVRPDDEFAKLRRGNYVGASLNRIEA
FT                   RLGRVE"
FT   CDS_pept        complement(476597..476899)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20464"
FT                   /old_locus_tag="SMb20464"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20464"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48846"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W99"
FT                   /protein_id="CAC48846.1"
FT                   /translation="MKVKTKALFGLFEARKTVARSTLAVMLAAAAWGCSSTVSQETTAS
FT                   ITREVGYPSPERKPALGKQAVTQKTPKLVRSAYLGRAPYICTPSGFGSTSRCFLR"
FT   CDS_pept        complement(477065..478135)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20465"
FT                   /old_locus_tag="SMb20465"
FT                   /product="probable glucokinase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20465"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48847"
FT                   /db_xref="GOA:Q92W98"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W98"
FT                   /protein_id="CAC48847.1"
FT                   /translation="MGRSANEKRNGVPLIHGASDLPSVTVDDYNLELRDGDGFLGDRAN
FT                   KFAFQEKLDAWRKRVRKGGDDPLGQALTQDLSKKQVDALLRGDDKEAAALIIGAVDDFA
FT                   GELASVLERFLQQKNWKNTERVVIGGGFRGSAVGELAIARAMVLLKAEGIKIELSPIVH
FT                   HPDDAGLIGAAHLMPAWMLKGHKAILAIDIGGTNIRVGIVELHLKDETDLSKAKVWKSD
FT                   IWRHADDKPNRSTTIEGLIGMIEKLIEKADKADLAPAPVIGVACPGVINEDGSILRGGQ
FT                   NLPGGNWESEHFNLPAALKDAIPQIGDHETFVIMHNDAVVQGLSQIPFVQNASSWGILT
FT                   IGTGLGNAHFSNKAEN"
FT   CDS_pept        478310..479467
FT                   /transl_table=11
FT                   /locus_tag="SM_b20466"
FT                   /old_locus_tag="SMb20466"
FT                   /product="probable cellulase"
FT                   /function="Cellulase M and related proteins"
FT                   /EC_number="3.2.1.-"
FT                   /note="probable cellulase M,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20466"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48848"
FT                   /db_xref="GOA:Q92W97"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017537"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W97"
FT                   /protein_id="CAC48848.1"
FT                   /translation="MQTPINIDPEYLTSRLKALLDIASPTGFTDEAVRYTARELERLGL
FT                   EVKLTRRGAIRALRPGAAERPARGIVSHLDTLGAQVKALKENGRLELVSIGHWSARFAE
FT                   GARASIFSGKGTYRGSILPLKASGHTFNEEVDTQPTGWRHIELRVDALARDRNDLVQLG
FT                   IDVGDIVAIDPQPELLENGFIVSRHLDDKAGVAIMLAALEAMQREKVDTPVDTHWLFTI
FT                   GEEVGVGASAAIVPEIASLVAIDNGTTAPGQNSDEFGVTLAMADQTGPFDYHLSKKLYE
FT                   LCGEHGIRVQKDVFRYYRSDAASAVEAGHDVRTALVTFGVDASHGYERIHLHALMSVAK
FT                   LAVYHAASEVQIERDAEEVSGLRGFTRQKVRQAEQDLKADEPDVS"
FT   CDS_pept        479716..481539
FT                   /transl_table=11
FT                   /locus_tag="SM_b20467"
FT                   /old_locus_tag="SMb20467"
FT                   /product="putative sensor kinase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20467"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48849"
FT                   /db_xref="GOA:Q92W96"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W96"
FT                   /protein_id="CAC48849.1"
FT                   /translation="MRVPRGFLRRGFNLRKWYTTLKGRMAAETGWAAALFEGAPAIATS
FT                   RQTWMNTFRARSDSVIAVARILLAIGSLWITWIDATIRPGRSDLVFWFLVIYLLYAIAA
FT                   AHFVWKAQVHRVRGTFIRHLIDVSSLVILAFLADRVSGPVFMLIPFVQLAATLHWLWRG
FT                   ALWTGSVAVAILIYLALSNTVWPFSSDADAAVALSFILFLVTATILLTWLGTHQEAVRS
FT                   ELLRLVEGTPSASDGLEWPAEAALEYAVQVARVPRALLIWSDGDEPWTNLAIWESGVCA
FT                   VRHLSPATYLPWTPEALEHASLLVIDAKRSRALVHRGGGRFDRWRGDGLPVSPALVAEF
FT                   SIASAISVQFQASDVEARLFLLDPPALTIDGVALAEIVADRLKTLFEQTILLRRLSDAA
FT                   AFEERVKIGRDIHDGVLQALAGTSLQLQTLRSSREYHEIDERLMAIQAMLSEEQTDLRA
FT                   LIRRLEPGSGRHASDSRLALRLGALAQRLRQQWSIEFRFVLYPEDLRLPVAMIDELMHM
FT                   IAEATANAARHGNARTLEARIRRDDGIVTLTLDDDGIGFGFDRRLEHAELETSKCGPRS
FT                   LRERVSMSGGNLSIDKVDQWTRITIKIPAHS"
FT   CDS_pept        481536..482180
FT                   /transl_table=11
FT                   /locus_tag="SM_b20468"
FT                   /old_locus_tag="SMb20468"
FT                   /product="putative sensory transduction DNA-binding
FT                   response regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20468"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48850"
FT                   /db_xref="GOA:Q92W95"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W95"
FT                   /protein_id="CAC48850.1"
FT                   /translation="MSVRILVVDDHRIVLDGLRRLLGAESGWEVVATCRTAADAIEALA
FT                   SKPVDLAVVDLRMPEMGGSDLIRRLRSDQPRLACVILTADISDEELAEAIENGVSGIVL
FT                   KEQAPSALIECIRAVLEGRTYFTDRSLNAAIDRIRESDTERRSVMQKLTPRELEISCLA
FT                   AAGLRSREIAARLGIAPGTVKLHLHSVYSKLNIATRVELANISQRLRFDTR"
FT   CDS_pept        complement(482210..483538)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20469"
FT                   /old_locus_tag="SMb20469"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20469"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48851"
FT                   /db_xref="GOA:Q92W94"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W94"
FT                   /protein_id="CAC48851.2"
FT                   /translation="MTKRHLGLLVCAIPGLYLLLSPIYALLHYELFAAEIPHFLRYVLI
FT                   PGVLAIAFIVVGLFARPQFSLLVGICGASLLAALFLFEAMHTVSVVSVRLGMFGQLSEA
FT                   EAETLTRNEKVVPGFTLRGLNRLAGTDELSEALLSGFPSTQVVLCTSNKGVVSYTADRF
FT                   GFNNPDHVYDKRLDVMLLGDSFVEGFCLPPGEDLASRLRGRGLSTASIGIRGNGPLMEL
FT                   ATLGRFGETLRPRRVVMVFFEGNDWENLERELTVPWLRAALSPNANYGLQATAKETMDQ
FT                   AREILAERKNAPVTSVDLLTRTALFRNFVALQQTLTRLGLVYPKITPSNPEFRRLLHRA
FT                   KALTESWGGSFTLVYVPRIDRFIGPFSSDGPFDPLRMEVLGAAAAEGIEVIDLQEAIRT
FT                   RPQPILMYAPDAHFSRDGAKFAANEILTRLAAMPENGQIVGSN"
FT   CDS_pept        483955..484386
FT                   /transl_table=11
FT                   /locus_tag="SM_b20470"
FT                   /old_locus_tag="SMb20470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20470"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48852"
FT                   /db_xref="GOA:Q92W93"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W93"
FT                   /protein_id="CAC48852.1"
FT                   /translation="MSKSHESFSEHTVEGPSNRSFGCTVGGILLGIVLVRWLVTGSLSS
FT                   ISVGLAAIGTVLVLLALAFPNSLSVPNRLWMRLGLLMFKVVNPVVMLLIYGTAIVPMGL
FT                   FLKWRGYDPLAASLDKSADTYWTTREQNEPDPATMRNQF"
FT   CDS_pept        484417..484566
FT                   /transl_table=11
FT                   /locus_tag="SM_b20471"
FT                   /old_locus_tag="SMb20471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20471"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48853"
FT                   /db_xref="GOA:Q92W92"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W92"
FT                   /protein_id="CAC48853.1"
FT                   /translation="MELVRELWTYMGIRKKFWLLPIFIVLGVFGALVVLTQGTAVAPFI
FT                   YTLF"
FT   CDS_pept        484580..486412
FT                   /transl_table=11
FT                   /locus_tag="SM_b20472"
FT                   /old_locus_tag="SMb20472"
FT                   /product="probable carbamoyltransferase"
FT                   /function="Metal-dependent proteases with possible
FT                   chaperone activity"
FT                   /EC_number="2.-.-.-"
FT                   /note="probable carbamoyltransferase, nodulation protein
FT                   U,, putative nodU gene"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20472"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48854"
FT                   /db_xref="GOA:Q92W91"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W91"
FT                   /protein_id="CAC48854.1"
FT                   /translation="MRILGISAFYHDSAAAMIEDGRIVAAAQEERFTRKKHDADFPANA
FT                   VAYCLSAAECEMTEVDHVVFYDKPILKFERLLETYLATSPRGFRSFRMAMPLWIKEKLF
FT                   QKKLLRRYLGKLAGVKEWPGSLLFTEHHLAHAASAFFPSPFASAAVLTMDGVGEWCTTS
FT                   LGHGRGKDLDILKEIRFPHSLGLLYSAFTYYTGFKVNSGEYKVMGLAPYGRPLFVQKIL
FT                   DHLIDLKEDGSFRLDQRYFDYCAGLTMTSPAFHELFGAEPRRPESPLTQREMDLAASVQ
FT                   AVTEEVVLKLARFARQETGERHLCLAGGVALNCVANGKLLKKRIFDDIWIQPAAGDAGG
FT                   AVGSALAAWHGYLGNGRSPDGRDRMTGAYLGPAFDQREVEKRLTASGAVYTVLSDDDLI
FT                   ARTVDAIVDEKAVGWMQGRMEFGPRALGGRSILGDPRSPIMQKTLNLKVKYRESFRPFA
FT                   PSVRREDVAEWFDVDVDSPYMLLVGDVLDRHRLPLGAGEAALFGIDRLNVPRSGIPAVT
FT                   HVDYSARVQTVHRDTNPRYWELLSAFKQRTGCPVLVNTSFNVRGEPIVCTPEDAFRCFM
FT                   GTEIECLVVGNCFLRKEDQSSNLRQDYKDRFELD"
FT   repeat_region   486412..486461
FT                   /note="REP (repetitive extragenic palindromic) element"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(486727..487224)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20473"
FT                   /old_locus_tag="SMb20473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20473"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48855"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W90"
FT                   /protein_id="CAC48855.1"
FT                   /translation="MQARRVIEIVQSAGYLPAELILTGYWASQSGLVVFILNGVTPQAV
FT                   DLVLDPIVVTLPMTIPGVLYVDVGDKTRVREAVLFAEEIYAATRLFRRLTIRCGIAPKL
FT                   IAPVDRAIRSLESRTLFERDARTPDVAKPQVATPVPTGNRLGWRATEARAWIQLQTSDS
FT                   SI"
FT   CDS_pept        complement(487781..488002)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20474"
FT                   /old_locus_tag="SMb20474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20474"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48856"
FT                   /db_xref="InterPro:IPR025629"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W89"
FT                   /protein_id="CAC48856.1"
FT                   /translation="MTTDKIKGPSSYFPSIEKKYGRPIGDWQALVRKHYPAKHMELVGM
FT                   LKSEHGMGHGHANALVAHTLAEDKQAAA"
FT   CDS_pept        complement(487989..488483)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20475"
FT                   /old_locus_tag="SMb20475"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20475"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48857"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W88"
FT                   /protein_id="CAC48857.1"
FT                   /translation="MSKNTICLWYDKDAEEAARFYADTFPGSKIGAVIRAPGKYPDGEE
FT                   GDVLVVEFTVAGVACIGLNGGPTFKHSEAFSFQISTEDQEETDRYWNAIVGNGGQESEC
FT                   GWCKDKWGVSWQITPRTLMDALAAGGEQAKRAFDAMMSMRKIDVAAIDAARKGVTRNDH
FT                   R"
FT   CDS_pept        488823..490388
FT                   /transl_table=11
FT                   /locus_tag="SM_b20476"
FT                   /old_locus_tag="SMb20476"
FT                   /product="putative ABC transporter periplasmic
FT                   dipeptide-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20476"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48858"
FT                   /db_xref="GOA:Q92W87"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W87"
FT                   /protein_id="CAC48858.1"
FT                   /translation="MKRLFRSAIALAALAFAGAAAAPAAAQTPPDVLVVGQIAEPQSLD
FT                   PHTVTATNDFRILVNVYDGLVRFKDGTLEVEPALAESWKISDDGKTYTFTLRQGVKFHD
FT                   GSNFDAEAVKFNFDRMLKKDHPFYDTGPFPLSFNFASVKAVNVLDEHTVEFKLSEAFAP
FT                   FLSNLAYPTGLIVSPVAVEKHGKEYGRSPSGTGPFKFVEWLSNQRVVVERNPDYWDSAA
FT                   KLQAVVFRPITDANTRVAEMMAGGIDVMVEVPPDNLATFEQDANFAVAEQAGPHVWFTI
FT                   LNTKQGPFADKRVRQAANYAVNKQTLVDDVLRGTATVAAGPIPPAFNWVESSVEPYAHD
FT                   PEKAKALLAEAGVENPQVTFYVTEGGSGMLDPITMGAAIQADLQAVGFKVKIETYEWNT
FT                   FLGRVNPGLEGKADMAEMAWMTNDPDTVPYLTLRTDAMPDKGGFNSGYYSNPQLDELLE
FT                   KARRSTDQAERGKLYGEVQSIVHDDAPWLFVANWKQNAVTTAAVKGFKLQPSFLLDLHG
FT                   VTKE"
FT   CDS_pept        490466..491413
FT                   /transl_table=11
FT                   /locus_tag="SM_b20477"
FT                   /old_locus_tag="SMb20477"
FT                   /product="putative didpeptide ABC transporter permease
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20477"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48859"
FT                   /db_xref="GOA:Q92W86"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W86"
FT                   /protein_id="CAC48859.1"
FT                   /translation="MQAYVLKRLVAVVPVLFGLSIIVFLVMGLIPGDTATAILGSYATP
FT                   ENVERINRDLGLDKPLVQQYAIWIGNVLQGDFGRSFALNRPVLDEVLERFQATLVLAGV
FT                   SLVLCSVIGLLAGVVSAVRQFGWADRVITFFVLAGISTPSFWLGLLLIYLFAVHWRILP
FT                   ASGMYAVYGRGDLKDLLLHLILPAATLAVVAAGVIARLTRGAMLEVLRQDYVRTARAKG
FT                   LPERRVIYAHAFRAALVSVVPAIGIQAGFVLGGAVYVETVFQWPGIGAMLVKAISTRDI
FT                   LLVQGGVLVVAASYVLFNLLADVVQSMLDPRIRT"
FT   CDS_pept        491410..493212
FT                   /transl_table=11
FT                   /locus_tag="SM_b20478"
FT                   /old_locus_tag="SMb20478"
FT                   /product="putative dipeptide ABC transporter permease and
FT                   ATP-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20478"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48860"
FT                   /db_xref="GOA:Q92W85"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W85"
FT                   /protein_id="CAC48860.1"
FT                   /translation="MSALAASPAPRRGSGRITSWHLLLNNRLATGGLVLLGLILLLIVL
FT                   VPILPLPDPDATAPVNRLQPVLTAGHLLGTDQLGRDILSRLLWGTRVSIAVGFAATLIA
FT                   AGIGSAIGIIAGYAGGRTDNAMMRGIDMLMAFPYILLALAIVAALGPGLMNALYAIALV
FT                   NIPFFARNVRGVTLGYAHSEFVDAARLSGKGHLSVILTEVLPNVMPVIVITMSTTAGWM
FT                   ILETAGLSFLGLGAQPPQADLGSMLGEGRAQLFTAPHVSVVPGAMIFLIVISLNVLGDG
FT                   IRDVLDPRLRSGALARPAPVTEVAPDRTAPANTAEGACLAIEKLETGFRRGKEIIPAVR
FT                   DVSLHVKPGECLGLIGESGSGKSVTALSVMGLVASPPGVIRNGAVYLGNDDVLSMPETR
FT                   LIAKRGSRLAYVFQDPLTTLHPMYPVGRQVEEAIAAHQQVRAAERREKAVALLEKVGIP
FT                   DARERSVHYPHQLSGGQRQRVGIAMALANDPEIIIADEPTTALDVTVQARILELLRDLQ
FT                   REQGMALLFITHDFGIVSEFCDRVAVMKDGEIVETGKTREVLANPQHPYTKRLIACVPE
FT                   LGTGERFLDRVAGLFAGGKAEVAQ"
FT   CDS_pept        493209..494006
FT                   /transl_table=11
FT                   /locus_tag="SM_b20479"
FT                   /old_locus_tag="SMb20479"
FT                   /product="putative dipeptide ABC transporter ATP-binding
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20479"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48861"
FT                   /db_xref="GOA:Q92W84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W84"
FT                   /protein_id="CAC48861.1"
FT                   /translation="MTGAAIQVRDLCKTFGGGRSFFGKAKHEIRAVKAVSLDVARGETL
FT                   AVVGESGSGKSTLARMLVGLEEPTSGSMLIAGRDAAALRRSGPRAFGKTIQYVFQDPVA
FT                   SLNPRKTIQEILETPLKLLCGYEAPRRRARMQELLHAVQMPEDTLLRYPHEFSGGQAQR
FT                   IAIARALATEAEIIVLDEPVSALDVSIQAQVLLLLRDLKQRFGLSYLFISHDLAVVEAI
FT                   SDRVAVMYFGEVVETAPAARLFTDPEHAYTRQLVASAPRIRKE"
FT   CDS_pept        494013..494795
FT                   /transl_table=11
FT                   /locus_tag="SM_b20480"
FT                   /old_locus_tag="SMb20480"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20480"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48862"
FT                   /db_xref="GOA:Q92W83"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W83"
FT                   /protein_id="CAC48862.1"
FT                   /translation="MPVVIEKKKETGRDGQRLFVPAERTKRRPEAIADRIKDYIRSEGL
FT                   GPGDRLPQERDLIDTFKAAKGTVREAMKALETQGLVFTRSGPGGGAFVAKPSARHAMEL
FT                   LSTHFFFDQPSISDIYAMRKVLEPEVAALLAGRVTREELIALENTIRIYDHPPADLDEQ
FT                   YRQRVAELDFHSMLAQLCPNPLLGFVCGLMHNLLRELPAARAIYADPTSLSRETGLSFQ
FT                   YRLMAALKDGRSEDARVIAAEHMAFAESYMLERAAATK"
FT   CDS_pept        494919..496694
FT                   /transl_table=11
FT                   /gene="asnO"
FT                   /locus_tag="SM_b20481"
FT                   /old_locus_tag="SMb20481"
FT                   /product="AsnO"
FT                   /function="Glucosamine 6-phosphate synthetase, contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /EC_number="6.3.5.4"
FT                   /note="asparagine synthase, glutamine-hydrolyzing,, PMID:
FT                   11389771"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20481"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48863"
FT                   /db_xref="GOA:Q92W82"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017535"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W82"
FT                   /protein_id="CAC48863.1"
FT                   /translation="MCGICGEVRFDGGSPSVTAVSIMADVLAPRGPDASGVVVRGNVGL
FT                   GHRRLRILDLSDKSQQPMVDSDLGLSLVFNGCIYNFRELRLELEEKGYRFFSSGDTEVI
FT                   LKAWHAWGEECVSRFHGMFAFVIHERDSGRVVMARDRFGIKPLYIAEVQGALRFASALP
FT                   ALVKAGGVDTSIDVAALHNYMTFHAVVPPPRTILNGVRKLPPATLRVYERDGSFEDRRY
FT                   WDPPYRRQAGDAAISREEWQEQLLDALRIAVKRRMVADVPVGVLLSGGVDSSLIVGLLA
FT                   EAGQRGLMSFSVGFEEANGEKGDEFVYSDLIAGHFGTDHRKIFVPSADLMGALPGTIAA
FT                   MSEPMVSYDNVGFYLLSKEVSKHVKVVQSGQGADEVFGGYHWYPPLMNSNDVVADYGKA
FT                   FRDRSHAVLTTQLSDAWIADHDVSGDLLNEHLLREGAATPVDQALRLDSNVMLVDDPVK
FT                   RVDNMTMAWGLEARVPFLDHELVELAARMPPEEKLRDGGKGILKDVARRVIPSEVIDRK
FT                   KGYFPVPQLKYIAGPYLDLIRDTLRSQKARERGLFQDAYLDRLFQEPSDHITPLRGSEL
FT                   WQVGLLEMWLEAQGV"
FT   CDS_pept        496696..498483
FT                   /transl_table=11
FT                   /locus_tag="SM_b20482"
FT                   /old_locus_tag="SMb20482"
FT                   /product="probable D-alanine-D-alanine-ligase"
FT                   /function="Acetyltransferases"
FT                   /EC_number="6.-.-.-"
FT                   /note="probable D-alanine-D-alanine-ligase,, ATP-grasp
FT                   fold"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20482"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48864"
FT                   /db_xref="GOA:Q92W81"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017534"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W81"
FT                   /protein_id="CAC48864.1"
FT                   /translation="MKKSREIALPRQRSKGTKAVTHRLNRLRTHTQPGRDAEGSRTAGG
FT                   AKRDVVLDCGWGRLLFAQTFSDDEKLLSELREEAPSSRDIAFYVRDPHVLLSRAPQEIF
FT                   LDPSHTYRLDLWTYRANTRRTRGITIRRLASEADGDGVNRVYAACGMVQIRSDFFSSER
FT                   DDRSLTYFVAQDDATGEIVGTVTGIDHQRLFDDPDRGASLWCLAVHPQARQPGIGEHLV
FT                   RKLAEHFQARGLSYVDLSVMHDNTLAIGLYEKLNFRRMPLFAIKRKNAINEKFFAMPHQ
FT                   SYDALNPYARLIVDEATRRGIHVEITDAEGGFFRLSHGGRSIHCRESLSELTSGVAMSI
FT                   CDDKAITRRMVSAAGLVVPDQIEVDENGKAIQDFLKKHGKLVVKPARGEQGRGISVGIT
FT                   TMEALEEAIASARQVCDRVLLEAFFEGEDLRLVIIDYTLVAAAVRLPPRVIGDGRSKIA
FT                   SLIGKQSRRREAATGGESRIPLDAETDRCLAEQGLDLETILEEGREITVRKAANLHAGG
FT                   SIHDVTEIVHPDLVEAACRAARAINIPVVGIDLMVRDPAEPDYVFIEANERPGLANHEP
FT                   QPTAASFIELLFPGSRTAV"
FT   CDS_pept        complement(498491..499561)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20483"
FT                   /old_locus_tag="SMb20483"
FT                   /product="probable transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="probable HTH lacI-type transcriptional regulator
FT                   purR, (purine nucleotide synthesis repressor),, periplasmic
FT                   binding protein,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20483"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48865"
FT                   /db_xref="GOA:Q92W80"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W80"
FT                   /protein_id="CAC48865.1"
FT                   /translation="MTNGGRKKATIYDLSVLSGSSPSTVSAVLNGTWRKRRIKESTAEL
FT                   IRSLAETHQYTANRQARGLRSSRSGLVGLLLPVHDNRYFSSLAQTFEAHVRSKGQCPIV
FT                   VSASRDPEEERRTAETLISYSIDELFICGATDPDGVHEVCEAAGLRHINIDLPGTKVPS
FT                   VISDNFEGGRLLTEAIIRHFPAERPLEPDDLYLFGGRDDHATRERIRGFRAVKSDLLGA
FT                   DPDECIWPTGYAADNARKAFEAFYEQHGKLPRGFFVNSSINFEGLLRFMAEHPLENFTD
FT                   LVVGCYDYDPFASFLPFPVIMIRQNIEGMIAKAFEVIEEPRASLQIHMIEPQLVPPRTA
FT                   LTGPLDALMDSEMPRE"
FT   CDS_pept        499835..500827
FT                   /transl_table=11
FT                   /locus_tag="SM_b20484"
FT                   /old_locus_tag="SMb20484"
FT                   /product="putative ABC transporter periplasmic
FT                   sugar-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20484"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48866"
FT                   /db_xref="GOA:Q92W79"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W79"
FT                   /protein_id="CAC48866.1"
FT                   /translation="MIKKILAAALAASLSLAGAYTAAAQDTGKVGVVVKIGGIPWFNAM
FT                   EAGIKERGEKLGVDAFMVGPTSADPALQVRAIEDLIAQNVKVIGVVPNDAKVLEPVLTK
FT                   AREKGIIVITHESPSQKGADWDFELASATGFGEAHAKLLAEKMGGKGEYAVFVGSLTVP
FT                   LHNAWADAAIEYIKKNHPEMTLVGDRYGVAEDVDKSRSTALDLISAHPDLKGFLAFGSQ
FT                   GPIGAGRAIEERRKVGEIFVLGPFSPGQGQKLIKSDAISGGFMWNPKQAGEVFVTLAAK
FT                   LMKGEEIKDGEEIEGLGVIHPDFENRNIIVDQLVPINKETVADLAAMGL"
FT   CDS_pept        500933..502462
FT                   /transl_table=11
FT                   /locus_tag="SM_b20485"
FT                   /old_locus_tag="SMb20485"
FT                   /product="putative sugar ABC transporter ATP-binding
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20485"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48867"
FT                   /db_xref="GOA:Q92W78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W78"
FT                   /protein_id="CAC48867.1"
FT                   /translation="MGLDSMHQSASAASTDKPLLSLRNINMTFGGVKALKNVSFEVQPG
FT                   EVHCLAGENGCGKSTLIKVITGVYRPAEGAVIEYDGETYPHMSPVTAQDRGIQVIWQDL
FT                   ALFPEMTVAENIAFHEVLGGRPRLVDYGRMRRIAVDALGRLGITLDVDLPLKEYAIAQR
FT                   QIVAIARALVGEAKLVFMDEPTASLTQSETDHLLEIVRSLSASGVAVVFVSHRLAEVLE
FT                   ISSRITVLRDGALVGVYPAAGMTQSKITELMTGKTFDQHVRARPRDDQPVVLDVRGLTR
FT                   PGQFEDISFTVRRGETVGITGLLGAGRTEVALALFGMLKPATGTISIDGREVRFGSNRE
FT                   AIRAGVAYLSEDRLSLGLIQPQPIADNLVIASLRKILSGGLLSEDRKRSLVSRWIADLG
FT                   VKIGHQADAISTLSGGNQQRVAIAKWLATDPKLLILDSPTVGVDVGARAGIFDIVAKLA
FT                   ESGLAIILISDEVPEVYFNADRVLHMAQGRIVGTYDPRQSRLEEIEAAVYA"
FT   CDS_pept        502455..503456
FT                   /transl_table=11
FT                   /locus_tag="SM_b20486"
FT                   /old_locus_tag="SMb20486"
FT                   /product="probable sugar ABC transporter"
FT                   /function="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative inner-membrane sugar ABC
FT                   transporter,,permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20486"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48868"
FT                   /db_xref="GOA:Q92W77"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W77"
FT                   /protein_id="CAC48868.1"
FT                   /translation="MRSLIRTHATEFSLLAVIVVISTVLSFATANFFSLGNAFDLLNIS
FT                   AVNIIFAVGLLVVLIAGGIDISFAVAASVVQYGTAIALGWIGGGGWISGLLIAGSLGVL
FT                   LGCFNAFLIHRFRIISIVATISTFNIYFGLLMFFTRGVSIYDLPDWLTDRVILFEREMP
FT                   DGTWIEITLPVLVMIVCVIATWTLITRTTTGRQLYAFGDNPEGARRFGINIGAMQFIAF
FT                   GWLGLMAGIGGLIQAHYAQEVVPNALYGRELDVLAAVVLGGARLGGGKGTVLGCVLGVL
FT                   LISITQNGLNLMGVSPFAFKMIIGAIILIAITLSSTRIERLLPFVGQKGTGR"
FT   CDS_pept        503453..504451
FT                   /transl_table=11
FT                   /locus_tag="SM_b20487"
FT                   /old_locus_tag="SMb20487"
FT                   /product="probable sugar ABC transporter"
FT                   /function="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative inner-membrane sugar ABC
FT                   transporter,,permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20487"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48869"
FT                   /db_xref="GOA:Q92W76"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W76"
FT                   /protein_id="CAC48869.1"
FT                   /translation="MTTVFERIKAAIGPEMAGPGLAFVAVVLVFGIASPQFLSAATFGS
FT                   VAFQLPELGLLTLAMLLPILTGGLNLAITFTANLAGLTLAWVLKANGGADAGFGIFLVG
FT                   SLLAVMVGAASGVVMGLVIAFTRAHPILVSLSMMIFLRGLGEFLTRGGDISGFPPFVGV
FT                   IGHGSVAGIPVPLIVFVVCVLAWHLLLGRTKLGFNTYMIGSNLEATRYSGINTRKAIVL
FT                   VYTLSGVMCSIAGIIMLARFNSVRIGHGESYLLITVLACFLGGVNPFGGFGRVIPVFVA
FT                   LVVLQLLSSGLNLIGANQHLATAVWGILLVGVMILRWAVSRIKISIVRRGS"
FT   CDS_pept        504454..505302
FT                   /transl_table=11
FT                   /locus_tag="SM_b20488"
FT                   /old_locus_tag="SMb20488"
FT                   /product="probable D-tagatose 3-epimerase"
FT                   /function="Sugar phosphate isomerases/epimerases"
FT                   /EC_number="5.3.1.-"
FT                   /note="Conserved hypothetical protein"
FT                   /note="probable D-tagatose 3-epimerase,, AP
FT                   endonuclease,family 2, xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20488"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48870"
FT                   /db_xref="GOA:Q92W75"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W75"
FT                   /protein_id="CAC48870.1"
FT                   /translation="MQGFGVHTSMWTMNWDRPGAERAVAAAVKYKVDFIEIPMLNPPAV
FT                   DTEHTRGLLEKSRLRAVCSLGLPERAWASVRPEAAIDHLKIAIDKTADLGGEALSGVIY
FT                   GGIGERTGVPPTVEEYDNIARVLQAAAKHAKSRGIELGVEAVNRYENHLINTGWQAVKM
FT                   IERVGADNVFVHLDTYHMNIEEKGVGKGILDAREHLKYIHLSESDRGTPGYGTCGWDEI
FT                   FSTLAAIGFKGGLAMESFINMPPEVAYGLAVWRPVAKDEEEVMGNGLPFLRNKATQYGL
FT                   I"
FT   CDS_pept        505347..506819
FT                   /transl_table=11
FT                   /locus_tag="SM_b20489"
FT                   /old_locus_tag="SMb20489"
FT                   /product="probable carbohydrate kinase"
FT                   /function="Glycerol kinase"
FT                   /EC_number="2.7.1.51"
FT                   /note="putative L-fuculokinase,, putative fucK gene"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20489"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48871"
FT                   /db_xref="GOA:Q92W74"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W74"
FT                   /protein_id="CAC48871.1"
FT                   /translation="MNDRDSGAAPVAVLDVGKTNVKLSAVAADGTLVETISVPNRVLPG
FT                   PPWRHHDLTRLGGWVFETLAVLSRRHGLAAVVAAGHGSGGVLTGADPDVGDGAALPMID
FT                   YEQPLPPDIRDGYSPLAGTFLDRGSATMHGATHQARQLYWMEEREPDAFGKARWYLGLP
FT                   QYWAWRLSGVAASEASFLGAQSHLWNVAERRFSPIVSARGWERLMPPFSKAWQTLGWIR
FT                   PELVRRFGLPAEMRVLTGGHDSSLNHYRYHAAGLRDFTVISTGTWIVGFSRSTPIERLD
FT                   EHRGMTLNSDVFGNRLGGILTMGGREFSHIAGSNPPTDDAPIEVLGRLVAQRTIAAPSF
FT                   GDDDGLFPGSAGRGRILGPAAETAMERKALALLYCALLTVECIEALSADRLVVLDGSFL
FT                   RDPLYAGVVAALLPERQVRFNLDAYGVAAGAALLAGHETREKPAPLALSESIDLARLNP
FT                   DLSRYAANWRAVARAMRGNRDKFENTEGNLHG"
FT   CDS_pept        506812..507510
FT                   /transl_table=11
FT                   /gene="fucA2"
FT                   /locus_tag="SM_b20490"
FT                   /old_locus_tag="SMb20490"
FT                   /product="L-fuculose-phosphate aldolase"
FT                   /function="L-fuculose 1-phosphate = glycerone phosphate +
FT                   (S)-lactaldehyde"
FT                   /EC_number="4.1.2.17"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20490"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48872"
FT                   /db_xref="GOA:Q92W73"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W73"
FT                   /protein_id="CAC48872.1"
FT                   /translation="MAETETDKLALRREMVDICRRMNLSGINQGTAGNLSVRTDDGFLI
FT                   TPSSMPYDTMQPDDLVEMGFDGTYVGHRPSSEWRFHRDILRARTDIDVVLHCHSIYATT
FT                   LACHHKTIPSFHYMTGIAGGTTIRCAEYATFGTQALSDNALLALKDRLACLLGQHGQIS
FT                   LGKTLEQALWLAIEVETLSRIYVQALTLGEPPILPDDEMERVIAQMRRMSYGQAPDPEG
FT                   VNDVARPRVS"
FT   CDS_pept        complement(507618..508478)
FT                   /transl_table=11
FT                   /locus_tag="SM_b22020"
FT                   /old_locus_tag="SMb22020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22020"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51281"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDC2"
FT                   /protein_id="CAQ51281.1"
FT                   /translation="MLNGIDASVAARRPSGEPISRLSGSPQAVLHSGSSLQWSGPMGIT
FT                   LPNESSNYRTARDKLLQREAALRREMEAVAAEIRALPPGGVVPEDYEFDHIDGKGRPAK
FT                   VRLSELFRPGTDVLILYHYMFPRHRGDKRPKPSSGPMAELPIEDGPCPSCTALLDNWEG
FT                   AVPHVEGLGANIAAVAKAPIEQVAAFAAHRGWRNLKLLSAANNSFKRDYHGEDAEGQQL
FT                   PILTVFHKGADGLIRLSWASELLFLPADPGQDPRHLGTVEPMWTLLDLTPGGRPSTDEQ
FT                   FEYQG"
FT   CDS_pept        complement(508667..509245)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20491"
FT                   /old_locus_tag="SMb20491"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20491"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48873"
FT                   /db_xref="GOA:Q92W72"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W72"
FT                   /protein_id="CAC48873.1"
FT                   /translation="MNPERWTHLCVDMQRMFAEDTPWQVTWMPKVFDQVVEIATRFPER
FT                   TIFTRFVPPSAPEELPGTWRAYYEKWPMMTTTQLDPVLVDLVPDLKRLVPPARIFDKRT
FT                   YSPWTNGRLHSALLHQDIGTLVVTGGETDICVLAATLGAIDLGYKVILLKDAVCSATDQ
FT                   THDASLELLSKRFSVQVKVMNTEEWLSSF"
FT   CDS_pept        complement(509567..510469)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20492"
FT                   /old_locus_tag="SMb20492"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="(3R)-3-hydroxyacyl-[acyl-carrier protein] +
FT                   NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+"
FT                   /EC_number="1.1.1.100"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20492"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48874"
FT                   /db_xref="GOA:Q92W71"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3U9L"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W71"
FT                   /protein_id="CAC48874.1"
FT                   /translation="MSKKIILITGASSGFGRLTAEALAGAGHRVYASMRDIVGRNASNV
FT                   EAIAGFARDNDVDLRTLELDVQSQVSVDRAIDQIIGEDGRIDVLIHNAGHMVFGPAEAF
FT                   TPEQFAELYDINVLSTQRVNRAALPHMRRQKHGLLIWISSSSSAGGTPPYLAPYFAAKA
FT                   AMDAIAVQYARELSRWGIETSIIVPGAFTSGTNHFAHSGVPDDHARQAEYEAGPNAGLG
FT                   EEIKKAFAAIVPPDADVSLVADAIVRVVGTASGKRPFRVHVDPAEDGADVGFSVLDRLR
FT                   AEMLHRVGLSDLLKPRALA"
FT   CDS_pept        complement(510584..511318)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20493"
FT                   /old_locus_tag="SMb20493"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="(3R)-3-hydroxyacyl-[acyl-carrier protein] +
FT                   NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+"
FT                   /EC_number="1.1.1.100"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20493"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48875"
FT                   /db_xref="GOA:Q92W70"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3U5T"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W70"
FT                   /protein_id="CAC48875.1"
FT                   /translation="METNKVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEV
FT                   AGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGIMPLTTIAETGDA
FT                   VFDRVIAVNLKGTFNTLREAAQRLRVGGRIINMSTSQVGLLHPSYGIYAAAKAGVEAMT
FT                   HVLSKELRGRDITVNAVAPGPTATDLFLEGKSDEVRDRFAKLAPLERLGTPQDIAGAVA
FT                   FLAGPDGAWVNGQVLRANGGII"
FT   CDS_pept        511441..512337
FT                   /transl_table=11
FT                   /locus_tag="SM_b20494"
FT                   /old_locus_tag="SMb20494"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20494"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48876"
FT                   /db_xref="GOA:Q92W69"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W69"
FT                   /protein_id="CAC48876.1"
FT                   /translation="MDRFDAMRVFARVAERRSFTLAAEDLGLPRSTITDAVKQLEGRLG
FT                   VRLLQRTTRVVRTTLDGEAYYHRCVRLIADLEDAEAVFSGASPSGLLRIDVHGTQARHF
FT                   LLPGLKVFLDRYPDIRLHISETHQPVDIVREGYDCIVRAGHLADSPLIGRKLAELKRGT
FT                   FASPEYLARFGTPHVPEDLFDGHQMVGLLSSDTPSVAPFAFVVAGKARELTLPTVVTVT
FT                   GPETNVASACAGLGLIQVPRYRVASELASGALVEVLTDFPPSPLPVHVLYSHTRQLSPR
FT                   LRVFIDWITERYRLRES"
FT   CDS_pept        513218..514921
FT                   /transl_table=11
FT                   /locus_tag="SM_b20495"
FT                   /old_locus_tag="SMb20495"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20495"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48877"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W68"
FT                   /protein_id="CAC48877.1"
FT                   /translation="MHLLSSALSVAILFAAAPALAHDAKYHLAKNTELKQFSGNQLPTP
FT                   ATQGAQVPLWPNLTGHRSFASTASKEAQAYVDQAMMLSFGFNHAEAARSFKQAQELDPS
FT                   CAICFWGEALVLGPNINAPMDADANAVALAAVAKAVALAPNASPREQALIAALSRRYAP
FT                   DTERTVLDQAYAEAMAEVADKFPKDDDIAVLYAEALMDLNPWDYWTDAGAKPKGKTAAI
FT                   ISTLERVLARNPDHVGAIHLYIHVVEASTTPERAERHADRLAKMDIGAGHLVHMPSHIY
FT                   YRVGRYADSLAVNRRAVATDESFFQAVAPEGLYAGGYYPHNIHFLLVSAQMAGDGPTAI
FT                   EAAQKLSGVISDELARAAPAFVQPIKAAPLFAHAQFSDPETILAVARPTGDFPFVDAAW
FT                   HYMRGVAQARRGELDAARSEGAAIAEIARSADLNALEDGGMPAADVLAIAGHVLTARIA
FT                   QAADDWPAAARAFADAKKVEDRLSYMEPRHWYYPIGQSLGAALLRVGDLDRAENAFLES
FT                   LVLAPNNGWALFGLSEVYRARGDEVLAEKTSRRWRDAWVGSTSMLRLDRL"
FT   CDS_pept        complement(515354..516964)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20496"
FT                   /old_locus_tag="SMb20496"
FT                   /product="choline dehydrogenase"
FT                   /function="choline + acceptor = betaine aldehyde + reduced
FT                   acceptor"
FT                   /EC_number="1.1.99.1"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20496"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48878"
FT                   /db_xref="GOA:Q92W67"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W67"
FT                   /protein_id="CAC48878.1"
FT                   /translation="MNETIADAGSYDFIVIGAGSAGCVLANRLSADPKNRVLLLEAGGS
FT                   DRYHWVHVPIGYLYCMGNPRTDWMMRTAAEPGLNGRSLPYPRGKLLGGCSSINGMIYMR
FT                   GQAADYDGWRQAGNTGWGWDDVLPYFLKSEDNFRGKSPMHGAGGEWRVERQRLSWPILD
FT                   AFRDAAEELGIPKAEDFNTGDNEGSGYFEVNQRGGVRWNTSKAFLRPAMKRPNLRVLTG
FT                   AETERLIFDGRRTKGVRFRLNGRIQVARATREVILSAGAINSPKILELSGVGRPDVVSA
FT                   AGAEVVHDLPGVGENLQDHLQIRTVFRIEGAKTLNQLYHSIFSRIGMGAEYMLRRSGPL
FT                   SMAPRQLGIFAKSSPSVATADLEYHVQPLSTDRLGEPLHRYPAVTVSVCNLRPESRGSV
FT                   HVTTAESSAAPDIRPNYLSTPGDRLLAAHAIRHARNLMATKAIARFRPAEMLPGSEFQS
FT                   EDELIRRAGDIATTIFHPVGTCKMGTDPMAVVDPSLKVHGLDGLRVVDASIMPSIVSGN
FT                   TNSPVIMIAEKAAEAILHR"
FT   CDS_pept        complement(516973..518502)
FT                   /transl_table=11
FT                   /gene="lyx"
FT                   /locus_tag="SM_b20497"
FT                   /old_locus_tag="SMb20497"
FT                   /product="putative L-xylulose kinase protein"
FT                   /EC_number="2.7.1.53"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20497"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48879"
FT                   /db_xref="GOA:Q92W66"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W66"
FT                   /protein_id="CAC48879.1"
FT                   /translation="MGDYLLGLDAGNTVIKAVIFDRKGKEIASAAAEGHSRMPYPGHVE
FT                   RDLDELWENARRVIRKCIDEAGIDAGELAAIGCAGHGNGLYALDHEGRPLLGIQSLDTR
FT                   AAALVEEWTSQGVGDRTYPIGQQRPWPSQTPTLLAWMKRYRPEVFASIGTIFLCKDFIV
FT                   NRLTGARVSDVSDMTGCGLLNVAGRHYDRELMAAYGLCESMDLLPPLVESAEIAGRITE
FT                   AAAAGTGLAAGTPVVGGLFDVVASAIGSGVTRTGAASIIAGTWSINQVIIERPELQGPV
FT                   FMSSTFDRDRYMAIESSATSAANLEWLVREFFSEVRSDGRSPFDLCCELASSSDPAFDD
FT                   PIYHPYLYGAQQDGSARAGFYGIAGWHTKGHLVRAVLEGVAFGHRQHIETMRKAGAAFD
FT                   EAVLSGGGSRSLIWPQIFADVIGVPVSVAGSRETGALGAAIAAATGVGIFSDFAEGAAA
FT                   MVKTERHYLPNRALEAHYARRYALYRDIADVMTPLWRRLSAMQAITAGVAA"
FT   CDS_pept        complement(518533..519375)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20498"
FT                   /old_locus_tag="SMb20498"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /function="D-fructose 1,6-bisphosphate = glycerone
FT                   phosphate + D-glyceraldehyde 3-phosphate"
FT                   /EC_number="4.1.2.13"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20498"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48880"
FT                   /db_xref="GOA:Q92W65"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W65"
FT                   /protein_id="CAC48880.1"
FT                   /translation="MRTNSKVRMNRLFNRGRCLDVAIDHGVCNEPSFLSGLENMETVVK
FT                   ALTAAAPDAIQMNYGQADLLQDLPGKDKPALVMRIDMGNPYNRIRHRDMWAVLQNEAEP
FT                   LIGALAMDAACVVVNLFMLPDEPDLFRQCVQNIARVRADCDKYRMPLMIEPLVMQPVTE
FT                   HGGYMVDGDADKIVTLTRLAREMGADIVKADPTNDVDEFHRVVEAARCPVLVRGGGKED
FT                   LRSVLDKSAALMKQGAMGMVYGRNIYQHSNPKAVVRALMAIVHDNASGEEAFALYRQS"
FT   CDS_pept        complement(519442..521175)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20499"
FT                   /old_locus_tag="SMb20499"
FT                   /product="putative glycerol-3-phosphate dehydrogenase
FT                   protein"
FT                   /EC_number="1.1.99.5"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20499"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48881"
FT                   /db_xref="GOA:Q92W64"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W64"
FT                   /protein_id="CAC48881.1"
FT                   /translation="MTRTEILDGLRQSPKVDVCVLGGGINGLSVFRELALQGVRVLLVE
FT                   KHDYCSGASAALSRMVHGGLRYLENGEFTLVKESLVERDRLLRNAPHLVSPLATTVPVF
FT                   DIFSGLANGIVRFLGLSRRPSRRGAIAIKAGLSIYDLLTRKRALMPRHRFRGRRATLAK
FT                   WPALNPKIRSSATYYDAWVSHPERIGMELLQDGLSASTEAAALNYAELRRNEAGTYIIA
FT                   DDVEGVSVEIEPSLIVNATGGWIDITNGALLPPDHRSAPLMGGTKGSHLIIDNVHLRDA
FT                   LGDHMIYYENEDGRICILFPYFGKVLVGSTDIRVDDPGTVRCEEEERDYILQSLAFVLP
FT                   GIEIGPEEIVYKFSGVRPLPASSDSFTGRIPRDHFCTMIESAGTPVLCMIGGKWTTFRS
FT                   FGELAADTVLERLGLPRRTSTADRAIGGGRRFPADRESWIAALAARCGLPPPHVAELFS
FT                   RYGTEAEALAAFIGQGSDAAIPGAGHTMRELLFLIRNEAVEHLDDLLLRRTTLAISGTL
FT                   SLAILDAALELLTGEKGWSEARSLSERNRCLALLRDRHGVDEKALAARMPPPLAKAVAA
FT                   G"
FT   CDS_pept        complement(521187..522182)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20500"
FT                   /old_locus_tag="SMb20500"
FT                   /product="putative aldoketo reductase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20500"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48882"
FT                   /db_xref="GOA:Q92W63"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W63"
FT                   /protein_id="CAC48882.1"
FT                   /translation="MNGQQIMREIGRSGVAASAVGLGTWAIGGWMWGGTDERESVAAIQ
FT                   ASLDAGVTLIDTAPAYGLGRAEEIVGKALSGRRDKAVIATKCGLVWHTQQGNHFFDQDG
FT                   RPVHRHLGRESIFHEVEQSLRRLGTDYIDLYITHWQDPTTPIEETMRALEDLRAAGKIR
FT                   AIGASNVNLEELQIYVQIGGLDAIQERFSMLDREIEAQLLPVTMANGVATLSYSSLALG
FT                   LLSGSIGPERVFSGDDQRRNNPRFSVANREKVTRFAEAIRPIAQEYEGSIAQIVIAWTL
FT                   AQPGITFALCGARNPAQALDNAGAGTIRLSAEALSAIDAAIAAELANMDR"
FT   CDS_pept        complement(522179..523183)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20501"
FT                   /old_locus_tag="SMb20501"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20501"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48883"
FT                   /db_xref="GOA:Q92W62"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W62"
FT                   /protein_id="CAC48883.2"
FT                   /translation="MPNAKPKSMSAPREEIVIARQMHQALVLHFLEGMTQAQIADQLGI
FT                   SHATVNRLIKRGRQLGLVEIKIKSPVEPLVEIEEQLLALGGIRRAVVVPTVSDNPQIAL
FT                   QSVGEAAARLMLEQISDGDTICITGGKGVSAVVAGLQPSRRFDIEVIPATGCVQGKHYT
FT                   DVNHVSTLMADRLGGHSFQIHAPLFADSEAERKMLLGMRSVADVFKRARDAKIAVVGIG
FT                   SILSDDSSYYDLHPSSSTDREAIEQSGASCELLAHLLDDHGRVCGYGLNRRLVSLTLSE
FT                   FASIPTKIGVASGPSKAGPILSVMRGNHLDTLVTDQATGARILELAKEGGERS"
FT   CDS_pept        complement(523185..524177)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20502"
FT                   /old_locus_tag="SMb20502"
FT                   /product="probable sugar ABC transporter"
FT                   /function="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative inner-membrane sugar ABC
FT                   transporter,,permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20502"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48884"
FT                   /db_xref="GOA:Q92W61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W61"
FT                   /protein_id="CAC48884.1"
FT                   /translation="MAVDTLAVAQKTRRPTWKRIGTMREAGLIAIILSLSVIMSFASPH
FT                   FLTLGNFRAMLMSFSVEGIVVVGMTILLIVGGIDLSVGSVVCFSMVLSGSLFLMGVDPW
FT                   TASLVGIAASAAIGCIMGFFVTVVGLNHFITSLAAMVIVRGLCLVITKGTPLSLFTLPP
FT                   AFKAVGQGTFFGVPYVILIFIAVVGAFDFLLRRATAFRKVFYTGSNEKAALYSGIKTKD
FT                   VKFWVTVLCATLSGVAGTIYMSRFGAATPTFGVGMELNIIAAAVIGGASLNGGSGTILG
FT                   AILGIALLSVVTSSLILLDVSVYWQDMIKGCILLAAVSIDHLLNKRKAL"
FT   CDS_pept        complement(524197..525735)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20503"
FT                   /old_locus_tag="SMb20503"
FT                   /product="putative sugar ABC transporter ATP-binding
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20503"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48885"
FT                   /db_xref="GOA:Q92W60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92W60"
FT                   /protein_id="CAC48885.1"
FT                   /translation="MTSETVLEIRNVSKHFGAVKALTAVDFRLARGEVHALCGENGAGK
FT                   STLMNVIAGVLQPSEGEVLIEGAPVKIASPAVAQSLGIALVHQEIALCPDATIAENMFM
FT                   AATNRRRSALMNYAQLERDAQAVMNRLAPIDVSQKVGDLPISSQQLVEIAKALTLDCRV
FT                   LIFDEPTAALTETEAQVLFGIIRDLKARGISIIYISHRMAEVFSLCDRVTVFRDGRYVA
FT                   TEMVSDVTPDDVVRLMVGREISQLYPDKQPSSERLGEPILSVRDLGGERFRDVSFELRY
FT                   GEILGVGGLIGSGRTEIAEGICALRPVTQGEIRLHDKVLRLRRYSDAAKAGVVYLSEDR
FT                   KGSGVFLDLSIAQNIAALDLKALTSLGLLNSREERALAEDLTRRLGVRMGGVDMPVSSL
FT                   SGGNQQKVAIAKQLAVDPKVILMDEPTRGIDVGAKSEIHRLLRELARAGIGILVISSEL
FT                   PELIGLCDRVLVVREGRIAGEVSGNEMTEEVIMRLASGIGPATETNLKASGHAA"
FT   CDS_pept        complement(525801..526802)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20504"
FT                   /old_locus_tag="SMb20504"
FT                   /product="putative ABC transporter periplasmic
FT                   sugar-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20504"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48886"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W59"
FT                   /protein_id="CAC48886.1"
FT                   /translation="MAVLATTLLAGTAAAATENPFRCKPGEKYVMNVMVSGVEYWFPVY
FT                   EMFKQAGQQFGCETEYTGTPEYDVNKQIASFDQALAQNPAGILVHPMNSDPFIEPINRA
FT                   TDQGTAVVTFAADSPLSKRVSYITSDNTREGIYAADKIAEKLGGKGEYAVLENPGQDNH
FT                   DKRIAAFIARMEEKWPDMKLVGRAASNQDPNKAYQGLTSLIQANPNLGAVFMPEANSAI
FT                   GAAQANKETGGKVLVMCADVNANILDMIKAGEVFGSINPNQGMQGYMGFLLLWLAKHPE
FT                   LIDPMNDAKRSGFNPMSIPVVDNGLSIVTADNADDFYWDKYLKRRGTKGIEE"
FT   CDS_pept        527073..527861
FT                   /transl_table=11
FT                   /gene="tfxG"
FT                   /locus_tag="SM_b20505"
FT                   /old_locus_tag="SMb20505"
FT                   /product="putative trifolitoxin immunity protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20505"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48887"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W58"
FT                   /protein_id="CAC48887.1"
FT                   /translation="MTEDAEIPLTGGERTAVTRRGSVVLREAGPWTRSVHALLRHLREV
FT                   GFEGAPCVVGDGFDEHGREVLTYIDGKVINPTPWSDEAIWGLGDLIRRLHEAAATFRPP
FT                   PDAVWRGWFGRSIGKADIIGHCDAAPWNVISRHGNPVALIDWEAAGPVDRLTELAMIAW
FT                   NNAQLYDDDVAERNRLPDTESRMRQVRLFADGYCLAAPERHRLGYRIIEFAAESAANEV
FT                   IEQGITPKTEHVPRVWGIAWQTRSVAWLLRNRSALERALV"
FT   CDS_pept        complement(527905..528858)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20506"
FT                   /old_locus_tag="SMb20506"
FT                   /product="probable sugar ABC transporter"
FT                   /function="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative inner-membrane sugar ABC
FT                   transporter,,permease component, putative araH gene"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20506"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48888"
FT                   /db_xref="GOA:Q92W57"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W57"
FT                   /protein_id="CAC48888.1"
FT                   /translation="MTTSLKKLLLGEQGLLVIFAAAFVVVALTVPNFLTERNMLGLLQS
FT                   VVTIGVVACTMMFCLASRDFDLSVGSTVAFSGMVAVMASNATGSIVLGLLAALACGGIV
FT                   GLANGIVIARFRINALITTLATMQIVRGFALIASDGRAVGINDPVFYQLSLSKFLTVPT
FT                   PIWVMALFFIVFGFLLNRTVFGKNTLAIGGNPEASRLAGVDVARMRIWIFALQGLVCAV
FT                   AGVLLASRITSGQPNAATGLELSVISACVLGGVSLAGGRATMTGVVVGVLIMGIAENVM
FT                   NLLNIQAFYQYVVRGLILLIAVLLDNMRSVAGRPRA"
FT   CDS_pept        complement(528861..530387)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20507"
FT                   /old_locus_tag="SMb20507"
FT                   /product="probable sugar ABC transporter"
FT                   /function="ABC-type uncharacterized transport
FT                   systems,ATPase components"
FT                   /note="putative arabinose ABC transporter, membrane
FT                   component, ATP-binding,, putative araG gene"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20507"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48889"
FT                   /db_xref="GOA:Q92W56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017917"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92W56"
FT                   /protein_id="CAC48889.1"
FT                   /translation="MQDFLEFQSISKGYPGVQALSEVSFSVRKGAVHGLMGENGAGKST
FT                   LIRVLSGDQAADTGEIRINGEPQHYRSVRDAFNAGVIVIHQELQLVPELTVAENLWLGR
FT                   FPGKAGVIDRRQLIRVVSDRLAEIGIDVDPEAKVASLSIGERQMVEIAKAVMTDARVIA
FT                   LDEPTSSLSSRESEILFALIDRLRSNGTVILYVSHRLDEIFRLCNSLTVLRDGRLAAHH
FT                   PDISKVGREQIIAEMVGREISNIWGWRARTLGAARLTVERVSGANLPQPISFTVRAGEI
FT                   LGFFGLIGAGRSEMARLVYGADRRRQGKVLVDGLAVPADSPRLSIRAGVVLCPEDRKFD
FT                   GIVQGRSIEENMAISSRRHFSPFGVVDKGKEAELAERFIAKLRVRTPSRHQDIVNLSGG
FT                   NQQKVILGRWLSEEGVKVLLIDEPTRGIDVGAKSEIYEILYELAAQGMAIVVISSELPE
FT                   VMGIADRILVMCEGRIAAEIDRSDFDEHRILAAALPDASATTATLPEQVS"
FT   CDS_pept        complement(530452..531435)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20508"
FT                   /old_locus_tag="SMb20508"
FT                   /product="probable sugar ABC transporter"
FT                   /function="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative arabinose ABC
FT                   transporter,,extracellular/periplasmic substrate-binding
FT                   component,,putative araF gene"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20508"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48890"
FT                   /db_xref="GOA:Q92W55"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR026266"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W55"
FT                   /protein_id="CAC48890.1"
FT                   /translation="MRFIKAVALAGTVAIFAATSAFAADVKIGFIVKQPEEPWFQDEWK
FT                   FADEAAKEKGFTLVKIGAQDGEKVQSAIDNLGAQGAQGFIICTPDVKLGPGIVAKAAAN
FT                   DLKLMTVDDRLVNADGSPIEDVPHMGISATKIGEAVGEAIVAEIKKRGWDMKEVGAIRV
FT                   SYDQLPTAVDRVEGALSVLKANGFPEANVFDAPQAKTDTEAALNAATVVLNKNAGIKKW
FT                   VAVGLNDEAVLGAVRATETVGIPADSMIGIGIGGADSAINEFKKPSATGFFGTVIISPK
FT                   RHGYETALNMYEWIANGKEPEKLILTAGQLALRDNYEAVRKELGIE"
FT   CDS_pept        531624..532391
FT                   /transl_table=11
FT                   /locus_tag="SM_b20509"
FT                   /old_locus_tag="SMb20509"
FT                   /product="putative transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="putative HTH gntR-type regulator family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20509"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48891"
FT                   /db_xref="GOA:Q92W54"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W54"
FT                   /protein_id="CAC48891.1"
FT                   /translation="MEISVQGQQDQSTEPSGAPSRRPRVQKDVTRAIAAEICGDDYPAG
FT                   SFLPRENDLCERYGVSRTVIRESLKILESKGLVRGRSRVGTVVCSKDEWNILDQQVLEW
FT                   IGDRIFQFDLLNCILEARRAIEPIAAELAAARATVQEIAAIERAWQQMRDAEGDIVKFT
FT                   AADVAFHESLLKASHNQVFQQLASIIQAGLKFSLQASNEAADTCGDAVEIHRQLVEALR
FT                   MRDTAAARACSCQLLDLAARDLAVAVKRHSPPA"
FT   CDS_pept        532438..533586
FT                   /transl_table=11
FT                   /gene="dgoA"
FT                   /locus_tag="SM_b20510"
FT                   /old_locus_tag="SMb20510"
FT                   /product="probable galactonate dehydratase"
FT                   /function="Enolase"
FT                   /EC_number="4.2.1.6"
FT                   /note="probable galactonate dehydratase,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20510"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48892"
FT                   /db_xref="GOA:Q92W53"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W53"
FT                   /protein_id="CAC48892.1"
FT                   /translation="MKITKLTTYIVPPRWLFLKIETDEGVVGWGEPVVEGRALTVEAAV
FT                   HELSDYLVGKDPFLIEDHWNVLYRGGFYRGGAIHMSALAGIDQALWDIKGKALGQPVHS
FT                   LLGGQCRDRIKVYSWIGGDRPSDVANNAREVVARGFKAIKLNGCEEMQIVDTNEKIDKA
FT                   VETIGLIRDAIGPHVGIGVDFHGRVHRPMAKVLAKELEPFKLMFIEEPVLSENREALRE
FT                   IANHCSTPIALGERLYSRWDFKSVLSDGFVDIIQPDLSHAGGITECRKIAAMAEAYDVA
FT                   LAPHCPLGPIALAACLQVDAVSYNAFIQEQSLGIHYNEANDILDYISNKEVFAYEDGFV
FT                   SIPQGPGLGIEVDEAYVMERAKEGHRWRNPVWRHSDGSVAEW"
FT   CDS_pept        533617..534396
FT                   /transl_table=11
FT                   /locus_tag="SM_b20511"
FT                   /old_locus_tag="SMb20511"
FT                   /product="putative oxidoreductase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20511"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48893"
FT                   /db_xref="GOA:Q92W52"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W52"
FT                   /protein_id="CAC48893.1"
FT                   /translation="MSDRLKGKRIMVTGAAQGIGLAIAEAFLSERAALFLLDRDGPLLE
FT                   KEAKRLQRQGQSLAYAEADITDAEAIESTLSAAASSIGPINALVNNAGVNVFSEPLEMS
FT                   NADWQRCFDINLRGAWNCCKAVLPSLIEQGGGAILNIASTHAFTIIPHTFPYPVAKHAL
FT                   IGMTKALGIEYASKGVRVNALAPGYVLTQKAYDYWNSFPDPAAAEAATLKLHPGGRIAT
FT                   AEEIARAAVFMISDECPFMNATCLTVDGGLSVLHHPA"
FT   CDS_pept        534745..534999
FT                   /transl_table=11
FT                   /locus_tag="SM_b22021"
FT                   /old_locus_tag="SMb22021"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22021"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51282"
FT                   /db_xref="GOA:B2FDC3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDC3"
FT                   /protein_id="CAQ51282.1"
FT                   /translation="MIENDLDDRPQYTPWIAALWVEPDMRRRGIAAKLMEAARKQASAR
FT                   GHAFCYLCARPDNSPYYLALGFKQIESEVSGLNLFSISC"
FT   CDS_pept        535094..536020
FT                   /transl_table=11
FT                   /locus_tag="SM_b20513"
FT                   /old_locus_tag="SMb20513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20513"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48894"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W51"
FT                   /protein_id="CAC48894.1"
FT                   /translation="MQHFPYIGSGPYCYANAFAMMFGKHAPSTASIEFATASPFGLQLV
FT                   GGSLPFFDPFGWTPEAGFNAALDAMGWTSSVMSAGNAGDALERLRSQLVHGPVWVGPVE
FT                   MGWLRYQPGKDGPIGADHFVVVIGIANDRVQLHDPQGYPFATLPIGDFLTAWQAETIDY
FT                   GTPFTMRFGFRQVRVVDEDDVIRASLPAAIRWLSMQRPPHLPEGTIGNGEAAEALASMI
FT                   DARCDEDLRAHLIHFAIRVGTRRLADAATCLSRIGYTDAAHIASEQAAMIGALQCPLVT
FT                   GKDAEAADLLRRLAPTYQLLLEALQSR"
FT   CDS_pept        536208..536366
FT                   /transl_table=11
FT                   /locus_tag="SM_b22022"
FT                   /old_locus_tag="SMb22022"
FT                   /product="putative partial response regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22022"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51283"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDC4"
FT                   /protein_id="CAQ51283.1"
FT                   /translation="MAVVYISGDSAAEWAINGVPNDIMLEKPFAMAEMITAVDHLLNER
FT                   STDPASA"
FT   CDS_pept        complement(536420..537637)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20514"
FT                   /old_locus_tag="SMb20514"
FT                   /product="protein-glutamate methylesterase"
FT                   /function="protein L-glutamate O5-methyl ester + H2O =
FT                   protein L-glutamate + methanol"
FT                   /EC_number="3.1.1.61"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20514"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48895"
FT                   /db_xref="GOA:Q92W50"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR011247"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W50"
FT                   /protein_id="CAC48895.1"
FT                   /translation="MATIIRIRHDPLISADISAPIVPAGKIFPSRLRFSRDRTYPFVER
FT                   FCPMEHTMGRRDVIAIGGSLGAVAALKHLLGKLPGDFAAAVFVVIHVGARGKDLLAEIL
FT                   NAHSGIPVTTAVDGEAVERRHVYVAPADHHLLVIDGVIRLGRGPRENLARPAVDPLFRS
FT                   VGLNYGPRAVAIVLTGMLNDGAAGLADLKRCGGVTVVQNPSDAVAPDMPMGALRASDVD
FT                   YRAPLEDLAALLVELTGEEAGPPILVPAEIRLEVDIALGLQIGSETMLTIANPVPISCP
FT                   ACGGVLSQIKSWPPLRFRCQVGHAYTSEALAAASEGAVDEALRVALRIIEERVTLSEKM
FT                   AQDAHRSGFAAAAAANRRRANEGREHAETLRRAIIGSGTDATAGELEDADLAVAKHPDT
FT                   IDPESS"
FT   CDS_pept        537727..541212
FT                   /transl_table=11
FT                   /locus_tag="SM_b20515"
FT                   /old_locus_tag="SMb20515"
FT                   /product="putative methyltransferase"
FT                   /function="Methylase of chemotaxis methyl-accepting
FT                   proteins"
FT                   /EC_number="2.1.1.80"
FT                   /note="putative CheR methyltransferase, SAM binding domain"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20515"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48896"
FT                   /db_xref="GOA:Q92W49"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W49"
FT                   /protein_id="CAC48896.1"
FT                   /translation="MDRELDPPIVAIGASAGGVQALQTFFDLMPSDTGATFVVIVHLDP
FT                   HARSELANILAARTRMPVTQVEDQARLESNHVYVIAPNRRLKVADGTIAALPFEEPHAL
FT                   RAPIDLFFRSLAEEHGSEFAVILTGAGADGAIGVKAVKEAGGIVLVQDPEEAEYASMPR
FT                   NAIDTEVADFVLPIRELPHRVAELLARRDQLPSHPFRADDDDMIGRILAHVRGRTGHDF
FT                   SQYKRATILRRIGRRAQIARRETFADYYNYLRENPEEAQALFSDFLISVTTFFRDPSAF
FT                   EALAERVIPQLFDGKEVADAIRVWIPGCATGEETYTMGMLLIEEAARRDLSPEIQVFGS
FT                   DLDEQALRIAREGRYPSTIESDLSEERLRRFFQREGDHYRVRRELRDVVLFASHSLLRD
FT                   PPFSHLDMISCRNLLIYLDRQLQQQVCNTFHYALNAGGFLFLGSSESADHPGLFLTVDR
FT                   EARIYRAVAGGGARRPMVLPALLGPQKPEMKSTIIRTPAAGHVSDAAVHRQMLEKIAPP
FT                   SMLVDESHHAIHLSENAGRFLRPSGGPVSTDATDLVREEFRFDVRAALHRAFERDEPTL
FT                   SMPILADLDGQPHRVYLQVKPVVQGTERTRHALVLFIEGEAIDKTQEVVLDTLDGRPTI
FT                   DEAIRRLQEELQLAQNRLRLTSEESATATEELRAANEELQSMNEEYRSTAEELETSKEE
FT                   LQSINEELQTVNNELKLKLESISRAHSDLQNLMAATDIATLFLDPSLRIKRFTPRLTEI
FT                   FNVTPSDEGRPITDFTHYLKYKRLSDDARAVLETLRPLEHEVKSRNDGWYLVRMRPYRT
FT                   VEDKIDGVVVTFLDISERRHAEEAAKESGRRLEQEMRLVELSRSPIFVWDFDDGIMQWN
FT                   RGSEELYGYSREEAIGRRKEELLKTAVPGSSFDRLRRTLSEKGRWSGELNHTTKDGRVL
FT                   TVESQIELVPFGERRLVLESTRDITDRKRWERRGQLLLNELSHRVKNTLAVVQSLARQT
FT                   LRTTRSSEDFVERFEGRLAALASAHKLLVDSEWRGAELDALARGQLDAYAGSDRRRLQI
FT                   EGEPVTLPPDLATPFGLVLHELATNAAKYGAFSTGNGQIRLSWKLGNNGRRLGVIWQER
FT                   GGPPVEPPSEQGFGGVLIEKSLPGSTVHRDFQPDGVVCTIDIELPEIRPDGAEN"
FT   CDS_pept        541280..541606
FT                   /transl_table=11
FT                   /locus_tag="SM_b20516"
FT                   /old_locus_tag="SMb20516"
FT                   /product="putative response regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20516"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48897"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W48"
FT                   /protein_id="CAC48897.1"
FT                   /translation="MEAAFLDVGAQVVGPCGTLEAALAAAKNEALALAVLDIRLGTATT
FT                   ERVIDLLNQRGIPFFFYSGQTLPDEMRKKSNGAVVIAKPATQQDIVGTAAGVLTASNLP
FT                   PSPS"
FT   CDS_pept        complement(542357..542647)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20517"
FT                   /old_locus_tag="SMb20517"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20517"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48898"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W47"
FT                   /protein_id="CAC48898.1"
FT                   /translation="MDDFDFHHGASRLGGATGTGTDFSSVTGATLTSGRAASPGVSEAD
FT                   SAGSIDPTSDLSEIAAQLAGLAEDLKALAATPIQPIPTAGDPDDQPEVSSE"
FT   CDS_pept        542829..543548
FT                   /transl_table=11
FT                   /locus_tag="SM_b20518"
FT                   /old_locus_tag="SMb20518"
FT                   /product="hypothetical protein"
FT                   /function="Predicted chitinase"
FT                   /EC_number="3.2.1.14"
FT                   /note="hypothetical protein,, putative endochitinase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20518"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48899"
FT                   /db_xref="GOA:Q92W46"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W46"
FT                   /protein_id="CAC48899.1"
FT                   /translation="MSAITAQQVRAAAKGRVNESNLASVLVALDKYGERFGMDRPHRLA
FT                   QYFAQLMHESGDFRYDREIWGATPAQQRYDTRTDLGNTPEKDGDGYLYRARTGMQLTGK
FT                   DNYQQFRDWCRAAGLDCPDFVEDPDAVNADPWERLVPLFYWDTRDLNRWADEGDAETIT
FT                   KKINGGKNGLADRFDRLARISLVPLGYRADNVLQFQADQRLQVDGDVGPQTRAAMHTRL
FT                   WRSPLAKRAGRRSKLLR"
FT   CDS_pept        543981..544349
FT                   /transl_table=11
FT                   /locus_tag="SM_b20519"
FT                   /old_locus_tag="SMb20519"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20519"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48900"
FT                   /db_xref="GOA:Q92W45"
FT                   /db_xref="InterPro:IPR010889"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W45"
FT                   /protein_id="CAC48900.1"
FT                   /translation="MRETRGRAGMIDATVHQQLGTLLAEVKNLREAFRRSEDKSDAIRA
FT                   SMHRRMDELVERVGTLEGSTVAMQGDITEMKPITDDVKKWKLMGIGALGVIGIGGAALS
FT                   VTFADVVKRGLAIFLRGG"
FT   CDS_pept        546127..546684
FT                   /transl_table=11
FT                   /locus_tag="SM_b20520"
FT                   /old_locus_tag="SMb20520"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20520"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48901"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W44"
FT                   /protein_id="CAC48901.1"
FT                   /translation="MGAINMAESIKQKLMKASDIPAFVDDVIRAGCGICAVGQDKYVLG
FT                   DGEAVADELDRKQIRRARLPQGRNCRLSALDRAVRGRRCGWCWVAIRSEPVQMRNPAIG
FT                   EENAGCSPEKESRRLRRAGADRRGRVPTPGLMTQSLGHGSSKGIRELGAPKERLNTSAA
FT                   FSCDFATCPRRAPYRPPRSRLP"
FT   CDS_pept        546977..548086
FT                   /transl_table=11
FT                   /locus_tag="SM_b20521"
FT                   /old_locus_tag="SMb20521"
FT                   /product="probable multimeric flavodoxin WrbA"
FT                   /function="multimeric flavodoxin WrbA"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20521"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48902"
FT                   /db_xref="GOA:Q92W43"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W43"
FT                   /protein_id="CAC48902.1"
FT                   /translation="MVKNSRITLSSALLEPRKGTPSPRLEEAEFRRRFLNRFQDPAFDS
FT                   FRSELDKVASAAWDAYEHQRKAPRTQKAGAPFKDPEYELSIDWLAARDAVHAAQLRHLD
FT                   ARGPARILLISGSSRSEHTCPGEMSKSYRLMRIAQEAIDQTAGVKTTVLELHRLASEYG
FT                   RMIHPCKACFSTSPALCHWPCSCYPNYSLGQVDDWMNEIYPMWVEAHGIMIVTPVNWYQ
FT                   VSSPIKLMMDRLVCADGGNPDPTATQGKDAKLAKALELEGWNYPRHLAGRLFSVIVHGD
FT                   VEGAENVRHSLSDWLCYMHLEPAGPLAELDRYIGYWKPYALSHEELDADEAVQEEVRNA
FT                   ARTLVEAVSAKRAGKLVSAGRQLSAPRQK"
FT   CDS_pept        548378..548746
FT                   /transl_table=11
FT                   /locus_tag="SM_b20522"
FT                   /old_locus_tag="SMb20522"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20522"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48903"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W42"
FT                   /protein_id="CAC48903.1"
FT                   /translation="MVNPDLHESHDLIASDRVVGTAVYDMNGENVGSIERIILEKRGGR
FT                   VAYAVMSFGGILGIGHEHYPLPWEMLDYNTDLGGFQVNITKEQVEGAPRYPAGQDYDWS
FT                   PESGRRVYDYYGIAPYWV"
FT   CDS_pept        complement(549220..550428)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20523"
FT                   /old_locus_tag="SMb20523"
FT                   /product="diguanylate cyclase signal peptide"
FT                   /function="FOG: GGDEF domain"
FT                   /note="GGDEF: diguanylate cyclase (GGDEF) domain"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20523"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48904"
FT                   /db_xref="GOA:Q92W41"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W41"
FT                   /protein_id="CAC48904.1"
FT                   /translation="MGGAISLLAVNFIVAQIFVVAFLIISVKSRSGRAAAWCAAGFAVA
FT                   SLSAICEAVLPFTPMPRLFAVGAFANVLAGFCLLRIGLGVFYSVPAKPPVLASFFIGSV
FT                   IVDLFIYDLPRGTLLHAFFYQMPFFLIQAWSAAAIIRSRRRSYADGILLCMLALSALYF
FT                   LVKIYAAVAAGSGATAADYLQSPFALISQALGAMLIVGTGVAMLGVVVKDVVDEARASS
FT                   EIDALSGLCNRRGFSSRVAPLLRDLSDHDVGTLILADIDRFKLVNDTFGHHTGDEVIRE
FT                   FSHILADVMPHRAVAGRVGGEEFAIFLPRVGLADARVVANGIRSELAVKRINGLPEGVA
FT                   VTASFGVSAVAAGELLDAAMRRADNSLYAAKAGGRNRVECAEPPIRVIASADYHRSGKY
FT                   RPT"
FT   CDS_pept        550946..551554
FT                   /transl_table=11
FT                   /locus_tag="SM_b20525"
FT                   /old_locus_tag="SMb20525"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20525"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48905"
FT                   /db_xref="GOA:Q92W40"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W40"
FT                   /protein_id="CAC48905.1"
FT                   /translation="MPPQSTRNLIVEEADALFYESGFEATSFAEIAKAVGISRGNFYHH
FT                   FKTKDDILDAVIARRMGLTRSMLDGWQTEGEDPRGRILLFVHMLIVNRAQIMDFGCPVG
FT                   TLCSELAKLDHTAQGRATEIFGLYRDWLAKQISELGAVDRAETLALHLLAWSQGVAVMA
FT                   TAFKDEAFIRNEVAGIEQWLASLLAPRNPDKGHRCSLLS"
FT   CDS_pept        complement(552144..552578)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20527"
FT                   /old_locus_tag="SMb20527"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20527"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48906"
FT                   /db_xref="GOA:Q92W39"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W39"
FT                   /protein_id="CAC48906.1"
FT                   /translation="MIAAIAPASLAQLALRLALAVPFWRSGLGKWDGFLELNDVAVLLF
FT                   TSEFQLHLPGGPYPFPAPAATAFVVAFAEVMLPIFLALGLATRLAALGLLAMAIVIQLT
FT                   VPDGWPIHLTWAAMALGLITWGAGRLSLDHWLVSPSGSAR"
FT   CDS_pept        complement(552658..553458)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20528"
FT                   /old_locus_tag="SMb20528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20528"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48907"
FT                   /db_xref="InterPro:IPR018640"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W38"
FT                   /protein_id="CAC48907.1"
FT                   /translation="MCEVRDCFLEAADDLDYPAPFVAGLLDPACPTPTLLTGPHSKAAD
FT                   RRFAVYRNNVTVSLIEALAATFPATRRITGDAFFRAMARFHIREVPPKSPLLFEYGRDF
FT                   PDFIERYAYARPMPWLADIARIERAWLDAYHAADAAALLPHVLATAKPTELANLVFEPH
FT                   PATGVVRSAYPAVTVFLANRGDGPVGRIEASVPETALITRPSLEVEVRALSRGIDIFVG
FT                   SLLEGEPFGRAAVAGHACCPNFDLATAIRVMLEAGAFAAIRHGG"
FT   CDS_pept        complement(553445..554374)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20529"
FT                   /old_locus_tag="SMb20529"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20529"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48908"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92W37"
FT                   /protein_id="CAC48908.1"
FT                   /translation="MTELTIHADRAQLGIPLFPAHPVDGLAGTSFKHQHLPAILADDEW
FT                   TGGFFEVHAENYMGAGGPPHAALTKIREDYPVSLHGVCMSIGGPQSLDKGHLARFAALV
FT                   KRYEPALVSEHLAWSTHDTTYYNDLLPLPYTEASLQRVAEHINEVQEVIGRPLLLENPS
FT                   SYLLFKESTMSETAFIRGLVRRTGCGLLLDINNVFVSATNHGFSALDYLSDFPMAHVGE
FT                   IHLAGHTEQQDDEGDLLLIDSHDKPVADAVWKLFDVVIALCGPIPTLVEWDSAIPDWPI
FT                   LKREAQAAQMLMDRHAAGLRQETLHVRG"
FT   CDS_pept        complement(554407..554745)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20530"
FT                   /old_locus_tag="SMb20530"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20530"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48909"
FT                   /db_xref="InterPro:IPR018740"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W36"
FT                   /protein_id="CAC48909.1"
FT                   /translation="MERRIMSTRSSINTAMLAGAVATALSSLASAAPLSQAEVKAAMDA
FT                   GKEKCYGVALKGQNDCAAGPGTTCQATSTVDYQGNAWKFVDGGTCTTMELPGDRNGSPE
FT                   PLTRDVPS"
FT   CDS_pept        554980..555516
FT                   /transl_table=11
FT                   /gene="rpoE7"
FT                   /locus_tag="SM_b20531"
FT                   /old_locus_tag="SMb20531"
FT                   /product="RNA polymerase sigma factor, ECF subfamily
FT                   protein"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20531"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48910"
FT                   /db_xref="GOA:Q92W35"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W35"
FT                   /protein_id="CAC48910.1"
FT                   /translation="MNGADDGDLAGLLRTALGGNEKAYSEFLQSAAALVRIWARRRVAS
FT                   VGLDPEDIVQETLLAVHLKRHTWRTGGPVKPWLFAIARHKLVDALRRHGRHSRVQLSEI
FT                   EGNLATEEAETARDWEIGRALEVLTPGQRSVVTAISVEGRTIAEAARSLDMNETAVRVA
FT                   LHRGLAAIARRFGRK"
FT   CDS_pept        555518..556156
FT                   /transl_table=11
FT                   /locus_tag="SM_b20532"
FT                   /old_locus_tag="SMb20532"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20532"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48911"
FT                   /db_xref="GOA:Q92W34"
FT                   /db_xref="InterPro:IPR009495"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W34"
FT                   /protein_id="CAC48911.1"
FT                   /translation="METQELIKALAADNQRSGMPMTLVWTGAAVIAIALAACVFFVLLG
FT                   PRPDITSAMQTLRFPFKIVVAIALAASSLSALRALSRPETEPRDLLPPLIVAPALIAIA
FT                   VLTELIAMPASTWSARLVGTNSLVCLSFIPLIGIGPLALLLLALRYGASSHPAVSGAAA
FT                   GLAAGGIAAAFYASHCTDDSPLFVATWYTMAVAILAIAGALAARRVIHW"
FT   CDS_pept        complement(556745..556948)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20533"
FT                   /old_locus_tag="SMb20533"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20533"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48912"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W33"
FT                   /protein_id="CAC48912.1"
FT                   /translation="MIGLGHGSAFIGARMRALFDAGVPVIATDPHPANERAIAVYKKLG
FT                   FEPFGAPLETQWGLILPMLARQ"
FT   CDS_pept        complement(557553..558362)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20534"
FT                   /old_locus_tag="SMb20534"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20534"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48913"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W32"
FT                   /protein_id="CAC48913.1"
FT                   /translation="MNAFEPALCTVTFRKLAADEIVALAAKARLAAIEWAGDAHVPPGD
FT                   TSTARTVGHLCESAGLKTSYGSYVAPPTDDLSALAPALATAVALGASNIRIWPGTRQRA
FT                   SRDYSADEWRDAADAIRDMGAEAARHGITVSLEYHPQTLTDETSSALRLIEAVAHPNVY
FT                   LYWQPRPGLPLVEALTEIASIGAHVSHVHVFAWDRERKRFPLASAEGYWQAALAAMPQS
FT                   RWTGRRFAMLEFVAGDDPAAFLADAATLRKILKAEFPPGASAIADRD"
FT   CDS_pept        complement(558359..559369)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20535"
FT                   /old_locus_tag="SMb20535"
FT                   /product="putative dehydrogenase"
FT                   /function="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /EC_number="1.1.1.95"
FT                   /note="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20535"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48914"
FT                   /db_xref="GOA:Q92W31"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W31"
FT                   /protein_id="CAC48914.1"
FT                   /translation="MTLPTVAFAMQPERTRYVLTPELLAQVDAFARILDQRPMTEFADE
FT                   WSQRLLAEAQILVTGWGAPFIDAAVLARAPRLRLIVHAAGTIKGLVDESVFDAGIRVSH
FT                   AAEANAVPVAEFTLAAVIFAGKQVFRFRDVYAADRGRERTQILQGEAVGNHRRTVGIVG
FT                   ASRIGRRVIGLLRHLDYRLLLYDPLVKDAEAMALEVEKVDLDTLMARSDIVSLHAPLLP
FT                   ETRHMIDNRQLALMKDGATLINTARGALVDEAALIEKLQSGAINAVIDVTDPEIPDENS
FT                   PLYDLPNVFLTPHIAGAIGLERMRLGEMAVDEVARFLEGRPLLFEVHKQDLGRMA"
FT   CDS_pept        complement(559366..561219)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20536"
FT                   /old_locus_tag="SMb20536"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20536"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48915"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W30"
FT                   /protein_id="CAC48915.1"
FT                   /translation="MTYDPASANPLAGNPLETRGDMQRALLDLFDPLLPYFSEGNARVR
FT                   LDAAAAHFDRAAADLEGFARPLWGLAPFAAGGGNFAHWDRYAEGIANGTDPGHPEYWGQ
FT                   VNGRDQRMVELAALGFALVLAPEKLWEPLNGRERDNLASYLLHARKFDYADNNWKFFRV
FT                   FVDIALDRLGIEHDRSLTKAYLTELDGFYIGGGWYRDGNVRRVDHYIAFAMHFYGLIYA
FT                   RLVEDDHAKRYRERAVAFAQDFRHWFAEDGATLPFGRSLTYRFACAGFWAALAFADIEA
FT                   LPWGEIKGLCLRHLRWWADKPIADRDGVLSIGYGYPNLLMSENYNSAGSPYWAFKAFLP
FT                   LAVSENHPFWTSSEVPLRRLAEPVVLRHPGMVMMPVKGDVVALSSGQENRQMRFGSEKY
FT                   AKFAYSARYAFSVESDERAFAGGAFDSMLAFSDDGVHYRVREANEEVRLADNVLFSKWS
FT                   PWPDVVVETWLVPASPWHVRVHRIATPRPLETAEGGFAIPRRDFETDALTAAEGTAHAI
FT                   GAEDFSGIRDLGSTVPREGRIQKAPPNTNLIAAKTLVPQLRAKIPSGETILACAVLAAR
FT                   NTSVVTEDWSNPPAMPDMAALDALRAKGLTVSAMQAPGSAP"
FT   CDS_pept        complement(561216..562244)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20537"
FT                   /old_locus_tag="SMb20537"
FT                   /product="probable transcriptional regulator"
FT                   /function="Transcriptional regulators"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative HTH lacI-type transcriptional
FT                   regulator,,periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20537"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48916"
FT                   /db_xref="GOA:Q92W29"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W29"
FT                   /protein_id="CAC48916.1"
FT                   /translation="MIERPSRRLRQADIAAQAGVSVSTVSRVLANEPGISEDVRVQILK
FT                   VANDLGYPLKAGAAAAPRALALIASNGVTGSLSAFYQGIVDGLRSEAAEQGMSFDIRLV
FT                   NEAKATPQAVGEHMQSVGAQGLFLVGIDPCQALAEWFVESRTPVVLVNGVDPQLRFDGV
FT                   SPPNFFGAFAATRMLLDAGHRRILHLTGSHRHTIRERVRGFEAAVASVDSGHARVIRLP
FT                   FANNSSAEAHAATLAALAEDEGFTAAFCMNDFIAVGVLEAVTELGRRVPDDFAIIGFDD
FT                   LPCADMANPRLSTMRVDRAALGREAVAMMQFRFRHPDVPARHVTHAVVPVPGGTIATKD
FT                   NP"
FT   CDS_pept        562392..563678
FT                   /transl_table=11
FT                   /locus_tag="SM_b20538"
FT                   /old_locus_tag="SMb20538"
FT                   /product="probable sugar ABC transporter"
FT                   /function="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="Conserved hypothetical protein"
FT                   /note="probable sugar ABC
FT                   transporter,,extracellular/periplasmic substrate-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20538"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48917"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W28"
FT                   /protein_id="CAC48917.1"
FT                   /translation="MLLNRRGFMIGAAGAATGIALGSRSALAAESVQLRAMWWGSNDRS
FT                   KRTLAVAKLFEEKNPDIRIVGESLSGDGYWTKLATQMAGRAIADIFQLEPSTISDYSKR
FT                   GACMALDPFISSALHVDAFGKDVLNLTTVDGKLWGVGLGLNSFALFYDADAFAKAGITP
FT                   PGVDTTWEEYADIAIEMTKAAGKKNVWGGPYGARYAYVFDAWLRQRGSSLYTDTGLGFR
FT                   VEEAKEWYAYWEELRKRGGTVGADIQTLDQNTIDTNCLALGYSAMGMAYSNQMVGYQLI
FT                   MKSKLGIGMLPRAEKGGPSGHYYRPALIWSIGASTEHGEAAAKFINFFVNDVEAGKILG
FT                   VERGVPMSPTVREAILPSLNPTETETVKYINALKDQVGGYPSPAPLGSTEFDQRVLRPI
FT                   ADELAFERISIDEAATRLVDEGKATVRAG"
FT   CDS_pept        564786..566660
FT                   /transl_table=11
FT                   /gene="cyaF6"
FT                   /locus_tag="SM_b20539"
FT                   /old_locus_tag="SMb20539"
FT                   /product="probable adenylate cyclase protein"
FT                   /EC_number="4.6.1.1"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20539"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48918"
FT                   /db_xref="GOA:Q92W27"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W27"
FT                   /protein_id="CAC48918.1"
FT                   /translation="MDDPTVHRRLTAILAADVVTYSRLMARDEAGTHAAWKSHRRDLID
FT                   PKITEYEGRIVKLAGDGFLAEFPSVVNAVTCAATVQRGMLERNVDVPRPSRIELRMGIN
FT                   LGDVIVESDDIFGDGVNVAVRLEKIAAPGGIAVSAAVRDNVGNRLDLRFEDMGEQALKN
FT                   IDRPVRAYSISLDFPAAQRTVGSDAGTREPWEIEKPSIAVLPFNNISGDPEQEYFSDGI
FT                   TEDIITDLSKISGLFVVARNTAYTYKNKPVKVQQVSQDLRVGYILEGSVRRVGSRVRVT
FT                   AQLVEGKGGGPLWADRYDWDLTEIFALQDEITHTIVDHLKVKLLPEEKKDIGRVPTGNF
FT                   EAYAYYLRGRQFLHWHSQSHYVLAKRMFAMAVELDPLYARAYAGIADCDSFLFLHYNAD
FT                   VSIDGILATSAKALDLESGLAEAHASLGLALSLRERHSEAMAEFDQAITLDPDLFEAHY
FT                   FYARACFTQGKLDEAARHFQRAADIKPDDYQALLVLINVLRSLGREQEMNTAAREGVAR
FT                   AERELMMRPENPRPAYLGAVGLAALGELDRAKEWAGRALATDPDDRLAKYNVACFYSLQ
FT                   GEPDRAIDLLIELLPEATHETKRWVKYDSDLDPIRNHPRFPKVLELLG"
FT   CDS_pept        567528..567749
FT                   /transl_table=11
FT                   /locus_tag="SM_b20540"
FT                   /old_locus_tag="SMb20540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20540"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48919"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W26"
FT                   /protein_id="CAC48919.1"
FT                   /translation="MALDVPANLTSSVQAPAHHKGNQYRWSIIAVNGGETERAKGNGAA
FT                   LGPCFGLIAKRPRSAAFSGNGRPLTAWE"
FT   CDS_pept        568100..568345
FT                   /transl_table=11
FT                   /locus_tag="SM_b22019"
FT                   /old_locus_tag="SMb22019"
FT                   /product="putative partial transcriptional regulator
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22019"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51284"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDC5"
FT                   /protein_id="CAQ51284.1"
FT                   /translation="MSIEMTRFDVLDHLKTPEDRFAYLEAAFEAGDPSLVAHALGDVAR
FT                   SIVCGVHAPLIFQLRRSEADPRRSNELTEEYLTSSL"
FT   CDS_pept        complement(568337..569989)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20541"
FT                   /old_locus_tag="SMb20541"
FT                   /product="putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20541"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48920"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W25"
FT                   /protein_id="CAC48920.1"
FT                   /translation="MSSPLDLSLFPNLPPEVVKAFAAMQFELSVERAARQHEQAVVAEK
FT                   DAFIAELKELIEKLEGQVHDYRRTKFGPKSEKLDPAQMELALEDLETAIAETQARIAAV
FT                   EKKIEASASDPDKVAPRKERKARALPEHLPRVERVIEPESIVCPCGCGNMVRIGEDRTE
FT                   RLDRIPARYEVIVTIRPKYACPKGRTGVVQARAPAHLLEGSWPTEALLAEIAVSKHSEH
FT                   MPLNRQAEVMARHGVPIDRTVLADWMGRTGSEIAPVVDHMAKRLLWESTRLYVDETTAP
FT                   VLDPGRGKTKTGYLWAVLRDDRGWNGSAPPGVVFHYRPGRKGEYAAEILDGFNGTIQVD
FT                   AYGGYSHLATLDRVGGDPLKLAFCWAHGRRKLIKATPKSGSPIVDEALVRIAALYKIED
FT                   SIRGSDPEHRRAVRQELSLPLVDAFFAWLAAQAKRVSRKSDLGKALAYMLTRQDGFRLF
FT                   LDDGHVDIDSNLVENAIRRPAMNRRNALFAGHDEGGRNWARFASLIGTCKMNGVEPYAY
FT                   LCDLFTRLANGHLAKDIDALMPWAYAARITASQ"
FT   CDS_pept        complement(570052..570405)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20542"
FT                   /old_locus_tag="SMb20542"
FT                   /product="putative protein in ISRm14"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20542"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48921"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANR6"
FT                   /protein_id="CAC48921.1"
FT                   /translation="MIVAGQRLPILIATRPVDFRCGHQALALMVQTELKLDPHSGVTVI
FT                   FRSKRGDRLKILVWDGTGMVLTYKILEHGSFAWPKVQDGTMRLSRGQYEALFEGLDWRR
FT                   VMAQRVTAPSAAG"
FT   CDS_pept        570289..570705
FT                   /transl_table=11
FT                   /locus_tag="SM_b20544"
FT                   /old_locus_tag="SMb20544"
FT                   /product="putative protein in ISRm14"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20544"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ANR5"
FT                   /protein_id="CAC48922.1"
FT                   /translation="MRVELQLGLHHQSQRLMPTAEVHRPRCNQDRQSLARDDHTGARMA
FT                   RTRAATRSTGTSPGTRNTTSGPISNVKTDETASDSGGAKTFTASLGSAAIAKGTNAGSA
FT                   SPLSDRPGIASNGSARMPSRACRRQKESWCGTTS"
FT   CDS_pept        complement(570402..570845)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20543"
FT                   /old_locus_tag="SMb20543"
FT                   /product="putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20543"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48923"
FT                   /db_xref="GOA:Q92W24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W24"
FT                   /protein_id="CAC48923.1"
FT                   /translation="MAGDGFVGRYEVVEPRRGNRRWPDAVKARIVAESLEPGVRVVDVA
FT                   RRHDVVPHQLSFWRRQAREGILALPFEAMPGLSESGDAEPAFVPLAIAAEPSEAVNVLA
FT                   PPLSEAVSSVLTLEIGPDVVLRVPGDVPVERVAALVRAMRAPV"
FT   CDS_pept        complement(571438..571656)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20545"
FT                   /old_locus_tag="SMb20545"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20545"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48924"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W23"
FT                   /protein_id="CAC48924.1"
FT                   /translation="MDDREAGSAADAEPAPDLSEVAAQCAAADLLDFAAQLAGLAEDLK
FT                   ALAARPIEPTPTLAEPDHPPEATSSDL"
FT   CDS_pept        complement(571843..572361)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20546"
FT                   /old_locus_tag="SMb20546"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20546"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48925"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W22"
FT                   /protein_id="CAC48925.1"
FT                   /translation="MAEKWDECVIIDLPNLEGIQIVWSPAYAAQLLSENWPDTTGRSYS
FT                   AALNSCTDAMFGAASAAPARDAFLAAVEEARVKTLRWHHAAPPLVKGNDSIEGGYVAEL
FT                   GFQARSHSVRAWSTGGGRQADEFSARSSLRSSESGAVLVSVPSTDARLISFTLPFAASR
FT                   TCRAVSAHW"
FT   CDS_pept        complement(572518..572796)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20547"
FT                   /old_locus_tag="SMb20547"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20547"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48926"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W21"
FT                   /protein_id="CAC48926.1"
FT                   /translation="MYEPFEAQIKAWLKEGPTLSAAGVLRRLTEIDPIRFTEKNIRMVQ
FT                   MLVKAWRMEMAVLVILDGGWIKSLPSAAAAAVDTGTSASAVLGNILR"
FT   CDS_pept        573930..574424
FT                   /transl_table=11
FT                   /locus_tag="SM_b20548"
FT                   /old_locus_tag="SMb20548"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20548"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48927"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W20"
FT                   /protein_id="CAC48927.1"
FT                   /translation="MESIIERNCRKDGFDIFMPSFYTELRHHRTKQILQKRFPFLVGYG
FT                   FVSLPRLNFEELRRVDGVVCFLRGANYGPLEFPDGYHRGPVLRRSRATAGLPLQAALPE
FT                   GDRAPRANPALGRPAPEDPAKGSESARLHGRPCRECYRFSKPADQRASADNYQWIEQPH
FT                   C"
FT   CDS_pept        576048..576365
FT                   /transl_table=11
FT                   /locus_tag="SM_b20549"
FT                   /old_locus_tag="SMb20549"
FT                   /product="hypothetical protein"
FT                   /EC_number="2.1.1.62"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20549"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48928"
FT                   /db_xref="GOA:Q92W19"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W19"
FT                   /protein_id="CAC48928.1"
FT                   /translation="MRALRKASAHYDVMSAEQIRALPVGQLASMNCLIYSRATAPHLAF
FT                   TVECLKAWGFEYKSFMAWRKTTAAGKVRMGTGYRVRTTGEIVFVGTLGNPKQSHVPPTI
FT                   S"
FT   CDS_pept        complement(576533..576778)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20550"
FT                   /old_locus_tag="SMb20550"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20550"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48929"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W18"
FT                   /protein_id="CAC48929.1"
FT                   /translation="MGTVWGECVILDLPDLDGVQIVWHPAYAARLLIDSWPVDHGRAYG
FT                   TAINACADAMVGICTGERARIAFIAAINEAKIDLLA"
FT   CDS_pept        complement(576952..577398)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20551"
FT                   /old_locus_tag="SMb20551"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20551"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48930"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W17"
FT                   /protein_id="CAC48930.1"
FT                   /translation="MVMAHLGRVATKIDHRPLELAEKRQQINTGRWSAAPSLLNTVVFS
FT                   EAEMNSKMFARPVYLKEKKDLIREITNLYDAIDFLEGWPERDRDIVHDATLKTCYMAHD
FT                   GHKPIQVARDAIRAFGKKKGILVKAPAVLPWMIKPSSGSGRVSA"
FT   CDS_pept        578150..578881
FT                   /transl_table=11
FT                   /locus_tag="SM_b20552"
FT                   /old_locus_tag="SMb20552"
FT                   /product="putative peptidase"
FT                   /function="Predicted peptidase"
FT                   /EC_number="3.1.2.-"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20552"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48931"
FT                   /db_xref="GOA:Q92W16"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W16"
FT                   /protein_id="CAC48931.1"
FT                   /translation="MLRGILPLAAIAALGLFDPEAANAEQVALTSTVSVKNELKYLLYT
FT                   PDGYATSTESYPLVIWLHGGDQGGSDIDKVKSSGIPKLIEDGKKFPFLVFSPQNPSEEL
FT                   LYPIEKVDAALEEVASTYRVDRSRIYVIGFSRGGFGAWALAEQFPDKFAAIVPIAGGGN
FT                   RHYLNRTNEKAAFWVFHGSNDGVIPLSDSVVLYERLKALDRNARLTVLEGVDHSGVEWA
FT                   TLNDAELWDWLLKQRLEGAPQ"
FT   CDS_pept        578902..579096
FT                   /transl_table=11
FT                   /locus_tag="SM_b20553"
FT                   /old_locus_tag="SMb20553"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20553"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48932"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W15"
FT                   /protein_id="CAC48932.1"
FT                   /translation="MRREVGVVSRRPSLFFREIDLLAMWQIRPQLGRLLGIEFVRFRDL
FT                   LIEDVRIAGGLDIGVADAY"
FT   CDS_pept        complement(579454..579963)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20554"
FT                   /old_locus_tag="SMb20554"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20554"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48933"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="InterPro:IPR016992"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W14"
FT                   /protein_id="CAC48933.1"
FT                   /translation="MGDTLDVFPTEVKASATISRCGAYRYRLERQWDSEKAKVAFLMLN
FT                   PSIADACQDDPTIRRCIGFARAWGHGGLIVGNLFALRSTDPKALYDHPDPIGPDNDRHL
FT                   LSIAQSARKIICAWGTHGTLHDRGREVAERLAFFNPAALKLTADGHPVHPLYVAASTQP
FT                   KEYFAR"
FT   CDS_pept        complement(579967..580188)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20555"
FT                   /old_locus_tag="SMb20555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20555"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48934"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W13"
FT                   /protein_id="CAC48934.1"
FT                   /translation="MRKTRVGHERLPLERANRRLVDPPRMTQRPVTAVETGILSFHAAL
FT                   LGQILHPTGEIVHERMASAEAAVRGGRG"
FT   CDS_pept        580645..581325
FT                   /transl_table=11
FT                   /locus_tag="SM_b20556"
FT                   /old_locus_tag="SMb20556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20556"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48935"
FT                   /db_xref="GOA:Q92W12"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W12"
FT                   /protein_id="CAC48935.2"
FT                   /translation="MHIEPGVVDGAKIILSYATAARALGLTAKLAADSIRNDGGAGALV
FT                   LRSVVTTALVFCFFEVLPHHPAGVSEVHLVLGSTLLLLFGAGAAAVGLSAGLFLRGLFF
FT                   APFDLPQYGMNVTTLLVPLWATSLLAARIIPSRTAYVELTYRQTLALSTTYQGGIVAWV
FT                   AFWALYGHGFSVENLAAVGSFGAAYMSVILLEPLIDLGVLAGAKALDRYSRGPMFNIRL
FT                   HQAA"
FT   CDS_pept        complement(581530..581871)
FT                   /transl_table=11
FT                   /locus_tag="SM_b22006"
FT                   /old_locus_tag="SMb22006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22006"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51285"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDC6"
FT                   /protein_id="CAQ51285.1"
FT                   /translation="MQHHCGRVFWNKSLVAAGSERRERSCVDPRGDPTHADKQKMKRLI
FT                   WDCQKDIAAYVTPQSGIGQDEPLQMLTSRLDGGQAERAWATIGTTGGRTRMMVKTRRRN
FT                   PRASDSETA"
FT   CDS_pept        complement(582372..582707)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20557"
FT                   /old_locus_tag="SMb20557"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20557"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48936"
FT                   /db_xref="GOA:Q92W11"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W11"
FT                   /protein_id="CAC48936.1"
FT                   /translation="MVGLGIVGIFLPLLPTTPFLLLAAWLFSRSSPRLAKWLMDHPLFG
FT                   PPLRDWREGGAISRRAKISAVLLMSLALIYLWVAFEPSAIALLVVTGIMFICGAFIVSR
FT                   PEPPNKP"
FT   CDS_pept        complement(583428..583838)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20558"
FT                   /old_locus_tag="SMb20558"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20558"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48937"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W10"
FT                   /protein_id="CAC48937.2"
FT                   /translation="MCKPRALSGGRPPAVLQRARRGTVLAEASVFSDQYHCDAVAAMAT
FT                   EVVLVAIGEIQRLLNEDHVFALEWSRHLSNELQHTRKRAEILALRTVAARLDGWLTWSD
FT                   GDLPPKGEWRRLAEEIAVSPEALYREISRRRD"
FT   CDS_pept        583971..584555
FT                   /transl_table=11
FT                   /locus_tag="SM_b20559"
FT                   /old_locus_tag="SMb20559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20559"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48938"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W09"
FT                   /protein_id="CAC48938.2"
FT                   /translation="MFTVAIGWQAEHPPSLVPTGVPMRILFLMLMAVTLPLPAAAEGGH
FT                   VHHSPYAGQELREMKSLSADDLAELESGGGWGLAKAAELNGIPGPSHVLKMRADLALSA
FT                   DQETSTQRIFEKMREDAVIEGKRLIAGELALEIAFREGSINKANLRAQLRAVETIRANL
FT                   RYIHLTAHLEMMRVLTEAQVKQYSELRGYAR"
FT   CDS_pept        complement(584682..584903)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20560"
FT                   /old_locus_tag="SMb20560"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20560"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48939"
FT                   /db_xref="GOA:Q92W08"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W08"
FT                   /protein_id="CAC48939.1"
FT                   /translation="MYHLNVEDVTCGHCAATVEKAVKAADPKAKVAVNLEAKTASIESD
FT                   IGPDVFIAAIEDAGYRASFKKSCCSHVD"
FT   CDS_pept        complement(585597..586055)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20561"
FT                   /old_locus_tag="SMb20561"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20561"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48940"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W07"
FT                   /protein_id="CAC48940.1"
FT                   /translation="MFERCLVGTLGSVSALYRVLWMQTARKNHDTCIMRQTWREEVIER
FT                   KWPAAVLAKMENPFPWKEHYPPRRLAAYEALLIPVLVGHALWIGSELLLQRHEFPNGKA
FT                   EEGRLPETLKRCGLVSRQYYVIRLPYLEENIQRRHDHEIQIEKKHRTL"
FT   CDS_pept        complement(586186..587100)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20562"
FT                   /old_locus_tag="SMb20562"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20562"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48941"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W06"
FT                   /protein_id="CAC48941.1"
FT                   /translation="MAESKAGTLTQCLGVGKQFHREPVVKLISRTRGLRKLFEPRLFRK
FT                   REQRPELVISCGFRAEPAVLDIKAAYGGKPLTVHLQRPRIEGYDLVFVSRHDWVEELDQ
FT                   RPNYHSMVGVPHQITSARLAPLRDAARRRLSPEGRPIVAVFVGGSNGAYVYDDKTHQNI
FT                   KCAVEQLEKAGWRIVVSASRRSEDHTQQTLSTLNSESIAVWDRRSENPYLDYMAAADAF
FT                   VIAKDSITMPCEALATGKPVFTLELTHVAGPRLDKFERYHRDLHETLQLTRPFEGKIEP
FT                   YSYEPLDETRRIASVIRSELNRP"
FT   CDS_pept        complement(587215..588129)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20563"
FT                   /old_locus_tag="SMb20563"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20563"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48942"
FT                   /db_xref="InterPro:IPR008166"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W05"
FT                   /protein_id="CAC48942.1"
FT                   /translation="MFGLKAKRHLTRELAITPPQGELNRHGIAIVACVKNEASYIAEWV
FT                   RFHQAVGVRHFHLYDDGSTDGTVELLQRSLTGQELTVVPWKMRMRDEQSGEFLNGQTIA
FT                   FAHAILNFGGKYERMAFIDVDEFLLPKKGRTLEEALRGAGGFPNISLPWHMFGHSGHVS
FT                   RPAGPVCLNYKMRVSDPMRQNLDASNFKCIVDPVEVTKVGVHHFQTRSYGDETANDAGI
FT                   VVPKKRRKDAEFYSAEFIQLNHYYAKSIEELKEKTDRGWSFDGSAEKYRNKVTSTITYI
FT                   EANAIEDRSMIDFVDKNGIDLGQ"
FT   CDS_pept        588360..589190
FT                   /transl_table=11
FT                   /gene="kdsB2"
FT                   /locus_tag="SM_b20803"
FT                   /old_locus_tag="SMb20803"
FT                   /product="probable 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase (CMP KDO transferase) protein"
FT                   /EC_number="2.7.7.38"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20803"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48943"
FT                   /db_xref="GOA:Q92W04"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W04"
FT                   /protein_id="CAC48943.1"
FT                   /translation="MDFPASGTTENLTTAEQWCALFSRYSHVILVANSDQVNVKELQAE
FT                   YPRTALFVFFNKVYKILDEQFSGHSLLISRAQPGGANIVYRQEVADVVKLFAPQDFLGI
FT                   MNIRLAASERLNTSSDYLGTPTGHLDLTGFCADFYPQAKVPTSGFAIALWLVDQALPAK
FT                   IILAGFSAKRSEKWRVVAVHDWTFEQVFLRLFERVGKLTMNGGIATNSYASLASRFPEL
FT                   PAAEISSTIAEVLSSRLNQTDAQVDKLISLTNVLRSIDEFLRRLKPKFLKKTKA"
FT   CDS_pept        589233..589964
FT                   /transl_table=11
FT                   /locus_tag="SM_b20804"
FT                   /old_locus_tag="SMb20804"
FT                   /product="putative membrane-anchored protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20804"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48944"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W03"
FT                   /protein_id="CAC48944.1"
FT                   /translation="MGSWISDARKRIYRNLKYRIMRPDPPAAPFRFNSPVVVVGSAPVS
FT                   NRPAGLDESFRIITVNGSQSVIAKWGVDAPDITMMMFNQVEGTTANAIEVRRVLKGQRT
FT                   GTLYVFLWRKDDRARLEEGLRAFDYKFDRLEIVDRYERMALLDRVADLRSLEMDADSKC
FT                   SNGMNAVLFALYNGAPAVIVTGINPNSSGHVYNSTGLTRLHVQMDKVLVSKLISEGRPI
FT                   FTADPPVSKELGIPLWSGKNR"
FT   CDS_pept        590027..590932
FT                   /transl_table=11
FT                   /locus_tag="SM_b20805"
FT                   /old_locus_tag="SMb20805"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20805"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48945"
FT                   /db_xref="GOA:Q92W02"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W02"
FT                   /protein_id="CAC48945.1"
FT                   /translation="MISNRPFSRSCIKIAVRLLLGRSRAHVQDWFPGLKLELATADRDG
FT                   TIQYRGELVGRLTSPLRALEEKPANVLIVGSGPSVARCDLTRAAGSSCLLLNGALHLFP
FT                   SVIAKPLAIAIEDERFVWRHFDLVKRIPAGCICLLSVSVIRAICELDRTWLRDRQIVLI
FT                   DNVRKPYGVARRDTAELRKLPYVRLSEDGDVGFSEDPFAGIFQAGSVAVSAAQFAVAWR
FT                   PRSIGFVGIDLSNANEPRYYETTDKAYSGIVAAQKRIVDHLVMTRSIAAESGIEVVNHS
FT                   PISALVGMGFGYDATFAKAE"
FT   CDS_pept        complement(591060..591749)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20806"
FT                   /old_locus_tag="SMb20806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20806"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48946"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W01"
FT                   /protein_id="CAC48946.1"
FT                   /translation="MTQGAHIYIGFDSKEVVAYHVLCQSILEKSSIPVTFTPISLNNVE
FT                   NIFTRERNPLQSTEFSFSRFLVPYLSRYEGWSLFADCDMLMRTDIAQLWELRDDRYAAM
FT                   CVKHDYVPKVETKFLGQVQTKYEKKNWSSVILFNNAKCRKLDLDYVNTASGLELHQFKW
FT                   LESDDLIGELPASWNWLVNEYEYSPDAKLVHFTDGGPYFDEYKNDDYAEEWFATRDRVL
FT                   HVTQRSA"
FT   CDS_pept        591882..593519
FT                   /transl_table=11
FT                   /locus_tag="SM_b20807"
FT                   /old_locus_tag="SMb20807"
FT                   /product="putative membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20807"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48947"
FT                   /db_xref="GOA:Q92W00"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q92W00"
FT                   /protein_id="CAC48947.1"
FT                   /translation="MKPRAAERCGWLSVVHRRASGNFRELRLVALSLARDIATNAGEND
FT                   GGRMRSLLVRRPDLLYVLIAGYCLLSIILKVLRPDSLEIDESEQALLSQYLLLGYGAQP
FT                   PFYNWLQYGVVALFGISVASLAIVKNGLLFLFLLFYGLTARLLSSSRLAPAVAVLGVLT
FT                   LPPVFLLSQRDLSHTVAALFAVSLFLYGFFRALKSPPKVSHYLLVGVAVGLGAISKYNF
FT                   VILPVAALLAILPEAKLRKYLFDWRVLASVAVCAMIVAPHAYWIVNNLGHATGVTVAEM
FT                   KEGADSARLPHAIQGLVSLAVSALKGVALTLAVFGLLFYADVGKILRAESLGTRVIGRM
FT                   IVACFLIIAFIVVAMDATHIRAKWLALFTALLPLYLTLKIDAADLDPARRLPALFSISG
FT                   ILSVGVIVMLWARVFVGPMIGDYSFAHTPYNGFASTVRADPGPPPVAIVVDDRIVAGNL
FT                   RIQFPDTPIILTGFSQEAEKHLPPGRILAAWSAEGKGREEVPPRITGLLQLMPVRIADA
FT                   KPTIVSVPYNAGRPGDTYTFAYIWADFH"
FT   CDS_pept        complement(593495..594271)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20808"
FT                   /old_locus_tag="SMb20808"
FT                   /product="putative membrane-anchored protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20808"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48948"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VZ9"
FT                   /protein_id="CAC48948.1"
FT                   /translation="MNLARLPVQWNFEMTIEPEALEKLREKHRRWLSRLGIIDKPWLIL
FT                   GSAPSPTIPPDLIGHCARVDVNNAGKTANALGLPPADLTFRKRKKSWEEHPYVRTRGLL
FT                   WLHTKSIWVMYLKLLAMPHVRYKSLMRATKAEREAIVNVVSGGLPSDIGEVGKVTNGVA
FT                   ALCYALFMGVPSVTLAGFSVTKMGHSYDEKGRIRRQIAEDTFVLRRLRDRGNVFTTELE
FT                   LSEHIGLPFVRDREDVIRNMGGAIGANPAQWKSAQI"
FT   CDS_pept        594508..595497
FT                   /transl_table=11
FT                   /gene="kpsF1"
FT                   /locus_tag="SM_b20809"
FT                   /old_locus_tag="SMb20809"
FT                   /product="arabinose-5-phosphate isomerase"
FT                   /function="D-arabinose 5-phosphate = D-ribulose
FT                   5-phosphate"
FT                   /EC_number="5.3.1.13"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20809"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48949"
FT                   /db_xref="GOA:Q92VZ8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VZ8"
FT                   /protein_id="CAC48949.1"
FT                   /translation="MNVVVSDPILASISRTIATAADGINALAGCLEDNAALRRSFVDAI
FT                   ELVASKRGRVVVAGVGKSGHIGRKIAATLASTGTSAYFVHPTEASHGDLGMITAEDLLI
FT                   LLSWSGETVELGNVLTYAKRFNVPVISVTSNADSTIARNSTIPVVLPKVPEACPHGLAP
FT                   TTSAMLQLAVGDALAIALLERRGFSAEDFKTFHPGGKLGSQLLLAHELAHSGEAVPLLP
FT                   IGSPMSEAVIQMSSKGFGVVGVVGGDGELVGVITDGDLRRHMSQSLLLLTVETVMSHMP
FT                   RVITPGMLASAAMEMMQSQKITVLFLVDDVGRPSGILHVHDLLRAGVA"
FT   CDS_pept        595610..597643
FT                   /transl_table=11
FT                   /locus_tag="SM_b20810"
FT                   /old_locus_tag="SMb20810"
FT                   /product="putative O-acetyl transferase"
FT                   /function="Predicted acyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative O-acetyl transferase,, putative
FT                   membrane-located cell surface saccharide acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20810"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48950"
FT                   /db_xref="GOA:Q92VZ7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VZ7"
FT                   /protein_id="CAC48950.1"
FT                   /translation="MGTRLAVIHRDFEYRPDLDGLRAVAILPVLLFHAGFSSFSGGFVG
FT                   VDVFFVLSGFFMARIILTDLERGSFSFWSFYLRRMRRIFPALFSMIAVSAVASWFLLMP
FT                   QEFRYFGDSVQAAALFTSNILFRSESGYFDLSSEMKPLLHTWSLSVEEQFYLIFPVAVF
FT                   LAFKFAHRHIRAIVLAVALLSFGASTWGIVHSPEKAFYLLHFRVWELLIGVLVAIAPAS
FT                   TYGARGSQALAALGLLAVLLAVFVYSPDTPFPGIYAAVPCLGTALVIHAHCRGGAIGRL
FT                   LGNPVSVFIGRISYSLYLWHWPIIVFLRYGLGHELTTGWALTAVAMSFALAYISWRFVE
FT                   QPARYGVLASSRVAIIGVSSAAISSAVAFGFIVNDLEGIPQRLPEKARTLYQATYDESP
FT                   FSSKRCFTDSNGEGLTPVQIRRGEICRVGVETAGEPRFLVWGDSHAAAIAPAIDLAARQ
FT                   MGISGMFVGRGSCPPLPNTDFGPPGAVKRCIDHNSAVMSLIEKRKFAFVFMVGYWPKYV
FT                   HRDELPGQGIFFDPRVVPSRTDWSTPVRKGLDATLTKLARQGSKAVLVMDVPEMGYDVP
FT                   EALARAAASGRSLDIAPSVEYTNKRQALARRVLADAARSSGALVVDPMSAICDASKCHA
FT                   MREGTVLYKDGDHLSAKGAESLSALFRPVLSIMRESVQAASR"
FT   CDS_pept        597789..598109
FT                   /transl_table=11
FT                   /locus_tag="SM_b20811"
FT                   /old_locus_tag="SMb20811"
FT                   /product="putative protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20811"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48951"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VZ6"
FT                   /protein_id="CAC48951.1"
FT                   /translation="MQSPGGGSLHFEDDGLRVATLEFLVKVLATKRLRDDPDADLKQDV
FT                   LSALERIPLQFVSSEVERAEIRAKMHAEANAILNWAVEGRTTTISPIAGRPLSASHYRQ
FT                   WR"
FT   CDS_pept        complement(598175..599221)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20812"
FT                   /old_locus_tag="SMb20812"
FT                   /product="conserved hypothetical protein, possibly
FT                   membrane-anchored"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20812"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48952"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VZ5"
FT                   /protein_id="CAC48952.1"
FT                   /translation="MSGSKIKIALFNDTDFRVNIGCRLTSQGLKQQILDAFPAAEITSI
FT                   GFNFAAFRKEFPKSTSAGGYELSDIETRLSTAYGEGAVDHIRAADFVILQPEGSLDHRT
FT                   TAEGLATFFTPILTARKLGKPFAVLNGTIPIYEGERSDYLKGLFRELGHVAARDEISAE
FT                   YYGIEFLADAAFLRISPAPVADRDGCLITTGARNNAEEDVEILKAALKICEAWKLRPVV
FT                   LTHAVERFSPYEAEIIGRGGIFAETASIEHAAETISKCRLHIGGRYHMAIFSLLCNVPS
FT                   LLFDVKTHKNQWLERYSPLITLVHPHTDLDAAAAAVLSGGVSQGHPGSTAAEKYVHFLK
FT                   RAMAEQPL"
FT   CDS_pept        599852..601657
FT                   /transl_table=11
FT                   /locus_tag="SM_b20813"
FT                   /old_locus_tag="SMb20813"
FT                   /product="ABC transporter, ATP-binding and permease
FT                   components"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20813"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48953"
FT                   /db_xref="GOA:Q92VZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VZ4"
FT                   /protein_id="CAC48953.2"
FT                   /translation="MNVKDRKEREVDNETIAGILRRVIAENGRDHIGGYAFAIACLMVV
FT                   AATTAFTAWISETVINEAFAHKRGDVVLLVCFSIFAAFVLRGLATYGQAVALSKIGNSI
FT                   VASYKRRLYTHLMALSIGFFQEKRSAHLTAKINQNISGIRDVLNMTVTSVARDVLTLVG
FT                   LVGVMISKDWLLSLITFVGAPPLLLGLRYISRRLRLATREAVEANSRVLGAMQETIQGI
FT                   SIVKAFTMEDELGRKVEGIIKGAENRANRIARLSERTAPLTETFAGLAISGVLAYAAFR
FT                   TIYSNVAPGALFAFVTALLLAYDPVRRLARLQVSLERAAVNARMLYEILDTVPHQRDLP
FT                   GARQLAFSEATVEFRDVRFSYGNGEEVLKGVSFLAEGGKTTALVGPSGAGKSTIISLIP
FT                   RFYDPQSGVILIDGQDIAAVTKQSLRNGLAYVSQQAYLFEGSIRDNIRYGRPEATDAEV
FT                   EEAARLAYAHDFILAQPQGYDTPVGEQGMTLSGGQRQRLSIARALVRNAPILLLDEATS
FT                   ALDTESEAAVQKALDQAMSGRTVIVIAHRLSTVVNADKIVVMNEGLVVEEGTHEELARR
FT                   PDGVYARLHNIQGGFLELTVGAAAT"
FT   CDS_pept        601995..602735
FT                   /transl_table=11
FT                   /locus_tag="SM_b20814"
FT                   /old_locus_tag="SMb20814"
FT                   /product="hypothetical protein"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20814"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48954"
FT                   /db_xref="GOA:Q92VZ3"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VZ3"
FT                   /protein_id="CAC48954.1"
FT                   /translation="MIISHRHKFIFIHVPKTAGSTVSAYLAREFGPWDVQLGSWKDALG
FT                   NGAKANRLALIAMFCHLSPLKIAQTLIRNHSVDSLAGVALSRRFAGRLADHSSASEIES
FT                   FDPSAWKQYFKFCFVRNPFERAVSLYNWHYRKADTRPSFSQMLCLIEAGAAEKERINWK
FT                   SWQLYTKNDEVVVDFVGRQERLSEDLRNVCDRLGLPFDERFLTRAKANPRRPDIRSYYK
FT                   PGDRERVERLFGAEIEHFKYRFPD"
FT   CDS_pept        complement(602786..604453)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20815"
FT                   /old_locus_tag="SMb20815"
FT                   /product="putative protein, similar to protein involved in
FT                   assembly of outer membrane proteins"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20815"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48955"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VZ2"
FT                   /protein_id="CAC48955.1"
FT                   /translation="MREVKAKKITARIESLAKPLRVAGRLQWRNKPVDVDLQIPAVDTI
FT                   LAGNLSAEGIPLKLQVKMPDANLSLDGKAALAGTYAGKLGFSTADLSAFLAGLGQSGAE
FT                   SIGPLAFNGHVDAGATGVSFQEASISVNSVEGAGSGSVEFTAPLKIMTALNFDELDLAQ
FT                   LAGAQSPALQAKAATGAEPADVPLDLSALRSIDATIKVNAKKLGYGKVFAGPVATSLVV
FT                   SDGVASLTLPEAPFYGGHVVASLRADSSQSEPSIALKTSISGASAAPLLTDMAGFKHLE
FT                   GSLKAEFDVTGAGRTSGALAKSLQGNANVGFSDGAIRGIDIANVYNNLVSLMTSGFKQD
FT                   ESKATTFTELGASFAIEGGVARTEDLKLVGPLIRMTGNGAADLAQSTLNFRLEPRLVAS
FT                   LKGQGAEISTDGIGVPVVVEGSFAAPRIYPDLSDLLKNPDAALAKLKDFGLPIDKLHIG
FT                   DLLNEDGAGAAVKDLLGGTLDKALKDKAFKQEEQQLSIEEIIGGDPAPKPDEAAVEIPT
FT                   NEEAAKADAPTEQPANGTEVPSEEADGPMEGFFKQLLR"
FT   CDS_pept        complement(604519..605808)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20816"
FT                   /old_locus_tag="SMb20816"
FT                   /product="hypothetical protein"
FT                   /function="Uncharacterized protein involved in outer
FT                   membrane biogenesis"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20816"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48956"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VZ1"
FT                   /protein_id="CAC48956.1"
FT                   /translation="MRRFILSLLGVAALAVAAIAVLPSLISSDWVRAELGRQLSAATGS
FT                   SIAFNGPVNLSAFPYLAVVAEDVTLSAEAEGITAEFAEVSGSVALSSLWSDRLHIKQIA
FT                   LDRPVIVLEEKAADEAASTADRGIETGSGDPLPALVAFLERSAIESVSITSGTFIRRSA
FT                   EDPEEVVSDVELTLSAPDVDDAFSLSASARVGERSYETSFTISTLRSLLERQPADVTLT
FT                   AEADPAPAPGLTNFEASGQVTLNANGSYQIRGGEVEAGEQAFSLNALFVPGERARFLVD
FT                   LEADRLDLTPFMDVAPETSQTEAPAADTAKPANLQFLAGFDADMSINAAALTLGEISAS
FT                   DVSFSAALKDGELAAELGHLEIDAGSLAANVATDVTADEPAFRGRLASKGLDIAKLSAL
FT                   AGQTVPLSGALTIDAGFAFRGLDGEAIRRQ"
FT   CDS_pept        complement(605893..606924)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20817"
FT                   /old_locus_tag="SMb20817"
FT                   /product="putative transcriptional regulator, LacI family
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20817"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48957"
FT                   /db_xref="GOA:Q92VZ0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VZ0"
FT                   /protein_id="CAC48957.1"
FT                   /translation="MTKRPTIADLARASGVSVATVDRVLNGRHPVREETARRVYDAAKT
FT                   IGYHAVGLLRQRVFEDLPQYRLGFLLQKPEQSFYKALAKEIENAALSVTHIRANAQVDF
FT                   VASSTPGAIVDKLKMMAARNQAIALVSPDYPAVTAGIEELKERSVPVFALLSDFAAGVR
FT                   EGYIGLNNQKVGRTAAWMIAKAAKRPGKVAAFVGSHRFHGHELREIGFRSYFRENAPDF
FT                   EVLDTMVNLDTPEITHEATLDLLQRHPDLLGFYVCGGGMEGAISAIREEKLGGKLLAVV
FT                   NELTPESRAALADEMVLMAVSTPVPALARETIDLMVGAIDRGASSVPGQTFLPFDIYTP
FT                   ENI"
FT   CDS_pept        607130..608221
FT                   /transl_table=11
FT                   /gene="mocD"
FT                   /locus_tag="SM_b20818"
FT                   /old_locus_tag="SMb20818"
FT                   /product="MocD"
FT                   /function="Fatty acid desaturase"
FT                   /note="hydrocarbon oxygenase,, required for rhizopine
FT                   catabolism,, PMID: 10937432"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20818"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48958"
FT                   /db_xref="GOA:Q92VY9"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR039393"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VY9"
FT                   /protein_id="CAC48958.2"
FT                   /translation="MTTLATKRDYSLLGRDAEAAVASGLAAAEWYHTDIPRKQMKELMK
FT                   REDGPAIRDTTIWLGSMVLLGGLGIYFWGSWWAAPFFLAYGVLYGSASDSRWHECGHGT
FT                   AFKTMWMNDAVYQIACFMIMRNPVTWRWSHTRHHTDTVIVGRDPEIAVMRPPDLIRLVL
FT                   NFFGIIDVWHATIDMARNAFGVISAAEKTFIPEMEQPKAIRVARIWLAIYLGTIGLSLY
FT                   LGSILPLVLIGLPRLYGAWHHVLTGLLQHGGLADNVTDHRLNSRTVYMNPVSRFVYWNM
FT                   NYHVEHHMFPMVPYHALPRLHAMIKHDLPAANPSILHGYREMIPAFLRQLRNEDFFLKR
FT                   ELPPTAKPYREEFHIDRLVPAAE"
FT   CDS_pept        608264..608581
FT                   /transl_table=11
FT                   /gene="mocE"
FT                   /locus_tag="SM_b20819"
FT                   /old_locus_tag="SMb20819"
FT                   /product="MocE"
FT                   /function="Ferredoxin subunits of nitrite reductase and
FT                   ring-hydroxylating dioxygenases"
FT                   /EC_number="1.-.-.-"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20819"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48959"
FT                   /db_xref="GOA:Q92VY8"
FT                   /db_xref="InterPro:IPR012747"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VY8"
FT                   /protein_id="CAC48959.1"
FT                   /translation="MSSNWVEVCAAEEIDEEDVVRFDHEGRTFAVYRSPDDEYFATDGL
FT                   CTHEQIHLADGLVMGDIIECPKHNGRFNYKTGQARGAPVCVNLRTYPVKVEAGSVFIGL
FT                   S"
FT   CDS_pept        608691..609920
FT                   /transl_table=11
FT                   /gene="mocF"
FT                   /locus_tag="SM_b20820"
FT                   /old_locus_tag="SMb20820"
FT                   /product="MocF"
FT                   /function="Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /EC_number="1.18.1.3"
FT                   /note="putative ferredoxin reductase,, PMID: 10937432"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20820"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48960"
FT                   /db_xref="GOA:Q92VY7"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VY7"
FT                   /protein_id="CAC48960.1"
FT                   /translation="MTHIVIIGAGECGARAAFALREKGFGGEITLTGAEPHLPYERPPL
FT                   SKDGLAQASLPKFIAGAARYEEARITVLTGVTAESIDRVHKAVTLSDGVSLDYDRLLLA
FT                   TGARPRAFPRVPENAGRIRTLRTHADALAIRGALTPGARLAVIGGGFIGLELAATARKL
FT                   GAEVVLVEGLPRVLSRGVPEEIAVLVAERHRREGVEIICGAQIAAIDGAGDGARLLLAD
FT                   GVDIEADLIVVGIGAVPNTELAEAAGLAIENGIAVDERLCTSDPRHLCRPATAAPSLCP
FT                   HYGGRRVRLEAWRNAQDQGALAAANLMGAGETMVSVPWFWSDQYEFTLQIAGLADGAET
FT                   TVRRDMEEGAFILFHLDGEGRLIAASGIGPGNAVARDIRLAEMLIAAGAKPEPLALASP
FT                   ETRLKKLLAA"
FT   CDS_pept        610001..610801
FT                   /transl_table=11
FT                   /locus_tag="SM_b20821"
FT                   /old_locus_tag="SMb20821"
FT                   /product="putative 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase"
FT                   /function="Ketopantoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="putative 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase , ,, putative panB gene"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20821"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48961"
FT                   /db_xref="GOA:Q92VY6"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VY6"
FT                   /protein_id="CAC48961.1"
FT                   /translation="MRHRRPTVADLLSMKGKRQLTMLRVVTLEEAEAAEKARIDLVSVP
FT                   PALLGPEFREAAPSVFAFPGLEYGDHVTAEDYIRAAFQALKAGGDAVYCAASLSTVRRM
FT                   REEGIPVCGHVGLIPSKATWTGGFRAVGKTAASALEVWRQTKALEEAGAFAAEIEVVPG
FT                   EVAAAISARSSMLMLSMGAGTGCDAQYLFAEDVLGANRGYYPRHAKTYRNFAAEYDRLQ
FT                   QERIAAFSEFAFDVRSGAYPEKGHLVGIEEKELGAFLSELEGGR"
FT   CDS_pept        611046..611870
FT                   /transl_table=11
FT                   /gene="rkpT2"
FT                   /locus_tag="SM_b20822"
FT                   /old_locus_tag="SMb20822"
FT                   /product="putative cell surface polysaccharide export ABC-2
FT                   transporter permease protein, close relative to wzm1Y20833"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20822"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48962"
FT                   /db_xref="GOA:Q92VY5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VY5"
FT                   /protein_id="CAC48962.1"
FT                   /translation="MRGSNHSSMAIHLRSDVNLIQQHLRVTAALIVREMSTRFGSKPGG
FT                   YLWAIFDPVAHVALMTLIFQAIARMPALGLSFPLFFASGYLPFAFYQRMSSFMAGTVKA
FT                   NKALFSYPIVTPFDAIVSRFILQLMTDTLVTILILMMIIELGGVTQPMNLGGMIEAAGA
FT                   AALLGLGIGTINIVMFARFSLYEQIFGIINRPLFMISGVFFLPESLPHPFRDFLLYNPL
FT                   VHVIMWFRASIYPEYRADLLDKGYVIEFALVCFVAGLLLLTTSMREIREDRL"
FT   CDS_pept        complement(611880..612911)
FT                   /transl_table=11
FT                   /gene="rkpZ2"
FT                   /locus_tag="SM_b20823"
FT                   /old_locus_tag="SMb20823"
FT                   /product="LpsZ"
FT                   /function="Capsule polysaccharide export protein"
FT                   /note="lipopolysaccharide processing protein
FT                   (Polysaccharide chain length determinant protein), involved
FT                   in capsule polysaccharide biosynthesis"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20823"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48963"
FT                   /db_xref="GOA:Q92VY4"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VY4"
FT                   /protein_id="CAC48963.1"
FT                   /translation="MSFPPLFLFGFNKWKTFIRDWFPDHEPRFVRLKQWPFEYELYWKR
FT                   LLLRDPRTRVLAWQYKGPPKLKEFCARHRIPFNYVEDGFLRSVALGALRVPPLSLAFDA
FT                   QDMYFNANGPTDLEDILRTYDFESDDALMHRARATREQLLASRLSKYNSGHSLDIASIY
FT                   GKKTGKRVLVIGQVERDASIAYGCSKKMTNNDLVRLASLENPAAQIIYKPHPEVLKGTA
FT                   KAKSDPELVRDIALILQQDISLADALETIDHVYTITSLAGFEALLRGINVTTAGCPFYS
FT                   GWGLTDDRQPNQRRNRKLTIDQIFAAAYILYPRYLDPVTKAPIEIEQALEVLARMRAEQ
FT                   IAA"
FT   CDS_pept        complement(613522..615858)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20824"
FT                   /old_locus_tag="SMb20824"
FT                   /product="putative glycosyltransferase involved in capsule
FT                   biosynthesis"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /note="putative glycosyltransferase,, capsule
FT                   polysaccharide biosynthesis"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20824"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48964"
FT                   /db_xref="GOA:Q92VY3"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="InterPro:IPR019290"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VY3"
FT                   /protein_id="CAC48964.1"
FT                   /translation="MLHAQPNGEELPVAETEELAKVKSVLTDSRQFSRTSAVDVVTPSD
FT                   ITMVICLRAHEGNHWVMDRLRLIRSYYDPMPRVLVLDFGSPEPFASEISTICALNGLDY
FT                   SHEPDTDTYSPAAAHNRGFEKCETDLVFFCDADCFGSSDMFAKMASIATSLKMRTIIDT
FT                   PLVLPVYHLNQADTQVFFDVEDMTCRSRFLDAMAFYSPLAEFRKEDNFFIAPYSNIFLI
FT                   NRRMFSLTGGYDERFRGHGSEDFEFLTRLGLYIKNLPMPVELTKDHLGPLREGFFSSRP
FT                   YSGFRRFLEALSKPAENLGLRVFHLYHERSKSEDWGSQNDWKRERMNEAFKVYVGSEHN
FT                   LLQVDFLAREKTVVCLCKHLDQWGYYTPLRAAGYRLHPVFDTAPETIAAITTGLISGEF
FT                   SALSIFNPYMKSHAQFKQLVLLARDLGREVIVIERGALPGTIYYDEDVAYNSPNFSEER
FT                   FLQEQFSDDELADSRSYIEELKAGDSTLEQMDDYATTRRKLAALASLKSPVLFIPLQLH
FT                   DDMAVTMFIKGEQQYPEFSASLSETIDANPDIVFVVKPHPLSKLDHLTQKPNLILAARE
FT                   DNIHCLLDIASFTVCYNSGVGLLSILHQTPTATLGNAFYNMAGAGYRASSVQDAIDVFR
FT                   AGNLTPPPSELIERLAAWFIFRRYSRFVATDSIAEFKERKAHGYKDILVTHFRWNGHDL
FT                   PLDRQRRFVQFSRRSYAWSQMAVTVKGTTKHSHSSFYEWAFLITVPATMPPPPKTSRKR
FT                   SNGNAQGQIYYGMPRKLTGVTAIEI"
FT   CDS_pept        616023..616793
FT                   /transl_table=11
FT                   /locus_tag="SM_b20825"
FT                   /old_locus_tag="SMb20825"
FT                   /product="putative acetyltransferase, cysElacA/lpxA/nodL
FT                   family protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20825"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48965"
FT                   /db_xref="GOA:Q92VY2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VY2"
FT                   /protein_id="CAC48965.1"
FT                   /translation="MKEEVVAALGRHRVTFMGQPRDTRFGFGFKKDPIALEPFIQFRGG
FT                   AFDVWKIGAFTYLGCRMTVFRHVDSIGRFCSIAPNVTVGAAEHATRMLGTHSMFNGQWD
FT                   KQWPELFSEFGLTTDQIAVGRQAANAQLAARAGRVKIGNDVWIGDGAFISRGVTIGDGA
FT                   VIAARSVVTKDIPPYAIVGGVPARVIRYRFDEAMIGRLLAAEWWEYGPAILRGVDWSSP
FT                   DKCIDVIEQRVSEGFPRYTPRRIVVKPDDSVEMK"
FT   CDS_pept        616861..617394
FT                   /transl_table=11
FT                   /locus_tag="SM_b20826"
FT                   /old_locus_tag="SMb20826"
FT                   /product="hypothetical protein"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20826"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48966"
FT                   /db_xref="GOA:Q92VY1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VY1"
FT                   /protein_id="CAC48966.1"
FT                   /translation="MSKHSRAFKQSVVEFYLRGNDGYGKVGAEFGIDHSTVLKWVAIYE
FT                   AHGVAGLSKKFSSYDAEFKLSVLKRMWEDGLSCRQTAALFNIRNAGCLSDWERRYEIGG
FT                   IDALAPRRRGRPRTMPEPPLPKQPQAPQNDETKSRAELLAELNYLRMENAYLKKLEALT
FT                   REQPAPRKRKSSRR"
FT   CDS_pept        617618..618205
FT                   /transl_table=11
FT                   /locus_tag="SM_b20827"
FT                   /old_locus_tag="SMb20827"
FT                   /product="putative transposase, probably encoded by an
FT                   unidentified IS element protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20827"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48967"
FT                   /db_xref="GOA:Q92VY0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VY0"
FT                   /protein_id="CAC48967.1"
FT                   /translation="MVEMGLKSLVRPKKYRSYKGDAGRAAPDLLRRQFAADAANQKWVT
FT                   DVTEFNVAGEKLYLSPVMDLFNGEIIAFETARRPAFKLVEGMLNKALERLKSKDRPILH
FT                   SDQGWHYQMPAYQRRLQARNIAESMSRKGNCLDNAAMESFFAVLKSEFFHPNRFDSIQS
FT                   LKDGISDYNHQRIKLKLKGLSPVQYRTQSLIS"
FT   CDS_pept        618428..618703
FT                   /transl_table=11
FT                   /locus_tag="SM_b20828"
FT                   /old_locus_tag="SMb20828"
FT                   /product="putative protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20828"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48968"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VX9"
FT                   /protein_id="CAC48968.1"
FT                   /translation="MSADQVRAMSREEAADIYRRSYWPQCGVDLLPPGLDYAVFDFGVN
FT                   SGPARAVKTLQKVVGVREDGHVGEQTLAAVRKFEGRRRHADPRLLR"
FT   CDS_pept        618700..619116
FT                   /transl_table=11
FT                   /locus_tag="SM_b21663"
FT                   /old_locus_tag="SMb21663"
FT                   /product="putative secretion activating protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21663"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48969"
FT                   /db_xref="GOA:Q92VX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VX8"
FT                   /protein_id="CAC48969.1"
FT                   /translation="MSACASSDRSRTPRPAFRLSGQWPRLDHALNRKDPKELWKDQPGV
FT                   IGNALRLAADASGQTVEKPQTPPESGAKADSSDTGIGEVLKTPEAWGPIGSILTAGGAI
FT                   MAGSGPVQRALAAIMVASAAVGLWYFLRRVREAG"
FT   CDS_pept        619216..619485
FT                   /transl_table=11
FT                   /locus_tag="SM_b21664"
FT                   /old_locus_tag="SMb21664"
FT                   /product="hypothetical exported or membrane-anchored
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21664"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48970"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VX7"
FT                   /protein_id="CAC48970.1"
FT                   /translation="MTRLPYPSKPPSKFSERKARSMLKCLGLTLPLCALITGCQTTNKR
FT                   NACDGFAPFRPKLETTVYILQNDRLFANYVAAHNRLLSSLGCGK"
FT   CDS_pept        619543..619899
FT                   /transl_table=11
FT                   /locus_tag="SM_b21665"
FT                   /old_locus_tag="SMb21665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21665"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48971"
FT                   /db_xref="GOA:Q92VX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VX6"
FT                   /protein_id="CAC48971.1"
FT                   /translation="MTSVKAPTGKWDWNLNTLVILLGFGGGLIAWGGDMGDRLDKRVTA
FT                   VEATIRQIDTHELRISSVEKQAAEAATSMRAVESTLNALAPTCGLRARCCSGSRPASAT
FT                   ARSCGADRLAGALK"
FT   CDS_pept        complement(619946..621625)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20829"
FT                   /old_locus_tag="SMb20829"
FT                   /product="putative secreted calcium-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20829"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48972"
FT                   /db_xref="GOA:Q92VX5"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VX5"
FT                   /protein_id="CAC48972.1"
FT                   /translation="MPVMRPFFIHSTSHFGRKIPAAEEIMATVTYHFPGGLYPSQYNPP
FT                   LSGVSVNPTFGELVDMSESARSTTTSTDVLYRLDNGLKLKLVGTGFSFSPSGDALGGTI
FT                   TSIEVLLNNGTTLVQTISGPSLSLEDFQNASAGFDNLELEAWLLNRADTINGSAGHDNL
FT                   SGHFGNDVLNGNGGDDFITGGNGDDTYDGGTGHDILSFQDAYGSPLATNGVSLNTATGT
FT                   VVDQFGFSETFQNFEEYRGTQFADKMIGSSANETFMGLGGRDTFDGWTGTDLVRYDRDA
FT                   QFGGTLGVKVDLAAGTAKDGFGREDTLTSIEDVRGTDFDDSIVGNWAANFLRGFAGKDW
FT                   INGGTGSDTMRGGKGNDTYTVDRPGDIVDENADSGAGIDTIRSNISFNLGNTAAVKGSV
FT                   ENLVLTGTWNVNGAGNGLNNSLSGNSGNNSLNGGAGDDVLNGDLGNDILTGSVGLDTFR
FT                   FNTALDEATNVDTVTDFIVADDTIQLQGSIFSAISGTGTLTDIQFVANATGAAETAENR
FT                   IIYDIDTGELFYDSDGNGGGGAVHFATLATNLSITAADFFVV"
FT   CDS_pept        621885..622898
FT                   /transl_table=11
FT                   /gene="kpsF2"
FT                   /locus_tag="SM_b20830"
FT                   /old_locus_tag="SMb20830"
FT                   /product="arabinose-5-phosphate isomerase"
FT                   /function="D-arabinose 5-phosphate = D-ribulose
FT                   5-phosphate"
FT                   /EC_number="5.3.1.13"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20830"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48973"
FT                   /db_xref="GOA:Q92VX4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VX4"
FT                   /protein_id="CAC48973.1"
FT                   /translation="MNALTHPTADAHAGGTVLESIGRTLTTATNGIKALADHLTSDQAF
FT                   AGALVDAVELMGDGDGRVVVSGVGKSGHIGRKIAATLASTGTSAYFVHPTEASHGDLGM
FT                   ITAQDALVLLSWSGETAELANMLTYAKRFKVPIISISSNRESTLARNSEIALVLPKVPE
FT                   ACPHGLAPTTSAMLQLAVGDALAIALLERRGFSAEDFKAFHPGGKLGAQLRLVQELAHG
FT                   TGQMPLLSVGRPMSEAVIEMSAKGFGVVGITDESGKLIGVITDGDLRRHMAGDLLAQPV
FT                   QEVMSRNPRVVRSEVLASAAMEFLEEHQVTVLFLVDEAGAPVGILHIHDLLRAGVA"
FT   CDS_pept        complement(622973..623926)
FT                   /transl_table=11
FT                   /gene="rkpR OR kpsE"
FT                   /locus_tag="SM_b20831"
FT                   /old_locus_tag="SMb20831"
FT                   /product="RkpR"
FT                   /function="Capsule polysaccharide export protein"
FT                   /note="High confidence in function and specificity"
FT                   /note="polysaccharide export inner-membrane
FT                   protein,,BexC/CtrB/KpsE family,, PMID: 11768534"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20831"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48974"
FT                   /db_xref="GOA:Q92VX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VX3"
FT                   /protein_id="CAC48974.1"
FT                   /translation="MFTQASGGSTVSDSYILMDYILSERMAADADRRFKLEDVYATRGL
FT                   DYFYGIGSDLPIEDKLAYWRDMVKVNFDHASGIMQVTVKAFEPAQAQEIAKFIVDQSDN
FT                   LVNSLSLSARNDVLRAAQDEVLAGEARLSKARAGLRDYRDKSQEISPEEGAKLAVQLIG
FT                   GLEGELTKLNADLATAKSQMGEDTPRIRVLKTRIESLEQQLAVERQRLGAGEKGTSAAN
FT                   DPNAPDVAGRIAEFEELETEREFAERAYTAALGSLEKARIDANNRQRYLALFIEPTLSQ
FT                   MAQYPSRLLNAFLVTLGLLFAWGVGVMGYYNIRDRA"
FT   CDS_pept        complement(624306..624965)
FT                   /transl_table=11
FT                   /gene="kpsT OR rkpS"
FT                   /locus_tag="SM_b20832"
FT                   /old_locus_tag="SMb20832"
FT                   /product="capsular-polysaccharide-transporting ATPase"
FT                   /function="ATP + H2O + capsular polysaccharide(in) = ADP +
FT                   phosphate + capsular polysaccharide(out)"
FT                   /EC_number="3.6.3.38"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20832"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48975"
FT                   /db_xref="GOA:Q92VX2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VX2"
FT                   /protein_id="CAC48975.1"
FT                   /translation="MIRFEQATKFARTKGIKKPIIEDASLTLNRGKSVGLLGRNGAGKS
FT                   TLLRLIAGAIKLDKGRIIRRGKISWPLGFAGSFQPSMTGEQNVRFVARIYGVDTEQLIG
FT                   YVEEFAELGPYFKAPVGTYSSGMKARLAFGLSMGVNFDYYLVDEITAVGDANFKKKCQA
FT                   VFETRLQDSDVVMVSHSTGTIRDYCDCGVVLEKGKMTYYENVEDAIRAHDKNMKES"
FT   CDS_pept        complement(624962..625741)
FT                   /transl_table=11
FT                   /gene="kpsM OR rkpT1"
FT                   /locus_tag="SM_b20833"
FT                   /old_locus_tag="SMb20833"
FT                   /product="RkpT"
FT                   /function="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /note="ABC sugar transporter, permease component,, PMID:
FT                   11768534"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20833"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48976"
FT                   /db_xref="GOA:Q92VX1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VX1"
FT                   /protein_id="CAC48976.1"
FT                   /translation="MTDVGYLTTHFRVVGALLVREMATRFGSKPGGYVWALLDPAAHIL
FT                   LMTVIFQAIARAPALGTSFALFFATGYIAFQFYQAMTGYLNAAVKANKALLSYPNVAPI
FT                   DTIVARFVLQMGTTSLVAFIVLGTIVATMRVDTDIHWPSILEAVGLACLFGLGVAMVNC
FT                   VLFLKYPLYEQVFSIVNRPLFLISGVFFLPDSIPAPYRDLVLINPLVHVIMGFRKGFYP
FT                   EYRAIGLDMDYLYGIAFLTLFAGMLVFTLSRKTLRNE"
FT   CDS_pept        complement(625738..627036)
FT                   /transl_table=11
FT                   /gene="rkpZ1"
FT                   /locus_tag="SM_b20834"
FT                   /old_locus_tag="SMb20834"
FT                   /product="probable lipopolysaccharide processing protein"
FT                   /function="Capsule polysaccharide export protein"
FT                   /note="High confidence in function and specificity"
FT                   /note="probable surface saccharide synthesis
FT                   protein,possibly involved in chain-length determination,"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20834"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48977"
FT                   /db_xref="GOA:Q92VX0"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VX0"
FT                   /protein_id="CAC48977.1"
FT                   /translation="MAVTRRQREDFATISSAPTPEPVTTFAVQIVEWKREPFERYFPNR
FT                   RFHFLPMNVGVREFERVWRPRILAEKDAEFLAWGPELPGPLEALARARNIPVTFIEDGF
FT                   LRSTRPSASRTPPLSLALDGRALYFDCRHPSDLEVLLKTYDFEADAALMERARAGIALL
FT                   TESGISKYNGARRRAAEEVYGEKTRKRVLVVGQVEDDASVRYGCLARMSNNDLVRLANS
FT                   EQADAQIFYKPHPDVLSRVRPARSDPAEVAHLCELVTDSLPLAEALRTVDHVYTITSLA
FT                   GFEALIRGIPVTTAGCPFYAGWGLTDDRQTNPRRGRQLSIEALFAGAYLLYPRYFDPET
FT                   GAQTSFEATVTAIRRQLDEPQSLGPPRPQWRAWGPYGLLGWRHLLTAFVTAAIRKIGSD
FT                   RDVEDFRADPIRFFRSLSDRKYRIIGRILYPFG"
FT   CDS_pept        complement(627125..628120)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20835"
FT                   /old_locus_tag="SMb20835"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20835"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48978"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VW9"
FT                   /protein_id="CAC48978.1"
FT                   /translation="MTAIYSSRDSISGFKGMAEEKRAQSSMRSSLEHLPEKKQRELARV
FT                   VEVIHEELEDALKGGTSEFKKRGRILKIILFGSYARGNWVDEPHTKKGYKSDYDLLVVV
FT                   NDRRLTDFATYWSKAQDRLMHLSEVQTPVSLIVHSRREVNTALYEGQYFFVDIRRDGIV
FT                   LYELDDEPLAEPKSLSPAEALRVARQNFDDKFPSAPSFLDTAQYLVRKNQLRHSAFELH
FT                   QSIETAYSCLLLTLTNYSPPSHSLKFLRGLAEDHDRRLVEVWPRDQHRFTAWYNILNEA
FT                   YVKARYSKHFEITDEALSWLLERTEHLLRLVEMICTERLGELERAPVRDQ"
FT   CDS_pept        complement(628101..628430)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20836"
FT                   /old_locus_tag="SMb20836"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20836"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48979"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VW8"
FT                   /protein_id="CAC48979.1"
FT                   /translation="MLRSAAQVYPVYAALTTCNVCHDRSGRHSFLLFSICYDRSGDRRP
FT                   WLSFSSGARNDASHSRATPEAKLTLLVCHPRIRRRPRTASLYRRDRQDGQHDFAGMHKS
FT                   DRDLQ"
FT   CDS_pept        complement(628971..629195)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20837"
FT                   /old_locus_tag="SMb20837"
FT                   /product="Hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20837"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48980"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VW7"
FT                   /protein_id="CAC48980.1"
FT                   /translation="MINFRPTRCLVLGRGMFAIGASAKAAKIGGDLCEQAARAINAAEA
FT                   YGCFTPISEADLFDMEYWSLEQANLKIAV"
FT   CDS_pept        complement(629245..630306)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20838"
FT                   /old_locus_tag="SMb20838"
FT                   /product="Calcium binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20838"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48981"
FT                   /db_xref="GOA:Q92VW6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VW6"
FT                   /protein_id="CAC48981.1"
FT                   /translation="MVLPKGRAMATRIYGTNYADVIKQNGYIAVEIYAYDGDDDIYLNR
FT                   TDSYGGYNFVDAGYGNDLVVNSYEGGNDIYLGGGNDIYVADIRARDASSYDIVYGGSGN
FT                   DRFEIEGYASDYYGESGNDTFFSVGFNNYFNGGTGTDTISYQFQDDWSAERGKGVTIDL
FT                   GYNYATTGSGRREDLISIENATGTNYGHDDITGSAVANTLRGLGGHDIIEGLGGNDVLD
FT                   GGSGDDDLYGGSGADILRGGTGFDYLVGGTGTDSFDFNSISESAVGSRRDVITDFHRSE
FT                   FDVIDLSTIDADTTWSGNQSFTYIGGNAFSGEAGELNFRSGIISGDVNGDGYADFQVRV
FT                   NGVTSLRVDDFFL"
FT   CDS_pept        630969..631178
FT                   /transl_table=11
FT                   /locus_tag="SM_b20839"
FT                   /old_locus_tag="SMb20839"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20839"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48982"
FT                   /db_xref="InterPro:IPR018738"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VW5"
FT                   /protein_id="CAC48982.1"
FT                   /translation="MKTFIVQRVACFDPASIVDDAVRMDTADSKTRKTFLEDTAIIAIS
FT                   DRAVRLRALQRKAENLARCSAVIA"
FT   CDS_pept        complement(631205..631897)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20840"
FT                   /old_locus_tag="SMb20840"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted enzyme involved in methoxymalonyl-ACP
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20840"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48983"
FT                   /db_xref="InterPro:IPR010037"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VW4"
FT                   /protein_id="CAC48983.1"
FT                   /translation="MSTIEVGEDPSFFIDRVAGSGLFDHLPLNSDDLARANSYGGRAAV
FT                   AEIRARVGNYEEYLKSLEMRMTISPFDEVGRPRIVQLINKSNQFNLTTRRYNEEDVRRM
FT                   QEDPNFIGWQIRLDDKFAQHGTIGVVIVLKKGSEWEIDTWLQSCRVLERGVEQGLMNSL
FT                   IEQAVSADVVSIRGRYIPTERNAMVSDFYPRLGFDLAGTNGNGSVDFVCTISQYEPHPV
FT                   SMNISLCV"
FT   CDS_pept        complement(631879..633090)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20841"
FT                   /old_locus_tag="SMb20841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20841"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48984"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VW3"
FT                   /protein_id="CAC48984.2"
FT                   /translation="MNTMFPWRPPLEENWAARVAELEAIAAAGEMPDYAATRSVANQQL
FT                   GPRQQLRIERLGKRLGKIKGNGFTRIELGLLGNRTLSYLCDPLGAAGLARGLLVSAHEA
FT                   PYDGVAGFAFSAKNCFERGLDAVLAVLDESALHGERPLLDRVAEDEAVLEAERIASAIA
FT                   EAARSKTGCPAIIATLPPCIQLTSADIATPGSTARFRLRVNMMLGDGAAEGRWLMWDQA
FT                   ALASRIGIERWFDPVAYHSAKVPFNVELCPLAADNIASLLAAKSGKSARALVLDLDNTL
FT                   WGGVIGDDGLAGIRIGQNSAEGEAFVAFQNFVLGLRERGVVLAVCSKNTDAVAREPFRR
FT                   HPDMLLKEEHIAVFQANWDDKPQIFVRSPKNSVWVWSHFPTLTTILPNANASDGSFRSC
FT                   PQLR"
FT   CDS_pept        complement(633126..633377)
FT                   /transl_table=11
FT                   /locus_tag="SM_b22007"
FT                   /old_locus_tag="SMb22007"
FT                   /product="Acyl carrier protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22007"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51286"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDC7"
FT                   /protein_id="CAQ51286.1"
FT                   /translation="MSDHQLYLSQVADVIRELFDEYDGPITLETTARDVPQWDSLSNVR
FT                   LMVLIEQELAVRFSTAEVQGFKNLGSLIDAVVKRKQNQ"
FT   CDS_pept        complement(633438..634667)
FT                   /transl_table=11
FT                   /locus_tag="SM_b20842"
FT                   /old_locus_tag="SMb20842"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20842"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48985"
FT                   /db_xref="GOA:Q92VW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VW2"
FT                   /protein_id="CAC48985.1"
FT                   /translation="MVGKMLVASTNPHLPSAAGRWMGAEHVHGRRGTLRKKPSFSPRWR
FT                   AALPMIVTFCLVWLGYLSIVTIVIATDPYDIYRWGARLKLTRNDVPRDVVVRWVDVVSK
FT                   QSGINTFLVGGSTTAMYSPDDISAALGGSVVAYNLSYGGPRPMDRDIVLDQLAINAQAK
FT                   RIIITFDWMYILDSEKMRQGFPEYLYDEQISDDIRMVDLKSLRRTWKVLLGETSYEAQD
FT                   DERYAKFTERQYRSFQMPAQMAELQGLIEEYRSVVDAPSGRTCASFNAVNEQLVPRIRK
FT                   FVEKGAQVDVIMPILSYANYYFRMSDISATLLDEVLLSRRCFVKSIDTLPNVRVFAWDD
FT                   DPRIAGDLGNFRDPGHVYNPGLLRRTLTSLSTGENRLTAADVDAYERRIRTEVKNYRLR
FT                   NSYLERTARK"
FT   CDS_pept        complement(634671..636197)
FT                   /transl_table=11
FT                   /gene="algI"
FT                   /locus_tag="SM_b20843"
FT                   /old_locus_tag="SMb20843"
FT                   /product="probable alginate biosynthesis protein"
FT                   /function="Predicted membrane protein involved in D-alanine
FT                   export"
FT                   /EC_number="2.3.1.-"
FT                   /note="High confidence in function and specificity"
FT                   /note="probable poly (beta-D-mannuronate)
FT                   O-acetylase,(Alginate biosynthesis protein algI),, MBOAT
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b20843"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48986"
FT                   /db_xref="GOA:Q92VW1"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VW1"
FT                   /protein_id="CAC48986.1"
FT                   /translation="MTLIAFYLALLTRGRNEALLVIFTASIIFYAPYGISSVFLLLVAL
FT                   LVNFGVSNALLAMDDSNPYRRVLYGCGQGYNIASLCYFKYKIVTVLLGDNNDFLTDIAG
FT                   VAIPAGISFYTFHQAAFLADAYVREKSVVEFFAGTRSLRAGFWAFCRYGAFVSFFPQLI
FT                   IGPITYLHEFHPQVKSRKFISFDPLNIAVGLAFISIGMFKKVVIADNIAPTVDLVFGAA
FT                   GAGAVMDPAHAWIGALSYMAQLYFDFSGYSDMALGLARMFGLRYPLNFYSPFKANGILD
FT                   YYRRWNMTLTRVIARFLFTPLSIAGTRYCAVHRLSPLPTQVLSLWLPMLINFQVLSLWH
FT                   GAAWTFVAFGLMQGVWSAAEAQIRGSKKYKRMCKSTSPFFRLLVERAIFFMLICLSLAM
FT                   FRSESVGAAFHLYAQMFGASLDAPSAFEMREPVLMLFCAFSIIYLMPNAVELMRRYRPA
FT                   MMTYENESYGFAFLRSIWRPSWGWAAFAAILTISSLHYVSRQPPFLYQGF"
FT   CDS_pept        complement(636623..637090)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21013"
FT                   /old_locus_tag="SMb21013"
FT                   /product="hypothetical protein"
FT                   /function="Lactoylglutathione lyase and related lyases"
FT                   /note="hypothetical protein,"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21013"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48987"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VW0"
FT                   /protein_id="CAC48987.1"
FT                   /translation="MAVITFDPRKVFHYGFVVPNMDRALKTWTQQGATLVVPPAIDPAQ
FT                   NVSCALLIYLDSVPIELVAPLRDGPNPVASRLAKGGGLDHVCLFSDSLEDDVAKLEADG
FT                   AMVVVAPCYGAVFKRRLAFVVTRAGLVVELMTRTTVEGAEGDPLAPLNGRA"
FT   CDS_pept        complement(637296..637676)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21014"
FT                   /old_locus_tag="SMb21014"
FT                   /product="putative protein, similar to part of
FT                   LpsZ,possibly not functional result of genomic
FT                   rearrangement"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21014"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48988"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VV9"
FT                   /protein_id="CAC48988.1"
FT                   /translation="MARARAGIALLTESGISSIMARVSARRGGPGEKTRKRVLVAGQVE
FT                   DHASIRYGCLSRMTNNDLGAARDLRASGCLDPLQAASRRARPPMRTVDHVNRSPRLRAS
FT                   RRSCAASGVTTAGVSLLLRIGA"
FT   CDS_pept        complement(638049..639299)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21015"
FT                   /old_locus_tag="SMb21015"
FT                   /product="putative enzyme, similar to oxidoreductases
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21015"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48989"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VV8"
FT                   /protein_id="CAC48989.1"
FT                   /translation="MESRWNDEDAARFVEAARAEGQSEALGLRIYTSRLIGSDPDLVLH
FT                   GGGNTSVKIRSDEGEQLMHIKGSGWDLDTIEAPGLPAVRLASLLEARNTPKLSDPDMVL
FT                   LLRASLIEKDAPNPSVEALLHAFIPFDYVDHTHATAVLALADQPNMRDAIRRIYGDRLA
FT                   YVPYVMPGFDLSIAADRIYRSHSDCEGLWLENHGLFSFANDARASYDLMIEFVTLAEQE
FT                   LARAGVALSGPQPNDGERDAALAARLEKALMRERSPFAKGVFLDYRSTEAIRELTSKPN
FT                   VETISLRGTVTPDHVIRIKPWPMIIGADADEPAIESALAAYADRYRAYFERNATRANEK
FT                   KRILDVYPRVVLVLGKGMFAIGANAKAAKIGGDLCEQAARAINAAEAYGCFTPISEADL
FT                   FDMEYWSLEQAKLKIAV"
FT   CDS_pept        complement(639364..640395)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21016"
FT                   /old_locus_tag="SMb21016"
FT                   /product="putative sugar ABC transporter"
FT                   /function="Transcriptional regulators"
FT                   /note="Conserved hypothetical protein"
FT                   /note="probable sugar ABC
FT                   transporter,,extracellular/periplasmic substrate-binding
FT                   component,,putative yneA gene"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21016"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48990"
FT                   /db_xref="GOA:Q926H7"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="PDB:3EJW"
FT                   /db_xref="UniProtKB/TrEMBL:Q926H7"
FT                   /protein_id="CAC48990.1"
FT                   /translation="MIKTIMKSSALAAALLAGTVLASGAAHAENQIAFIPKLVGVGFFT
FT                   SGGAGAVKAGEEVGAKVTYDGPTEPSVSGQVQFINNFVNQGYNALIVSSVSPDGLCPAL
FT                   KRAMERGVLVMTWDSDVNPDCRSYYINQGTPEQLGGLLVDMAAEGVKKEKAKVAFFYSS
FT                   PTVTDQNAWAEAAKAKIAKEHPGWEIVTTQYGYNDAQKSLQTAESILQTYPDLDAIIAP
FT                   DANALPAAAQAAENLKRAEGVTIVGFSTPNVMRPYIERGTIQRFGLWDVTQQGKISVFV
FT                   ADHVLKNGPMKVGEKLEIPGVGTVEVSANKVQGYDYEADGNGIILLPERTVFTKENIGN
FT                   FDF"
FT   CDS_pept        complement(640398..641411)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21017"
FT                   /old_locus_tag="SMb21017"
FT                   /product="putative sugar ABC transporter permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21017"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48991"
FT                   /db_xref="GOA:Q92VV7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VV7"
FT                   /protein_id="CAC48991.1"
FT                   /translation="MKKLIFRWETALFAMLVAELLIFGLVNPRFLNLTNLIYGTSDFVQ
FT                   IGIVALPLTLVIIAGGIDVSFASVIGLTAIMFGVATFYGVPLPLSILLALVTGALCGLL
FT                   NATVIHLSKIQPLVVTLGSLYLFQGTATVASGLVGAGGYEGIGNFPEAFNAFGYAEFLG
FT                   LPAPLALFLALSLVLIVLLHFTRFGRTVFLSGQSERAAHFAGIPVGRVQTFTYVITGVS
FT                   AAIAGLVMSAYFGSARVDLGSATLLPAVTAAVLGGASIYGGQGSILGTLLATFVIGYLQ
FT                   QGLQAAGVPSQISSALSGGLLVVAVALRHASAMLADFIAVARQQRQNRVAVTSGGE"
FT   CDS_pept        complement(641408..642439)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21018"
FT                   /old_locus_tag="SMb21018"
FT                   /product="putative sugar ABC transporter permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21018"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48992"
FT                   /db_xref="GOA:Q92VV6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VV6"
FT                   /protein_id="CAC48992.1"
FT                   /translation="MLDLFSRNRVATLILVLAVAYAAIGTAAPGYLSGATASVVVSNSL
FT                   VLMLISLGTMMVILTRNIDVSSGSVLGLSAAVLGLSLTAGVSLPLAIAFCLATGAVAGA
FT                   FNGLMVAYLGIPSIVATLGTLGLYRGIMLVLTGGRWIEDLPQGLKALAANLGFGFSVLT
FT                   IVVLALVALAWIVLRRTRFGRNFYAVGDNRAAAHHLGVPVKLVQFSAFVATGVCAALAG
FT                   LVFAAQIGFIPNQAGNGIELKAIAVNVLGGVSLLGGTGSVAGVFTAVIFITSIDSALVF
FT                   LKIPAYWNDFIAGAILLSVLLLDGRIRQIIDRRIRARRYGVHERGPTQSRETTTARNVE
FT                   ASR"
FT   CDS_pept        complement(642432..643949)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21019"
FT                   /old_locus_tag="SMb21019"
FT                   /product="putative sugar ABC transporter ATP-binding
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21019"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48993"
FT                   /db_xref="GOA:Q92VV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030281"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VV5"
FT                   /protein_id="CAC48993.1"
FT                   /translation="MNRCGMAGSPVAGRVAKLTDVWKSYGAVPVLKGVSLVLHAGEVHA
FT                   LLGGNGAGKSSLMKIMSGVIASNAGAIEINGRALTHASPALAQKLGLYLVPQEAHILPN
FT                   QSVLENICLGLAASPRALRPRVEQLVAELSVSLDLDVQAAALEIAERQIVEILRGLVRD
FT                   ARVLILDEPTSALTPFETSALFQRVRKLQSQGVGIFFISHKLREIREICGTISVLRDGV
FT                   IVLSGPLDSYSDAVIIDAMSRVQIADDADKKRVCRKVSQIGKPRLSVRDLSGEGFRDIS
FT                   LDVRAGEILGLAGVVGAGRTEFAETLFGLRPQMGGSVVFDGAELKKRSPRICIDLGLVY
FT                   LPEDRQQHGLFLEAPLSWNVSSYLVHRLPFFLRPGAERKVFDGFRASMGIKCTGADQEA
FT                   RGLSGGNQQKVLLAKCLSARPKVLILDEPTRGVDVAARNDLYDVIRRLAADGVAIILIS
FT                   SDFHEIEQLADRVEIMAFGQSGGKLTDQISVDAIARLAFGASEGRHA"
FT   CDS_pept        644175..645122
FT                   /transl_table=11
FT                   /locus_tag="SM_b21021"
FT                   /old_locus_tag="SMb21021"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21021"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48994"
FT                   /db_xref="GOA:Q92VV4"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VV4"
FT                   /protein_id="CAC48994.1"
FT                   /translation="MASDNGEWSYADTDEEILTRIAWYYYNDGLTQNEIGEKLNMSRIK
FT                   VSRLLESGRRSGIIQVRINSRYQGCLALERRIKERYGLLEAYVVPQLPDQDPSDRLGQA
FT                   AAQFLMQRLQPDDLLAVGWGATVSNTIQRLGHVANERNIGLVSLTGGVGTYVDGMRTAN
FT                   WGSSVHLVPAPLVVRDPDVARNLSSEPAVANLLEMALNASYQLVGIGELSATSTVVRSG
FT                   YVSPDEVEPLRRKGAVGDILCQFYNECGEPLELPLHDRVIGVKLAALSRAEKVVAAAGG
FT                   IHKVQAIHAALCGKVVGILITDETTASRLIELED"
FT   CDS_pept        645127..646725
FT                   /transl_table=11
FT                   /locus_tag="SM_b21022"
FT                   /old_locus_tag="SMb21022"
FT                   /product="probable sugar kinase, probably EGGY family
FT                   protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21022"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48995"
FT                   /db_xref="GOA:Q92VV3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VV3"
FT                   /protein_id="CAC48995.1"
FT                   /translation="MKTSYMLAVDAGTGSGRAVIFDENGNQIASAQHEWWHRADPRFPG
FT                   SMDFDVEGNWSLLSRAIRQAIAESRIAPAEIRAVSATSMREAIVAYDRSGREIWACANV
FT                   DSRAVSEVRDLQRDFADLERALYTESGQTFALGALPRLLWLKRNLPDVYARIHKISMLS
FT                   DWVLARLSGVIASDPSNAGTTGLYSLTKRDWMPEALSKAGMRDDIFPESVEPGTVIGRV
FT                   TEKAASETGIAVGTPVVMGGGDCQSGAAAVGVVNEGDCAVLGGTFWQQVVNVGPSVSDP
FT                   SMDLRINPHVVNGLNQAEAISFFVGMVMRWFRDSFGAEEVAAAGPGGDAYRLLEEKAAG
FT                   VPVGAYGIIPVFSDVMHYGNWYHAAPSLLNLSIDPEKSGKAAIFRALQENAAIVAARNL
FT                   SAIFKLSGKTPDKIVFAAGASKSAHWSQILADATGLPVVTPVVKEATALGCAQRRQSGS
FT                   AYAATSSRRRRAGCAGTSVSSRISTTRLSTTRRASAGHAPTRCSDSSWTRASPRPCGRR
FT                   QVSEFYRSVNQHSRN"
FT   CDS_pept        646729..647043
FT                   /transl_table=11
FT                   /locus_tag="SM_b21023"
FT                   /old_locus_tag="SMb21023"
FT                   /product="hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /note="hypothetical protein,, antibiotic biosynthesis
FT                   monooxygenase motif"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21023"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48996"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VV2"
FT                   /protein_id="CAC48996.1"
FT                   /translation="MLIQMVSINVKQGHAADFLEAFRINYEGTRQEPGNLRFDVLRNPD
FT                   DDHSFVIYEVFKSPEALDAHRKTEHYQECVRRIDPILAGPRTKTFYNVEMADFLAAGQA
FT                   "
FT   CDS_pept        647212..647379
FT                   /transl_table=11
FT                   /locus_tag="SM_b21024"
FT                   /old_locus_tag="SMb21024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21024"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48997"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VV1"
FT                   /protein_id="CAC48997.1"
FT                   /translation="MPRCCGVRVTPTPPLFLTKNFGSHPIPCLKHVGNDVVNDGHQRAI
FT                   RQAVPIGRLA"
FT   CDS_pept        complement(647391..647810)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21025"
FT                   /old_locus_tag="SMb21025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21025"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48998"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VV0"
FT                   /protein_id="CAC48998.1"
FT                   /translation="MSTFLKQLFAFGLAAVILQLPQHAALAADPCKGVDTKLSATRKAD
FT                   YSRLVANGLDQKVQPSKISIINFMQAGTWTIVYADVPVADPGYFFFDSSSGNPVLKEVW
FT                   GGIAEKSDEPEIAKWARDLGANKMIASCFADTVSG"
FT   CDS_pept        complement(647954..648091)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21026"
FT                   /old_locus_tag="SMb21026"
FT                   /product="hypothetical exopeptide protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21026"
FT                   /db_xref="EnsemblGenomes-Tr:CAC48999"
FT                   /db_xref="GOA:Q92VU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VU9"
FT                   /protein_id="CAC48999.1"
FT                   /translation="MDRAGVAFLVLICVLIALVVSILGFVPESEVPPDVPEVVPQTPLR
FT                   "
FT   CDS_pept        complement(648788..649504)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21027"
FT                   /old_locus_tag="SMb21027"
FT                   /product="hypothetical membrane-anchored protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21027"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49000"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VU8"
FT                   /protein_id="CAC49000.1"
FT                   /translation="MGSVSDRTDVFAWLNRNLTMTCREPGAFIARWSIARQRTNVFPDR
FT                   DPPRGMMLRAGPARRRVASRCFSVNRATSMPQFGILWRDIEAHAPRVLDTLDEQSRCLA
FT                   RVSKALFMPQTLDLWTCSTSPSPMLRVTTSTEATAAADIPLFRSKQPAVRIEHAAKIGE
FT                   ADTGELFQNTLDSRFRLESALTLDFGHAVFDAVICCQAGSVALSGLYPADAYASSADLP
FT                   LKSSRANFSCLGTDMD"
FT   CDS_pept        complement(649719..649880)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21028"
FT                   /old_locus_tag="SMb21028"
FT                   /product="conserved hypothetical protein, similar to
FT                   Y20302"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21028"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49001"
FT                   /db_xref="GOA:Q92VU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VU7"
FT                   /protein_id="CAC49001.1"
FT                   /translation="MSAAISILVTILFVIVLLYLVQKLPIDSTMKQMAQIVVLIVGAVS
FT                   LLSSLGVF"
FT   CDS_pept        649978..650502
FT                   /transl_table=11
FT                   /locus_tag="SM_b21029"
FT                   /old_locus_tag="SMb21029"
FT                   /product="putative protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21029"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49002"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VU6"
FT                   /protein_id="CAC49002.1"
FT                   /translation="MPVCRRRRSASSQNMDPAWPVAGGRRQASHRPPSATGTAARGVNT
FT                   MRLGLYSPIRAKPKATIRDRAVSAAAFEILNSRVCEFERSEAGPLLSSREKGLSASKSK
FT                   RPAIRAGVTFHGVPSRLWVGRRMLFCSGSPKSSLSRINRNPPVPIRKASTPVRLRRWSL
FT                   RAVEKGTIFTT"
FT   CDS_pept        complement(650647..651096)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21030"
FT                   /old_locus_tag="SMb21030"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21030"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49003"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VU5"
FT                   /protein_id="CAC49003.1"
FT                   /translation="MLRRTILAFFVVASATAAFVPAEAQDCDAAGTVGSGGSAAAGGTS
FT                   ASTIGTAGTCRTDDGTTSSIGVGGSAATSEGKAKSQTKINDNPSQLQGQSKAQAMDKGT
FT                   FSKSQTKTKVTDDGLQSRTKTMSHVPGEKPTKSKTKTLIPLPQPE"
FT   CDS_pept        complement(651108..651719)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21031"
FT                   /old_locus_tag="SMb21031"
FT                   /product="hypothetical membrane-anchored protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21031"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49004"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VU4"
FT                   /protein_id="CAC49004.2"
FT                   /translation="MAQPLDQVAEHRMRPPAVSKAMKTAPATPPRTMRATRIVLLASPR
FT                   RTAPRATDRPADIKSAGFGGPFRSQRFQEGGGPMTSSSFLVPVITALFAAAMAAPDHAA
FT                   AKEIKLDDGSTCVVIEPEQSDGSRVSSSVTVGSGSVSSSTTVGGGTSASGGSATSSAGS
FT                   SVTSGSSGGESFATATVTRPDGTTITRRSDGTCAIIKPKK"
FT   CDS_pept        651740..652156
FT                   /transl_table=11
FT                   /locus_tag="SM_b21032"
FT                   /old_locus_tag="SMb21032"
FT                   /product="hypothetical proline-rich protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21032"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49005"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VU3"
FT                   /protein_id="CAC49005.1"
FT                   /translation="MLPPPAEEPPVPRVEAEPALPDPAADPPVPTELLDVPPPAEDPPV
FT                   PSVDAEPDWQSLVFGSQPPPAELPPVPTVLLEVPPPALVPPVPIVVLDCANAPSVVPAR
FT                   RPAARAVLMKYRIGVPFLTLMSLWLQPAYQPKPA"
FT   CDS_pept        652630..652914
FT                   /transl_table=11
FT                   /locus_tag="SM_b21034"
FT                   /old_locus_tag="SMb21034"
FT                   /product="putative protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21034"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49006"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VU2"
FT                   /protein_id="CAC49006.1"
FT                   /translation="MLPGLFVIQDGSYPSCLIMAESIATIRSRARFRKVARGCIPRRAG
FT                   EVTRKKALEASVGRGLCGKANEGPELQQAFCMTLQSMHEITEFCSWSLR"
FT   CDS_pept        complement(653580..653798)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21035"
FT                   /old_locus_tag="SMb21035"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21035"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49007"
FT                   /db_xref="GOA:Q92VU1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VU1"
FT                   /protein_id="CAC49007.1"
FT                   /translation="MEQCRGARAMLGWSQAELAKAASVSRQTIADFERGAHVPIVNNLA
FT                   SIVAAFAKAGIEFIPENGGGVGVRFKK"
FT   CDS_pept        653937..654485
FT                   /transl_table=11
FT                   /locus_tag="SM_b21036"
FT                   /old_locus_tag="SMb21036"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21036"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49008"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VU0"
FT                   /protein_id="CAC49008.1"
FT                   /translation="MADSDNSRTLSTVTRGDFYSFVAASLPTSQEFARATRLPSDACND
FT                   DPALVVWQQWCNAREHLSESTLRQQRHESSLFSVVLPPPLEQFAGSRTYSEALEAEDRA
FT                   SIAEEQAAESLWETPAVSIAGAAAKLHAAMTKWQPSPTSQEEPWPQIRSVIADLLKIDT
FT                   GSVASRLSMPERQPELQGD"
FT   CDS_pept        654648..656243
FT                   /transl_table=11
FT                   /locus_tag="SM_b21037"
FT                   /old_locus_tag="SMb21037"
FT                   /product="putative oligopeptidemurein peptide ABC
FT                   transporter periplasmic solute-binding protein precursor"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21037"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49009"
FT                   /db_xref="GOA:Q926H6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q926H6"
FT                   /protein_id="CAC49009.1"
FT                   /translation="MKLGSPFRPRLLSAFLISIFLGSAPATLAQERGELRIATSYKLMT
FT                   LDPQYANLNENTSLLSHIYERLVYQDDNLELKPGLATSWRPLSDTQWAFKLRDKVRFHD
FT                   GSAFDADDVVYTIERIRDFLKPPSGGFRSYVSGIKSVSAPDPLTVLIETDGAVPNLPLF
FT                   FSSLFVMNRPSKGFETTENLNAGHPPNGTGPYRFESWSSGESLRLARNDDYWGGKPAWS
FT                   KVTFRVIENPAARVAALSTGEVDVAHAIPARDVASLKQRGAKIASVGAARVNFVQFDVA
FT                   RDTLPGVTDKSGEPIANPFKNPLVRRALTLATDRGILVDKILAGYGTAAAQVFPNGLPG
FT                   TSANLLPEAPNYDEAKMLLAKAGFPDGFNLVLAGPAGRYPGDAESLQAVAQSWARIGVN
FT                   AQPAAAPFSVFNTKRAAGDYGVWYGGTSGEAVDIILHSLLASPDPERGTGALNFGKYRN
FT                   EAFDAMLAGAESIAVGPERNAALAQATELVMADQPIIPLYHFHHIVGYGSRIGSYLLHP
FT                   RGWTTAMQTLPAME"
FT   CDS_pept        656250..657227
FT                   /transl_table=11
FT                   /locus_tag="SM_b21038"
FT                   /old_locus_tag="SMb21038"
FT                   /product="putative oligopeptidemurein peptide ABC
FT                   transporter permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21038"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49010"
FT                   /db_xref="GOA:Q92VT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VT9"
FT                   /protein_id="CAC49010.1"
FT                   /translation="MGMISVALGRLGQAFLLLIAMSLIGFIGIHSVGNPVFNVVNIETA
FT                   TPEDIHAATIALGLDQPIWRQYLAFIGNVVSGNFGTSYIYHLPAFELVMSKLPATLELA
FT                   SIAMLIAAPLGTGLGLLAGRRSGTLFDRTMVKASVSALSIPSFWLAMMLILVGAILTGW
FT                   FPSGGRGLTASFLGQEWSFLTANGLWHLVLPALALAIPNIALIARLSRSGTIEVENLDY
FT                   TRFCRAKGLSARRILFRHTLPNISVPIVTIIGLQFGGMLAFAVVVETIFSWPGVGKLLI
FT                   DSIQLLDRPVVMATLTVIAVAFVALNALVDLFYAVLDPRVRLSS"
FT   CDS_pept        657241..658116
FT                   /transl_table=11
FT                   /locus_tag="SM_b21039"
FT                   /old_locus_tag="SMb21039"
FT                   /product="putative oligopeptidemurein peptide ABC
FT                   transporter permease protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21039"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49011"
FT                   /db_xref="GOA:Q92VT8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VT8"
FT                   /protein_id="CAC49011.1"
FT                   /translation="MKAQIVSALKRRRHGPVLTASKLLLASYILVAIAAPLIAPQNPYD
FT                   PLQIYGWEASSPPGTRGSGGYLYLLGTDGLGRDIVSTILYGLRISLVVSIVSSALAALI
FT                   GLTAGVSAAYFGKWVDIAIMRLVDLQLSLPTILIALIAIVTLGPGIDRIILALIIAQWA
FT                   TYARIARGVALSEANKPYMDAARLMRLPTSRIIFRHLLPNSIAPAVTLIPIEVGHAVAL
FT                   EATLSFLGLGVPIDKPSLGSAVANGFQYLLTGQYWISLFPGLALFGLIASINLVGEDVR
FT                   RSLDPRNHSR"
FT   CDS_pept        658113..659786
FT                   /transl_table=11
FT                   /locus_tag="SM_b21040"
FT                   /old_locus_tag="SMb21040"
FT                   /product="putative oligopeptidemurein peptide ABC
FT                   transporter ATP-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21040"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49012"
FT                   /db_xref="GOA:Q92VT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VT7"
FT                   /protein_id="CAC49012.1"
FT                   /translation="MTVEHVTTPLLRVENLGLRHVSGSATTPILSDVSFELGRGEILGI
FT                   IGESGAGKSTVGNAILGLLSPEFQQTSGTIEFDGKAIDGMTADERETLRGRRISAIFQD
FT                   HTASLDPLMSVGAQVEETCLALDSSLSRREARARAIDLLARVGIPEPERRYRNYPHQFS
FT                   GGQRQRVVIAIALAGSPDIIIADEPTSALDATVQKQVLELLKILVDETGVSIILVTHDM
FT                   GVISEITNRVLVMRKGQVVEADRTTAILDQPRHDYTKKLLAAVPRLRIPTRTAKAEDNG
FT                   RQADSPAIDSDQNPLLIAEGLSKQFAPQGFAWGIGRGKPRFGLRDVGIRLARGSITGIV
FT                   GESGSGKTTFGRILAGLDTAPTGRITIGEHPFDVSQSGRRSGLLGRVQMIFQDPSVSLN
FT                   PRMTIGETLDESIRFGARIRSGEEPADLAAMMDRLGLPRSLLGRHPHQLSGGQKQRVCI
FT                   ARALLARPEIIVADEPTSALDVSVQAEIVQLLKDTIAERAMTMVFISHDLAIVQAMCSS
FT                   VYIFKDGRIEDFGPTEFIFSRSDNPYTRALINARPQRFTC"
FT   CDS_pept        659874..661109
FT                   /transl_table=11
FT                   /locus_tag="SM_b21041"
FT                   /old_locus_tag="SMb21041"
FT                   /product="conserved putative protein, possibly related to
FT                   processing of cell wall amino acids"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21041"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49013"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VT6"
FT                   /protein_id="CAC49013.1"
FT                   /translation="MNDRFTLAVTGQSLIKHDIRDIPAPAFRELQSLLRQADLSFTNFE
FT                   GTILGRHGGWPLKGSFFGCSDPVVLDTLRAIGFRALSLSNNHAFDLGPSGVLSTLEEVE
FT                   KRGFLHAGLGRDQAQVSRASTATIGGRRVAIVAMDGGPGPDFMYAADGDDDRPARPGVN
FT                   RLRLTQVLEVDGAAFEQIRAIRDKIGYTAIDLTNDSQPDDPRHPAPDHEIGIARAVFRR
FT                   SGQFGRSVKIDEADLSRNLSAVATAAKNGSLVVAYLHHHHWASDWYQVPDWVSGVAREC
FT                   IDAGAAMFVSHGAPVLQPIEIYRGRPIFYSLGNFIFHVRSEKSTWTAPEVWESVVGVCS
FT                   FREDNRLIEITLYPVVIGGDEALADRMLERRLAPHLATGESAARILQRCSEQSARLGVD
FT                   IELCGDVGVIRF"
FT   CDS_pept        661226..662467
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="SM_b21042"
FT                   /old_locus_tag="SMb21042"
FT                   /product="tripeptide aminopeptidase"
FT                   /function="Release of the N-terminal residue from a
FT                   tripeptide"
FT                   /EC_number="3.4.11.4"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21042"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49014"
FT                   /db_xref="GOA:Q92VT5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92VT5"
FT                   /protein_id="CAC49014.1"
FT                   /translation="MRMKSMRVREELVSRFFRYAAIESQSNGRSQSLPSSPGQAALAAL
FT                   LADEMRAIGLEDVCIDAHAIVTGVKRGNRPAAPPIGFIAHLDTVDVGLSPFVRPQVLRF
FT                   EGEDLCINRQEDIWLRVAEHPEILDWLGEDIIVGDGTSVLGADNKAAIAVIMTLLGRLD
FT                   HEVGHGDVFVAFVPDEEIGMRGAKAMDVSRFPCDFAYTIDCCELGEVVLETFNAASCEI
FT                   VFTGVSAHPMSAKGMLVNPLLMAMDFISHFDRKETPECTEGRDGFYWFKDLIANDSVAS
FT                   LTALIRDFDTDGFNRRKHRIAAVAEQMRSRYPTGNVRYQITDTYRNVSTSLARDERAVA
FT                   LLFKAMEELGIGKKVIAMRGGTDGAVLSAKGIPTPNFFTGAYNFHSRYEFLPVPAFERS
FT                   LEVALKVCQLAATE"
FT   CDS_pept        663077..663646
FT                   /transl_table=11
FT                   /locus_tag="SM_b21043"
FT                   /old_locus_tag="SMb21043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21043"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49015"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VT4"
FT                   /protein_id="CAC49015.1"
FT                   /translation="MPIMFDSLPSSSGQIKAGTPRALAVTTAERASSFPDIPTITESGI
FT                   PGYEIHIPGMRSSLRPTPQPVIARLNEAPKNAMAGSSGAETHGGIQRQDRGLDARGARL
FT                   GTAFAAFWHPSIGRQPWCDFLRLGPDDRHRFRMGRIGLTTELPSQVRKANSSCSPARVL
FT                   HRPARALPWPPDPGEDGKARLSPIAN"
FT   CDS_pept        complement(663822..665732)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21044"
FT                   /old_locus_tag="SMb21044"
FT                   /product="putative ATP-dependent DNA ligase protein"
FT                   /EC_number="6.5.1.1"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21044"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49016"
FT                   /db_xref="GOA:Q92VT3"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VT3"
FT                   /protein_id="CAC49016.1"
FT                   /translation="MDLEWRAILRQRAKAPHPREGVPNGAQGRKAAVGSRWTASPVDRL
FT                   ANLGATQSAFPAFIEPCHPTLKKRPPDGADWVHEIKLDGYRAQLHINGGKITLYTRTGL
FT                   DWTTEFEAIATAAEDLAGHDVVMDGEVTVFGKTGLPDFQALRRELAKRSSPNLTFQAFD
FT                   LLHLDGYDLRRVPLIERKRVLRELIGDAAGTIAYVDYLELEEGEPVYRHACKMGLEGIV
FT                   SKRKDAPYRSGRQEIWTKTKCTKRDAFPIVAFVEKLGAQPRRIASLYLGRWEGDRLVYA
FT                   GKAQTGYTLTAAREVRERLNPLIIGKSPLSHPINKPKATWVEPQVYAEIDYGGVTDDGL
FT                   LREPVFKGLQDVSRAAGKPKPTTAPASIRVPPANILQLLPEAVVPSKEELANYWTRVAD
FT                   RALHFLGGRPLKLVRHIHGTTFYHKGPLPPIPPEVHQLRIEKREGGAGVRLWVDDLAGL
FT                   LGLVEIGAVELHPWAASVDDIEHADALIFDLDPGEGVSWAFVVETALRLREFLEAEGFK
FT                   TWPKLTGGKGVHLMSPLPAKMTHNAAHAYAKRLAQQFASTDPDRYVTSAQLSRRPGKLF
FT                   LDYLRNGRGTTAVGTYSPRARSGFPVAAPVTWRDIERGIKPDAFTIGRPPKRRAVLASA
FT                   S"
FT   CDS_pept        complement(665989..666261)
FT                   /transl_table=11
FT                   /locus_tag="SM_b22008"
FT                   /old_locus_tag="SMb22008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22008"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51287"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDC8"
FT                   /protein_id="CAQ51287.1"
FT                   /translation="MRPRHERNTTMSDPKDGKLTEQQTPSRRTTVPPEMDFEPVPLPDQ
FT                   AAEPGTKDADAPPAQSGPSKKGKRPTEGAVKNEPMHHTGAVPPKV"
FT   CDS_pept        complement(666454..666726)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21695"
FT                   /old_locus_tag="SMb21695"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21695"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49017"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VT2"
FT                   /protein_id="CAC49017.1"
FT                   /translation="MYFTVDDPDGSYATGQVIRLAAEGLYFVRFDGNEVTLPLELVSIG
FT                   EMLETTEEEYKLWRFFDTIEERDKWIEWLDAPSKPRVISLVRPTK"
FT   CDS_pept        complement(667137..667616)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21698"
FT                   /old_locus_tag="SMb21698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21698"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49018"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VT1"
FT                   /protein_id="CAC49018.1"
FT                   /translation="MLPWFSAFSAEGRAADGAMADGDGRRALGKVWRLSSNRRWNRYET
FT                   FRPARFLDRMRYCLRVDDKVEFRLADSATITGLSKQARACTKYFYLVGIFRIGHDSMKA
FT                   PFRRARSRHIAVLRMTTSGGGDGGRSRDRTASKDTLVPREPQSTMACGRTAVAGG"
FT   CDS_pept        complement(669334..669843)
FT                   /transl_table=11
FT                   /gene="exoI2"
FT                   /locus_tag="SM_b21662"
FT                   /old_locus_tag="SMb21662"
FT                   /product="putative succinoglycan biosynthesis protein"
FT                   /function="Micrococcal nuclease (thermonuclease) homologs"
FT                   /note="putative succinoglycan biosynthesis periplasmatic
FT                   protein"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21662"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49019"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VT0"
FT                   /protein_id="CAC49019.1"
FT                   /translation="MNSHRSIGVTLALLLFAHFAFAADPITGRATVIDGDTIEIRGERI
FT                   RLHGVDAPESWQKCENADGSSYQCGREAAQELDRFLAESRPVRCQFVQRDRYKRFVGVC
FT                   FRADGRDVNHWLVESGNAVDWTRYSNGVYANAQELARSHRAGIWRGNFELPCNARASRA
FT                   KREASC"
FT   CDS_pept        672636..673517
FT                   /transl_table=11
FT                   /locus_tag="SM_b21696"
FT                   /old_locus_tag="SMb21696"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21696"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49020"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VS9"
FT                   /protein_id="CAC49020.1"
FT                   /translation="MDEDPNDNAPAPRVGATTELPHDRVTVARFREAFPRARWSDRLNT
FT                   WFVPGRTAQKRISRWLAEVEAEADAFADEKGRDAFEFDPIESRYLKAVPASFEIRTPYS
FT                   RTIVNEIREIPYAYWDADRRLWTVPYRSFDELRRRWPAIEAAAQRSEPEARKARREAIR
FT                   GTEEDEALKARTRERRRKRYPVPADDRPPLTRAIGTHVGVVFFIGMDGELVDPATMSAF
FT                   YFPMNEGGEYVWASWRPGALEELVTTWPARTPPGQDELDRGWWMPTLEELRNARRDAKS
FT                   RRRARQRRDGKV"
FT   CDS_pept        673504..674031
FT                   /transl_table=11
FT                   /locus_tag="SM_b21697"
FT                   /old_locus_tag="SMb21697"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21697"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49021"
FT                   /db_xref="InterPro:IPR025568"
FT                   /db_xref="InterPro:IPR025951"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VS8"
FT                   /protein_id="CAC49021.1"
FT                   /translation="MERFNPVSAQQMTLKEFQFLSPLEPREIVGLWRGRGIPTGHPLDG
FT                   VLENLGWFGKRFNADMRADALLFWSGKRRLIALDPRIVPLRLALRFHKVGRTRIARNLF
FT                   SQFQRGLRAKGPVASLRTMPFSGVASAAMLYDDQPIVDYFRRIDQHKIMGAMTIRGDER
FT                   IYFFELKRVDEP"
FT   mobile_element  674489..675026
FT                   /mobile_element_type="insertion sequence:ISRm10-1-1 OR
FT                   SMb21709"
FT                   /note="this element seems to be partial or inactive"
FT   CDS_pept        674574..674957
FT                   /transl_table=11
FT                   /gene="TRm10-1a"
FT                   /locus_tag="SM_b21661"
FT                   /old_locus_tag="SMb21661"
FT                   /product="putative transposase of insertion sequence
FT                   ISRm10-1, orfA protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21661"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49022"
FT                   /db_xref="GOA:Q92VS7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VS7"
FT                   /protein_id="CAC49022.2"
FT                   /translation="MGQALSDDLRIRVLKASAAGMSARQAAARFGVGISTAIRWIARAK
FT                   EGELTPRPQGWRRPSAVDAHEEFVVALIEERKDVTLDEMVQRLSVERQVKISRSALGAW
FT                   LRGRGWTFKKRPHTHWSKTGRMS"
FT   CDS_pept        674930..675061
FT                   /transl_table=11
FT                   /gene="TRm10-1b-1"
FT                   /locus_tag="SM_b21711"
FT                   /old_locus_tag="SMb21711"
FT                   /product="putative transposase of insertion sequence
FT                   ISRm10-1, orfB N-terminus protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21711"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49023"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VS6"
FT                   /protein_id="CAC49023.2"
FT                   /translation="MEQDRPDVLKRRRVWFDGQLDLDPEKLIFIDESVLQRHGRSST"
FT   CDS_pept        675573..676832
FT                   /transl_table=11
FT                   /locus_tag="SM_b21045"
FT                   /old_locus_tag="SMb21045"
FT                   /product="RNA-directed DNA polymerase"
FT                   /function="deoxynucleoside triphosphate + DNA(n) =
FT                   diphosphate + DNA(n+1)"
FT                   /EC_number="2.7.7.49"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21045"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49024"
FT                   /db_xref="GOA:Q92VS5"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VS5"
FT                   /protein_id="CAC49024.1"
FT                   /translation="MTSESTTDKPFRIEKRRVYEAYKAVKANRGAAGVDGQTLEIFEKD
FT                   LAANLYKIWNRMSSGTYFPPPVRAVSIPKKAGGERVLGVPTVSDRIAQMVVKQMIEPDL
FT                   DSLFLPDSYGYRPGKSALDAVGVTRQRCWKYDWVLEFDIKGLFDNLPHDLLLKAVRKDV
FT                   KCNWALLYIERWLTAPMEKNGEVIERSRGTPQGGVVSPILANLFLHYAFDLWMTRTHPD
FT                   LPWCRYADDGLVHCQSEQQAEALKVELSSRLAACGLQMHPTKTKIVYCKDQRRREAYPN
FT                   VTFDFLGYQFRPRRVANTQRDEFFCGYTPAVSPTALKSMRATIKSLNIPRQTPGTLAEI
FT                   AKQLNPLLRGWIAYYGRYSRSALSTLADYVNQKLRAWIRRKFKRFQSHKTRASLFLRKL
FT                   ARENPGLFVHWKAFGTNTFT"
FT   mobile_element  676911..677414
FT                   /mobile_element_type="insertion sequence:ISRm10-1-2 OR
FT                   SMb21710"
FT                   /note="this element seems to be partial or inactive"
FT   CDS_pept        676928..677401
FT                   /transl_table=11
FT                   /gene="TRm10-1b-2"
FT                   /locus_tag="SM_b21046"
FT                   /old_locus_tag="SMb21046"
FT                   /product="putative transposase of insertion sequence
FT                   ISRm10-1, orfB C-terminus protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21046"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49025"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VS4"
FT                   /protein_id="CAC49025.2"
FT                   /translation="MARLRGRALRGERCRAGVPHGHWKTTTFTGALRLTGMTAPFVYDG
FT                   AMNGNVFLAYVEQVLLPTLQAGDVVVMDNLPAHKTSGVRDAIERAGAKLMFLPPYSPDF
FT                   NPIENAFSKLKAMLRGRAERKIDALWDAVGALIPRFTPDECANYFRAAGYDPD"
FT   CDS_pept        complement(677565..677840)
FT                   /transl_table=11
FT                   /locus_tag="SM_b22009"
FT                   /old_locus_tag="SMb22009"
FT                   /product="Acyl carrier protein (ACP)."
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22009"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51288"
FT                   /db_xref="GOA:B2FDC9"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDC9"
FT                   /protein_id="CAQ51288.1"
FT                   /translation="MCSRSKGHRMENSKAATRVRAIIIEQLGVDPARATDDASIVDDLG
FT                   ADSLEVAQIVMMIEDEFNIEISDESADAVVTVGDAIYVVVASKTKS"
FT   CDS_pept        679090..679800
FT                   /transl_table=11
FT                   /locus_tag="SM_b22010"
FT                   /old_locus_tag="SMb22010"
FT                   /product="Putative two component transcriptional
FT                   regulator,LuxR family"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /note="High confidence in function and specificity"
FT                   /note="Contains 1 HTH luxR-type DNA-binding
FT                   domain.,Contains 1 response regulatory domain."
FT                   /db_xref="EnsemblGenomes-Gn:SM_b22010"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ51289"
FT                   /db_xref="GOA:B2FDD0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2FDD0"
FT                   /protein_id="CAQ51289.1"
FT                   /translation="MSRQWQTKGKSSHVENVDKRCLLILDGRALGRECLARTLINHGLA
FT                   MDVAAYGSIDDWRQMKGNCPPVAAVLLNIGARQDGEIATDIPRLASLFRPAPVVVLSDS
FT                   DDIAQILRVLESGAQGYIPTSVGVDVCIEAIGLAIAGGVFVPASSVLAARYLIATEKRE
FT                   LSPLAGMFTVRQAEVVEALRKGKANKIIAYELKLRESTVKVHIRQIMKKLKATNRTEVA
FT                   CKLNSLFSGDTFTS"
FT   CDS_pept        complement(679969..680235)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21047"
FT                   /old_locus_tag="SMb21047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21047"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49026"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VS3"
FT                   /protein_id="CAC49026.1"
FT                   /translation="MAQRPVRIELHLRFHSVLKMPDTSTPSNQWIRVSRLSLGRDVVTG
FT                   TGEQLLDSLTAWPKMGGLVSRDEGGRSGDWPLLGIKIVAFRYL"
FT   CDS_pept        complement(680362..681807)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21048"
FT                   /old_locus_tag="SMb21048"
FT                   /product="hypothetical membrane protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21048"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49027"
FT                   /db_xref="GOA:Q92VS2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VS2"
FT                   /protein_id="CAC49027.1"
FT                   /translation="MQISFVGLLICAGILVIGYYCRAPLIIGLIVSLAFGATAVMTLSA
FT                   IGGSSPLIYTFFAALLITAVVSRRRMWRDLGHVFGKIRPVWVLTGLMLYAMVGAWLFPR
FT                   FFAGQTSVFVQAAMRRGVIEAPLAPVSGNITQTGYFVLGGLTAIALCVLLLHENRLESI
FT                   RRGFLLWCSVHVVFGLLDLLGKVAGAGDILSPIRTASYAMLTEVIENGFWRITGAASEA
FT                   SSFGGGSLVCLSFCYVYWRKTKSRVAQALAFLLLVLLLLSTSSVAYVGLAVLSIPVALS
FT                   ISWSFLSGRMDKDEILIIALLALAAVTVLAIVQYDEEFFAPFVHLIDSMVLNKASSASG
FT                   QERAYWNIKSLQAFVETGGLGVGLGSSRASSWPIAVASQLGLVGGVMMVTLLLVILRGM
FT                   GSLKGHIDPETNAVVSSVQACALGSVAAGSLGAGSADPGMIFFIALAVISTSRVNARKS
FT                   RDATIRTIQLGQPEPLAYRPATH"
FT   CDS_pept        complement(681853..682011)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21049"
FT                   /old_locus_tag="SMb21049"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21049"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49028"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VS1"
FT                   /protein_id="CAC49028.1"
FT                   /translation="MAFGGGLVVGRPRRPKATCDDKPYQIIAGPYSVWRPCIPRNNCQG
FT                   LHEASCA"
FT   CDS_pept        682224..683777
FT                   /transl_table=11
FT                   /gene="wzx1"
FT                   /locus_tag="SM_b21050"
FT                   /old_locus_tag="SMb21050"
FT                   /product="putative succinoglycan biosynthesis transport
FT                   protein"
FT                   /function="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21050"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49029"
FT                   /db_xref="GOA:Q92VS0"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VS0"
FT                   /protein_id="CAC49029.1"
FT                   /translation="MHVPNRIGQIAHAVGDDPRPCNLTLRDPDSRDRGSEMTSLGKKVV
FT                   SSAAWAAVETWGRQVAMFAVFVILARHLGPEEFGLATLAMIAPTILATVVTRGIPDALV
FT                   QRAEIEPIHLDSAFWLLVATGATLSALIWAFAGVVAEAFGEPLLEDLVRWTGIIVVVQS
FT                   LAAVPTAVLKRELNFRLFTLRTLTGTMVGGTVGLTMAIAGYGMWSLVLMQVAKAIVETT
FT                   VILLGSSWRPRMAYSYARCRELFGFAGPVIVQTLWTFVNEEIPKVILGLFLGPVAVGVY
FT                   AIARRPLDLLGEFLLGPLAAITMPAVARVQREPDKIDHFFNTSVRMAAIAGFPAFVGFA
FT                   AIAPVAVPLVFGPQWASAVVAVQILMILGLQRTIDSLCAYTILALGHSKLVLKLNMTYT
FT                   LFSLVLLTAAAQISLEAVIAALVACNLLLLPVFLFYVQHTAHIDVSKPLAIFPRLAGAA
FT                   ALMFAIVSAWLLAAPDDLPQAVTVAAGIAIGAPIYIAAAVLLVRADLLKARDMLLSLRE
FT                   "
FT   CDS_pept        complement(683928..685277)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21051"
FT                   /old_locus_tag="SMb21051"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /function="UDP-glucose + 2 NAD+ + H2O = UDP-glucuronate + 2
FT                   NADH + 2 H+"
FT                   /EC_number="1.1.1.22"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21051"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49030"
FT                   /db_xref="GOA:Q92VR9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VR9"
FT                   /protein_id="CAC49030.1"
FT                   /translation="MQHMNTGPDAEKLLNRIRTRDFTIGIMGLGYVGLPLAMSSLEAGF
FT                   RVIGFDIDQSRVALLNRGESGIKHLPGPAIQQAVESKRFRATSDFSELSMPDAILIAVP
FT                   TPLTRNREPNLSFVENSARSIAERLRPGQLVVLESTTWPGTTREIVRPLLEATNLVVGK
FT                   DFFLAYSPEREDPGNEVHTTTSVPKVIGADEPSSLEVAQALYSQIIVRTVPVTSTATAE
FT                   AVKLTENIFRSVNIALVNELKVIFDRMGIDVWEVIEAAKTKPFGYMAFYPGPGLGGHCI
FT                   PIDPFYLTWKAREYEVATRFIELAGEVNTNMPHYVVDRLVEALDRRARRGLNESRILLI
FT                   GMAYKKNVGDTRESPSLRLIDLMERRGAVVDYHDPYVPEIPATREYAELAGRRSVDISA
FT                   DRLASFDAVVITTDHDAIDWKTVVEGAKLVVDTRNVCARFHVSAPNVVKA"
FT   CDS_pept        685581..686546
FT                   /transl_table=11
FT                   /locus_tag="SM_b21052"
FT                   /old_locus_tag="SMb21052"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /function="dTDP-glucose = dTDP-4-dehydro-6-deoxy-D-glucose
FT                   + H2O"
FT                   /EC_number="4.2.1.46"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21052"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49031"
FT                   /db_xref="GOA:Q92VR8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VR8"
FT                   /protein_id="CAC49031.1"
FT                   /translation="MMAQSILITGGAGNIGSALTRALVKLPQTQVVVADNLSTGSRDKV
FT                   QIDAGNLTVIRSDANDFDDISSLFYRFHFTHVFHFAAVVGVQRTLANPLLVLRDIAGIE
FT                   NVLRLCKNTGAERVYFASSSEVYGEPFEIPQNENTTPLNSRLPYAVVKNLGEVYLRTYE
FT                   REFGLPFTIFRFFNTYGPRQSEDFVLPRFLRAALLGVPLTIYGDGSQTRTFCYVDDTVD
FT                   TCIAVHRTRSHENDVINVGSDLEVSIRQLAEIVIGVLGSSSKLEFLPPLTEGDMTRRCP
FT                   DTSKMKALLNRPLVPLEEGIRRLAEHLSKSQSSHELRKVA"
FT   CDS_pept        686566..687816
FT                   /transl_table=11
FT                   /locus_tag="SM_b21053"
FT                   /old_locus_tag="SMb21053"
FT                   /product="putative membrane-anchored glycosyltransferase
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21053"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49032"
FT                   /db_xref="GOA:Q92VR7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VR7"
FT                   /protein_id="CAC49032.1"
FT                   /translation="MKLVYVGQPYDRLFPPVQNSIGLIVYNTALHLSNSLHITVYGRHY
FT                   RDDRVPADLPFALRRAPVRRDRLLQKVIREFPRPARWTQLDRKADDHSQYRNEIRRYLA
FT                   LDRPDVVHLMNYWKWSRALKPPGSSHRLVLEMQCEWLSQRDRDQVASQLEVVDAVVAVS
FT                   DHIAETFRSAFPDYPGAVASVGNGVDVFHFRPSEAGASGDARTGRVILFVGRISPEKGL
FT                   HTLVEAFSEVALRFPDVELRIAGPYSPLPVDFLTSLSSDPRVLDLKRFYDQWNRCRYQQ
FT                   HLDELMDRHRLRHRIRFLGNVSHKELVAAYHDADIVVNPSLSESFGISVVEGMACGIPV
FT                   VGTRVGGMCESILDGHTGMLVEADAPGELSQALITVLDDPARARGMGTEGRERAVALYS
FT                   WEARAERLRSVYERVSR"
FT   CDS_pept        complement(687905..688522)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21054"
FT                   /old_locus_tag="SMb21054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21054"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49033"
FT                   /db_xref="GOA:Q92VR6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VR6"
FT                   /protein_id="CAC49033.1"
FT                   /translation="MYRQARNAVRDVLRTRAPYLVRYISTFHLTDDRRLLETVILPYLR
FT                   DDPAVKRVLFVGCEWYTKPCESKFRGKEYWTIDIDPNKRRFGARRHMVDALRNLERHRP
FT                   ADYFDVVICNGVFMKTAIETRDDAEASFRACWRCLRPGGWFVLGWNDIDELRPYPPSES
FT                   PTLAAFTRTSFPPLGVSEHRTDTSYGHTYTFFRKPEAIQEGL"
FT   CDS_pept        complement(688755..689339)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21055"
FT                   /old_locus_tag="SMb21055"
FT                   /product="putative protein, slightly similar to
FT                   metyltransfrases"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21055"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49034"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VR5"
FT                   /protein_id="CAC49034.1"
FT                   /translation="MICRRTENGPMRLVSRLLDAFSERRVVATGEAAGLTLVSRDADPE
FT                   FGRGTYERPIQQAIASNLAPGDAFFDIGANIGFFSIIAARRVGTEGQVYAFEPVPRNAA
FT                   AIRRTAQLNGFHAIRVFPEAVGATIGRAELLLARHIGGAALASAEAPPDMNGYLEVDVT
FT                   TLDDAIARHACGPRRWSRSTSKVPRSKSFVA"
FT   CDS_pept        complement(689474..691801)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21056"
FT                   /old_locus_tag="SMb21056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21056"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49035"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VR4"
FT                   /protein_id="CAC49035.1"
FT                   /translation="MKCSRATGSIFSDLPRAVFILAVSIATTNCDVSHGNENPEGIALN
FT                   GLTFERKEIADHSGDVKLAGDVDGDGQLDFVLGGLPEDPLSWWHGPDLRKTTIATPRTE
FT                   FTTDGVLADVDSDGDLDIVTADGSDGVNVIWFENPRPNGDPADGQKWKRHELGAAGGWG
FT                   KDIKAADFDGDGRLDIVVRAPGEVMIFFQNEPIAWVGVAFPSFNLGEEGMAIGDIDSDG
FT                   NTDLVLCGVWAHNPGGAAARDAPRWQSHPVGPFNPAFKALVIDIDQDGRVDILSSSSEH
FT                   TADVAWFRAENGPSGRWARHVIQPAVAGAHTLQAADMDRDGDIDVVVGQMHQTEERALA
FT                   VHYNRDGRGTRWTRQIIDDTGLHNGVVADLDSDDDFDIYGANWAGHPPLRVWINRLNPP
FT                   APIHRLDRWVYHRITNAHVRSFGLAFADMDGDGRTDIVSGPFWYRQPPLPWQKGWEQIR
FT                   LGEGLDAVQALDLDGDGRAEATAQRNRGKTLQFHWLKIVDAAAHKFEEHVIGEVAAATH
FT                   DLGSQGHVFAQIVEGGLPELAVSSGGGVFYFTIPDDPTAPWPRTRICAEASDEGIAFTD
FT                   LDGDGLIDLVASTGEAKEVAWWRNPGDGSKDWQRRDIGKVPEMVYPDRVAAADLDGDGY
FT                   PDIVVTEENGAADGARASWWRGPATGSFNWERHEITSRGSINSLSVADMDGDGRLDLVM
FT                   AEHRGALRMSVWRNVGGGNFIEQLIGEGFESHLGARAVDLDGDGDLDIVSIGWDAPGAI
FT                   HAWRNDAVEQMPSAPEAGQLRR"
FT   CDS_pept        complement(691767..692645)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21057"
FT                   /old_locus_tag="SMb21057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21057"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49036"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VR3"
FT                   /protein_id="CAC49036.1"
FT                   /translation="MHVQCRANNTGERMMDTHTWDVRQALCRILDSRMRRRFKPFDVAD
FT                   WSASSVIFAPHPDDETLGCGGVSAKKLASGVEVRFVFVTDGAASHRRLISPEELRSRRE
FT                   SEALEAVHRLGASSESVTFLRFPDAEASHHIHAITKAIVPLLERWRPQSVFVTHAKDPP
FT                   SDHIAVNAAVRAALRWHGRPLTVFEYPVWYWYHWPWVRPAGDLPGMWRTTLRQTVKTVA
FT                   GLRALSALNTLVPIGEFLDVKRHALAAHVSQTQRPEDKDDWQTLSDLSSGEFVARLLAD
FT                   HEVFTRYRVNF"
FT   CDS_pept        692698..692919
FT                   /transl_table=11
FT                   /locus_tag="SM_b21058"
FT                   /old_locus_tag="SMb21058"
FT                   /product="putative glucose-1-phosphate
FT                   cytidyltransferase,probably incomplete due to sequencing
FT                   artefact or chromosomal point mutation protein"
FT                   /EC_number="2.7.7.33"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21058"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49037"
FT                   /protein_id="CAC49037.1"
FT                   /translation="MKVGILAGGFGTRLAEETEVRPKPMVEIGGMPILWHIMMHYSHFG
FT                   HREFAIALGYKGEYIKRWFSDYIALNGT"
FT   CDS_pept        692943..693467
FT                   /transl_table=11
FT                   /locus_tag="SM_b21059"
FT                   /old_locus_tag="SMb21059"
FT                   /product="putative glucose-1-phosphate
FT                   cytidyltransferase,probably incomplete due to sequencing
FT                   artefact or chromosomal point mutation, preceded by ORF
FT                   #125 protein"
FT                   /EC_number="2.7.7.33"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21059"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49038"
FT                   /protein_id="CAC49038.1"
FT                   /translation="MRRHTNAAPDWSVDLVETGLKTLTGGRIKRLIDWMNNGTFMLTWG
FT                   DGVSNIDLDELVAFHRSHGKLATMTAVRPPARYGHIQFDGNRVVEFTEKPQASEGWING
FT                   AFFVLEPGVRDYIGGDEDMFEHAPMQRLASDGQLMAYRHETFWQCMDTLREKHILQTLW
FT                   DSGNAPWKTWE"
FT   CDS_pept        693472..694521
FT                   /transl_table=11
FT                   /locus_tag="SM_b21060"
FT                   /old_locus_tag="SMb21060"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /function="UDP-glucose = UDP-galactose"
FT                   /EC_number="5.1.3.2"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21060"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49039"
FT                   /db_xref="GOA:Q92VR0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VR0"
FT                   /protein_id="CAC49039.1"
FT                   /translation="MKVLVTGHRGYIGAVLTPMLHQRDHDVTGLDSDIFRSCTFEGTLD
FT                   DTPTMEEDVRDIVIDDLAGFDAVIHLAGLSNDPLGDYRPNLTQQINCEASVTLARLAKR
FT                   AGVPRFLFASSCSNYGAAGSGFLTESAAFNPVTPYGISKVEVEHAVAPMADECFSPTFL
FT                   RASTAYGLSPRIRFDLVLNNLTAWAFTTGQIYLKSDGSPWRPIVHVEDIARAYIAALEA
FT                   DRELVHNQAFNVGLTTENYQVREIADIVQAIVPNSRIEFAADAGPDTRCYRVDCNYIGR
FT                   RLHAFKPQWTARRGVEQLYEAFCSVGLSLEDFEGERFKRIAHVKKLIRNGELDEDLRRV
FT                   SVPTMALAV"
FT   CDS_pept        694544..695791
FT                   /transl_table=11
FT                   /locus_tag="SM_b21061"
FT                   /old_locus_tag="SMb21061"
FT                   /product="putative NDP-hexose 3-C-methyltransferase
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21061"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49040"
FT                   /db_xref="GOA:Q92VQ9"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VQ9"
FT                   /protein_id="CAC49040.1"
FT                   /translation="MLHETLNSVTEHACRSCGGTRLETFLDLGATPLVDRLLVDGDIDK
FT                   PELIFPLRVAFCRDCSLAQITETVSPNILFADDYPYYSSFSPALLEHSRENALSLIACR
FT                   NLGPESLVIELASNDGYLLKNYVEAGVKVLGIDPADGPAAAAERIGVQTRCTFFTRDLA
FT                   ETLRAEGAVADVIHANNVLAHVADTNGFVAGIARLLKEDGVAVIEVPYVVPLIEHCEFD
FT                   TIYHEHLCYFSVTALDRLFRRHGLYLNEIKPLSIHGGSLRLYVELRQRVGAAVKKRLAQ
FT                   ETALGIDTIDYFRNFSAKVDVLKRELLALLHRLKSEGSSIAAYGAAAKGATLINTIGIG
FT                   RDLIDFVVDRNVHKQGKYMPGQRLPIRSTEALVQAQPDYVLLLAWNFADEILAQQADYH
FT                   TRGGKFIIPVPVPRIL"
FT   CDS_pept        695813..697012
FT                   /transl_table=11
FT                   /locus_tag="SM_b21062"
FT                   /old_locus_tag="SMb21062"
FT                   /product="putative sugar nucleotide processing
FT                   enzyme,similar to NDP-hexose methyltransferase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21062"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49041"
FT                   /db_xref="GOA:Q92VQ8"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VQ8"
FT                   /protein_id="CAC49041.1"
FT                   /translation="MRCAQAVEIETIASDLRSECPVCCGRELLPSVTFEAIPVLCNALH
FT                   SSAASARTAETGRFCGAFCRRCTHFFNAAFEEQRIGYTQSYENSLHFSPRFVAFVEALA
FT                   GRLSNSYALAGKTVIDVGCGKGDFLKRLCALSGATGIGFDKSFEEDRGALVPQVRFVRD
FT                   WFDDRYADLRPDLVSCRHVIEHIADPIAFLRALRAHPGIGPETIFYFEVPNALYTLREL
FT                   GIWDLIYEHVSYFTAHSLRIAVEAAGFDVLSAGSSFGDQYLFIEARAGRVHPLAEAAES
FT                   EECALLVRKFEGLHRDKVTHWQNFLSKHNLERVVVWGAGSKGVTFVNAVPLAAGIGALV
FT                   DVNTYKQGRFAPGTGTPVLSPESLRGCLVEAIIIVNPIYRHEIARIANAIGLAPEIVVA
FT                   "
FT   CDS_pept        697071..698642
FT                   /transl_table=11
FT                   /locus_tag="SM_b21063"
FT                   /old_locus_tag="SMb21063"
FT                   /product="hypothetical nucleotide-binding protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21063"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49042"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VQ7"
FT                   /protein_id="CAC49042.1"
FT                   /translation="MTVSVAIDVGPRDDSGGLLVADAFSDDRAAGTVIGTHTTNGVIRG
FT                   GCDSERQIAIDHGTLRFQPLVKPGWARQGIAYGPFRRASGLVMAVSVTNGHNTSQGTTI
FT                   GEHILRRIHRWALGANADPWPNRLVSWACGPRKKGTFRRFLWWARSTRTTYKLPDFNEN
FT                   LALGWFTSDAPRDPLSDGCGFIVHAAKGENGELWTRVGTRCLSAFRGLKNLQIYYFVAL
FT                   RERGAIYYAAAMEGAHGLAAFPMMRPIAIDPFNDDETLYAGVHQCVLGQIGFRVDTRIH
FT                   GIRVHKVPDLTSRFGTAHVGDPMTRDAVASDIAGRSGSWRVLRGNVDRTDTGAVGGDGV
FT                   ALATSDPGVPSGLIHAIAATGDTPGACGLAWRVRDGDNFWLFKVSGEGSALIRVEQGAE
FT                   VILVSDARRSLAPDTLHSLQILDGYGQIGCYLDGDRLFGIDDQPLEEATATGIWFDGAG
FT                   GVEMRDFETHPREVPIPPFVLFEAPWLRLGHHAEIVDDFAGPFGDLAGRAPRIGGGTWG
FT                   KTSVSA"
FT   CDS_pept        698639..699172
FT                   /transl_table=11
FT                   /locus_tag="SM_b21064"
FT                   /old_locus_tag="SMb21064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21064"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49043"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VQ6"
FT                   /protein_id="CAC49043.1"
FT                   /translation="MIDVTGNGAARVRGTVEKPHPNRTLYTLPWDQVGFADLEVTITPP
FT                   GDERGQAHCCRTGLVFWQDRDNYLTFTVYLDDDYHGSSIALFTKRHGFEELYDAVWTML
FT                   WTKIDWGKPFRLRIPFDGERFVVFVDDEPVMQRALTDLYPDDPPLRILRVGLAVNWEWG
FT                   NDTGSSLQSFIARR"
FT   CDS_pept        complement(699188..700165)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21065"
FT                   /old_locus_tag="SMb21065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21065"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VQ5"
FT                   /protein_id="CAC49044.1"
FT                   /translation="MNKPHLTFQPMEITRPASPRESTARQRRKNLVIVRAGRNSLHAGW
FT                   TAGTGEAEFDLLVAAYEELTSGASDQWSVLLPGRKIAGYNELFQRYPELLDRYEYIALI
FT                   DDDIKATKQDINRLFQIGAAYCLDLFQPALSWDSHFSYAATLAIHKFRLRFTNTVEMMC
FT                   PVFRAKYLRVALPLFSLGYETGIDLVWTRLNDDPWFRYAIVDEVVVTHTRVIGTTMKQQ
FT                   GFAPNESYDRQVESVLKRFAAEFRGFVTYAGIDKHDRLISSRYLIGLHSLATWTAWRRT
FT                   PVPLTYFVRLVTDYTRHCFVRPTNLHRIPIAENAPRSSAIRTDC"
FT   CDS_pept        complement(700162..701115)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21066"
FT                   /old_locus_tag="SMb21066"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21066"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49045"
FT                   /db_xref="GOA:Q92VQ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VQ4"
FT                   /protein_id="CAC49045.1"
FT                   /translation="MSVRVSLGLPVYNGENFIAEAIQSLLDQDFEDFELIITDNASTDR
FT                   TAEICQSFAERDARICYFRNTRNLGAGGNFNRAFNLSCGTYFKWCAHDDLISANFLTDT
FT                   VNALDEDADAVIAYPTLLGIDRYGAMTAYQERDLPNMRNLPPGSRFRILIAAHGCDAAM
FT                   FGLWRRSSLVQTCLHEPYYGSDCALLAEMALLGKFVRVPSAILYSRDHPTRSVNLHSSE
FT                   RLLWHNQDASGSNPFELSSRLRHLVVIAYRHRRQAPVHHSLCHLALWMLDPPLIGRLVL
FT                   EGVGAFSPRLRAKLRAIGLRALTSIQGSSNQPSRRI"
FT   CDS_pept        complement(701131..702336)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21067"
FT                   /old_locus_tag="SMb21067"
FT                   /product="putative NDP-hexose methyltransferase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21067"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49046"
FT                   /db_xref="GOA:Q92VQ3"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VQ3"
FT                   /protein_id="CAC49046.1"
FT                   /translation="MRPPRVAAPGGCPCCASTGTRPIYRVSSIPVHSCILLGSAEEARA
FT                   FPVRDLELAYCQGCGFIFNRIFDESVMGYSTNFEESQHFSDTFGTFAKKLAGEIVEVCA
FT                   VAGKLVLEIGCGKGEFLRELCAVGGATGLGIDPGYRADKGRGGDGDRRLNFIVDHFGPK
FT                   YEHLSADVVLCRHTLEHIAPVREFLRSIRRLAGKRNDSWIVFETPDAKRVLKEAAFWDI
FT                   YYEHCSYFSPGAHARVFRQEGFDVTDLELVYGGQYIVQYARPAEGRIRPTLPLEDDLGE
FT                   LERLVETFSNRVSSFQEQWHERVTAAHASGRRIVLWGGGSKAVSFLTTLGLGEEVDAAV
FT                   DVNPYKQGKYTPGTGHPVVSPQALLQQPPDLVIVMNAIYGNEVTQALNSLGLKPEIVAV
FT                   GK"
FT   CDS_pept        complement(702645..703658)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21068"
FT                   /old_locus_tag="SMb21068"
FT                   /product="putative lipopolysaccharide
FT                   1,3-galactosyltransferase"
FT                   /function="Lipopolysaccharide biosynthesis
FT                   proteins,LPS:glycosyltransferases"
FT                   /EC_number="2.4.1.44"
FT                   /note="Conserved hypothetical protein"
FT                   /note="putative lipopolysaccharide
FT                   1,3-galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21068"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49047"
FT                   /db_xref="GOA:Q92VQ2"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VQ2"
FT                   /protein_id="CAC49047.1"
FT                   /translation="MDKGAVFPSNWQSSSGSAAIVLVTDQNYALPTFSAALSADQHTKG
FT                   ADTAIRMFVVGAEDTWARQFDEAVAGTKIKVIAARLPQLAELSPYHRDHYLPPIALARF
FT                   WIDSLLDAGVDRFLYIDGDTMVDGELDSLLASTPPAEGLMAAPDFLNIFMDEVSRGKKR
FT                   DLAHLEGIGCRPETYFNSGVIYASREAWNDIVPVAMKFMVEHPEHCPASDQSALNHAAR
FT                   GRVTMLSLRYNYQSEHMMVLDPRRRGIGPAIWHFTGGPKPWNTPGWPWDESFNRYYCAA
FT                   EMRLHGSTIVTPVPPEAQTRAGIAHRRRSRSRMTWVYPWRKITRRRKILHLLADDR"
FT   CDS_pept        703975..705393
FT                   /transl_table=11
FT                   /locus_tag="SM_b21069"
FT                   /old_locus_tag="SMb21069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21069"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49048"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024655"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VQ1"
FT                   /protein_id="CAC49048.2"
FT                   /translation="MFTRLAIGTLCLLTTAASGFADILWGVNGHPITAYPGIGIEQQLN
FT                   YLEDLGMKSYRVNISDAVRVRDLAALVKEGKARGIEILPVITPGNIDLDKDSVGKLYEK
FT                   AHRLAVTLGSQFKADIRVWELGNEMENYAIIKACEKRDDGSQYPCEWGPAGGVGPLDYY
FT                   GPRWAKVSAVLRGLSDGMTAVDPQIRKAVGTAGWGHVGAFERMKQDGIDWDISVWHMYG
FT                   EDPEWAFKELARYGHPIWVTEFNNPLGSQRSDEQQADGLRQAMMRLRELHLKYSVEAAH
FT                   VYELLDETYWAPNFEAYMGLVKLIETSDGGWATGEPKSAYAAAREVILGKRPVVRPKRD
FT                   CEISEVRASEPLSVRQGRFAYCLVLGHRKDAGAIARWAEALENGQTNVTEMMLTLMQSD
FT                   EFNRRYATFGLTDRPFISFLYLLLMDRSADPHGLDSYAGHLSGGTMTRENVALGMMLSS
FT                   EFQRKYAAHLGAGQ"
FT   CDS_pept        705774..707672
FT                   /transl_table=11
FT                   /gene="exoP2"
FT                   /locus_tag="SM_b21070"
FT                   /old_locus_tag="SMb21070"
FT                   /product="putative tyrosine-protein kinase"
FT                   /function="Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis"
FT                   /EC_number="2.7.10.1"
FT                   /note="putative MPA1 family auxiliary surface saccharide
FT                   export protein"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21070"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49049"
FT                   /db_xref="GOA:Q92VQ0"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VQ0"
FT                   /protein_id="CAC49049.1"
FT                   /translation="MLERQWSAAAGQQNLYGPGGDSEFIGFADITSFVRQRIFLIMAFP
FT                   LLGLLGAGFSLATTDSIFTARTQILIEPKIPELLQRQSGEINLSLDTSQVETQLAVLRS
FT                   EKIALMVIEELDLVDNPRFKSVSSPSMVERVGRIKEMAADMLALDGDPQHQAMPKPASP
FT                   IADRSETKAVIAQLSEFERRRIVVETFRESLGVQRVGVSYAIDITFQSHDPALAAKVAN
FT                   ATAAAFVREQLETRAAAAREGVAWLEKRIEEVRTQMNLATQVTQEFRAKHDYSVGRQLG
FT                   ATIVDGEVVASGQGEGVTRNGPTLEELEVTADTYRKMYESLLAAFTSSVNQQPYLIADA
FT                   RVITPATRPLAASHPRKKLVLALGGLSGLMAGFGLAFARHTLDRTIRTSRQVRDELGFD
FT                   CVGELPPVGFLRGFGQLDDVLRRPESLFSRNLRHTKGAISLADVAHPLRCIGVTSATPD
FT                   DGKSTVASNLAALYAVSGMRTLVIDADGFHSTLTKRLPHSQAPAGENRDGAEIEGQITS
FT                   VPGLQFDLLPSPASDTLRLITPKNLEALLVNELDSYEIIIVDLPPFTSGVHGLVAASVL
FT                   DGVLIVAEWGKTPLDLVGELSRILRITKTAVIGVVMTKVRSLSTRQYRKRATQTGH"
FT   CDS_pept        708086..708736
FT                   /transl_table=11
FT                   /locus_tag="SM_b21071"
FT                   /old_locus_tag="SMb21071"
FT                   /product="putative undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /function="Sugar transferases involved in
FT                   lipopolysaccharide synthesis"
FT                   /EC_number="2.7.8.6"
FT                   /note="Undecaprenyl-phosphate galactose phosphotransferase
FT                   (Galactosyl-P-P-undecaprenol synthetase),, putative rfbP
FT                   gene,"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21071"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49050"
FT                   /db_xref="GOA:Q92VP9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VP9"
FT                   /protein_id="CAC49050.1"
FT                   /translation="MAIARPHGPDLQPLGGRPKRGLDLAVASTALVLALPLMAVVALLI
FT                   KVITGGPVLFVHRRIGFNGTPFDCYKFRTMAENADQVLEEYLACNPRAAEEWRETQKLK
FT                   NDPRTTLLGQMLRMSSLDELPQLINIIRGEMSCVGPRPIVAGEMSRYGAVAYEYLKTRP
FT                   GLTGLWQISGRNDIDYASRVALDAQYVRNWSIWTDLIILAKTAYAVMRFDEAS"
FT   CDS_pept        complement(708781..709035)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21072"
FT                   /old_locus_tag="SMb21072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21072"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49051"
FT                   /db_xref="GOA:Q92VP8"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VP8"
FT                   /protein_id="CAC49051.1"
FT                   /translation="MAWSFLAVGAAGVLIGVRLRVPALIVASFITIMVSVTAMQCLGFS
FT                   DQRTFLTTLYLVLTLQATYLIGVLFATLLHRSPFDRHWR"
FT   CDS_pept        complement(709463..710830)
FT                   /transl_table=11
FT                   /gene="exoF2"
FT                   /locus_tag="SM_b21073"
FT                   /old_locus_tag="SMb21073"
FT                   /product="putative OMA family outer membrane saccharide
FT                   export protein, similar to ExoF"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21073"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49052"
FT                   /db_xref="GOA:Q92VP7"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VP7"
FT                   /protein_id="CAC49052.1"
FT                   /translation="MPAGVLSKRIRRCIGLFALSAALSVFAVCGPIAAIANDEYLLGPQ
FT                   DKVRVKIYEWRASRDVIFEWKALNDTFTVSAGGTLSLPFVGAIPAAGLTPNSLAYAIGD
FT                   NLKRNMGLGRRPDAAVEVIQYRPFYIVGHVMQPGEFPYRPELTVLQALSIAGGLRTREE
FT                   SIARFEREMIQGRGDVSLLGLENINLLARKARLEAELKHANKIEFPGSLISRQDDRAVT
FT                   LLMEQERSIFQARREGLETQIRALENLRAFLEKELISLDKQLVFHDRQIALIQKELGDV
FT                   SSLVSKGLAAAPREMSLERALAQYQSERLAGETSLLRTRQEISKTEISILELRNRYVNE
FT                   VTATLRLTQAELDALGRKAETAIELLHESEISAPRLLARQARAAKAEPIYTIVRTTNGH
FT                   SEELRAGESNVVKPGDTLKVEIPMPVLEDFEATDPGPPGTTALSIAPTTSRVPNVR"
FT   CDS_pept        complement(710902..711801)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21074"
FT                   /old_locus_tag="SMb21074"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21074"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49053"
FT                   /db_xref="GOA:Q92VP6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VP6"
FT                   /protein_id="CAC49053.1"
FT                   /translation="MPDSELLMKLAVIIATFGRKEQLAQLLVHLERQERLPDEVVVSAP
FT                   DETHVPVYEPRVFPISIVLGRRGLCAQRNRALEQVLERFDVITFFDDDFIPKDDYLRLV
FT                   ELAFQEHEDWAVVMGHVVKDGARTAGLSWAEGLQVLAAEPSKMPVKPKIVDHVGAYGCN
FT                   MSIRMKFVGELRFDERLVLYGWQEDIDFTSQLRRFGRVIGLNTLRGVHLGLKIGRVSGE
FT                   RFGYSQIINPTYLMRKGTVPASFALPLIGRNIAANLVRSLWPEPYVDRRGRLRGNLIAL
FT                   AHLLKGRIEPEYIQKIAA"
FT   CDS_pept        712082..713314
FT                   /transl_table=11
FT                   /locus_tag="SM_b21075"
FT                   /old_locus_tag="SMb21075"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21075"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49054"
FT                   /db_xref="GOA:Q92VP5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VP5"
FT                   /protein_id="CAC49054.1"
FT                   /translation="MHYMRRDELATITRLRPHRRTSGQTPPALADRSARLAIVHDWCPN
FT                   FRGGERVLARICKLFPNAEVFTLFDFLPKDIKEQYFHDVAFHSSVANRLPLVQKYYRSL
FT                   FFLCPFLIEQFDVTGYDAVISSSAAFARGVLTRPDQPHLCYVHSPIRYAWDEQFSYLAQ
FT                   GRLGFGPKGLLFRYMLHNLRTWDTRTAHGPDLMLANSSYVRSRIQRIYGREAEVVFPPV
FT                   ALDELEFIACKDDYYVTASFLAPYKRTDLVIRAFNEMPSRRLVVVGEGQQSQSLRGMAS
FT                   SNVSFTGYLPRQEYVRTVARAQAMVFAGCEDFGIALAEAQACGTPLIVFGRGGARDIVQ
FT                   PFGEAEHPTGILFGIQSVESLKEAIHIFEQNQPAIKSQACRSNADRFSEGRFDLAILKA
FT                   LAVAQAAHFRR"
FT   CDS_pept        complement(713304..714437)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21076"
FT                   /old_locus_tag="SMb21076"
FT                   /product="putative glycosyltransferase"
FT                   /function="Glycosyltransferase"
FT                   /EC_number="2.4.1.21"
FT                   /note="putative mannosyl transferase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21076"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49055"
FT                   /db_xref="GOA:Q92VP4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VP4"
FT                   /protein_id="CAC49055.1"
FT                   /translation="MERSWTINGRFLAQPLTGVQRYAFEIVRALDELIVNQPLLASRLK
FT                   IELLVPRDAKVPSLRAISTRAIAIAPMHGHLWEQAALAAHVRGGLLSFCNTGPLSVRKQ
FT                   ILCIHDVNTRTYPQSYSLPFRLLYRTLLPALGRRVAAVATVSRYSAGELVRHRICGPDK
FT                   ITVIPNGHEHAASWKPRHSQRTRAVAGRDTIVVIGSAIAHKNTGLIIGMAERLAAVGLR
FT                   IAVVGMSDARVYRTSGRKESASNVTWLGRLSDEELAALLQDCLCLAFPSFIEGFGLPPL
FT                   EAMAIGCPIVVSNRASLPEICGEAALYASPNDAEAWFDRFMRVRNMPDVRDEMIGIGRM
FT                   QASNFQWKASASRYLDIMAVLDGMSKPSGGPVAVSIA"
FT   CDS_pept        complement(714587..714877)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21077"
FT                   /old_locus_tag="SMb21077"
FT                   /product="putative protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21077"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49056"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VP3"
FT                   /protein_id="CAC49056.1"
FT                   /translation="MLATPPRTTLAEHAMKHPMTIWAPVVQLPVGRSGPFIVHLEALCR
FT                   RLVSFRKYLHMRAFETNPLEVKVAYPMAIILRPSPGLTPMSKSAIQKVVTW"
FT   CDS_pept        714876..716084
FT                   /transl_table=11
FT                   /locus_tag="SM_b21078"
FT                   /old_locus_tag="SMb21078"
FT                   /product="putative glycosyl transferase"
FT                   /function="Glycosyltransferase"
FT                   /EC_number="2.4.1.21"
FT                   /note="putative mannosyl transferase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21078"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49057"
FT                   /db_xref="GOA:Q92VP2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VP2"
FT                   /protein_id="CAC49057.1"
FT                   /translation="MTDVGGARPVDQQSTRAKSALRHGCDVGGPALAAPIPNWRHDWTI
FT                   NGDFLGLRPTGVARYAREVTLALDALMTERHPMTRGLQFSIVAPCEPPGDLPLKSIPVR
FT                   VVPEYSRPRLPQFWVQAQLPFYVRGGLLSFCNLAPVAIRRQIVCIHDLHTRLMPQSYGR
FT                   GFRLAHRLILPALGRRASAITTVSNFSRDHIAGFGVAPFEKVTVTYNGSDHVARWDAAL
FT                   SSIDLGQRPFVFCLGQSQKYKNVELLLKLAPALDRLGLDLCMAGDVDAALLKRLVPQQP
FT                   SNLRLLGRISDDDLAKALSHALCFLFPSRIEGFGLPAVEAMALGCPLVASTAPCLPEVC
FT                   GDAALYAGPADAGSWISAVRRLCNEDSLRRHLAEKGRERAATFSWRRIAEAYLLLIADI
FT                   DLC"
FT   CDS_pept        716513..717244
FT                   /transl_table=11
FT                   /locus_tag="SM_b21079"
FT                   /old_locus_tag="SMb21079"
FT                   /product="putative cAMP binding protein"
FT                   /function="cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /note="cAMP-binding protein, catabolite gene activator and
FT                   regulatory subunit of cAMP-dependent protein kinases"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21079"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49058"
FT                   /db_xref="GOA:Q92VP1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VP1"
FT                   /protein_id="CAC49058.1"
FT                   /translation="MTVASEAFARVLETSILRLALDDSDKSHFGSLGFILRRYPAHAVI
FT                   TRQGEEEDRIFVVHSGWGCICTNLVNGERQILDFPLKGEVVASRAFEGEGLESFTAQTE
FT                   LMLFEAPAKAISSGLAHSTSLAAGLLGAVAREKAILSQHLTNLGRRSALVRTAHFLLEL
FT                   GTRLEKADAAKTHEFECPLTQYDLAAALGVTAIHVNRMLRELRQRGYLDFRQGSVHLLN
FT                   KKGLEHFADFDPGYLRLPGET"
FT   CDS_pept        717545..718369
FT                   /transl_table=11
FT                   /locus_tag="SM_b21080"
FT                   /old_locus_tag="SMb21080"
FT                   /product="putative response regulator protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21080"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49059"
FT                   /db_xref="GOA:Q92VP0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VP0"
FT                   /protein_id="CAC49059.1"
FT                   /translation="MLWWGCTMHSLTRIHENAALEVHRLSSSRPGKATSETHNNTAAGS
FT                   ALLLLDSRTLDRECLSQCLVLHGMGMQVLAYGSIDEWRKDKELHPPIAAILLNIGGRKA
FT                   VDTSNAAEISDLVREFDPTPVVLLSDWDELPQILRALECGVRGYIPSSIGFDVCVQAVN
FT                   LARAGGIFVPASSVLTTRMEMVAGGEVPRPMAGMFTQRQEEVIHALRRGKANKIIAYEL
FT                   NLRESTVKVHIRNIMKKLKATNRTEVAYKLSDMFVVEGGAGDKPGLPQPRSC"
FT   CDS_pept        718406..719953
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="SM_b21081"
FT                   /old_locus_tag="SMb21081"
FT                   /product="phosphomannomutase"
FT                   /function="alpha-D-mannose 1-phosphate = D-mannose
FT                   6-phosphate"
FT                   /EC_number="5.4.2.8"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21081"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49060"
FT                   /db_xref="GOA:Q92VN9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VN9"
FT                   /protein_id="CAC49060.1"
FT                   /translation="MNFARFEPASANGPAQESGPEKFTYETSPLIRATGFREYDARWWF
FT                   GRSDCGKAPELNLMGAQALGMGLGTFIQRSGAGPEIVTGHDFRSYSLGIKLALVCGLMA
FT                   AGARVRDIGLALSPMAYFAQFALDVPSVAMVTASHNENGWTGVKMGMARPLTFGPQEMA
FT                   ELRRIVLEADFDLTGGGAYEFVPDFRRRYIDDLTRGRRIGRKLKVVAACGNGTAGAFAP
FT                   DVLQRIGCEVIPLDCDLDHSFPRYNPNPEDLKMLHAIRDKVLESGADVGLGFDGDGDRC
FT                   GVVDNEGSEIFADKIGVMLARDISASNPGSVFVVDVKSTGLFASDPVLKANGARTDYWK
FT                   TGHSYIKRRVAELGAIAGFEKSGHFFFNAPLGRGYDDGLITAISICEMLDRSPNRSIAE
FT                   IYRALPMTWSSPTMSPHCADEVKYAVAERVVERFRAMQRDGVPVAGQMIADLVTVNGVR
FT                   VVTEDGTWGLVRASSNKPELVVVVESPVSEARQRAMFEAVDCVLRENPEVGAYNQTI"
FT   CDS_pept        719985..722288
FT                   /transl_table=11
FT                   /gene="manC/manA"
FT                   /locus_tag="SM_b21082"
FT                   /old_locus_tag="SMb21082"
FT                   /product="probable mannose-6-phosphate
FT                   isomerase,GDP-mannose pyrophosphorylase protein"
FT                   /EC_number="2.7.7.22"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21082"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49061"
FT                   /db_xref="GOA:Q92VN8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VN8"
FT                   /protein_id="CAC49061.1"
FT                   /translation="MPERISCFVMSGGVGSRLWPLSREDNPKQFHDLAGHGSMLVNTVR
FT                   RLKARPAGDTPVHVIASERHSERVRADLAGIDLAGGHAIFEPVGRNTAAAVAVAALETI
FT                   ATHGDGLVLVVPSDHEISTEEQFWNTVEKGVPAAEAGRLVVFGIPPDSPETGYGYIESV
FT                   GKGNVRDVARFVEKPGLEMAKAYVASGTFFWNAGIFLFRAGAMRAAFREHQAAIWQKTE
FT                   CAFAAAATEVSGTYLPIEQYSTIPSASIDYAIMEHASGIAMVPASFYWSDLGSWQSLLD
FT                   ISPTDGNGNVVIGDVVAIDCERSYLRSQGRLLSVIGLRDVAIVSTADATFVAPVAKSQE
FT                   VKRIVEQLEKSGRLETKFTPAHARVLQPGAWRERVAHWLFEETLPLWSTAGVDERHGGF
FT                   HEALSFEAAPLIKPKRMRTMARQVYAFSVAKLRGWDGDADGLIGHGIAFMEKGRTQRGG
FT                   WARVLQEDGTIADACEDAYDHACVLLMLAHAYQAGNPDALRLGQETFAFLDEHLEDDRL
FT                   TGFLETSDGTELRRSNPHMHLLEAFLAWYAATGERGYLRRAARIIDLFRSHFFDTESWT
FT                   LGEYFDEAWNPAVGPKGQWTEPGHHFEWASLLVEFAAKSRQTDLIAFARKLYASAIATG
FT                   LNRSTGLAYGAVSRAALPLDLISRSWPQAEAVKAALALEGTGGPDLKPEIEARVGRLFR
FT                   WHIDPAPLGMWIDRVDEKGSAVATEVPASIFYHLVTALMQYLDKTEEAVYRSPSFPQSI
FT                   NAAEPLAALNRETV"
FT   CDS_pept        722424..722867
FT                   /transl_table=11
FT                   /locus_tag="SM_b21083"
FT                   /old_locus_tag="SMb21083"
FT                   /product="probable transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /note="putative transposase IS3/IS911"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21083"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49062"
FT                   /db_xref="GOA:Q92VN7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VN7"
FT                   /protein_id="CAC49062.1"
FT                   /translation="MADDGFVGRYEVVEPRRGNRRWPDAVKARIVAESLEPGVRVVDVA
FT                   RRHDVVPHQLSFWRRQAREGILALPFEAMPGLSESGDAEPAFVPLAIAAEPSEAVNVLA
FT                   PPLSEAVSSVLTLEIGPDVVLRVPGDVPVERVAALVRAMRAPV"
FT   CDS_pept        722864..723217
FT                   /transl_table=11
FT                   /locus_tag="SM_b21084"
FT                   /old_locus_tag="SMb21084"
FT                   /product="hypothetical protein encoded by ORF2 of
FT                   ISRm14,IS66 family"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21084"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49063"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VN6"
FT                   /protein_id="CAC49063.1"
FT                   /translation="MIVAGQRLPILIATRPVDFRCGHQALALMMQTELKLDPHSGVTVI
FT                   FRSKRGDRLKILVWDGTGMVLTYKILEHGSFAWPKVQDGTMRLSRGQYEALFEGLDWRR
FT                   VMAQRVTAPSAAG"
FT   CDS_pept        723280..724932
FT                   /transl_table=11
FT                   /locus_tag="SM_b21085"
FT                   /old_locus_tag="SMb21085"
FT                   /product="putative transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /note="putative transposase,, IS66 family"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21085"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49064"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VN5"
FT                   /protein_id="CAC49064.1"
FT                   /translation="MSSPLDLSLFPNLPPEVVKAFAAMQFELSVERAARQHEQAVVAEK
FT                   DAFIAELKELVEKLEGQVHDYRRTKFGPKSEKLDPAQMELALEDLETAIAETQARIAAV
FT                   EKKIEASASDPEKVAPRKERKARALPEHLPRVERVIEPESIVCPCGCGNMVRIGEDRTE
FT                   RLDRVPARYEVIVTIRPKYACPKGRTGVVQARAPAHLLEGSWPTEALLAEIAVSKHSEH
FT                   MPLNRQAEVMARHGVPIDRTVLADWMGRTGAAIAPVVDHMAKRLLWESTRLYVDETTAP
FT                   VLDPGRGKTKTGYLWAVLRDDRGWNGSAPPGVVFHYRPGRKGEYAAEILDGFNGTIQVD
FT                   AYGGYSHLATLDRVGGDPLKLAFCWAHGRRKLIKATPKSGSPIVDEALVRIAALYKIED
FT                   SIRGSDPEHRRAVRQDLSLPLVGAFFAWLAAQAKRVSRKSDLGKALAYMLTRQDGFRLF
FT                   LDDGHVDIDSNLVENAIRRPAMNRRNALFAGHDEGGRNWARFASLIGTCKMNGVEPYAY
FT                   LCDLFTRLANGHLAKDIDALMPWAYAARITASQ"
FT   CDS_pept        complement(725358..725834)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21086"
FT                   /old_locus_tag="SMb21086"
FT                   /product="hypothetical protein"
FT                   /function="Adenylate cyclase, family 3 (some proteins
FT                   contain HAMP domain)"
FT                   /EC_number="4.6.1.1"
FT                   /note="putative adenylate cyclase"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21086"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49065"
FT                   /db_xref="GOA:Q92VN4"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VN4"
FT                   /protein_id="CAC49065.1"
FT                   /translation="MEYIAGMTDIVFARDGSVAKIIGDSLHVPFGTPSDQPDHATRAVA
FT                   CSLELDAFACSFREHCQRRTSLTATRALEPTSEPPSLAISEEKVFRLKRLQRYHQRRRT
FT                   PGRETLRPITYCVRLRPSQSMRRLEVMSTLVPLTTDVLSCMRCRLLSASYPSSG"
FT   CDS_pept        725979..730598
FT                   /transl_table=11
FT                   /gene="traA2"
FT                   /locus_tag="SM_b21087"
FT                   /old_locus_tag="SMb21087"
FT                   /product="putative conjugal transfer protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21087"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49066"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041533"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VN3"
FT                   /protein_id="CAC49066.1"
FT                   /translation="MAIMFVRAQVIGRGAGRSIVSAAAYRHRTRMIDEQAGTSFSYRGG
FT                   ASELVHEELALPDDIPAWLKAAIAGRSVAKASEALWNAVEAHETRADAQLARELIIALP
FT                   EELTRAENIALVREFVRDNLTSKGMVADWVYHDKDGNPHIHLMTALRPLTEQGFGPKKV
FT                   PVLGEDGEPLRVVTPDRPNGKIVYKLWAGDKETIKAWKIAWAETANRHLALAGHEIRLD
FT                   GRSYAEQGLDGIAQKHLGPEKAALARKGIAMYFAPADLARRQEMADRLLAEPGLLLKQL
FT                   GNERSTFDERDIAKALHRYVDDPVDFANIRARLMASDELVLLKPQQIDAETGKAKQPAV
FT                   FTTREMLRLEYAMAQSAEVLSRRKGFGVSNARAAAAVRSIETADTEKPFRLDLEQVDAV
FT                   RHVTRDNAIAAVVGLAGAGKSTLLAAARAAWEGEGRRVIGAALAGKAAEGLEDSSGIRS
FT                   RTLASWELAWESGREQLQRGDVLVIDEAGMVSSQQMARVLKAVEDAGAKAVLVGDAMQL
FT                   QPIEAGAAFRAISERIGFAELAGVRRQRDAWARDASRLFARGKVEEGLDAYAQQGRIVE
FT                   TETRAEIVDRIVADWANARRDLLQKSADGEHPGRLRGDELLVLAHTNDDVRKLNEALRN
FT                   VMIGEGALTGAREFQTARGLREFAAGDRIIFLENARFVEPRARRLGPQYVKNGMLGTVV
FT                   STGDRRGDTLLSVRLDSGRDVVISQDSYRNVDHGYAATIHKSQGSTVDRTFVLATGMMD
FT                   QHLTYVAMTRHRDRADLYAAKEDFEPKPEWGRKPRVDHAAGVTGELVEEGMAKFRPNDE
FT                   DADESPYADIRTDDGTVQRLWGVSLPKALKDAGAAEGDTITLRKDGVERVKVQVPIVDE
FT                   QTGEKRFEERQVDRNVWSASQLETAAARRERIERESHRPQLFKQLVERLSRSGAKTTTL
FT                   DFEGEAGYQAQARDFARRRGLYHLSLVAAGMEAEVLRRWAGIAEKREQVAKLWERASVA
FT                   LGFAIERERRVSYNEERTETLSTGIPSDGKYLVPPTTTFSRSVAEDARLAQLSSQRWKE
FT                   REAILHPVLAKIYRDPDGALSALNALASDAAIEPRKLAEDLGLAPDRLGRLRGSELVVD
FT                   GRAARDERTAATVALSELLPLARAHATEFRRNAERFGIREQQRRAHMALSVPALSKTAM
FT                   ARLVEIEAVRKQGGDDAYRTAFAFAVEDRLLVQEVKAVNEALTARFGWSAFTAKADVIA
FT                   ERNIAERMPEDLAPERREKLTRLFAVIRRFAEEQHLAERQDRSKIVAGASVELGKGTFA
FT                   VLPMLAAVTEFKTTVDEEARERALAAPHYAHHRAALVETATRVWRDPADAIGKIEDLIV
FT                   KGFAAERIAAAVTNDPAAYGALRGSDRIMDKLLAVGRERKGALQAVPEAASRIRSLGAS
FT                   YASALDAETRSITEERRRMAVAIPGLSPAAEDALKRLAAQIKNKDGKLDVAAGSLDPRI
FT                   AREFAKVSRALDERFGRNAILRGETDVINRVSPAQRRAFEAMRDRLTILQQAVRVQSSE
FT                   KIVSERRQRAINQSRGIRM"
FT   CDS_pept        complement(730922..731137)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21088"
FT                   /old_locus_tag="SMb21088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21088"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49067"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VN2"
FT                   /protein_id="CAC49067.1"
FT                   /translation="MTVVGWDGGLYRGSGAGEAGWLIQRHAQMETRAKAMQKEGLPIAW
FT                   TYKAVFLVGDRTALLKGAPIAIMRLS"
FT   CDS_pept        731300..732370
FT                   /transl_table=11
FT                   /locus_tag="SM_b21089"
FT                   /old_locus_tag="SMb21089"
FT                   /product="carnitine dehydratase"
FT                   /function="L-carnitine = 4-(trimethylammonio)but-2-enoate +
FT                   H2O"
FT                   /EC_number="4.2.1.89"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21089"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49068"
FT                   /db_xref="GOA:Q92VN1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VN1"
FT                   /protein_id="CAC49068.1"
FT                   /translation="MTTESELPLSGLVVVDMSQFLSGPYCSLRLMDLGARVIKIERPDG
FT                   GDLSRRLYLSDTEIGGDSTIFHAINRAKESLAIDLKNEADLAALKRLLAQADVMIQNFR
FT                   PGVIERLGLDYEAVRAINPRIVYASISGYGEEGPWVKRPGQDLLAQSRSGVMWLNGDEG
FT                   QGPVPFGLAIGDMLAGAAAAQGILAALVRRGISGNGSLVETSLLEALVDFQFEVLTTHL
FT                   NDGGRLPKRSAFRSAHAYLAAPYGVYAASDGYLAIAMTPIPKLADLLEIDELAPYRDDP
FT                   SSWFTERDRIKALIAARIACAAWTNGWRCWSRPTSGARACSTGTNSWRAMVSRCSTCCR
FT                   RWCAKTTCRSPPPARR"
FT   CDS_pept        732456..733592
FT                   /transl_table=11
FT                   /locus_tag="SM_b21090"
FT                   /old_locus_tag="SMb21090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21090"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49069"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VN0"
FT                   /protein_id="CAC49069.1"
FT                   /translation="MSVVLKGMTWNHPRGYDPMVACSQSWQEKTGVEIRWEKRSLQDFE
FT                   AFPVETLARNYDLIVIDHPHVGQITGENCLLPLDVPGREAERQALSAASVGPSYRSYAW
FT                   NERQWAFPIDAATQVQAWRPDRTDRPQTWGEMLALARRGGVLLPLRPPHSLMSFYTLCG
FT                   NLGRPCRSAAKGDLVDAETGATAVELLQEISALIDPACFGMDPIAVLEAMAVEASPVAC
FT                   APLIYGYVSYSIAGFRPALVRFGDFPTVNAAGPVGSALGGTGIAVSAFSRAPGEAIDFA
FT                   YWVASGGVQRGVYAASGGQPGHGDAWQDDKVNAAAHDFYRATRATLEGAWLRPRHDGYM
FT                   TFQQAGSDRLNEGLRGRERPRLVVEELNRLFHASFRCG"
FT   CDS_pept        733897..734907
FT                   /transl_table=11
FT                   /gene="lysM"
FT                   /locus_tag="SM_b21091"
FT                   /old_locus_tag="SMb21091"
FT                   /product="lysozyme"
FT                   /function="Hydrolysis of 1,4-beta-linkages between
FT                   N-acetylmuramic acid and N-acetyl-D-glucosamine residues in
FT                   a peptidoglycan and between N-acetyl-D-glucosamine residues
FT                   in chitodextrins"
FT                   /EC_number="3.2.1.17"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21091"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49070"
FT                   /db_xref="GOA:Q92VM9"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VM9"
FT                   /protein_id="CAC49070.1"
FT                   /translation="MRPFSAVSAIIITCLVLSSCGFGGSRPSRETTSSVVRPASPVPSA
FT                   AISAAAAQAAPQPEALAWAGTVPQPQAFMPAERAVGMPVPAERPIAMLAPENPAREPRG
FT                   RSRVYSHSFRDAHPINFGTRSPRKLAVHGVDVSRWQGDINWAKLRTQGANFAYIKATDG
FT                   GDHLDPMFKKNWRRADEAGLKRGAYHFFYWCRTAGEQADWFIRNVPRDPSALPPVIDVE
FT                   WNGESSCKRRPSPERVREKMQVFMDKLERHYGQRPIIYTAPDFYRDNLQGAFPNHPFWL
FT                   RSVAAHPSKVYPGRKWVFWQYSGSGLSHGVDGRIDLNVFNGSEEDWHNWVSARSS"
FT   CDS_pept        734912..735388
FT                   /transl_table=11
FT                   /locus_tag="SM_b21092"
FT                   /old_locus_tag="SMb21092"
FT                   /product="putative acetyltransferase protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SM_b21092"
FT                   /db_xref="EnsemblGenomes-Tr:CAC49071"
FT                   /db_xref="GOA:Q92VM8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q92VM8"
FT                   /protein_id="CAC49071.1"
FT                   /translation="MQVTPIRLLQTNDAAFLALATLMEEMQAHYRVACPPRAEIVAGLQ
FT                   AMPPGAEILVAEEHRSVLGFAAFSAIYPGPGLKPGIFLKELYVGGSQRGRGLGRALMQK
FT                   LASLARERGLARIDWTVEAENTRLLSFYEELGGTRKTDRLFFRLDGDALARLAG"
FT   CDS_pept        complement(735413..736315)
FT                   /transl_table=11
FT                   /locus_tag="SM_b21093"
FT                   /old_locus_tag="SMb21093"
FT                   /product="putative transcriptional regulator, LysR family
FT                   protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="Ensemb