(data stored in ACNUC9435 zone)

EMBL: AL596167

ID   AL596167; SV 1; linear; genomic DNA; STD; PRO; 253050 BP.
XX
AC   AL596167;
XX
DT   21-OCT-2001 (Rel. 69, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Listeria innocua Clip11262 complete genome, segment 5/12
XX
KW   .
XX
OS   Listeria innocua
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [2]
RP   1-253050
RA   Glaser P., Frangeul L., Rusniok C.;
RT   ;
RL   Submitted (09-JUL-2001) to the INSDC.
RL   Glaser P., Institut Pasteur, Genomique des Microorganismes Pathogenes, 25
RL   rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE.
XX
RN   [3]
RX   DOI; 10.1126/science.1063447.
RX   PUBMED; 11679669.
RA   Glaser P., Frangeul L., Buchrieser C., Rusniok C., Amend A., Baquero F.,
RA   Berche P., Bloecker H., Brandt P., Chakraborty T., Charbit A.,
RA   Chetouani F., Couve E., de Daruvar A., Dehoux P., Domann E.,
RA   Dominguez-Bernal G., Duchaud E., Durant L., Dussurget O., Entian K.D.,
RA   Fsihi H., Portillo F.G., Garrido P., Gautier L., Goebel W., Gomez-Lopez N.,
RA   Hain T., Hauf J., Jackson D., Jones L.M., Kaerst U., Kreft J., Kuhn M.,
RA   Kunst F., Kurapkat G., Madueno E., Maitournam A., Vicente J.M., Ng E.,
RA   Nedjari H., Nordsiek G., Novella S., de Pablos B., Perez-Diaz J.C.,
RA   Purcell R., Remmel B., Rose M., Schlueter T., Simoes N., Tierrez A.,
RA   Vazquez-Boland J.A., Voss H., Wehland J., Cossart P.;
RT   "Comparative genomics of Listeria species";
RL   Science, e1252229 294(5543):849-852(2001).
XX
DR   MD5; 18dcddf89a65afb9e315161009bdbfdc.
DR   ENA-CON; AL592022.
DR   BioSample; SAMEA3138320.
DR   EuropePMC; PMC154633; 12454178.
DR   GOA; P69001.
DR   InterPro; IPR016914; tRNA_cyt/urid_MeTfrase.
DR   InterPro; IPR029028; Alpha/beta_knot_MTases.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00616; LhrC.
DR   RFAM; RF01460; rliH.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01483; rli56.
DR   RFAM; RF01491; rli54.
DR   StrainInfo; 494327; 0.
DR   UniProtKB/Swiss-Prot; P69001; TRML_LISIN.
XX
CC   E-mail: pglaser@pasteur.fr
CC   Phone: +33 (0)1 45 68 89 96, Fax: +33 (0)1 45 68 87 86
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..253050
FT                   /organism="Listeria innocua"
FT                   /strain="Clip11262"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1642"
FT   regulatory      299..304
FT                   /gene="lin0935"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        312..1052
FT                   /transl_table=11
FT                   /gene="lin0935"
FT                   /note="similar to Nitroflavin-reductase"
FT                   /db_xref="GOA:Q92D83"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D83"
FT                   /protein_id="CAC96166.1"
FT                   /translation="MNQAIDAILGHYSVRNFEDKALTEEELALLIKSAQAASTSSFVQA
FT                   YSIIGITDKKIREQISAIAGNQPYTVQTGQLFIFVADLARHQAILEEHQVDTAALETSE
FT                   KWLVSIIDAALAAQNMAVAAESLGFGICFIGGIRNDVGQIAEILDLPPYTMPLFGLTIG
FT                   HPIKGKEKAKPRLPQDLVYHENTYQKMNPATLAEYDEQIKTYYDERTAGKRVEGWSEQI
FT                   ARGLGRKSRLDLKDFLQKQHLNQK"
FT   regulatory      1056..1094
FT                   /gene="lin0935"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(1056..1094)
FT                   /gene="lin0936"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(1104..1265)
FT                   /transl_table=11
FT                   /gene="lin0936"
FT                   /db_xref="GOA:Q92D82"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D82"
FT                   /protein_id="CAC96167.1"
FT                   /translation="MLGIIWGIIVVLLAVWLLGIIFHVAGGLINILLVVVLILVIWNLI
FT                   QMARNKRK"
FT   CDS_pept        complement(1351..1809)
FT                   /transl_table=11
FT                   /gene="lin0937"
FT                   /note="similar to protein-tyrosine-phosphatase"
FT                   /db_xref="GOA:Q92D81"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D81"
FT                   /protein_id="CAC96168.1"
FT                   /translation="MVKVVFVCLGNICRSPMAEGLFRKEVANAGLTDEIEIDSAATGTW
FT                   NLGKPPHRGTREVLKKHGINYEAMRARKVTDADFEQADYIIGMDQNNIADLNALNKNKD
FT                   VTLRSLMSFVSGKEEEEIPDPYYTGDFDETERMVTEGVKALLAFITKK"
FT   regulatory      complement(1817..1822)
FT                   /gene="lin0937"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(1822..2568)
FT                   /transl_table=11
FT                   /gene="lin0938"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D80"
FT                   /protein_id="CAC96169.1"
FT                   /translation="MTIWVRNGNNAATEQEISAKETELGLFLPAEYKELLLKQNGGLIR
FT                   KNHFPTNEPTSYGLDVAEIYYLASLNELLTDIPEQNDVDLAGKQVYFHRDESRYIGFSY
FT                   ADNKSLPSIIYVDFETLQTLVVAENMAEFLEALYFSPFPVDFAEQFPVKKLDQILASSN
FT                   VKKTKQLLELLEDYPDKKWYLETLIRLLQKNEIPYNIVVYQSFENQLLYFRRKLVPELV
FT                   EKIFAMLKDCDGIDQSATTELYKEWE"
FT   regulatory      complement(2577..2582)
FT                   /gene="lin0938"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(2624..2652)
FT                   /gene="lin0939"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(2659..3621)
FT                   /transl_table=11
FT                   /gene="lin0939"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D79"
FT                   /protein_id="CAC96170.1"
FT                   /translation="MDYLNDIEEAWGMDDNAEKVKILERAIASADMYNDVENGIEARDM
FT                   LIDTCLTAGFPKKQLQAFSWLVKKWEDDAAYIDAYDLLWKYKWISEHVPTFDEVSKAQI
FT                   DGLLNDMKVKFEQQNYSLRPYYKVCTLAAIRMGEKDKAEELFEKWNNTKADYLNDCPAC
FT                   ETNDKVHYYCFIKDFEKAKKAAAPIIKGKQSCAEVPHLTYGNMALAYLELGDEKMAQEC
FT                   FDKGYPLVEKESSLIPPLSHLLKYLVLTNQTEKAREVIDTNKEIVLKSESGLDRLLFLQ
FT                   AAYPLLDRETETDLVEIAETLTAKFDARNENSYYQDRLK"
FT   regulatory      complement(3628..3633)
FT                   /gene="lin0939"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(3632..3745)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lin0940"
FT                   /note="similar to heat shock protein HtpG (truncated,
FT                   C-terminal part)"
FT                   /db_xref="PSEUDO:CAC96171.1"
FT   CDS_pept        complement(3742..5436)
FT                   /transl_table=11
FT                   /gene="lin0941"
FT                   /note="similar to heat shock protein HtpG"
FT                   /db_xref="GOA:Q92D78"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D78"
FT                   /protein_id="CAC96172.1"
FT                   /translation="MENYSHRFQVNLAGMIDILSNHLYDEKDVYIRELLQNATDAIRAR
FT                   KKIEPTLNGKIHVSLSGEKNNKTLILEDNGIGLTEDEVHAFLATIANSSKGEKNFDGQD
FT                   TNDFIGRFGIGLLSCFIVSDEIVMISTSQKNGETTEWHGKADGTYSVRKIKTEKREPGT
FT                   QVYLRLRPHMDEHPECEKTEYLINTLKKYGSSLESAILIEADGYEQEINSWTKQFADKE
FT                   ILFSLPREQILRYGEHLLGTRFQDYFLIENESGRTFGIAFMIPYTVQMNAVRKQTVFLN
FT                   NMYVTSEANNVLPNWAFFAECILWTDELQPVASRESFYKNERLEIVSKELGVALKKGIE
FT                   TLPESALTKLLSTHYLGFKALASEDAPFLKLIYSYLPFKTLNGEEKLADIMKETTTIYY
FT                   TFSVDDFRQITDIARSSGMTLINGGYSYDTPILTMLNHLVDEAEFILIQPEEITNKLLP
FT                   MSAEEEITYQPILAEMNKMMAEFDADITIKHFEPKTLPIIFIHSAATQASRELERSLEE
FT                   TSSVFSDILESIQQEQAPAPLAHLYLNLDNELIKNFSRLVNLLMSYR"
FT   CDS_pept        5638..6108
FT                   /transl_table=11
FT                   /gene="fri"
FT                   /product="non-heme iron-binding ferritin"
FT                   /db_xref="GOA:P80725"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="PDB:1QGH"
FT                   /db_xref="PDB:2BJY"
FT                   /db_xref="PDB:2BK6"
FT                   /db_xref="PDB:2BKC"
FT                   /db_xref="PDB:6HV1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80725"
FT                   /protein_id="CAC96173.1"
FT                   /translation="MKTINSVDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEK
FT                   MDDLYSEFGEQMDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVG
FT                   TLELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE"
FT   regulatory      6122..6147
FT                   /gene="fri"
FT                   /regulatory_class="terminator"
FT   CDS_pept        6343..6645
FT                   /transl_table=11
FT                   /gene="lin0943"
FT                   /note="similar to B. subtilis YneR protein"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR008326"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D77"
FT                   /protein_id="CAC96174.1"
FT                   /translation="MNIEVTDQANKWFHDEFDVADGNGIRLFAKYGGSNSSLHPGFSIG
FT                   LAAEKPQEAAVAEKKEDLTFFIEDHDYWYFKDHDWKIDYEPKTEEVSFSFKEKVK"
FT   regulatory      6661..6691
FT                   /gene="lin0943"
FT                   /regulatory_class="terminator"
FT   regulatory      6748..6753
FT                   /gene="lin0944"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6760..7890
FT                   /transl_table=11
FT                   /gene="lin0944"
FT                   /note="similar to C-terminal part of B. subtilis ComEC
FT                   protein and to ComEA "
FT                   /db_xref="GOA:Q92D76"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D76"
FT                   /protein_id="CAC96175.1"
FT                   /translation="MTKKLVICISLIAIFLSGCSFSEPSTKPSNITEKTLNGASFTFFD
FT                   VGQGDSTLIQAEDGTTILIDTGRQDDDRILTYLKEANIKKLDLLLLTHPHADHIGNADK
FT                   VIATYKPKEIWMDGLTFSSSIYEKVIDAALASNAKYKEPRRGDKATFGPFDIEVLSPDK
FT                   LQNDANNDSIAVKMTYKDISAIFTGDAEKGREREMADSGANLEADILDLGHHGSSTSNQ
FT                   PFFLDKVKPQVAVYSAEMANSYGHPHVEVLEWLKERDIKTYGTDVNGTITIETDGEKIH
FT                   VQTEKEGTPKPGSSYNKENNTQKTEDATSEELPESINLNSASSEELQLLPLIGPALAEK
FT                   IIAERPYQSIDELKKINGIGDGIVRQIKEQGLAVTK"
FT   regulatory      7889..7894
FT                   /gene="lin0945"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        7900..8127
FT                   /transl_table=11
FT                   /gene="lin0945"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D75"
FT                   /protein_id="CAC96176.1"
FT                   /translation="MKKAILDRIEDGKAVFLIEPNHTEWLVNQEELDSSIKEGDVVTIS
FT                   ETNEIMKHPQETDEMKKRIAEKLERLRGKN"
FT   CDS_pept        complement(8326..9543)
FT                   /transl_table=11
FT                   /gene="lin0946"
FT                   /note="hypothetical transport protein"
FT                   /db_xref="GOA:Q92D74"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D74"
FT                   /protein_id="CAC96177.1"
FT                   /translation="MNSDLTNKKILTRSSRVMLIVGIILIAANLRAPITSVGPLLGMIQ
FT                   SDLHLTNTMAGLLTTIPLLAFAGLSPFVSKLSRSLGIEVLIFIALLTLVIGSLLRPFGG
FT                   EFYLFAGTFMIGLAIAVGNVILPSLIKKEFPFKLGLMTGVYSISMNLCAALAAGLTVPI
FT                   AMNNKFSWHGSMVFWAMLGVLALVIWLPQLRYNQRSSEKIATHLVTTSVWKSPLAWKIS
FT                   LYMGSQSAIFYISIAWLPNILADQGLSSTSSGLMLSLMQFAVMPITFIIPIIAGRMKNQ
FT                   QLLVGISVLLFMIGIFGIMFASGNLFILATAIILYGIGSGMSFSLSMMFFNLRTTSATE
FT                   SADLSGMAQSIGYLFAASGPILFGTLHDALGSWQPTLYVLIGITLIMLYCGLDAGRNKF
FT                   LFPQKK"
FT   CDS_pept        complement(9540..10229)
FT                   /transl_table=11
FT                   /gene="lin0947"
FT                   /note="similar to transcription regulator"
FT                   /db_xref="GOA:Q92D73"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D73"
FT                   /protein_id="CAC96178.1"
FT                   /translation="MVEKIERKSLAEQVYDQIKAEITSGAWKIGERIPKEADLMTQFGI
FT                   SRNTLREAIRALAHIGLLETKQGDGTFVRNNSELHAIMQKRVRESSVQEILEMRHALDR
FT                   EAVILACERRTDEDLKMLKKYKQLCYLANKDNDVTAFVKADSALHLTIVKAAHNDLLLD
FT                   MYVNILEEIQFSITSTTEMNPAVNKHNGHATLVSAIEKRDKEGAAHEVTEYITLFKQIA
FT                   AKNGDNK"
FT   regulatory      complement(10238..10243)
FT                   /gene="lin0947"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      10341..10346
FT                   /gene="lin0948"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        10351..11397
FT                   /transl_table=11
FT                   /gene="lin0948"
FT                   /note="conserved hypothetical membrane protein"
FT                   /db_xref="GOA:Q92D72"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D72"
FT                   /protein_id="CAC96179.1"
FT                   /translation="MNWLEKLKENDTARRVLVFVLLGIVLYLLRSMIDLILLTFIFAFL
FT                   VTRLENVILKRIRIPRKLIVIVLYCLVAMFLYVAIVHFLPILIDQISQLVDSLVKIYNN
FT                   PSDNKIVQWIVGFLKESNIQKYLQTGVDFIIASLSGIGSVGLSFFLALILSLFFSLEKE
FT                   RVTSFTGQFLTSKVGFIFKEAAFFGKKFVATFGVVLEAQLMIALVNTIITTIALYLMNF
FT                   PQLLSLSIMVFVLGLIPVAGVIISCVPLVLIAYSVGGFQDVVYILITVVIVHAIETYIL
FT                   NPKLMSSKTNLPVFYTFIILIFSETFFGVWGLIVGIPVFVFLLDILDVRNSEDIQKRTI
FT                   FGRKKKVD"
FT   regulatory      complement(11396..11422)
FT                   /gene="lin0949"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(11407..12309)
FT                   /transl_table=11
FT                   /gene="lin0949"
FT                   /db_xref="InterPro:IPR010315"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D71"
FT                   /protein_id="CAC96180.1"
FT                   /translation="MKKVILTIIILAIIITGFGIIFLQFEPTKKAAKEPTNATAQKSSK
FT                   KAKNPVSEIAVPTLFVHGYSGTANSFKGMINRLADDGIVTESLVMTVAADGSVSTTGSY
FT                   DKFSHNPTIQVIFEDNKSSMVNQTQWIQNVMKELKNNYHIEKVDAVGHSMGGVSLTSYI
FT                   EKVGSDKAYPVLENLVLIGAPLNGLVVGDNGVTAYDLTDEGPKQSSDRYSEFMKNKQKI
FT                   PTNLQVLNIAGDMLDGTKSDGSVSVASALSGKFIFEGQAKSYEEKIFTGKKAAHSKLHE
FT                   NTDVDAKVANFLWGTEKVD"
FT   regulatory      complement(12316..12321)
FT                   /gene="lin0949"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(12329..13150)
FT                   /transl_table=11
FT                   /gene="lin0950"
FT                   /db_xref="GOA:Q92D70"
FT                   /db_xref="InterPro:IPR010315"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D70"
FT                   /protein_id="CAC96181.1"
FT                   /translation="MLKRVFFSIVLPLGCLVGAIFILLTINTTYPKAANDAIPTIFIHG
FT                   YRGTDRSLHGMIRRFDQKYNWGTESLTVNVSPDGSISTTGTYSKNEKNPLINIVFEDNR
FT                   ATLPQQSMWTKKIMSYLQKNYDIKKFNAIGHSMGGGAWVSYLASYEKNKSYPQVNKIVF
FT                   LAVPFYPEEYVNGDQQVDIKNANNVHAKFAQKMAKVLPDNTEIMIIGGDLEDGSNSDGE
FT                   VKLNSVLYGQKLFAHQKVITHVIKGPKATHSSMHESTVVDKYVGQFLWGQK"
FT   regulatory      complement(13160..13165)
FT                   /gene="lin0950"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      13293..13298
FT                   /gene="lin0951"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        13308..13766
FT                   /transl_table=11
FT                   /gene="lin0951"
FT                   /db_xref="GOA:Q92D69"
FT                   /db_xref="InterPro:IPR025273"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D69"
FT                   /protein_id="CAC96182.1"
FT                   /translation="MIKRTGEIVLAIIGLIFSVLMQAAIAVIGLLLVNGSKGKEGLTTY
FT                   YNNYYQTVTEWEIPKDEIPDPDRIFDFVHTLSWTALSGGIITLIVGAAGIYYIMKNKNP
FT                   ILAGFLFLAAGIVSLLSTALIGFIPALLFVIAAMLCFIRKPKSTFSGF"
FT   regulatory      13775..13797
FT                   /gene="lin0951"
FT                   /regulatory_class="terminator"
FT   regulatory      13847..13852
FT                   /gene="lin0952"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        13861..14085
FT                   /transl_table=11
FT                   /gene="lin0952"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D68"
FT                   /protein_id="CAC96183.1"
FT                   /translation="MKNKVGIIAGAVAGVVACAAIYVVKKQQPPTPFDEVNDIRTRYAD
FT                   KEISETELEENNMISEGGVSSLQYEEKIK"
FT   regulatory      14094..14128
FT                   /gene="lin0952"
FT                   /regulatory_class="terminator"
FT   regulatory      14291..14296
FT                   /gene="lin0953"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        14304..14618
FT                   /transl_table=11
FT                   /gene="lin0953"
FT                   /db_xref="GOA:Q92D67"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D67"
FT                   /protein_id="CAC96184.1"
FT                   /translation="MRAILIGVLIVLLLAMILIVLWPAIMATIGAVLGFWSLKKLLEAR
FT                   SVGEKIVYGVLIGVGALIILANLKGILVVAIIGAIIYFLTRNKNKPRKNDDVFDYPYNK
FT                   "
FT   regulatory      14620..14625
FT                   /gene="lin0954"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        14634..15479
FT                   /transl_table=11
FT                   /gene="lin0954"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D66"
FT                   /protein_id="CAC96185.1"
FT                   /translation="MANLFEKMKQWNKEVSEKIEKREEKRRNSVSYYMDKTKQEMKDAE
FT                   RMVEKQRELKSLFYKEYKEMEVYVEKRRHQAEIAKEAGETKLADFALEEVAQYEEQLKA
FT                   TKSHYDQASEQLEKLELRMHEMRLKWKNLKTQHLAEMAEKNATETSEKMDKVIHDMSWG
FT                   SVSDYHEAQKQRDLAEEAEKKADMSKELSQSFDDLMDELEKKTKKSKEIIKDKAQNFTT
FT                   MVDEIIEREKQNFKKPEKASMEDQLNELEKEAAKEQPKEEKEVLIPELEKKEEENETDK
FT                   "
FT   regulatory      15489..15510
FT                   /gene="lin0954"
FT                   /regulatory_class="terminator"
FT   regulatory      15653..15658
FT                   /gene="lin0955"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        15668..16801
FT                   /transl_table=11
FT                   /gene="lin0955"
FT                   /note="similar to N-acetylglucosamine-6P-phosphate
FT                   deacetylase (EC 3.5.1.25)"
FT                   /db_xref="GOA:Q92D65"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D65"
FT                   /protein_id="CAC96186.1"
FT                   /translation="MTNKVITNATIYTGKGVLENAFVRFDKQILEVGSMTDFQAEKAEE
FT                   VIDAKGQKLVPGFIDVHSHGGYSFDAMDADPEALKKQVNGMLNEGITTYFPTTMTQSHE
FT                   NIEKALKVINEVAQTEPVIGGIHLEGPFVSKVFKGAQPEEYIQAPDLELFKKWFDISGG
FT                   LIQLVTYAPEHDTSADFENLCFELGVVPSIGHSNDVREHLKTSKATHATHLYNACHRMT
FT                   HREPGVPGHVLLEKGINAELIVDGIHVHPDMVKLAYQMKGPEHLCIITDSMRAKGMPEG
FT                   KSELGGQTVIVKDKQARLEDGTLAGSVLTYDDGFRNMIKFTGCTVEEAVLMSSGNQARE
FT                   FNLTQKGAIQAGKDADFNLLDEDLNITATYSFGKKHS"
FT   regulatory      16803..16808
FT                   /gene="lin0956"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        16817..17521
FT                   /transl_table=11
FT                   /gene="lin0956"
FT                   /note="similar to glucosamine-6-Phoasphate isomerase (EC
FT                   5.3.1.10) "
FT                   /db_xref="GOA:Q92D64"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D64"
FT                   /protein_id="CAC96187.1"
FT                   /translation="MQLITTENKLAGSKKALEIIEKGITSGEVNTLGLATGSTPETLYA
FT                   ELVKSDVDTKNVTTTNLDEYVGLAADDPNSYHYYMNDLLFSKKAFKESFLPNGEATDAE
FT                   AECARYEGILSEHPIDIQVLGIGTNGHIGFNEPGTSFDSLTHKVVLTDSTREANKRFFE
FT                   REEDVPTHAYSMGIKSIMNAKKIILLAFGENKAQAIKETIKGPVDVNCPASVLQNHPDV
FT                   TVILDNEAASLL"
FT   regulatory      17523..17528
FT                   /gene="lin0957"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17537..18259
FT                   /transl_table=11
FT                   /gene="lin0957"
FT                   /note="similar to transcription regulator (GntR family)"
FT                   /db_xref="GOA:Q92D63"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D63"
FT                   /protein_id="CAC96188.1"
FT                   /translation="MIDKQSGIPIYIQIQSEIKKKMEDGVWKVGTSIPAERQLAEMFHV
FT                   SRMTVRQAIQGLVDDNILQRRVGAGTFIAEKKLTERLEAVTSFTNLMLQEGKVPSTRIV
FT                   SYGIRPASTQEQEALQLPENSNVMKIERIRYGDRVPILYEVAAIPEKIASLLTKEDIMD
FT                   SLYKAIELKLGQKIGEAEQTMEASLVSEKIAPYLDVKLGSPVMKLRQITTLEDGRPFEF
FT                   TRSQYVGSRFQFVARIKQ"
FT   regulatory      18267..18295
FT                   /gene="lin0957"
FT                   /regulatory_class="terminator"
FT   regulatory      18381..18386
FT                   /gene="lin0958"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        18394..19449
FT                   /transl_table=11
FT                   /gene="lin0958"
FT                   /note="similar to undacaprenyl-phosphate
FT                   N-acetylglucosaminyltransferase"
FT                   /db_xref="GOA:Q92D62"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D62"
FT                   /protein_id="CAC96189.1"
FT                   /translation="MSWMIIFICFGASVLLTPLIRKIALYFDITDKPDQRRINVKPIPS
FT                   LGGLAIFISFAIGLFLLPIENEFLWALLIAAFVMVITGLLDDIMEFKARYKLIGQITAA
FT                   FIIVFWGDISIDFINLPFGGEIHFGILSIPLTIIWIVAITNAINLIDGLDGLAAGVSTI
FT                   ALLTILGMAFIMGDALVIMIASVLIAGTLGFLPYNFNPAKIFMGDTGALFLGFIIAVLS
FT                   IMGFKNVTFISLIVPILILGVPISDTVFAIVRRMVTKQPIAMADKSHLHHCLLRLGFTH
FT                   RQTVILIYAIAALFSLFAFIFTMSTLWGSMILIGVLLILIEVLIETLGLVGSTYRPLLN
FT                   LFKITKEDKID"
FT   regulatory      19449..19473
FT                   /gene="lin0958"
FT                   /regulatory_class="terminator"
FT   CDS_pept        19563..20471
FT                   /transl_table=11
FT                   /gene="lin0959"
FT                   /note="similar to proteases"
FT                   /db_xref="GOA:Q92D61"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D61"
FT                   /protein_id="CAC96190.1"
FT                   /translation="MEIIATADSISQAEQLLRAGVDRLYIGNSQFGLRLPHSFSVEELR
FT                   EIVHLAHQEKKKVTVAVNSLMHNEHMEELPTFLDQLAEMEVDAVACGDPGAIMLLGEMA
FT                   RPIPFIYDAQTFVTSAEQISFWEKQGAVGAVLARELTEDEIKAIAKSLTIPVEVLVYGP
FT                   TCIHQSKRKLVTNYQRIVEMEDDTSKERGLYLREPNDETSQLPIYEDESGTHIFASEDV
FT                   SLVPYLADLYEAGLNTWKLDGVLADSDNFVQIATLFVEAKEAVINGQFVAEYFVNKLTE
FT                   LQPKTRKLDAGFYLKNPDDVK"
FT   regulatory      20470..20475
FT                   /gene="lin0960"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        20485..21711
FT                   /transl_table=11
FT                   /gene="lin0960"
FT                   /note="similar to proteases"
FT                   /db_xref="GOA:Q92D60"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D60"
FT                   /protein_id="CAC96191.1"
FT                   /translation="MSKVLKKPEVLAPAGNLEKLKIAIRYGADAVYIGGQAFGLRSRAG
FT                   NFSFDEMKEGIAFAHERNAKVYVAANMVAHAGDTEGAGEFFRTLRDIGIDAVIVSDPAL
FT                   ISICFQDAPGLPVHLSTQASATNYKTLEFWKKQGLERVVLAREVSMQEIQEIGEKTDVE
FT                   MEAFIHGAMCISYSGRCTLSNHMANRDANRGGCAQSCRWKYDLFEIDNGVSKNLVDTDE
FT                   EPFSMSAVDLSMIKYIPDMVDAGVDSLKIEGRMKSIHYVSTVASVYRRAVDAYCADPEN
FT                   YEFDPAWEEELWKVAQRELSTGFFYKEPTEDEQLFGKTRKIPQYAFAAQVLEYDAETKI
FT                   ATLQQRNNFGVGEEIEFYGPGDTGFKQVVEVLWNEDGEEIDRAPNAMMTIKMPVDRPVK
FT                   PFYFMRKKK"
FT   regulatory      21779..21784
FT                   /gene="lemA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21794..22351
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /product="Listeria epitope LemA"
FT                   /db_xref="GOA:Q92D59"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D59"
FT                   /protein_id="CAC96192.1"
FT                   /translation="MIGWIIAIAVVVILVLIYFGLYNSLVKYRNRVDETWAQIDVQLKR
FT                   RFDLIPNLVETVKGYATHEKETLTQVIEARNKMMEVPADNRQGQIEADNMLSGALKSIF
FT                   ALGEAYPDLKANTSFIELQHELTTTENKVAYSRQLYNTTVMTYNTKVQSVPTNIVAKLH
FT                   NFKERDMLSIPEVERVAPKVEF"
FT   regulatory      22359..22364
FT                   /gene="lin0962"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        22374..23288
FT                   /transl_table=11
FT                   /gene="lin0962"
FT                   /note="similar to putative heat shock protein HtpX,
FT                   Listeria epitope LemB"
FT                   /db_xref="GOA:Q92D58"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D58"
FT                   /protein_id="CAC96193.1"
FT                   /translation="MLFEQIAANKRKTVFIILGFFIFVLMVGAAIGIIVWNNYLNGLIL
FT                   AAAIGAVYILIMVMSSSSVVMAMNHAKEVTSKEQAPVLWDTVESMAMVAGIPMPKVYIV
FT                   EDPSPNAFATGISPEKGAVAVTRGLLNKLERYELEGVIAHEISHIRNYDIRLSTIAIAL
FT                   VAVIAILSDLAMRLIFWGSLTGGRNSRKSDNNNGGGAQIIIYVVALIFVILAPIIATAI
FT                   QFALSRNREYLADASAVELTRNPDGLIQALQKISGDTKKMEEVSASSESIYFSSPLKSK
FT                   KDKPGLFDSHPPISSRIERLENM"
FT   regulatory      23296..23320
FT                   /gene="lin0962"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(23296..23320)
FT                   /gene="lin0963"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(23329..24147)
FT                   /transl_table=11
FT                   /gene="lin0963"
FT                   /note="similar to B. subtilis YjbH protein"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D57"
FT                   /protein_id="CAC96194.1"
FT                   /translation="MINQNLYYQSVANSKPIEIYLFFDPACDDCWNIEANMLRLQMEYG
FT                   NYFKLRYVLHNNLQTFVCKQKRAGNSNLSLKEQQIGAHLSYISCLAVKAAELQGKKQGI
FT                   TFLRKIQEAYFLENKDIASEEVLYEIAISTGLDLTEFKKDLASTAAKRAYIGDQKVAQE
FT                   MEIRENPTVVFFNKNIEDAGLKLSGLHRYEVYVHVLSELLNDFPEPEERPQMEEYLAKV
FT                   KVTSSASMAAFYGVSEQQIDRQMKKWRLQQKVELIDAPDGKPHWKYIGSL"
FT   regulatory      complement(24154..24159)
FT                   /gene="lin0963"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(24393..24977)
FT                   /transl_table=11
FT                   /gene="lin0964"
FT                   /note="similar to B. subtilis YjbK protein"
FT                   /db_xref="InterPro:IPR009195"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D56"
FT                   /protein_id="CAC96195.1"
FT                   /translation="MVKELEIEFRNLLTKEEYDRLIEDFRIKEDDFFEQTNFYLDTADF
FT                   GLKERNSALRIRKLETQYQLTLKTPEARGLMETTQILAADQATAITDGANIPVGPVRDT
FT                   LKEIGINHEDLQVFGSLKTIRAEKDYKKGLLVFDKNFYGSISDFDLEYEVSDYDKGKEI
FT                   FDKLLKEYQITNHPAENKVARFYNHVYKNND"
FT   CDS_pept        complement(24994..25461)
FT                   /transl_table=11
FT                   /gene="lin0965"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D55"
FT                   /protein_id="CAC96196.1"
FT                   /translation="MILTLLQNGDYETARLKALAELKNAPENAELNYFAAWAHDALGKE
FT                   DAAIPFYEKALELGLPDTDKKEAYIGLGSTYRITGSPEKAVLLFQKAIEEFPENNALRT
FT                   FFIMAKYNQGKEKEALQEALLLLTNTTNDKDILSYKKAIQFYAQDLDALFH"
FT   regulatory      complement(25468..25473)
FT                   /gene="lin0965"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      25608..25613
FT                   /gene="lin0966"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        25620..26288
FT                   /transl_table=11
FT                   /gene="lin0966"
FT                   /note="similar to B. subtilis YjbM protein"
FT                   /db_xref="GOA:Q7AP16"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP16"
FT                   /protein_id="CAC96197.1"
FT                   /translation="MNHWEDFLAPYKQAVEELKIKLKGMRSQFELENNHSPIEFVTGRV
FT                   KPVASILDKANQKHIALDHLVEEMQDIAGLRMMCQFVDDIEVVVRLLRQRNDFRIVEER
FT                   DYITNKKPSGYRSYHVVIEYPVETIQGEKKILAEIQIRTLAMNFWATIEHSVNYKYQGE
FT                   FPEAINKRLKRAAEAAFQLDEEMSQIREEIQEAQVYFSQNKDVSKDKKAVHQVMPKKNK
FT                   "
FT   regulatory      26303..26308
FT                   /gene="lin0967"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        26320..27114
FT                   /transl_table=11
FT                   /gene="lin0967"
FT                   /note="similar to conserved hypothetical proteins like to
FT                   B. subtilis YjbN protein"
FT                   /db_xref="GOA:Q92D53"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D53"
FT                   /protein_id="CAC96198.1"
FT                   /translation="MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDEIEPEIVISIGGD
FT                   GTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLK
FT                   TTVKYGIGKKEAEYLALNESTVKSSGGPFVVDVVINDLHFERFRGDGLCMSTPSGTTAY
FT                   NKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVD
FT                   HLSILHRDVQEIRYEVSAKKVHFARFRSFPFWRRVHDSFIED"
FT   regulatory      27121..27126
FT                   /gene="lin0968"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        27133..28023
FT                   /transl_table=11
FT                   /gene="lin0968"
FT                   /note="similar to ribosomal large subunit pseudouridine
FT                   synthetase"
FT                   /db_xref="GOA:Q92D52"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D52"
FT                   /protein_id="CAC96199.1"
FT                   /translation="MFLEWQVKNEEDGLLLRTFLKSKHISKQLLTAVKFGADGKIEVNN
FT                   EEQNVLYHVKTDDKVRLTFPTEQQNDRLLAEHTDLEVVFEDDFLLIINKPAGMASIPSQ
FT                   YHPTGSVANFVKGHYENQGLTSAIHIVTRLDRETSGLMLIAKNRYAHARLSSFLQQGLL
FT                   KRRYQAFTSGTLEEEAGSIEAPIGRKDVSIMERFVTPEGKYAKTNYEVLMRYNGFDHLA
FT                   IQLETGRTHQIRVHFSYIGHPLIGDDMYGGDQELLKRQALHSCHLHLVHPVTEEYMAFD
FT                   LPLPEDMEQIIQKSK"
FT   regulatory      28088..28093
FT                   /gene="lin0969"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28101..28889
FT                   /transl_table=11
FT                   /gene="lin0969"
FT                   /note="similar to enoyl- acyl-carrier protein reductase"
FT                   /db_xref="GOA:Q92D51"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D51"
FT                   /protein_id="CAC96200.1"
FT                   /translation="MNLSLEGKTYVVMGVANKRSIAWAIARSLNEAGAKLVFTYADDRA
FT                   KKSITELVPSLNEINQDPLILACDVTSEDAITATFETIKDKAGKLSGLAHCIAFANKDY
FT                   LTGDYLEVDRKSFLQAHEISAYSFTAVARALKHLDMLTEDASLLTLTYLGGERVVENYN
FT                   IMGVAKASLDASVRYLAMDLGAIGVRVNAISAGPIRTVSARGVSGFSDSISLVEERAPL
FT                   KRATQAEEVGDTAYYLFSNLSRGVTGEVIHVDSGYHIIGF"
FT   regulatory      28902..28931
FT                   /gene="lin0969"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(28907..28936)
FT                   /gene="dltD"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(28921..30195)
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /product="DltD protein for D-alanine esterification of
FT                   lipoteichoic acid and wall teichoic acid"
FT                   /db_xref="GOA:Q92D50"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="InterPro:IPR023896"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D50"
FT                   /protein_id="CAC96201.1"
FT                   /translation="MKKKLWMTFGPLLVAFAVFLFVLFGPSSLFSYVSSETVEKSATSM
FT                   NEYVIQGLDIQKEALKEGNYLPIYGSSELSRVDPFHPSVVSKKYDQGYTPFLLGRPGTQ
FT                   SLSHFLDVNALGDDLRGKKVAVVLSPQWFQPKGVSDPSFGANFSPLHAYKFALEDAKNT
FT                   PERRYAAKRLLSFQVVQSDSTLKKLLENIVAKGPKKPHDPKLVKLAGNVELKILERKDD
FT                   LESKTVSGSKQDRIEKGLKDLPEKLDYKQLDDLAKETGEKSIGDNPFQVKEKYYQKKIK
FT                   PIEGKLKDSRKDLRYDESPEFGDLQLLMDAFKKAGADVIFINPPINGKWIDYIGMNKQG
FT                   LDGYYAKTKQQIESQGFRYYSLEQYQNDSFFLEDPIHLSWRGWVKIDQVLADFVKAPVQ
FT                   TNYTPTVDDYYIKSHPDNGPKKIQK"
FT   CDS_pept        complement(30195..30431)
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /product="D-alanyl carrier protein"
FT                   /db_xref="GOA:Q92D49"
FT                   /db_xref="InterPro:IPR003230"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D49"
FT                   /protein_id="CAC96202.1"
FT                   /translation="MAFRENVLEILEEITETDEVVQNTNIKLFDEGLLDSMATVQLLIE
FT                   IESRLDITVPVSEFDRDEWATPEMIITQLEALK"
FT   regulatory      complement(30206..30211)
FT                   /gene="dltD"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(30440..30445)
FT                   /gene="dltC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(30456..31640)
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /product="DltB protein for D-alanine esterification of
FT                   lipoteichoic acid and wall teichoic acid"
FT                   /db_xref="GOA:Q92D48"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024024"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D48"
FT                   /protein_id="CAC96203.1"
FT                   /translation="MSTPYGTILYFGVLLLFFIPIIVAGLLGKRLPIYNAFVTLVFLYF
FT                   LFAANPVQGVTFIFFVFWQLALVRLYFHYRQEKKQNHGGVFVIAVILSILPLVISKVVP
FT                   ILGDQVTMVGFLGISYLTFKATQMIIEIRDNLIKQYNAWDFVNFLLFFPTISSGPIDRF
FT                   RRFKKDVDNPPSKEAYVALLNRGIFLIFLGFLYKFIIAYLVNKHFVVPLDIAITHNVDT
FT                   TTSLIGYMYAYSMYLFFDFAGYSAFAVGVSYLLGVQTPMNFNKPFAARNIKEFWNRWHM
FT                   TLSFWFRDYVFMRFVLWLTKKKWFKSKFTIAYIAYFVNFFIMGVWHGLHWYYIVYGLYQ
FT                   ATLIVGFDLIERFNKKHKFYPKNKITYVIGVIITFQFVCFGFLIFSGILDKINF"
FT   CDS_pept        complement(31637..33169)
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /product="D-alanine-activating enzyme (dae),
FT                   D-alanine-D-alanyl carrier protein ligase (dcl)"
FT                   /db_xref="GOA:Q92D47"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010072"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D47"
FT                   /protein_id="CAC96204.1"
FT                   /translation="MTTSIIERIDAWAEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFL
FT                   LNTLNSDKEKPIIVYGHMSPLMLIAFLGTIKSGRAYVPVDVSMPVERIEQIKKAADPAL
FT                   FICTEELPSNLTITGCPVLTQDQLMDALEKHFEEVPDPAECVKNDDNYYIIYTSGSTGN
FT                   PKGVQISQNNLVSFSNWILQDFSLRQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLD
FT                   KTITANMKDLYREIPAQNFDVWVSTPSFADLCLLDDNFNQENNPNLTRFLFCGEVLAKK
FT                   TASELLDRFPDAVIYNTYGPTEATVAVTQVKVTRELIDAYPSLPLGVIKPDMRLHIVDQ
FT                   ETGEILPEGEKGEIILIGASVSKGYLNEPEKTDQVFFDYKGYQAYHTGDSGVIKDGYLF
FT                   FQGRLDFQIKLHGYRIELEDIENNLKKVSYIQNCAIIPKMKDEKVDMLVAQVIPSSHDF
FT                   EKEYQLSAAIKNELKEFMPAYMIPRKWIYKTEFPLTMNGKIDRKALNSEVNK"
FT   regulatory      complement(31648..31653)
FT                   /gene="dltB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        33561..34235
FT                   /transl_table=11
FT                   /gene="lin0974"
FT                   /note="similar to ribose 5-phosphate isomerase"
FT                   /db_xref="GOA:Q92D46"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D46"
FT                   /protein_id="CAC96205.1"
FT                   /translation="MINQKKIAGEKACEWIEDGMVVGLGTGSTVYYTIEKLGEMVQKGL
FT                   NITGVSTSIETEQQARTLGIPLKSLNDVTKIDVTIDGADEINQAFQGIKGGGGALLREK
FT                   MVAQASSKNIWVVGEEKLVTELGKFPLPLEVIPFGWKQIKRMLENDGVETTLRKQSSGE
FT                   IYETNNGNYILDIINQTFTNPEAWHEKLAGIPGVLEHGLFLHYVDIIICGKASGEIEII
FT                   KK"
FT   regulatory      complement(34233..34264)
FT                   /gene="lin0975"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(34271..34708)
FT                   /transl_table=11
FT                   /gene="lin0975"
FT                   /note="similar to B. subtilis YjcF protein"
FT                   /db_xref="GOA:Q92D45"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D45"
FT                   /protein_id="CAC96206.1"
FT                   /translation="MTVKKVTDELGKQAALKIRNDVFVVEQNVDPALEWDEFDEMASVD
FT                   MFVDYAEDGTALATGRFRVKDGYGKVERICTQKIARGSGSGRRIMEAIELEAKTRGLTT
FT                   LKLGAQLTAIPFYEKLGYETCSDVFLDAGIKHKEMKKTLTY"
FT   CDS_pept        complement(34725..35474)
FT                   /transl_table=11
FT                   /gene="lin0976"
FT                   /note="similar to B. subtilis YjcH protein"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D44"
FT                   /protein_id="CAC96207.1"
FT                   /translation="MTAHKMLDEKFYSKLLGEELDLIICLPPDFSPLYKYPLFIVQDGK
FT                   DYFQFGKLARHSEELAVNEQIQKAIFIGIPYKTVMDRREKYHPDGEQNEAYIRFLAFEL
FT                   VPYLEERFPSFQMPTSRFLMGDSLGASVSLKAALLFPFTFGNVILHSPYVDDAILTLAE
FT                   KADPAKVKIYHIIGDQETAVETTGDEILDFLSPNKSLEQILTSRGFDYYFRVFNGDHRW
FT                   KYWQPFIKESLQFMLPVNTFDLESMRA"
FT   regulatory      complement(35483..35488)
FT                   /gene="lin0976"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      35681..35686
FT                   /gene="lin0977"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        35693..36712
FT                   /transl_table=11
FT                   /gene="lin0977"
FT                   /note="similar to branched-chain amino acid
FT                   aminotransferase"
FT                   /db_xref="GOA:Q92D43"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D43"
FT                   /protein_id="CAC96208.1"
FT                   /translation="MSKDIDWSNLGFSYIKTDKRYISHWKDGAWDEGTLTEDNTLHISE
FT                   GSTALHYGQQCFEGLKAYRCKDGSINLFRPDRNAARIQKSCERLLMPHIPTEKFIDACM
FT                   QVVRANEEFVPPYGTGATLYLRPFVIGVGDNIGVHAAPEYIFSVFCSPVGPYFKGGMAP
FT                   TNFIVSDFDRAAPNGTGAAKVGGNYAASLLPGQNAKDRNFGDCIYLDPATHTKIEEVGS
FT                   ANFFGITKDDKFITPYSPSILPSITKYSLLYLAEHRLGLKAEEGDVFIDKLDEFKEAGA
FT                   CGTAAVITPIGGIQTKDDFHVFYSETEVGPVTKRLFDELCGIQFGDVEAPEGWIYKVK"
FT   regulatory      36720..36738
FT                   /gene="lin0977"
FT                   /regulatory_class="terminator"
FT   regulatory      36893..36898
FT                   /gene="lin0978"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        36906..37670
FT                   /transl_table=11
FT                   /gene="lin0978"
FT                   /note="similar to daunorubicin resistance ATP-binding
FT                   proteins "
FT                   /db_xref="GOA:Q92D42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D42"
FT                   /protein_id="CAC96209.1"
FT                   /translation="MNEWMIEASGLRKSFKKTEVLKGVDFGVRRGEIFALLGSNGAGKT
FT                   TTIQILTTLLKADNGKASVAGLDVTKEPEKVREHISLTGQFAAVDGLLTGRENILLIAK
FT                   LRGEKNPDQTAKDLLARFGLEKASDRRADTYSGGMMRRLDIAMSLVGSPDVIFLDEPTT
FT                   GLDPEGRIEVWKTIKALSDGGTTILLTTQYLDEAEQLADRIAILHGGTIIANGTLEELK
FT                   KLFPPAEIEYVEKQPSLEEIFLAIINGKEGVK"
FT   regulatory      37654..37659
FT                   /gene="lin0979"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        37667..38419
FT                   /transl_table=11
FT                   /gene="lin0979"
FT                   /note="similar to ABC transporter transmembrane component"
FT                   /db_xref="GOA:Q92D41"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D41"
FT                   /protein_id="CAC96210.1"
FT                   /translation="MKAIRDTRILFGRSMRHILRSPDTIITVAIIPIMIMLMFVYVLGG
FT                   AIQTGTDNYVDYLLPGIILMAIASGIAYTAVRLFTDVQKGLFQRFHSMPISRSSVLWGH
FT                   VLTSLVSNAISVVLIILVALLIGFRSSAGILEWLAVAGILLLFTLALTWVAVIPGLTAK
FT                   SVDGASAFSYPLIFLPFISSAFVPTDTMPTAVRVFAENQPVTSIVNTIRALLYSGSVGN
FT                   EIWIALAWCVGITVVAYIFAVLKYKKTI"
FT   regulatory      38427..38450
FT                   /gene="lin0979"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(38427..38450)
FT                   /gene="lin0980"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(38456..39931)
FT                   /transl_table=11
FT                   /gene="lin0980"
FT                   /note="similar to efflux transporter"
FT                   /db_xref="GOA:Q92D40"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D40"
FT                   /protein_id="CAC96211.1"
FT                   /translation="MEQTKVKAVTIAVFVATFMAAIEGTIVSTAMPTIVSQLDGIELMN
FT                   WIFSVYLLTSAVTVPIYGKLSDLYGRKNIFVIATIIFIIGSSLCGFAQNMEQLIIFRAI
FT                   QGIGAGGILPSTMTIIADVYPFEKRAKVLGFMGSAWGIAGVFGPLVGGFLVDQLSWHWI
FT                   FFINVPIGLLTILLILLYLREEVERVKLPIDYLGASLFTVALLGLLFALQRAGESLNWT
FT                   EPLVVILFAVSILLFVAFYFVEKRAKDPIMPFVLFKNPVVLIGNLIGFLISAFLIGINV
FT                   YIPMWAQGMLGHGATIAGFMLAPLSVTWIIGSFIGGKLLMTLGNRHTVGIGVLITAASG
FT                   LILALFPASTNDIFFYLNSAFMGFGFGIIFTTTTVTVQDAVPRFQTGIATASNTLFRTV
FT                   GQTIGVAVFGTIFNSVLTTQFRAAAGSEVNRSNLNQLISPQTSGNVNPDLVEPLRDILY
FT                   SGLHMVFWVMFACCIVSYFIHFILPKKHISGEN"
FT   regulatory      complement(39939..39944)
FT                   /gene="lin0980"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      40058..40063
FT                   /gene="lin0981"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        40071..41123
FT                   /transl_table=11
FT                   /gene="lin0981"
FT                   /note="similar to glucanase and peptidase"
FT                   /db_xref="GOA:Q92D39"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D39"
FT                   /protein_id="CAC96212.1"
FT                   /translation="MSYEPNTTQTMQKIKELTSIPSPTGNTGQIIEKLVRDLEASNIPY
FT                   KLNNKGGLIVTLPGKDDSKHRMLTAHVDTLGAMVKEIKADGRLLLTLIGGYRFNAIEGE
FT                   YCTIETSEGDLYSGTILMHQTSVHVYKDAGTAERNDKNMEVRLDVKALDADKVRALGIE
FT                   VGDFVSFDPRVQIINDEYIKSRHLDDKASVAILLQLINHIHENKLELPHTTHFLISNNE
FT                   EIGYGGNSNIPAETVEYLAVDMGALGDGQTSDEYTVSICAKDGSGPYHLGLRKHLVELA
FT                   KKNNIDYKVDIYPFYASDASAAINSGNDIVHGLIGPGIDASHAYERTHRDSLYHTEKLV
FT                   YAYLFSNILK"
FT   regulatory      41122..41127
FT                   /gene="lin0982"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41136..41612
FT                   /transl_table=11
FT                   /gene="lin0982"
FT                   /note="similar to glutathione peroxidase"
FT                   /db_xref="GOA:Q92D38"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D38"
FT                   /protein_id="CAC96213.1"
FT                   /translation="MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLE
FT                   KMYKKLGGDNFEILGFPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDAAP
FT                   LYKYLTEQTGGKKVEWNFAKFLIDENGEVVERFPSKMKPEDFEDKVEALVAAVK"
FT   regulatory      41622..41648
FT                   /gene="lin0982"
FT                   /regulatory_class="terminator"
FT   regulatory      41736..41741
FT                   /gene="lin0983"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41749..42204
FT                   /transl_table=11
FT                   /gene="lin0983"
FT                   /note="weakly similar to two-component response regulator"
FT                   /db_xref="GOA:Q92D37"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D37"
FT                   /protein_id="CAC96214.1"
FT                   /translation="MNFHVKQNNNLAIGEVDIYCHPNNLEEVTKIVMGLEEQTEKISVK
FT                   KDGVTYLLAKRKILYFEAVESKIFVYTEKDVYETTWKLYELEEKFKDSSFFRCSKSMIL
FT                   NIEWIEKIAPGFHGKFEASLFNREKVIISRQYAKILKQKLNLGGKGK"
FT   regulatory      42186..42191
FT                   /gene="lin0984"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        42201..42629
FT                   /transl_table=11
FT                   /gene="lin0984"
FT                   /db_xref="GOA:Q92D36"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D36"
FT                   /protein_id="CAC96215.1"
FT                   /translation="MSTKLIQFIQSACIIFTAAIITMICSYISTGESETVAIRDIFTML
FT                   GFSVITTFVQQLLFNNSIKTKFAFYIRLIVFFFFISAAILGLGWLFDWYHSLTGFMIIF
FT                   GFICVTFLVMHLFFSFRDAKFSNEINQKLAEMRERETK"
FT   regulatory      42615..42620
FT                   /gene="lin0985"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        42626..43537
FT                   /transl_table=11
FT                   /gene="lin0985"
FT                   /note="similar to antibiotic ABC transporter, ATP-binding
FT                   protein,"
FT                   /db_xref="GOA:Q92D35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D35"
FT                   /protein_id="CAC96216.1"
FT                   /translation="MIKLTNVVKTFGKVEAVKGINLEVEKGSLFAFLGENGAGKSTTLS
FT                   MICTESEPTSGEIFIDDEKLTFKNRKNFRQKLGVVFQENVLDDLLTVRENLYNRASLYG
FT                   KTKAEITERLELVSSIMGIEDILNRRFEKLSGGQKRRAEIARAIMHDPEILLLDEPTTG
FT                   LDPKTRVSVWKIIDYLREEFGMTVFLTTHYLEEAKDADQLAVIHKGNIIAQGTPANIRS
FT                   RFSVDKIFFYDANVEELQVIIEKANLPYKVSKGTIRVDVIDENIGILAILNQAAGLYSS
FT                   FEVIKGNLDDAFISMIKEDSND"
FT   regulatory      43518..43523
FT                   /gene="lin0986"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        43530..44384
FT                   /transl_table=11
FT                   /gene="lin0986"
FT                   /note="similar to Streptococcus agalactiae CylB protein"
FT                   /db_xref="GOA:Q92D34"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D34"
FT                   /protein_id="CAC96217.1"
FT                   /translation="MISRNLKIYFRDRTAVFMSLLTILIIIGLYAIFLGNNMEEMFKQA
FT                   SGKTIGIQELVNTWVIAGILSITPVTVSLAVFSLKVHDEEQSIARSFAITPASRWRIVA
FT                   SYIVSGLVASFVLSVITLFVGEMYIWLTGGAFLPLESWVSLIGIILINVLCCSSIMFFI
FT                   ASLVKKASAFSSVSTIVGTVIGFIAGIYLPIGSLPAAVQTAMKCFPFTYGASTIREIMT
FT                   KEPLQQVFAGNTQAMDATKEMIGITIYWGDKTVTTGVSLLILSVFAVLFGILSVVLMKR
FT                   QTK"
FT   regulatory      44451..44456
FT                   /gene="lin0987"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        44466..46034
FT                   /transl_table=11
FT                   /gene="lin0987"
FT                   /note="similar to peptide chain release factor 3 (RF-3)"
FT                   /db_xref="GOA:Q92D33"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D33"
FT                   /protein_id="CAC96218.1"
FT                   /translation="MSQDLQKEVASRKTFAIISHPDAGKTTITEQLLLFGGVIRSAGTV
FT                   KGKKSGKFATSDWMEIEKQRGISVTSSVMQFDYNGSRINILDTPGHSDFSEDTYRTLMA
FT                   VDSAVMVIDAAKGIEAQTLKLFKVCRMRGIPIFTFINKMDRQGKMPLELLAELEEVLGI
FT                   ESYPMNWPIGMGKELAGIYDRYHRVIEQYRSEEDERFLPLGEDGDLKEVHAIQKSLYYD
FT                   QALEEIMLLDEAGNDFSRERIIAGEQTPVFFGSALTNFGVETFLRTFVDFAPSPSSHES
FT                   NEGVIEADNPKFSGFIFKIQANMNPAHRDRIAFIRICSGEFERGMNVTLTRTGKSMKLA
FT                   NSTQFMADDRETVNRAVAGDIIGLYDTGNYQIGDTITNGSKKLEFEKLPQFTPELFMRV
FT                   YAKNVMKQKHFHKGVEQLVQEGAIQLFKTWRTEEYIIGAVGQLQFEVFEHRMRGEYNSE
FT                   IRMEPIGKKIARWVKEEDADEKLSTARSMLVKDRFDQPLFLFENEFAINWFNDKNPDIE
FT                   LTSLL"
FT   regulatory      46041..46070
FT                   /gene="lin0987"
FT                   /regulatory_class="terminator"
FT   regulatory      46131..46136
FT                   /gene="lin0988"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        46144..46569
FT                   /transl_table=11
FT                   /gene="lin0988"
FT                   /note="similar to regulatory proteins (MarR family)"
FT                   /db_xref="GOA:Q92D32"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D32"
FT                   /protein_id="CAC96219.1"
FT                   /translation="MRREKTMDTLIRSIMIKSKRKMDAKVAQFGLTTQQARVLGFLNDN
FT                   AANEIIQKDLQRIFQTRGASITSLIQGLEKKQLISRKPSLRDGREKVVTLTKEGKDIVD
FT                   EFNASFPREDDKAKKILSADEYKTFIELLSKIDDQTD"
FT   CDS_pept        46622..47983
FT                   /transl_table=11
FT                   /gene="lin0989"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D31"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D31"
FT                   /protein_id="CAC96220.1"
FT                   /translation="MKHSDNYYLTKASIPKAIAHLSIPMMLGMSVGVIYNIINAFFIGL
FT                   LHDTSMLTAVTLGLPMFTILMAIGNMFGVGGGTYISRLLGKEDGIKAKQVSAFVLYGSL
FT                   VLGIICAIILGFLINPVTHFLGADATSFLHTKNYTLALLICSPFIIANFALEQVVRAEG
FT                   ASRISMNGMLIGTLVNLVFDPLLILYFNFNVVGAAVSIGIASTVSLIYYAWYLEKKSDY
FT                   LSIRFKWFKATKEIVQNVFKIGVSELLLSLFLIVTTLVLNHYSMIYGEGVVAGFGVALR
FT                   VVQLPEFICMGLYMGIIPLLAYNFSAGNIARFEKAIRFTAVSIGLIVLVISSFVFIFRF
FT                   QVMHLFSDSQSVISLGVHIMVAMLISSLFSGFTGLFTSTFQAIGKAIPATIMSVSQGII
FT                   FIPVIILGQHYFGLMGVIWSLTTTEILTCLIGVILFTIHNIKIASSAKTKDLAV"
FT   regulatory      48248..48253
FT                   /gene="lin0990"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        48264..49031
FT                   /transl_table=11
FT                   /gene="lin0990"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D30"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR013055"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D30"
FT                   /protein_id="CAC96221.1"
FT                   /translation="MDTAMILEYGWVLLVLIGLEGILAADNAVVMAVMVKHLPDKQQKK
FT                   ALFYGLMGAFVFRFGALFLISFLANVWQVQALGAAYLLYIAISHIWKHAKGKDGEKEKK
FT                   EKAGSGFWMTVLKVEIADIAFAIDSMLAAVALAITLPETGWGHIGGIDTGQFAIMFLGG
FT                   LVGLIIIRFAATQFVKLLKSYPSLETAAFLIVGWVGVKLVIYTLAHPSLGVIPHSFPES
FT                   TLWKLIFWGVMILIILWGWFVSYRSKKKTETTK"
FT   regulatory      49119..49124
FT                   /gene="lin0991"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        49136..49903
FT                   /transl_table=11
FT                   /gene="lin0991"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D29"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D29"
FT                   /protein_id="CAC96222.1"
FT                   /translation="MDVSIWGEYALVFLVLVVLEGILSADNAVVMAVIVKGLPHDKQRK
FT                   ALFYGLVGAFVFRFVALFLISFLVKIWEIQAIGAVYLLYLAIKHMWRLKKGKQEEVKEA
FT                   SEAKSTSFWGVVARVELTDIAFALDSMLAAAALVVTLPDLGNFDIGGMNGGQFIVMFLG
FT                   GIAGLVVIRFAATQVVKLLERYPTLETAAFLIVGWVGVKMAVLTLAHPSVAIIPEDFPD
FT                   SAVWKLTFWSVMIIIGLGGYIIARKKEKKTKRV"
FT   CDS_pept        49944..51281
FT                   /transl_table=11
FT                   /gene="lin0992"
FT                   /note="similar to Na+-transporting ATP synthase subunit J"
FT                   /db_xref="GOA:Q92D28"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D28"
FT                   /protein_id="CAC96223.1"
FT                   /translation="MLARMTPVQVIIAYYFIAVTISTIVLSLPFTLQKGVKVSFIDTLF
FT                   TAASSVSVTGLATVDVSQTYSTAGIWVLMAIFQIGGLGVMMISTFFYLILKRRIGLKQR
FT                   QLIMTDTNQFTMSGMVRMLREILVLIFGIELVGALILGIYFIPLYPNFWEAMFQGLYNS
FT                   VSLVTNAGVDITGKSLIPFANDYFVQFISILLIIAGAIGFPVLLETRRFLFEKNTLIPF
FT                   RFSLFVKVTTLTYFVLLIVGGLLIWLFEYNHFFSGKSWDFGFFNSMFLSATSRSAGLQT
FT                   MDSGALSVSTLLLVSFLMFIGASPSSVGGGIRTTTFAITILFIYSVIRGRKHVYIFGRE
FT                   LHQEDVRKSLAVTLVAGFLSISAIVILMQTETASLISVIFEVFSAFGTSGLSVGLTPDL
FT                   STPGKLIIIVLMFIGRVGIMYSMLSLRNKNQPKNAIRLPKEKIITG"
FT   regulatory      51290..51314
FT                   /gene="lin0992"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(51333..51355)
FT                   /gene="lin0993"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(51363..51731)
FT                   /transl_table=11
FT                   /gene="lin0993"
FT                   /db_xref="GOA:Q92D27"
FT                   /db_xref="InterPro:IPR025273"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D27"
FT                   /protein_id="CAC96224.1"
FT                   /translation="MGSRKPEVIIGLIGSIIGIVVGFWIINYGDSVTDYIQTFTYLPGE
FT                   LGNELANLGWITLIASVVALIASLLIKSAPRGWGVILVVIGIVLFFVIGTAWIVSGILI
FT                   TLTGLMGIFRRPIPKSKY"
FT   regulatory      complement(51739..51744)
FT                   /gene="lin0993"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(51761..52792)
FT                   /transl_table=11
FT                   /gene="lin0994"
FT                   /note="similar to B. subtilis YkrP protein"
FT                   /db_xref="GOA:Q92D26"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D26"
FT                   /protein_id="CAC96225.1"
FT                   /translation="MEQTEIKRESYFDNAKFILIFLVVFGHFLQTFITEYAGVRVLYIY
FT                   IYTFHMPAFILISGFFAKSFGKPGYLKKTMKKLILPYVFFQLIYSIFYYFLLNKENLSI
FT                   KFLDPEWSLWFLLSLFFWNLMLLVFSKIKPWKSVSIALLLGLVAGYFDIIGGYLSLSRT
FT                   LVFFPFFLVGYFLKKEHFYFLKTHIASIVGGIFVVLLLIFITMHPNLNDKWFLGSKPYA
FT                   NFVEVKSLGLFIRALVYMISFCSIAAFFSFIPQKRLFFTKWGKNTLYVYLLHGFFIKFF
FT                   REGGQTDFQYSPSTFLLLFGITFGLTVLLSSRLVKTVVQPVIELRASMLYNVFSRLTKR
FT                   ESY"
FT   regulatory      complement(52800..52805)
FT                   /gene="lin0994"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      52966..52971
FT                   /gene="lin0995"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52980..53459
FT                   /transl_table=11
FT                   /gene="lin0995"
FT                   /note="similar to methylated-DNA-protein-cystein
FT                   methyltransferase "
FT                   /db_xref="GOA:Q92D25"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D25"
FT                   /protein_id="CAC96226.1"
FT                   /translation="MLKQTSDSPVGTLFIIIEDAHITKISYDEPTNWEILAGEKGEIAI
FT                   YQQLLEQLAGYFEGEREVFDLPIFLQGTPFQQRVWQALSEIPYGVVVSYKDIAIAAGSP
FT                   KAVQAVGQANRANPIPILIPCHRCVKSDGALGGYNGADIDKKQYLLALEKGLRLS"
FT   regulatory      complement(53442..53467)
FT                   /gene="clpE"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(53475..55649)
FT                   /transl_table=11
FT                   /gene="clpE"
FT                   /product="ATP-dependent protease  "
FT                   /db_xref="GOA:Q92D24"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D24"
FT                   /protein_id="CAC96227.1"
FT                   /translation="MNCEKCNQNQATIQLYMNINGKRVEMPLCASCYAEVRNQANFGAN
FT                   EFPGAGGSPFDDIFRQLSGAANQASREQQSQRNAQVQTQTGGAGNGLLDEFGTNLTDMA
FT                   KNDQLDPVIGRDKEIKRVIEILNRRNKNNPVLIGEPGVGKTAVVEGLANAIVAGEVPSK
FT                   LMNKEVILLDVASLVSGTGIRGQFEERMKQLIKELQERKNTILFIDEVHTIVGAGSAEG
FT                   SMDAGNILKPALARGDLQMIGATTLKEYRTIEKDAALERRFQPVTVNEPSNEETLTILN
FT                   GLKSKYEDFHEVVYSPEALKAAVELSSRYIQDRHLPDKAIDLMDEVGSKYNLSIEKLDE
FT                   NTVSERVARLEEEKNQALQMEDYEKAAKVRDEITRLEENKTSNSFSERPVIQSSDIQAI
FT                   IEEKTGIPVGRLQEDEQSKMKNLESNLTGKVIGQDDAVKKVAKAIRRSRVGLKAKNRPI
FT                   GSFLFVGPTGVGKTELGRTLARELFGTSEAMIRLDMSEFMEKHSVSKLIGSPPGYVGHE
FT                   EAGQLTEKVRRNPYSIILLDEIEKAHPDVQHMFLQILEDGRLTDSQGRTVSFKDTVIIM
FT                   TSNAGTTDTEASVGFNTATDNKLEKGSDILAKLGAYFKPEFLNRLDSVIEFKSLEKDDL
FT                   VQIIDLMLVDLNSMLAQEGVTIDVSKEVKEHLIELGYDPKFGARPLRRTIQEHLEDAIA
FT                   DSLIDQPEAKKLNATLNDDKNIVITEQVTV"
FT   regulatory      complement(55780..55800)
FT                   /gene="lin0997"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(55813..56424)
FT                   /transl_table=11
FT                   /gene="lin0997"
FT                   /note="similar to hypothetical protein"
FT                   /db_xref="GOA:Q92D23"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D23"
FT                   /protein_id="CAC96228.1"
FT                   /translation="MKSIKIDYKLVLGLILCALLVILTYQFPRVFWYLYGAGMLFLLSF
FT                   VIFNDDLKKEFSFVKGILPGIFSGIVLYIIFYIGAFIIKVMPGGLEHSVEAAFNKYSTH
FT                   SLVIWLLLIVAIIPGEEIFWRGFVLKRLNHYFNHWFSNIFAALLCMVMMLPSGNFAAII
FT                   GIFVASLVWNVMYSYRPSLLMVYLSHLTFAFLLLAALPIY"
FT   regulatory      complement(56432..56437)
FT                   /gene="lin0997"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      56554..56559
FT                   /gene="lin0998"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        56569..57360
FT                   /transl_table=11
FT                   /gene="lin0998"
FT                   /db_xref="GOA:Q92D22"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D22"
FT                   /protein_id="CAC96229.1"
FT                   /translation="MLEKNYKFLLWVYIFWFLGSVLLVSLHIIPPRLTTIQSLFLVFTG
FT                   VFAAVFFIMQYGKWLGSAITLLIFVVSTCIEWMQLSYTDEYIGSTLGGSLYGIPITMGF
FT                   IWVGMIAGTHIIAREITLKINVDWIRGGIYSFIAATMVMIFEVLIEPITMQSKQLYITQ
FT                   NGFTILQLSDFINWWLLGLILHLMIYFILSLTDSWERLKYPDLKSEIVIVYWIIIAFFV
FT                   FLSFYLDLWTSIAIIIVSNIIFTACYFFSLEKETKTTKKSE"
FT   regulatory      57345..57374
FT                   /gene="lin0998"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(57359..57388)
FT                   /gene="lin0999"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(57373..58839)
FT                   /transl_table=11
FT                   /gene="lin0999"
FT                   /note="similar to phytoene dehydrogenase"
FT                   /db_xref="GOA:Q92D21"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D21"
FT                   /protein_id="CAC96230.1"
FT                   /translation="MESKKKIAIIGAGPGGLATGMLLSQLGYQVSIYEKNDRIGGRTAL
FT                   HKMGKYSFDVGPSALTMTHVLTSLFMDCNRNILDYVSLLPINPIHTLYFKDITFPLYSD
FT                   YSETKTVIKTYFPGEEDGFDRFMRENTKKMLYISPLNQFNYSSLFDFFRPTTIRALPSL
FT                   TLGRSLMDDLARYFNSKYLRIAFSLQMRYLGMSPWDIPAAYSIIPFSEYYFGTFHPIGG
FT                   QNKIVEAMQQVVMENKGKFYFNSEVTSFETNGKEITSATLANGQSIEADYYFTNLDFIY
FT                   SLTSNTKVKEKEKEYSSSAFMLYLGLKTVLPFSHQSIIFPDNYREFANNTIHKKILSKD
FT                   LAIHITNPSATDNTMAPMNHSSVRIMVSAPNTTSGIDWKEQTPAFRQLILDTVKARLEI
FT                   PDLEDYIEEEYIITPTDWEEKYHVKYGAIFGLQHLWHQQGFLHPAKKSPKFKNLFVVGA
FT                   GAMSSSSLPFIIENAQIATKKFLQKEKKSE"
FT   regulatory      complement(58848..58853)
FT                   /gene="lin0999"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(58880..58925)
FT                   /gene="lin1000"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(58943..59212)
FT                   /transl_table=11
FT                   /gene="lin1000"
FT                   /note="similar to B. subtilis protein YkvS"
FT                   /db_xref="InterPro:IPR018690"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D20"
FT                   /protein_id="CAC96231.1"
FT                   /translation="MHTFFFIKINATPKIEGVITMAKAHVGDIIEFKDGLTGIVEKLNE
FT                   NSVIVDLTYMENFKDLGIEEKTVVNHKNYQIIHSVEEDEEETEE"
FT   regulatory      complement(59221..59226)
FT                   /gene="lin1000"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      59506..59511
FT                   /gene="ptsH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        59521..59787
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /product="PTS phosphocarrier protein Hpr (histidine
FT                   containing protein)"
FT                   /db_xref="GOA:P0A439"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A439"
FT                   /protein_id="CAC96232.1"
FT                   /translation="MEQASFVVIDETGIHARPATLLVQAASKYSSDVQIEYTGKKVNLK
FT                   SIMGVMSLGIGKGADITIYTEGSDEKEAIEGLTEVLKKEGLAE"
FT   regulatory      59772..59777
FT                   /gene="lin1002"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        59787..61505
FT                   /transl_table=11
FT                   /gene="lin1002"
FT                   /product="phosphotransferase system enzyme I"
FT                   /db_xref="GOA:Q92D19"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D19"
FT                   /protein_id="CAC96233.1"
FT                   /translation="MAKELKGIAASDGIAIAKAYLLVEPDLSYEKTEVTDVESEVKRFE
FT                   SALEVSRTELSTIREKAAKDLGEDKAQIFDAHLLVLNDPELTGPIEESIKNAKTNAETA
FT                   LQETTDMFIGMFESMDNEYMRERAADIKDVRKRVLSHLLGVTIPNPALIDEEVVVVAAD
FT                   LTPSDTAQLNRKFVKGFVTDIGGRTSHSAIMARSLEIPAVVGTKEVTASVAKNDIVIID
FT                   GLEGNVIIHPTEEQIAHYEKIKSDFALQQAEWEKLKNEKTVSKDGVHVELAANIGTPND
FT                   LEGVISNGGEAVGLYRTEFLYMGRDNFPTEEEQFEAYKAVVSGMDGKSVVVRTLDIGGD
FT                   KTLPYLELPEEMNPFLGFRAIRLCFANEELFRTQLRALLRASVYGNLKIMFPMIATVNE
FT                   FRQARDILLDEKAKLKAAGTEVSDSIELGIMIEIPAAAVLADQFAKEVDFFSIGTNDLI
FT                   QYTMAADRMNERVSYLYQPYNPSILRLVKMVIDASHKEGKWTGMCGEMAGDQTAVPLLL
FT                   GLGLDEFSMSASSILKSRSLIKRLDQSEMVKLAEEALNKSTAEEVVELVEKYTAE"
FT   regulatory      61517..61544
FT                   /gene="lin1002"
FT                   /regulatory_class="terminator"
FT   regulatory      61604..61609
FT                   /gene="lin1003"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        61618..62652
FT                   /transl_table=11
FT                   /gene="lin1003"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D18"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D18"
FT                   /protein_id="CAC96234.1"
FT                   /translation="MVIYSLAGFFLLLFIVLSFIDRRRISNGIVLTLALFFSLLSLIYV
FT                   TLSNGNELFVSIMSTVLILLFLLIPFFIIGLATTLIMNGRLMLKREGRKLANMLPLFIG
FT                   LVIVILFIFWFGSILKNGSPILGMVVVFVMAFVGYFSFLFLSFLLSTFLYQFNFPRYNQ
FT                   DFLIVLGSGLIDGDRVPPLLASRLNRAIAFYEKQYDKKGKRATFIVSGGQGANETVSEA
FT                   RAMRDYLISKGIDENFIIMEDKSVNTLQNMQFSKAKMDAIMPTYNSLFSTNNFHLFRAG
FT                   LYARKAGLKSQGIGAKTALYYMPNALIREFIAITVMYKKVHLILLGLVVLFFVFLAIIG
FT                   ITFR"
FT   regulatory      62651..62656
FT                   /gene="lin1004"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        62665..63525
FT                   /transl_table=11
FT                   /gene="lin1004"
FT                   /note="similar to 3-hydroxyisobutyrate dehydrogenase (B.
FT                   subtilis YkwC protein)"
FT                   /db_xref="GOA:Q92D17"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D17"
FT                   /protein_id="CAC96235.1"
FT                   /translation="MEKIGFVGTGVMGSSMAKHLLEAGYEVHIYTRTKEKAEALLSQGA
FT                   LWESDPGSLGAKVDILISMVGYPKDVEQLYLGENGFLDNLKAGSVAIDMTTSSPALAKK
FT                   IAEAGHEKGIGVLDAPVSGGDIGAKNGTLAIMVGGAEDVFLKVKPIFEILGSSVILQGD
FT                   AGSGQHTKMVNQIAIASNMIGVTEAIIYAERAGLNPSRVLDSISGGAAGSWSLTNLIPR
FT                   VLQDDFSPGFFIKHFIKDMGIALSEAKQMGLELPGLTLAEQMYQTLAEQGLSEEGTQAL
FT                   IKYYR"
FT   regulatory      63534..63558
FT                   /gene="lin1004"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(63534..63558)
FT                   /gene="lin1005"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(63563..64708)
FT                   /transl_table=11
FT                   /gene="lin1005"
FT                   /note="similar to aminotransferases (to B. subtilis PatA
FT                   protein)"
FT                   /db_xref="GOA:Q92D16"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D16"
FT                   /protein_id="CAC96236.1"
FT                   /translation="MTKSIRPELRDIEVSGIRTFNTRVTGIPDMIRLTLGEPDFPTPEH
FT                   VKQAAITAIQENFTNYTPNAGMPELLEAASSYFEEKYDLTYSNKEIIVTVGATEAISVA
FT                   LQTILEPGDEVILPDPIYPGYEPLIKLNKARPVKVDTTESNFKLTPEQLRAHITPKTKA
FT                   LIIPYPSNPTGVSLSKQELRDLAEVLKETGIFVIADEIYSELTYHEEHVSIAPMLRDQT
FT                   IVINGLSKSHAMIGWRIGFLLAPEKITTEMLKIHQYSVTCASSISQKAALEAITNGKDD
FT                   AFQMRTEYKTRANFTQDRLEKMGFTVIPPDGAFYFFVKLPDDITENSFDWAVRLAEEAK
FT                   VAVVPGNAFSEKGDRYFRLSYATSVNNLAEALDRMAQFLAK"
FT   regulatory      64914..64919
FT                   /gene="lin1006"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        64928..65149
FT                   /transl_table=11
FT                   /gene="lin1006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP15"
FT                   /protein_id="CAC96237.1"
FT                   /translation="MTKPGKYEALFFPTKDGLLKIHAYGFNPCGSWGEVFATIGDQTIC
FT                   VKGFNRHKTIVRATKMIISATANRKNEF"
FT   regulatory      65158..65190
FT                   /gene="lin1006"
FT                   /regulatory_class="terminator"
FT   CDS_pept        65462..65695
FT                   /transl_table=11
FT                   /gene="lin1007"
FT                   /note="similar to B. subtilis YkuJ protein"
FT                   /db_xref="InterPro:IPR014904"
FT                   /db_xref="InterPro:IPR038073"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP14"
FT                   /protein_id="CAC96238.1"
FT                   /translation="MSQLLGIIQRLHAMQEDESAETQARRFEKNGTPVCEVKFFQASNS
FT                   FEVEIYGDNSKYQFDDIDMTAIEIFETLQENE"
FT   regulatory      65736..65755
FT                   /gene="lin1007"
FT                   /regulatory_class="terminator"
FT   regulatory      65899..65904
FT                   /gene="lin1008"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        65912..66364
FT                   /transl_table=11
FT                   /gene="lin1008"
FT                   /note="similar to B. subtilis YkuL protein"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D13"
FT                   /protein_id="CAC96239.1"
FT                   /translation="MISNRFGQFIDNELADSMISAEKVAHVQLGNNLEHALLVLTKCGY
FT                   SVIPVLDFEFKLHGLISAAMITDAILGLERIEFERLEDLKVEDVMQTDFPVIKDFNNNE
FT                   RIVRLLVDHPFVCVVDEDHHFEGIVTRRVVLKQVNRYIHLQVEENR"
FT   regulatory      66348..66353
FT                   /gene="lin1009"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        66361..67239
FT                   /transl_table=11
FT                   /gene="lin1009"
FT                   /note="similar to transcription regulator (LysR family)."
FT                   /db_xref="GOA:Q92D12"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D12"
FT                   /protein_id="CAC96240.1"
FT                   /translation="MIVTEYELLVCLAEELNMRKSAEKLFLSQPALSQRLQTIESRWNT
FT                   KIFIRTQKGLLLTPEGEAIVRHASSVIEREHTIQEKLEAMEGVVRGTLRIACASVVAQM
FT                   WLPRVLKAFASAYPNVQISLVTGWSSEVTQQLAAGNVHIGIVRGNSTWKSVQKPLFNDK
FT                   LVLVDTEITKIEEVFQTNRPFIQFRSDSNYYQVIQDYWQRNFGKMPRQAMLMDQMETSR
FT                   QMALNGIGFAILPEVTMLGYTDKINKIPLREKDGSILSRETNLLTYEQSLGLPQVKAFL
FT                   EITDKFLEQVK"
FT   CDS_pept        67287..67997
FT                   /transl_table=11
FT                   /gene="lin1010"
FT                   /note="similar to tetrahydrodipicolinate succinylase"
FT                   /db_xref="GOA:Q92D11"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D11"
FT                   /protein_id="CAC96241.1"
FT                   /translation="MEQMDAHQIISFIQNSKKATPVKVYLKGDLEKIDFPSDVKTFITG
FT                   NAGTIFGEWAVVEPLLEANKANIEDYVIENDRRNSAIPLLDMKNINARIEPGAVIRDQV
FT                   TIGDNAVIMMGASINIGSVIGDGTMIDMNVVLGGRATVGKNCHIGAGSVLAGVVEPPSA
FT                   QPVIVEDNVVVGANVVVLEGVRIGEGAVVAAGAIVTKDVAPGTVVAGIPARELKKLDAK
FT                   TASKTEIMQELRQL"
FT   regulatory      68010..68035
FT                   /gene="lin1010"
FT                   /regulatory_class="terminator"
FT   regulatory      68047..68052
FT                   /gene="lin1011"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        68060..69175
FT                   /transl_table=11
FT                   /gene="lin1011"
FT                   /note="similar to N-acyl-L-amino acid amidohydrolases"
FT                   /db_xref="GOA:Q92D10"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR023905"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D10"
FT                   /protein_id="CAC96242.1"
FT                   /translation="MLNEFIAIRRDLHQIPETGYKELKTQAYLLDYISKLPNEFLEIKK
FT                   WRTGILVLVKGTNPGKTIGYRTDIDALPITEETGLPFESKHAGNMHACGHDLHMSIALG
FT                   VLTHFASKPAKDNLLFVFQPAEEGPGGAKPIMESAEFSEWRPDTIYGLHIAPEYKVGQI
FT                   AIKPGLLFANTSELFISFKGKGGHAAYPHLANDMVVAASAFVGQMQTIISRNIDPMDSA
FT                   VITIGRIHGGEIQNVIAETAFLDGTIRTLSPETMEIVWTRLKQLAKGWEEAYQCEVEFH
FT                   PGSDYYQVDNDPVETEEFIHFLEEQYPESYVPARSAMTGEDFGYFLSEIKGFMFWLGVD
FT                   SEYSLHHAKLSPKEEAIPFAIDVLVNFLESK"
FT   regulatory      69180..69216
FT                   /gene="lin1011"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(69180..69216)
FT                   /gene="lin1012"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(69220..70065)
FT                   /transl_table=11
FT                   /gene="lin1012"
FT                   /note="similar to conserved hypothetical proteins like to
FT                   B. subtilis YkuT protein"
FT                   /db_xref="GOA:Q92D09"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D09"
FT                   /protein_id="CAC96243.1"
FT                   /translation="MNLLKKWFSSIDWDQFWNHIISVGIKIAILIALYFIFRVVGNKII
FT                   RSFFRKYRQQQAVSVGRADTLESLISNFYGYVLFFTFAILLLQNFMDVTAIIASAGVAS
FT                   LAIAFGAQGLVSDVVTGFFILLERQLDVGDTITIGLVNGTVEALGLRTTQVRDFDGTLH
FT                   FIPNRQIMVVSNHSRGNMRVMVDIQISPHEDPEKAIKIIGEVCDVAAKENKNIVEPPVV
FT                   LGVQNIDATNMIIRVVGKAVNGEQYSVQRDLLKDIREALAENEIELPLNFVSTFGPNNN
FT                   "
FT   regulatory      complement(70077..70082)
FT                   /gene="lin1012"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        70436..71629
FT                   /transl_table=11
FT                   /gene="gbuA"
FT                   /note="highly similar to glycine betaine ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="GOA:Q92D08"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D08"
FT                   /protein_id="CAC96244.1"
FT                   /translation="MSKIKVEELTKIFGKKASKASSLLSQGKSKTEILKETGATIGVNK
FT                   ASFSVEEGEIFVIMGLSGSGKSTLVRLLNRLIEPTSGKIWLDGKELSSLNKKELLEVRR
FT                   KSMSMVFQNFGLFPNRTINRNVEYGLEIQGMNKEEREKNAAESLALVGLAGYGEQYPSQ
FT                   LSGGMQQRVGLARALANNPDILLMDEAFSALDPLNRKDMQDQLLDLQDKMKKTIIFITH
FT                   DLDEALRIGDHIMIMRDGSVVQTGSPEEILAHPANEYVEKFIEDVDRSKVYTASNVMIR
FT                   PEIVNFEKDGPRVALKRMREAGTSSVFVVKRNRELVGIVHAAEVSKLVKENITSLETAL
FT                   HSDVPTTGPDTPLAEIMDTISTTTIPIAVTEDGKLKGIIIRGSVLAALSGNEVNVNA"
FT   regulatory      71607..71612
FT                   /gene="gbuB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71622..72470
FT                   /transl_table=11
FT                   /gene="gbuB"
FT                   /note="highly similar to glycine betaine ABC transporters
FT                   (permease) "
FT                   /db_xref="GOA:Q92D07"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D07"
FT                   /protein_id="CAC96245.1"
FT                   /translation="MPNIPTIPLASWIDKLVDGLTQFEGFFNVITNIIGGIVDAFQWVF
FT                   DLVPPWLFIILLVFGTFWVNRKGKKWGLIIFEVVGLLLIWNLDFWRDMTQTLTLVLTSS
FT                   LIALVIGVPLGIWMAKSGIVESIFKPVLDFMQTMPAFVYLIPAVAFFGIGMVPGVVASV
FT                   IFAMPPTVRMTNLGIRQVSTELVEAADSFGSTPWQKLWKVQLPMAKSTMMAGINQSIML
FT                   ALSMVVIASMIGAMGLGTRVYFAVGRNDAGGGFVAGIAIVIVAIILDRLTQAFNKKAKS
FT                   E"
FT   regulatory      72470..72475
FT                   /gene="gbuC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72484..73386
FT                   /transl_table=11
FT                   /gene="gbuC"
FT                   /note="highly similar to glycine betaine ABC transporters
FT                   (glycine betaine-binding protein)"
FT                   /db_xref="GOA:Q92D06"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D06"
FT                   /protein_id="CAC96246.1"
FT                   /translation="MLKKLITTAVLAMLIFTLAACGTTLAPYDAKKDLGEQINYTITGI
FT                   DAGAGIMLATQNAIKDYHLDDDNWQLQTSSTAAMTSTLQKAMKDKRPIVVTGWTPHWMF
FT                   TKFDLKFLDDPKNVFGNAENIHTIVRKGLKEEKPSAYKVLDNFFWTAEDMSEVMLEVND
FT                   GVDPEEAAKKWIKNNPEKVAKWTDGVEKVDGDEIKLTYVAWDSEIASTNVVAEALKQVG
FT                   YKPTIQAMEIQPMWASVATDAADGMVAAWLPNTSGIYYKDYKGKFEDLGPNLKGAKIGL
FT                   AVPKYMTNINSIEDLKISK"
FT   regulatory      73488..73493
FT                   /gene="lin1016"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        73501..73992
FT                   /transl_table=11
FT                   /gene="lin1016"
FT                   /note="similar to phosphotransferase system
FT                   glucose-specific enzyme IIA "
FT                   /db_xref="GOA:Q92D05"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D05"
FT                   /protein_id="CAC96247.1"
FT                   /translation="MFKKFLKKSKNETVFAHVTGQLIALEDVPDPVFNQKMMGEGIAIK
FT                   PESGTIVAPVDGKIIQLAETKHAFGIRTDMGQEILVHIGLETVSLNGEGFNVLVNVGDK
FT                   VKVGDPIVEADFDFIKKNAASTVVPMVVTNSSEGKYDFEFAGTPNTVAGKTEVFTTNLI
FT                   "
FT   regulatory      74004..74033
FT                   /gene="lin1016"
FT                   /regulatory_class="terminator"
FT   CDS_pept        74105..74800
FT                   /transl_table=11
FT                   /gene="lin1017"
FT                   /note="similar to E. coli copper homeostasis protein CutC"
FT                   /db_xref="GOA:Q92D04"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D04"
FT                   /protein_id="CAC96248.1"
FT                   /translation="MLEVIVQNPRDAYLAEKYGANRMEVVSAISEGGLTPSYGAIKEIV
FT                   RASKLPAMMMIRPHSFSFVYDEPARIVMERDIELAKEVGVKGIVYGGITEDGNIDQELL
FT                   EKVIEWKGDLDLTFHRALEATKDIEASYQVLRTYGQDINQLLTSGGTASALDSLPRLKR
FT                   WINDSKENPSSFKILVGSGVKPENIAIFQETLNHTDYHVGSAARETNDFAKDILKEKIN
FT                   ILKQHINQD"
FT   regulatory      74868..74873
FT                   /gene="lin1018"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        74880..75752
FT                   /transl_table=11
FT                   /gene="lin1018"
FT                   /note="similar to B. subtilis YitL protein"
FT                   /db_xref="GOA:Q92D03"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D03"
FT                   /protein_id="CAC96249.1"
FT                   /translation="MNNYIGKSQVMTVKEIKETGWLLEKDEVTVFLSKSNTHETELAVG
FT                   DEVTAFIFVDYDREIRATTIIPKIQVGHYGWGTVTEVRKHLGVFVDIGIEKDVVVSLDD
FT                   LPALPHLWPKKEDRVMIALRVDEENRVWGVLAEEEQFRAIAVRADQDLFNQNVEGTIYR
FT                   LLKVGSFVFTDDFHIGFIHESERTAEPRMGERVKARVIAVKPDGSLNLSLRGRAHEVLN
FT                   DDAEMILTYLRSVGGEMPFGDKSDPDAIRAKFGISKAQFKRAIGTLLKARRITQENGVI
FT                   TKLTEEASD"
FT   regulatory      75873..75878
FT                   /gene="lin1019"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        75888..76601
FT                   /transl_table=11
FT                   /gene="lin1019"
FT                   /note="similar to B. subtilis YvqF protein"
FT                   /db_xref="GOA:Q92D02"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D02"
FT                   /protein_id="CAC96250.1"
FT                   /translation="MKKMESSVVFIFLIAIIVGVGLEMLFQWELLILFALGIFFIFTSR
FT                   KASATKKSAKNSLFIGIVFIIIAVLLTTTFKVGLVVAGIYAIIHYISRKRAPQLLMLKT
FT                   REPDSKIDRTGKFIRNQWFGNQRILDVVYEWDDINIQTGIGDTILDLGNTVLPTGESII
FT                   MIRSVSGKIRILVPFDIGICIEHSAIFGNIQYDKESTSIQNNSIKVYSDNYESSARKVK
FT                   IMTSVIFGDLEVIRL"
FT   CDS_pept        76598..77656
FT                   /transl_table=11
FT                   /gene="lin1020"
FT                   /note="similar to two-component sensor histidine kinase in
FT                   particular B. subtilis YvqE protein"
FT                   /db_xref="GOA:Q92D01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D01"
FT                   /protein_id="CAC96251.1"
FT                   /translation="MSFSKLMMVVCSGLLLVATAIGTVGYYFFSEGSWYKILIEQKIFY
FT                   IPFIVFVPLTAISIGLIIGGLLGYFVKQKFESIDFSIRLLGQGDLEKKITSEEDETFLE
FT                   VQQVYKQIDRLRDKMKAQTILTQKLASDRAESSGQTKEAILSEERHRIARELHDSVSQQ
FT                   LFAAMMLLSALNEQSEKSATPAMQKQLKMVESIVNESQSEMRALLLHLRPTQLEGKSLK
FT                   TGIEQLLKELTTKLPIEVEWQIEDINLQKGIEDHLFRIVQELLSNTLRHSKAKLLEVRL
FT                   VTMDNLAVMKVVDDGVGFDMDNVRQGSYGLQNMRERVAEFGGTIKIISFKGRGTSVEIK
FT                   IPLVAKKDVENE"
FT   regulatory      77637..77642
FT                   /gene="lin1021"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77653..78291
FT                   /transl_table=11
FT                   /gene="lin1021"
FT                   /note="similar to two-component response regulator, in
FT                   particular B. subtilis YvqC protein"
FT                   /db_xref="GOA:Q92D00"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D00"
FT                   /protein_id="CAC96252.1"
FT                   /translation="MIKVLLVDDHEMVRIGVSAYLSVQDDMEVVGEAENGREGADMALE
FT                   LRPDIILMDLVMDEMDGIEATKEIMKNWKEAKIIIVTSFIDDEKVYPALEAGASSYMLK
FT                   TSTASEIADAIRATYGGDSVLEPEVTGKMMQRLTAKPEKNLHDDLTNRENEILLLIAEG
FT                   KSNQEIADELFITLKTVKTHVSNILSKLDVQDRTQAAIYAFKHDLVEKK"
FT   CDS_pept        78310..78969
FT                   /transl_table=11
FT                   /gene="lin1022"
FT                   /note="similar to a bacterial K(+)-uptake system"
FT                   /db_xref="GOA:Q7AP13"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP13"
FT                   /protein_id="CAC96253.1"
FT                   /translation="MKEGFAVIGLGRFGGSICRSLVEQGMEVLAIDSDEERVNEYMSIA
FT                   THAVIANSTDENALRQLGIRNFEHVIVAIGEDIQSSILTTLILKEMGVKYVTAKATNDK
FT                   HAKLLDKIGADRVVHPERDMGRRIAHYIVSKNMLDYLELSDEYSLVEISVSDPRFLGKS
FT                   LVDLDFRNSFGVNIVGIKKDKQMIITPEANDVLHEGDILIVIGSDDDIERLQEKIQ"
FT   regulatory      78977..79026
FT                   /gene="lin1022"
FT                   /regulatory_class="terminator"
FT   regulatory      79101..79106
FT                   /gene="lin1023"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        79114..80034
FT                   /transl_table=11
FT                   /gene="lin1023"
FT                   /db_xref="GOA:Q92CZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ8"
FT                   /protein_id="CAC96254.1"
FT                   /translation="MKKFLLDKIGARGLIQMLQAFIYASICVIVHTVIFPDLAGVLPIV
FT                   VLIGIISMQPTYGITRKVIPQIAIAFTLACAFVIISTYFFPINVYIYYFVMLIVILIVN
FT                   FTMPQKYMVMTLAIGTALYFLGTEDLPMPLYVMVIVALVDVFVFFILVRLVVRYVHLPL
FT                   EKTVQTIMKQLMGLFDKEMESVFKNNGKFVSKPLYSIFVQSQMFIKEYGTSKNMNPRHV
FT                   EIYQALLPNYLQLFFHMQTLEDIGRVGLSEEAKKALATINVEVSTEINAKETNPVASFH
FT                   VKKFVENFLAIKKGMAELAEGGDKK"
FT   CDS_pept        80031..80882
FT                   /transl_table=11
FT                   /gene="lin1024"
FT                   /db_xref="GOA:Q92CZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ7"
FT                   /protein_id="CAC96255.1"
FT                   /translation="MKKISMKERLALDPRVAKVLISITIAILLFPVMGDWIVYPTYVFN
FT                   AIYITAQMTKGATYKSSIERIVGTIVGGLLAAFVYLLVPNHHYIMIPIGAALAVALSYL
FT                   FTKKFTMVIVVITVMVLVGKGDGEPIVFLRDRLFDTMIGLAIGFLVYALYPRKKAKKLN
FT                   QVFISKEKDLLANIKAIEINSDDAKALAPKIKGLWKQLIELRKTREQIITDSSFVGDVN
FT                   SEEPMLQFTILVERAINNIEILYHVTLDKEVEPDYEIVFDYHQQACKKVINEMETLITK
FT                   HQ"
FT   regulatory      80887..80917
FT                   /gene="lin1024"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(80887..80917)
FT                   /gene="lin1025"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(80926..81891)
FT                   /transl_table=11
FT                   /gene="lin1025"
FT                   /note="similar to B. subtilis LytR protein"
FT                   /db_xref="GOA:Q92CZ6"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="PDB:3OWQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ6"
FT                   /protein_id="CAC96256.1"
FT                   /translation="MTETRTETKQKKPSTFTKVMKIASVTLLGILFFSITGLAAKYYIT
FT                   VQNTFTKINVPLETSNKTTSDLEKKKPFSVLLMGSDARPGETNGRADTIILATANKQQN
FT                   AVEMVSIPRDTKVDYGNGDIGKINASYSNGGPSGTVSAVEKLMPGVPVDYFISINMEGF
FT                   KDLVDAVGGITVYNDIDLTEVNSKFVKGNITLNGTDALQYVRIRHEDPRGDFGRQDRQR
FT                   DVIIGIANKVISSSGVSNFESIMKAVGDNFQTNMTLTDITSMATNYSSVLKNVDSQELK
FT                   GEGEMIYSESYGFDLYYFAPDETDLERVINMFKKSLDITE"
FT   regulatory      complement(81963..81990)
FT                   /gene="lin1026"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(82000..83667)
FT                   /transl_table=11
FT                   /gene="lin1026"
FT                   /note="similar to conserved hypothetical proteins (in
FT                   particular B. subtilis YkqC)"
FT                   /db_xref="GOA:Q7AP12"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP12"
FT                   /protein_id="CAC96257.1"
FT                   /translation="MKFVKNNETAVFALGGLGEIGKNTYGVQFQDEIILIDAGIKFPED
FT                   ELLGIDYVIPDYSYLVKNKDKIKGLFITHGHEDHIGGVPYLLRDLNIPIYAGKLASALI
FT                   RNKLEEHGLLRQTKIYEYEEDDVFKFRKTSISFFRTTHSIPDTYGIVVKTPSGNIVHTG
FT                   DFKFDFTPVGEPANLTKMAEIGKEGVLCLLSDSTNAEVPNFTMSERVVGESIKNIFRDV
FT                   EGRIIFATFASNIYRLQQVVESSIETGRKIAVFGRSMESAMEIGKQLGYIQAPKDTFID
FT                   VHQLNKTPAGNVTILCTGSQGEPMAALSRIANGTHRQIQIQPGDTVVFSSSPIPGNTTS
FT                   VNRTINLLYQAGAEVIHGKVNNIHTSGHGGQQEQKLMLRLMKPKFFMPIHGEFRMQKIH
FT                   AESAEECGVPEENSFIMANGDVLALTSETAHVAGKIHAASVYIDGSGIGDIGNIVLRDR
FT                   RILSEEGLVIVVVSIDMKNSRVMAGPDIISRGFIYMRESGNLIGEAQGLLTRHLNKVME
FT                   QKTTQWSEIKNEITDTLQPFLYEKTKRRPMILPIIMEV"
FT   CDS_pept        complement(83674..83883)
FT                   /transl_table=11
FT                   /gene="lin1027"
FT                   /note="similar to B. subtilis YkzG protein"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AP11"
FT                   /protein_id="CAC96258.1"
FT                   /translation="MIFKVFYQETLTETPVREKTQSLYVEAESEVKVRQLLKDEPFHIE
FT                   FVEKISDAHLAYEKENPDFALWEK"
FT   regulatory      complement(83679..83684)
FT                   /gene="lin1026"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(83891..83896)
FT                   /gene="lin1027"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        84378..85148
FT                   /transl_table=11
FT                   /gene="lin1028"
FT                   /note="similar to conserved hypothetical proteins"
FT                   /db_xref="GOA:Q92CZ3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ3"
FT                   /protein_id="CAC96259.1"
FT                   /translation="MSKIVFFDVDGTLVGETKEIPASAKQAIAKLKENGVYVAIATGRG
FT                   PFMLDEIRKELDINSYICYNGQYVIFEGKEIYAKPLPTESLERLITVASEHEHPIVFSG
FT                   KDSMRANLPDHDRITIGMNSIKRDYPKVDANYYKGRDIYQCLLFCDESYDAYYRKEFKQ
FT                   YGFLRWHDVSVDVCPADGSKAEGIKQMIKKLGFSMEDTYAFGDGLNDIAMLQAVGTGVA
FT                   MGNGRDEVKAVADYVTDHVDEDGVYKALQHLKLI"
FT   regulatory      85156..85184
FT                   /gene="lin1028"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(85165..85968)
FT                   /transl_table=11
FT                   /gene="lin1029"
FT                   /note="highly similar to B. subtilis YoaT protein"
FT                   /db_xref="GOA:Q92CZ2"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ2"
FT                   /protein_id="CAC96260.1"
FT                   /translation="MKFFRLLWVFTWKQALCCLFPGIIFISLALTKLIEIPFIARYDLL
FT                   LIICLVTQIFLIKFGLETWDELKVIMIFHLIGLGLEIYKVHMGSWSYPEPGLMKLFGVP
FT                   LYSGFMYSSVASYICQAWKRFDLNMTNWPNIWLVSSLCIAIYANFFTHHFIMDFRWILI
FT                   ILVLLLFRKTYVYFKVSATQLKMPLSFSFLCIAFFIYLAENIASFYGAWAYPDQLVAWR
FT                   PVHVSKITSWYLLVIISIIIVAQLKFIKQKWEQDQITTKSEATLK"
FT   regulatory      complement(85976..85981)
FT                   /gene="lin1029"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(86035..86616)
FT                   /transl_table=11
FT                   /gene="lin1030"
FT                   /note="weakly similar to molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /db_xref="GOA:Q92CZ1"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ1"
FT                   /protein_id="CAC96261.1"
FT                   /translation="MKNAKVNVGIVLAGGKSSRFGKSKALFQNEATGKTWVELTVNKLK
FT                   PFCEMVFVSANQENYQKLIALFHEDSAIQIIPDQPAYKDFGPLGGIYAVMVQKNAYPEA
FT                   NYLILPVDMPFLTSSEISRLAAFPNHFAKTAEENHYLVLNIPYSREILHNLLQKEQHRV
FT                   RGLLEKLQTKPLEFENEAPFTNINRQNELF"
FT   CDS_pept        complement(86597..87259)
FT                   /transl_table=11
FT                   /gene="lin1031"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q92CZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ0"
FT                   /protein_id="CAC96262.1"
FT                   /translation="MLRLQFHKKLPFHDLNIDYTFEKPVTAMMGASGSGKSTLFQCVSG
FT                   LKSIDGGIIEFDGTPWDDSNISLHLPVTERKVGYLFQNLALFPNMNVYENIAFGLKVKK
FT                   KKKKEQAEIQQQVRKMSDYLQISHLLYSSVQKLSGGEKQRVAMARAMITEPKLLLLDEP
FT                   FNGLDEETRLICMKLVGQMAKDFHIPVIFVTHYASEAEMMTEEILVMRDGRLEKRKS"
FT   regulatory      complement(86623..86629)
FT                   /gene="lin1030"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(87262..87933)
FT                   /transl_table=11
FT                   /gene="lin1032"
FT                   /note="similar to molybdenum ABC transporters (permease) "
FT                   /db_xref="GOA:Q92CY9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY9"
FT                   /protein_id="CAC96263.1"
FT                   /translation="MFTSVWHTLLVATISTFLAFMTMLPLSYYFAGRKSRFQLLVEILI
FT                   LLPLVLPPTVVGLVLLNVLGRNDFIGGVLWDTFDFSFIFSLSGAIVATTIIILPIMYQG
FT                   LKSAFLSIDHELVWAAETLSANKKQIFTKIILPNCWQPILAGVLLSFCRAMGEFGASLM
FT                   VAGYIEGKTDTIASSIYFMVQQGDMRTAIYLGLINVIIGVFALLVIHVLTVRQSNLTRG
FT                   M"
FT   regulatory      complement(87268..87273)
FT                   /gene="lin1031"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(87940..87945)
FT                   /gene="lin1032"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      88028..88033
FT                   /gene="lin1033"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        88041..88814
FT                   /transl_table=11
FT                   /gene="lin1033"
FT                   /note="similar to molybdate ABC transporter binding
FT                   protein"
FT                   /db_xref="GOA:Q92CY8"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR041879"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY8"
FT                   /protein_id="CAC96264.1"
FT                   /translation="MKKIAILISCLLVLLVGACANTSEKAKTTTTIHISAAASLKDTMD
FT                   DVKPLFEKAYPSIKLSFDFGGSGQIRERVESGAPIDGVLLASKKDADTLSNQKLAENTK
FT                   EFAGNDLVLIEPKNADQKEGLSLEQLLDNADKIAIGDPESVPAGAYAKQTLGNLNLYNT
FT                   EKAKLVLATDVRQVLSYVEAGNADAGFVYQTDAILSKKVQVKAKIDAKLHDPIAYYSAQ
FT                   VTDSEKKEPTTTFLDFMNKSEAQKILEKYGFKAAD"
FT   regulatory      88894..88899
FT                   /gene="lin1034"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        88909..90132
FT                   /transl_table=11
FT                   /gene="lin1034"
FT                   /note="similar to molybdopterin biosynthesis protein moeA"
FT                   /db_xref="GOA:Q92CY7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY7"
FT                   /protein_id="CAC96265.1"
FT                   /translation="MIEKRNTIRMEQAREVLCNQITHLPVERKNVTEALNQVLQEPIFA
FT                   PFPAPYFRRSGYDGFAITEEDDGNYPITLHVVAEVPCGKTYDKPLKPGETVRIMTGAKV
FT                   PDNASKIIMLEQSREAENKNDIVLINTQKSSNITEIGAEFAKGDLLLDRGHTLNAGSIS
FT                   LLSSFGISEVQVIRKPKVAILSTGSELVPAGNSLPDGKIYNSNQPLLENLLTVHHAEIC
FT                   AAEQLPDNYEDTKARLLELTKIADLIVTTGGVSVGDYDFMADIAKQEAELLFNKIQMRP
FT                   GSPTTGMWLNKTLIIALSGNPGACFTGFYLLVEPVLATFMGKDNTATTKVRAKMASDYT
FT                   KNNGFDRFLRGTYHLSEEGEYLVELVGSDMSSALGNLHLTTCLFKIPGGKVGKYQGEEV
FT                   EAWLLSSK"
FT   regulatory      90098..90103
FT                   /gene="lin1035"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        90111..90596
FT                   /transl_table=11
FT                   /gene="lin1035"
FT                   /note="similar to molybdopterin-guanine dinucleotide
FT                   biosynthesis MobB"
FT                   /db_xref="GOA:Q92CY6"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY6"
FT                   /protein_id="CAC96266.1"
FT                   /translation="MATILQIIGFKNSGKTTLLNALIRASRKENYTVSAIKHDAHDFSV
FT                   DHAGTDSYSFQESGAEAVVIANSRQYAVMEQTGIDLKTAIQKLPDSDIVLIEGYKEGPF
FT                   PKIILIREKAEIEILKNSKAVHKIATHNPALKEEAIFIGEEEALNAFAETLIKEFLQ"
FT   regulatory      90580..90585
FT                   /gene="lin1036"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        90593..91015
FT                   /transl_table=11
FT                   /gene="lin1036"
FT                   /note="similar to molybdopterin converting factor, subunit
FT                   2"
FT                   /db_xref="GOA:Q92CY5"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY5"
FT                   /protein_id="CAC96267.1"
FT                   /translation="MKYVALQHEKIEIGPLSEKLINKNHGGINLFVGTIREWTGDIQTE
FT                   EIRYTAYEAMALKELNKLATEVETKWGADVVIVHRLGLLEITDIAVFIGVSTPHRAACY
FT                   EGSRYIIERLKERVPIWKEEKDVDQIRWGGIDAHNG"
FT   CDS_pept        90999..91247
FT                   /transl_table=11
FT                   /gene="lin1037"
FT                   /note="similar to molybdopterin converting factor (subunit
FT                   1)."
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY4"
FT                   /protein_id="CAC96268.1"
FT                   /translation="MLTTVKFFAFLAEKTKQTEVKLNLQQCETVGEVREVISSEFPEIA
FT                   VDLATCMLAVNMEFQHDQDILPNEITEIAVIPPVSGG"
FT   regulatory      91247..91252
FT                   /gene="lin1038"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91260..91742
FT                   /transl_table=11
FT                   /gene="lin1038"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="GOA:Q92CY3"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CY3"
FT                   /protein_id="CAC96269.1"
FT                   /translation="MDKDDLTHFNDEKRAKMVDVTSKSETKRRAIARATIHMNEETLAR
FT                   IHAGKIAKGDVLAVAQVAGIMAAKKTSELIPMCHPIMTTKADISFDDDGKTALTITSEV
FT                   VTVGKTGVEMEALTAVTIAALTIYDMCKAMDKGMQIEKTYLVEKTGGKSGTFKAEA"
FT   regulatory      91757..91762
FT                   /gene="lin1039"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91771..92772
FT                   /transl_table=11
FT                   /gene="lin1039"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   A"
FT                   /db_xref="GOA:Q92CY2"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CY2"
FT                   /protein_id="CAC96270.1"
FT                   /translation="MQLLKDKFGRVHDYIRISVTDRCNLRCVYCMPEEGLTFLPHEKVL
FT                   SKDEIVSFMELMVKFGIKKVRITGGEPLLRTDIVEIVRGLGAIPEIEDISITTNAMYLA
FT                   KKAEALKEAGLTRVNISLDSLHADRFQAITRGGRLQKVLDGIQKAEEVGLFPIKLNVVL
FT                   IKGQNDDEITDFLQFTKDKDINIRFIEYMPIGHAGTSWKEKYLPLDTIFKACDDASFEY
FT                   EPVDSIRGNGPSENFRIKGAKGTFGVIHPVSAHFCDSCNRLRLTADGYIKACLYWDEEM
FT                   NIRPFIHEPVKLMQLVQKAIDNKPENHEMALKLQDEVQSNKPTWRRMSQIGG"
FT   regulatory      92779..92802
FT                   /gene="lin1039"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(92779..92802)
FT                   /gene="lin1040"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(92805..93293)
FT                   /transl_table=11
FT                   /gene="lin1040"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   B"
FT                   /db_xref="GOA:Q92CY1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY1"
FT                   /protein_id="CAC96271.1"
FT                   /translation="MEQKTFIKVTCSILTISDTRNLETDTSGKLIQSLLEAAGHQVITR
FT                   VIVPDDAPRIKQEMDKLAANGSFCLITNGGTGIAKRDVTYEALFATIQQEIPGFGEIFR
FT                   MLSYEEVGSRAMVSRAFAGFSKSGLLIFALPGSSNASRLATEKLIIPELPHLIAERQK"
FT   CDS_pept        complement(93305..94303)
FT                   /transl_table=11
FT                   /gene="lin1041"
FT                   /note="similar to molybdopterin biosynthesis protein MoeB"
FT                   /db_xref="GOA:Q92CY0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY0"
FT                   /protein_id="CAC96272.1"
FT                   /translation="MERYDRQMRVANIGEIGQEKLLSKTILIVGVGAIGSYAAEICARM
FT                   GFGKLILIDRDYVELSNLQRQSLYTEQDALEKQAKAYAAQKAILLINSEIEVEYIVDDA
FT                   NMTSLTPFAKKIDYILDCTDNFMTRDFLNQFCFIHQIPWIFTSCAGNYANLMPITPPDS
FT                   ACLHCLLGDIPQTNAASCDIIGVDGALIPMVAGMQVSLLTQMILNPDFTANTYYQIDNW
FT                   QLNFQSLAVKKRPHCTGCSPEKVLSEVPFSEQTIALCGRDTVQFHLQNKSNYREIKQRL
FT                   AEQKMLYTENPALLSFNYEKYQFVIFKNGRVLLHGTENLAEAKKIYQLFFN"
FT   regulatory      94429..94434
FT                   /gene="lin1042"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        94440..94991
FT                   /transl_table=11
FT                   /gene="lin1042"
FT                   /note="similar to B. subtilis YdfE protein"
FT                   /db_xref="GOA:Q92CX9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX9"
FT                   /protein_id="CAC96273.1"
FT                   /translation="MKKKLDTTKFYPAYPVFLLTYLNELGEAQMSTGSSSYTLGDTLVI
FT                   GISAESNASNYLKPGEKFAVNFPTTKQFDLIEQGGFSSGKRIDKVKEYQIELTKSESGA
FT                   LYIDSCPIIFECTVGQTIRDADYHTVFAKIDTRLMEETLIDTAGNFVHDELDLVLFSGD
FT                   AYERKFRKLDIKIEKVGGHL"
FT   regulatory      95000..95026
FT                   /gene="lin1042"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(95000..95026)
FT                   /gene="lin1043"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(95038..95589)
FT                   /transl_table=11
FT                   /gene="lin1043"
FT                   /note="similar to formylmethionine deformylase and to B.
FT                   subtilis YkrB protein"
FT                   /db_xref="GOA:Q92CX8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CX8"
FT                   /protein_id="CAC96274.1"
FT                   /translation="MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGHDMLEFLINSQ
FT                   DEELAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACL
FT                   SGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVVQHEIDHLNGVMF
FT                   YDHINKENPSYLPPDVDVFG"
FT   regulatory      complement(95600..95605)
FT                   /gene="lin1043"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      96409..96414
FT                   /gene="pdhA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        96423..97538
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /note="highly similar to pyruvate dehydrogenase (E1 alpha
FT                   subunit)"
FT                   /db_xref="GOA:Q92CX7"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX7"
FT                   /protein_id="CAC96275.1"
FT                   /translation="MASKTKKAIIDVKKQFEAVHKQFELVQILNEKGEIVNPDLMPDLT
FT                   DDELVELMTRMVWTRVLDQRSISLNRQGRLGFYAPTAGQEASQLASHYALEKHDYILPG
FT                   YRDVPQLIWHGLPLTKAFLFSRGHFVGNQFPEDLNVLSPQIIIGAQIVQAAGVALGLKK
FT                   RKKDAVVITYTGDGGSSQGDFYEGMNFAGAYHAPAIFVVQNNKFAISTPREKQSAAETL
FT                   AQKAVAAGIPGVQVDGMDPLAVYAVTKFARERAVAGEGPTLIETMTYRYGPHTLSGDDP
FT                   TRYRTKELDGEWELKDPIVRFRTFLEGKGLWNEEKENAVIDQAKEEIKVAIKEADATPK
FT                   QTVTDLLKNMYETPTAPIKEQLAIYEAKESK"
FT   regulatory      97525..97530
FT                   /gene="PdhB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        97541..98518
FT                   /transl_table=11
FT                   /gene="PdhB"
FT                   /note="highly similar to pyruvate dehydrogenase (E1 beta
FT                   subunit)"
FT                   /db_xref="GOA:Q92CX6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX6"
FT                   /protein_id="CAC96276.1"
FT                   /translation="MAQKTMIQAITDALAVELEKDENVLVFGEDVGKNGGVFRATEGLQ
FT                   EKFGEDRVFDTPLAESGIGGLAIGLALEGFRPVPEIQFFGFVFEVMDSVAGQMARMRYR
FT                   TGGTRTAPITIRAPFGGGVHTPEMHADNLEGLMAQSPGLKVVIPSTPYDAKGLLISAIR
FT                   DNDPVIFLEHMKLYRSFREEVPEGEYTVEIGKAAVRREGTDVSIITYGAMVQESMKAAE
FT                   ALEKDGVSVEVIDLRTISPIDVETIIASVKKTNRAVVVQEAQKQAGIAANIVAEINDHA
FT                   ILSLEAPVMRVAAPDSVFPFSQAETVWLPNHNDIIERVKEVIAF"
FT   regulatory      98614..98619
FT                   /gene="pdhC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        98629..100263
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /note="highly similar to pyruvate dehydrogenase
FT                   (dihydrolipoamide acetyltransferase E2 subunit)"
FT                   /db_xref="GOA:Q92CX5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX5"
FT                   /protein_id="CAC96277.1"
FT                   /translation="MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSV
FT                   EEITSPVSGTIKEIKVAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAP
FT                   AQASGKGIFEFKLPDIGEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVD
FT                   GTVKDILVSEGTVATVGQVLVTFEGDFEGEASHESTPESPAEEAELTNNDATSAPATGG
FT                   NGTPSSKKDPNGLVIAMPSVRKYAREKDVNIAEVAGSGKNNRVVKADIDAFLNGEQPAA
FT                   ATTTAQTEEKAAAPKAEKAAAKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHV
FT                   TLMDEIEVTALMAHRKRFKEVAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEE
FT                   LVYKHYFNVGIAADTDHGLYVPVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHG
FT                   SATISNIGSAGGQWFTPVINYPEVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRV
FT                   IDGATAQKAMNNIKRLLNDPELLLMEV"
FT   regulatory      100253..100258
FT                   /gene="PdhD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        100268..101671
FT                   /transl_table=11
FT                   /gene="PdhD"
FT                   /note="highly similar to dihydrolipoamide dehydrogenase, E3
FT                   subunit of pyruvate dehydrogenase complex "
FT                   /db_xref="GOA:Q92CX4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX4"
FT                   /protein_id="CAC96278.1"
FT                   /translation="MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGG
FT                   VCLNVGCIPSKALITIGHRFKEAGHSDNMGITADNVNLDFTKAQEWKGGVVNKLTSGVK
FT                   GLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYGKRV
FT                   LSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSL
FT                   VKRNLKSKNVEMVTKALAKSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEI
FT                   GLEQAGVKVTERGLVEVDKQGRSNVSNIFAIGDIVPGVPLAHKASYEAKIAAEAIAGEK
FT                   AENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVR
FT                   LVTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAE
FT                   LALGRPIHM"
FT   regulatory      101682..101710
FT                   /gene="PdhD"
FT                   /regulatory_class="terminator"
FT   regulatory      101845..101850
FT                   /gene="lin1048"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        101858..102169
FT                   /transl_table=11
FT                   /gene="lin1048"
FT                   /db_xref="GOA:Q92CX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX3"
FT                   /protein_id="CAC96279.1"
FT                   /translation="MEKQTATWKKALFWFAYVVAGICFLLTIVAFIVGFIHHMHDTGGW
FT                   RSVIQILETPITGFVKMTGGYIGKGILEVIILIIVSYVLPIFFCFATHYLKVKRREMA"
FT   regulatory      102284..102289
FT                   /gene="lin1049"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        102298..103248
FT                   /transl_table=11
FT                   /gene="lin1049"
FT                   /note="similar to L-lactate dehydrogenase"
FT                   /db_xref="GOA:Q92CX2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX2"
FT                   /protein_id="CAC96280.1"
FT                   /translation="MPSKKKKIVVIGRSNLQNLYIHTILLKKLPAEIYLIDEQAKTSVQ
FT                   DFEYASYYHSSATVNTGTFNECRSADLVLFFQEEMSNESFSNEDNLALIKEKVKKMMAT
FT                   GFQGIVLVATAESNIVASLIKHFSGLPANQIITPGTMLATSYFQVEIAKLFKISPKNVH
FT                   GYIIGESTQDVIPVWSRAFLGGKPILSYLAEEQKRITSDDLQNLTNMITKIPDFPVETK
FT                   DGCSFRFSTVTVLAELTEVILRDEARVLTVGVEVKEAYGLERPVFVSVPAVVGAEGVRE
FT                   LLELNLSDDEQKELKRITTKTTEKLGLLHNKGGIS"
FT   CDS_pept        103248..103520
FT                   /transl_table=11
FT                   /gene="lin1050"
FT                   /note="similar to B. subtilis YktA protein"
FT                   /db_xref="InterPro:IPR007920"
FT                   /db_xref="InterPro:IPR023324"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67357"
FT                   /protein_id="CAC96281.1"
FT                   /translation="MEYSYPLNPDWTTEEMTIVVQFLEAIERAYEKGIDTLELKEKYRA
FT                   FKQVVPAKGEEKRIGIDFEKASGYSAYKVMQLVKNATTSKIKMQP"
FT   regulatory      103526..103531
FT                   /gene="lin1051"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        103541..104071
FT                   /transl_table=11
FT                   /gene="lin1051"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX0"
FT                   /protein_id="CAC96282.1"
FT                   /translation="MDISQIKAEVVTPETGIHVGEKGAPVKVMSFINLRCPFCREWNEK
FT                   SKDVLTEYIQAGKIELIIKPFDKEKESLQRGNVAHRYLDYSKPEETRETINKIYSTQDE
FT                   WGSLSLSEVADYMESTLGLTEQDNKAASEKIIAEANAANVVFVPTVIVGEHIFDEHISP
FT                   EELRDLLDGELAK"
FT   regulatory      104077..104112
FT                   /gene="lin1051"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(104077..104112)
FT                   /gene="lin1052"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(104122..105066)
FT                   /transl_table=11
FT                   /gene="lin1052"
FT                   /note="similar to membrane and transport proteins"
FT                   /db_xref="GOA:Q92CW9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW9"
FT                   /protein_id="CAC96283.1"
FT                   /translation="MHQIFKSDENGKLIELEEVTRNCWINIVAPTSEEINKIADNYEIP
FT                   LEFLEDPLDKDESARIERDDDSDSVLIVCDFPVVDEDDIHYASFETIPMGIIITKDYFI
FT                   TICTIDSSIVQSFIRNRIKGFYTHMKTRFALQILYMISTTFLRHLKRLNRQTDEIEKEL
FT                   HESMKNKQLYDLMGIEKSLVYFVTALKSNKVVLDKMMRQNIVKMYEEDQDLLEDVIIEN
FT                   RQGIEMAEVHSNILSGMMDAYASIISNNMNIVMKFLTSFTIILTIPTMVFSFYGMNVKL
FT                   PFMETPLAWILTLGFAFGIAGALAIVFWRRKFF"
FT   regulatory      complement(105075..105080)
FT                   /gene="lin1052"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(105267..105881)
FT                   /transl_table=11
FT                   /gene="lin1053"
FT                   /note="similar to B. subtilis YktB protein"
FT                   /db_xref="InterPro:IPR009403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CW8"
FT                   /protein_id="CAC96284.1"
FT                   /translation="MTFKGFSKKDFKTMQIPGLDARMAGIQNDIQPKFKAVGEELTTYL
FT                   SAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFI
FT                   YENEESTKIANRFLKEKKLLAELPDTFAISPDHTEEKTYPVHGGQLDATLKRFRDVKKG
FT                   EFLVGKIYLPDDNHLSPGKDFIKEAEMVLDELIPLYKAALQ"
FT   regulatory      complement(105889..105894)
FT                   /gene="lin1053"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        106013..106786
FT                   /transl_table=11
FT                   /gene="lin1054"
FT                   /note="similar to extragenic suppressor protein SuhB and to
FT                   myo-inositol-1(or 4)-monophosphatase"
FT                   /db_xref="GOA:Q92CW7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW7"
FT                   /protein_id="CAC96285.1"
FT                   /translation="MDSEKIDYLARLWIMEAAAKIKQSFKETLDIDIKSGRNDLVTNMD
FT                   KETEAFFVKQIKDHFPNHRLFGEEGMSDDVTDLNGIVWILDPIDGTLNFVEQQRDFAIS
FT                   LAIYQDGVGHLAYIYDVTRDELYFAEKGKGATVNGKQIPKIDKDMDLQDALLIANLSVT
FT                   RKFPTMWEAVKVSRGLRLHGAASLEYMDVATGRAGAYLSANLAPWDIAAGKIIVEELGG
FT                   IVTRIDGSKINMLEKGSSIVATPKIHQTLLDNYLP"
FT   regulatory      106964..106969
FT                   /gene="lin1055"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        106978..108816
FT                   /transl_table=11
FT                   /gene="lin1055"
FT                   /note="similar to GTP-binding elongation factor "
FT                   /db_xref="GOA:Q92CW6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW6"
FT                   /protein_id="CAC96286.1"
FT                   /translation="MNLRNDIRNVAIIAHVDHGKTTLVDQLLRQSGTFRDNETVAERAM
FT                   DNNDLERERGITILAKNTAIKYEDTRVNIMDTPGHADFGGEVERIMKMVDGVLLVVDAY
FT                   EGTMPQTRFVLKKALEQNLTPIVVVNKIDRDFARPEEVVDEVLELFIELGANDDQLEFP
FT                   VVYASAINGTSSFESDPAEQKETMKPLLDTIIEHIPAPVDNSDEPLQFQVSLLDYNDYV
FT                   GRIGIGRVFRGTMHVGQTVALIKLDGTVKQFRVTKMFGFFGLKRDEIKEAKAGDLVALA
FT                   GMEDIFVGETVTPFDHQEALPLLRIDEPTLQMTFVTNNSPFAGREGKHVTSRKIEERLL
FT                   AELQTDVSLRVEPTASPDAWVVSGRGELHLSILIETMRREGYELQVSKPEVIIREIDGV
FT                   KCEPVEDVQIDTPEEFMGSVIESISQRKGEMKNMINDGNGQVRLQFMVPARGLIGYTTD
FT                   FLSMTRGYGIINHTFDSYQPIQKGRVGGRSRGVLVSMETGKSTTYGTMQVEDRGTIFVE
FT                   PGTDIYEGMIVGENNREGDIAVNIVKAKQMTNIRSANKDQTNVIKKPRHLSLEESLEFL
FT                   NEDEYCEVTPESIRLRKKILNKNEREKAAKRSKTAE"
FT   regulatory      108832..108881
FT                   /gene="lin1055"
FT                   /regulatory_class="terminator"
FT   regulatory      108984..108989
FT                   /gene="lin1056"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        108998..109867
FT                   /transl_table=11
FT                   /gene="lin1056"
FT                   /db_xref="InterPro:IPR031888"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW5"
FT                   /protein_id="CAC96287.1"
FT                   /translation="MKKRIIILAVLVVLLIGGVVIGVYANGNTAKDNEDKKTTAKKATS
FT                   TPKDTNKTVDTEKKDTVKDSVTDDKGVVTKGSSDIEKNAPTKSSGNSTESNKNTPSTPA
FT                   FSLSTSGFKTSNVASVLGGTVTTTYLSSSPSFQKIFQNLTIDVNQYKVEHVVGANKSVS
FT                   ASNPESYLANKNGYVITLDISIKNTSSKDKMYKADQITLVGANEFVGGSLDNFVPSNFH
FT                   LIGSKSDPNNFAAGKTARGLLTFTMTEAVYNDLAADSKLGVPNPDKFDSTVSEAKAGDD
FT                   VVVSFPVK"
FT   regulatory      109875..109894
FT                   /gene="lin1056"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(109875..109894)
FT                   /gene="lin1057"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(109900..110130)
FT                   /transl_table=11
FT                   /gene="lin1057"
FT                   /note="similar to B. subtilis YlaI protein"
FT                   /db_xref="InterPro:IPR019241"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW4"
FT                   /protein_id="CAC96288.1"
FT                   /translation="MNAKCILCERVDELDNREFKTKQLRNKPIRMYLCPECEHRVAIKT
FT                   ISRVNSGHFNFHKPVVMSNSELKNLIESTEK"
FT   regulatory      complement(110139..110144)
FT                   /gene="lin1057"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        110336..110617
FT                   /transl_table=11
FT                   /gene="lin1058"
FT                   /note="similar to B. subtilis YlaN protein"
FT                   /db_xref="InterPro:IPR009983"
FT                   /db_xref="InterPro:IPR036270"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CW3"
FT                   /protein_id="CAC96289.1"
FT                   /translation="MANKKIDHREEAIELLKQDAKRILQLIKVQMDNLTLPQCPAYEEV
FT                   LDTQMYGLSREINFATRLGLIEPEEGKKLISTLEKELSALHELSMSKK"
FT   regulatory      110633..110655
FT                   /gene="lin1058"
FT                   /regulatory_class="terminator"
FT   regulatory      110778..110783
FT                   /gene="lin1059"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        110790..111992
FT                   /transl_table=11
FT                   /gene="lin1059"
FT                   /note="similar to cell-division protein RodA and FtsW"
FT                   /db_xref="GOA:Q92CW2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW2"
FT                   /protein_id="CAC96290.1"
FT                   /translation="MLKRILKSYDYAFIAVFIVLCLFGIIMIYSASWSLAIGKDLPADY
FT                   YYARQVKNFIISFIFFVLFALIPFKFYQNNKVLMLIVFGSIGVLLLIFLVGKTVNNANS
FT                   WLVVGPRSLQPGEFAKLAVIIYMSAIYAKKQSYIDDFNRGVLPPIFFLAFVCFLIAIQP
FT                   DTGTAFIIFLVGCCIIIASGMRLRTIMKLIGIGVGVIVALTLILFALPDKVRTEIVSPT
FT                   KVARITTFMNPFEYADKEGHQLINSFYAIGSGGVSGQGLGESVQKLGYLPEAHTDFIIA
FT                   VVAEELGVFGVMFIILALFFIIFKTISTGLRAKDPFASLMCYGIASLIAIQAFINLGGA
FT                   SGLIPLTGVTLPFISYGGSSLMVLSMMLGIVANISMFNKYHRLYSADGSKKEVPKKQKR
FT                   R"
FT   regulatory      112002..112027
FT                   /gene="lin1059"
FT                   /regulatory_class="terminator"
FT   regulatory      112255..112260
FT                   /gene="pycA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        112267..115707
FT                   /transl_table=11
FT                   /gene="pycA"
FT                   /note="highly similar to pyruvate carboxylase"
FT                   /db_xref="GOA:Q92CW1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW1"
FT                   /protein_id="CAC96291.1"
FT                   /translation="MNRIKKVLVANRGEIAIRVMRACTELKIKTVAIYSQEDTGSFHRY
FT                   KSDEAYLVGAGKKPIDAYLDIENIIEIAKESGADAIHPGYGFLSENIEFARRCEQEGII
FT                   FVGPKSKHLDMFGDKIKAKEQALLADIPVIPGSDGPVAGIKEVEEFGEKNGYPLMIKAS
FT                   LGGGGRGMRVVESKEHVKESFERASSEAKAAFGNDEVYVEKCVMNPKHIEVQILGDTHG
FT                   NIVHLFERDCSIQRRHQKVVEVAPCNAITSELRNRICDAAVKLMKNVDYINAGTVEFLV
FT                   EGDNFYFIEVNPRVQVEHTITEMITGIDIVQSQLFIADGYALHDQLVAIPKQEDIHIHG
FT                   SAIQSRITTEDPLNNFMPDTGRVDTYRSTGGFGVRLDAGNGFQGTVVTPFYDSLLVKLC
FT                   TWGMTFEQATRKMRRNLIEFRIRGVKTNIPFLLNVVRHPDFASGNYNTSFIDTTPELFK
FT                   FPHIRDRGTKTLRYIGNVTVNGFPGIKHRDKPVYAEPRLPKIPYGSQIAPGTKQILDAK
FT                   GPEGVVDWVKKQEEVLLTDTTLRDAHQSLLATRVRSKDIFQIADAMAHLLPNMFSFEMW
FT                   GGATFDVAYRFLNEDPWVRLETLRKQIPNVMFQMLLRGANAVGYKNYPDNVIREFVKQS
FT                   AQSGVDVFRVFDSLNWIKGMEVSIDAVREAGKVVEATICYTGDIDDDTRTKYTIDYYKD
FT                   MAKELVAQGTHILGIKDMAGLLKPQAAYRLIGELKDTVDVPIHLHTHDTSGNGIYTYAA
FT                   AVSAGVDIVDVASSAMSGATSQPSMTGLYYGLVNGNRQTNLDAQNSQIINHYWEDVRHY
FT                   YKDFDNALNSPQTEVYIHEMPGGQYTNLQQQAIAVGLGDRWDEVKEMYTVVNQMFGDIV
FT                   KVTPSSKVVGDLALFMVQNELTEEDVYEKGDTIDFPDSVIEFFMGEIGQPYGGFPEKLQ
FT                   KLVLKGRTPLADRPGALMEPVNFAEVKAELKEKMGYEPSEKDVISYILYPKVFLDYQEM
FT                   ISKYGDVTVLDTPTFYKGMRLGETIEVELEKGKILLIKLNSIGEPIADGTRVIYFELNG
FT                   QPREINIQDMNVQSTVIARRKIDTTNPEHVGATMTGSVIQVVVKKGDSVKKGDPLLITE
FT                   AMKMETTIQAPFDGEVSSIYVSDGDTIESGDLLIEVNRK"
FT   regulatory      115846..115851
FT                   /gene="lin1061"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        115860..116753
FT                   /transl_table=11
FT                   /gene="lin1061"
FT                   /note="similar to metal binding protein (ABC transporter)"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW0"
FT                   /protein_id="CAC96292.1"
FT                   /translation="MKWFKGIAVALLLVILTACGNTETKAPTEKTKKIEVKDATEQKIT
FT                   LKEAPTKIVSLIPSNTEILFALDLGDKVKGVSAYDDYPKEAQKIEKVTSTTVDTEKIIA
FT                   LKPDLVLGHESMLATEKDAYQLLKDAGINVFVVPDATNLKEVENSIETIGKLTGKEQKA
FT                   KDVTASMEKQKAAVEKKVKELKTSPKVWIEISPDLYTAGKGTFMNEMLELAGGTNIVTE
FT                   TGFIPYNEEKVVELKPDIILSVYPDAKATILKRAAWKDLPAVKNEQIFEMDANKLSRPG
FT                   PRLLEGAADIQAVFEN"
FT   CDS_pept        117035..117838
FT                   /transl_table=11
FT                   /gene="lin1062"
FT                   /note="highly similar to teichoic acid translocation
FT                   permease protein TagG "
FT                   /db_xref="GOA:Q92CV9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV9"
FT                   /protein_id="CAC96293.1"
FT                   /translation="MKQVMEVIKEQIKNLPMIFRIARYEDKATYQSHYLGLAWQILNPL
FT                   IQIAIYYFVFGFGMNAKSGSDASYIEWMLAGIIPWFFISAVILQGANSIYNKIGMVSKM
FT                   NFPMSILPNITIVSNLTSYFTMMVILLGLLALNGTPVTIYWGQYLYYFVAMIAFLFSVT
FT                   LFNATISVLVRDYYIMLQSVMRVLFYVTGIVWNLETMLPQWLVHLLKLNPIYYVVNGFR
FT                   ETFLMNRGFWESPSYTMYFWLITLTLLFVGATLHMKFRERFVDYL"
FT   regulatory      117837..117842
FT                   /gene="lin1063"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        117851..118858
FT                   /transl_table=11
FT                   /gene="lin1063"
FT                   /note="similar to teichoic acid translocation ATP-binding
FT                   protein TagH (ABC transporter)"
FT                   /db_xref="GOA:Q92CV8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015860"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CV8"
FT                   /protein_id="CAC96294.1"
FT                   /translation="MGKNIKIAFKHVSKEYDLYQNKSDKIKGLFMPKSQKMQSFWALRD
FT                   VSFDIHDGETVGLIGINGSGKSTISSIMSGVIPPTQGEVVINGETSLIAIAVGLKGPLT
FT                   GYENIRLKLLMHGMKSSQINKLMPSIIEFADIGDFINQPIKNYSSGMRSRLGFAISVHT
FT                   NPDILVIDEALSVGDQTFYEKCVNKINEFKARGKTIVFVSHSLGQVKSLCDRIIWMHHG
FT                   EIREMGEAKEVAQKYDEFVKWFNKQPNDYKKKYQKEHKEHQKAPQKKVYPNPNANKYRL
FT                   TLFDKFLLTALIVLTILFGTLVATGKSFKGLISETSTNQVEQIAYVDNNEITIR"
FT   regulatory      118868..118888
FT                   /gene="lin1063"
FT                   /regulatory_class="terminator"
FT   regulatory      119028..119033
FT                   /gene="lin1064"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        119046..121370
FT                   /transl_table=11
FT                   /gene="lin1064"
FT                   /note="similar to autolysin (amidase)"
FT                   /db_xref="GOA:Q92CV7"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR025987"
FT                   /db_xref="InterPro:IPR038200"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV7"
FT                   /protein_id="CAC96295.1"
FT                   /translation="MINKKWMKIVMIPMLVVPMYGLTTVSGQLQNSLTGENSFVKDAQA
FT                   ATTASQQAFIDKIAPAAQASQEKYHLLSSITLAQAILESGWGKSGLATQGYNLFGIKGK
FT                   YNGQSVIMSTSEYVNGEWIKIDAEFRKYPSWNESVTDHTLLLVNGTSWNKNLYKKVVDA
FT                   TDYKVAANELQKAGYATSPTYAASLIRVIETYDLAKYDVLYDKILTQKSTSGKATVTSP
FT                   TGNGVWTLPYKVKGVQSVSPASTYANKDIDLVSVATTKRGTYYQFKYNGKVIGWVDGKA
FT                   LTIYDSVNYDKVNVGRAKITSAPGNGIWSKPYNVYGREFVTNATTYAQQEIKLLREAQT
FT                   AKGTYYQFSINNKTIGWIDKRALTIYPYDSVISSKAVNLDGQITNPTGNGIWTKAYKLE
FT                   GTTSVAQATQYANQDVKISEVVETQHGTYYNISIGGRAIGWLDKNAITLYDQAEYNKAV
FT                   TLDGTIKNVQGNAIWTEPYRTAGTKLVAQAEKYANKDVQIVREAKTPRGTYYQFKSGGN
FT                   VIGWLDVKAFDMYDEITSNKAVNMEAVIENVEGNAVWTAPYKSVGVKLIGPASNYKDKT
FT                   VKITREAQTSRGTYYEFSSNGKTVGWLDKKAFKTYSTIEYDESYVRDAVVTNVSGHTVW
FT                   TLPYQVYGVKSVGSASNYNNKQAKITRRAKTDRGIYYQFSIDGKNVGWLDERAFDVYDT
FT                   VEYNNVINKTALLSNPTGNGIWSAPYRVIGVKNVGQATSYANKTVQLVREAKTTRATYS
FT                   QMSVDGKLIGWIDQRAFTNIR"
FT   regulatory      121391..121412
FT                   /gene="lin1064"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(121391..121412)
FT                   /gene="lin1065"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(121423..123429)
FT                   /transl_table=11
FT                   /gene="lin1065"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV6"
FT                   /protein_id="CAC96296.1"
FT                   /translation="MKFYIKEIELIESKTWKIHGFSEGKISSIQAYYNEIREYKHPEQK
FT                   LNIPFTQEKNSFTAVISIDELAEYSLPNNETAWKFKVNGDYPYNHLMSDGPIINQPFQP
FT                   SNSLYQYHFDFPEGVLTLISRPVELLASLESFSLSEKLMTGTIKINSSLPDGPFKAKLL
FT                   LKRRPTPSFYLFHEQEQSFDLGLVTDKVVSFSIPVKDLATNFLVDNTNILDAMIEISPK
FT                   EVEQGLTTFLSIDAERKPSIPKEVELASPHFATLRSYVTGSSRLSFYFKKNIQGLVSVS
FT                   QLKESGSDITLQFKLEGNFHEGQVVAKRLDKKADVFEYHMEQAWPLKKGIGKHSVRISK
FT                   SEFLAGPNNKAYATWDFFLRSKDMPDLPILVPNTIDLSNTKFFNIANKKFLAQLTKNDF
FT                   NNLSCLTAPAPKIKEDITKIAVMGTCFSRNAFNSSPFFNPDYKAFFECSFTQFHSSIIS
FT                   VMTEPAESFNLDKYNDMKPAEKTIVEEDWKKDFFVNLKESNSDYFLIDLYPDVIRPVIW
FT                   LNNKTAITLSYIIEDSQLLNDLPYERILDHIDNEAFFNEWKGYADQFIAKLTETFPADR
FT                   VILNLGGFTTSYYDENGKVVVYKNKMAIEKNNYFWDRINNYFLSKLPEAKVIDFSKKSY
FT                   IGDFNYPFGHSFSHFESAYYKDFLKELIYITKS"
FT   regulatory      complement(123435..123440)
FT                   /gene="lin1065"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      123658..123663
FT                   /gene="lin1066"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        123674..124663
FT                   /transl_table=11
FT                   /gene="lin1066"
FT                   /note="similar to dolichol phosphate mannose synthase"
FT                   /db_xref="GOA:Q92CV5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV5"
FT                   /protein_id="CAC96297.1"
FT                   /translation="MEKPFLTVVVPCYNEEEVLSESVTQLTNIIKKLVMNDSISNNSQI
FT                   MFVDDGSKDRTWELIKQYSESHEHVSGLKLSRNYGHQGALLAGLTAAHEHSDCVVSIDA
FT                   DLQDDVNAIIEFMEKYHEGFDVVYGVRDKRDTDTFFKRNSALTFYKIMSKLGVNMVPNH
FT                   EDYRLLSKRALTEFLRYKEENMFIRGIVPLLGFKSTKVYYNRNERFAGESKYPLKKMLL
FT                   FAVDGITSFSVAPIRLLLVIGSITFLVGVVLGIYAIVQKIIGGVVPGWTSLIVSIWLLG
FT                   GVQLIGMGVLGEYIGKIFRQVKERPRFTIEDNVFEMKCEKNKNNESLV"
FT   CDS_pept        124669..126759
FT                   /transl_table=11
FT                   /gene="lin1067"
FT                   /db_xref="GOA:Q92CV4"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV4"
FT                   /protein_id="CAC96298.1"
FT                   /translation="MKNKLVYTFNALFILLFGYLLCLSIFKPQTFTFEHPFVLIVLSAA
FT                   ALLVLIGIFQFSTRLNKKGDGFLTISLVILILAVQVYLLVSLQMNSYADAYVIKGESLK
FT                   MLANGGHATGQEYFMMYPNNIFITIIRYWLYAFGGMLGVSNVFLLESVFLFLCMNITIF
FT                   VLFWIIRKENGSKYANIYLIIILFCVPLLGYIWYFYTDTLVLPFASLITLFYYLYTKNN
FT                   KWWYFIIIGLLFAVGYHIKPNIIILLPAMIIHQCFIRNWRKVLLNTMVLAIFFVSLNAV
FT                   FTPLSNHYGFKKNLAIEFPQTHWVMMGLGEPAGRYNSEDVAFTNQYKTKEEKQEANIEK
FT                   IKERLKEHGPIGLAKLYNNKMINTWTDGTRAYTWYTNSALDYPASFDYFFGDKRFFTEF
FT                   AAQMFHIINLLLICLGALRFYKKRELDISFFINITLVGVWLFHLIWEANQRYILFVTPL
FT                   MIVSSIYGFKFIIESLFTEKVVLKDKLKKSFLITSFLIFLLSSVFLAFGGKMIATDKQD
FT                   INHYIVKQSYAHIALPVNNKQTISQEFTSDSPFNSIDIYVMKKPEASSSYRIKVINETN
FT                   DTIIYNQEKKGTDFPNEAYLKLSVNDNPKGNNRYRIVISEVENSHPNQPLVLGTYFDND
FT                   LDLYPYGDLYVNDDKKEYQDIGFFVTNTTSKPLMPKYAYIMFDLCIMLVFAGTYYVFKR
FT                   RR"
FT   regulatory      126833..126838
FT                   /gene="lin1068"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        126847..129171
FT                   /transl_table=11
FT                   /gene="lin1068"
FT                   /note="similar to hypothetical protein 3 (capsulation
FT                   locus) of Haemophilus influenzae"
FT                   /db_xref="GOA:Q92CV3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV3"
FT                   /protein_id="CAC96299.1"
FT                   /translation="MSKDSNKIIEQSREIGISIIMPLYNVEEVILETLESIHEQTFDSY
FT                   EVLLIDDGSTDKTIEIVTEYIKDKPRFKLYTQPNGGPASARNHGLRLAIGMYICFVDSD
FT                   DILPNYSLQLMYDGAISTGAKLITGATKRFNSEGEWFIPMHIQYNIAKPGMKTLLKNPE
FT                   LFYSIGPCAKLYHHSLIDGVFFPENIRYGEDQPFVLHALLQAKDIYTVEKVVYYYRLRD
FT                   GESQSLTQSVDKDPIRILKSVFQIFDYGEEELKKNNTDYEVALKYYQRVSSVELWGALR
FT                   AAIESKKSENQKIAFTMTLDWLKTKSDDFLNIIPSFRYFLLFSSIERVRYITKDNKENY
FT                   RNLIGYLWSRQGEEAKIAFRKTYPIPMKAALQIIENNNWRDARKISFKFIVRRKFKAPI
FT                   LIRKISRGIIFRIATLMPRKKNQVILATERSTTLEGNLLAIYDYMFYNNMPQKVYVFLR
FT                   KNRNWFEMFQLYYTLGRTKTIVLDDYYNKIYGLKFNKNTHVVQSWHATGAFKKFGFSAL
FT                   EGTDANTEEFETRAHSPYTDVLVSSEGIIPEYMEAFRKQANQIKPIGVPRTDVFFDDEY
FT                   VNYTKEKYMKMYPQLRDKKILLYAPTFRGGPNERFNYSVVLDIAALKKELGDTHILILK
FT                   FHPVIKNVSFNVEEDDPFILNLTLNNDINDLMLFSDALITDYSSVIFEFSLMNKPIYFF
FT                   AYDIDDYLDERGFYFDYKATIPGEVFRDTPSLIEAVKSGLYNYDELEIFKKKFVGSLDG
FT                   NSTKRFVETYIGKANEKVKDI"
FT   regulatory      129158..129163
FT                   /gene="lin1069"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        129168..130178
FT                   /transl_table=11
FT                   /gene="lin1069"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV2"
FT                   /protein_id="CAC96300.1"
FT                   /translation="MSIVIEQLVVKESSGKWGSPHLLEQIKNNISMSNADFLIICSKPE
FT                   ENILSQIQDYIARFPENMVGADIHLFSQNPVFLQHLRKLPNEDSYEMTDTLQFLVELTP
FT                   KPTSTYLERDPHMLLEEMGQYQLYNVSFLKNYFEERINETTLIDIFHQAKMVWKHSVLE
FT                   ETKINEAKNQVANNYRITDMVDCWEFYRKLENNYTSLRLELLDFDKNLFNYLIRTKLGP
FT                   TFQKQLMSGNLTEATEAIEALTVFLEDNDKHLVSELVSLGYFYLQVPVKEYPEWGNNKA
FT                   FSNAYLKFLNVLFEKMHYQTKQYNLRFYRRATNAVYKAVGLNSLKPIAKCYKLYF"
FT   regulatory      130192..130223
FT                   /gene="lin1069"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(130192..130223)
FT                   /gene="lin1070"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(130229..131116)
FT                   /transl_table=11
FT                   /gene="lin1070"
FT                   /note="similar to putative UDP-glucose pyrophosphorylases"
FT                   /db_xref="GOA:Q92CV1"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV1"
FT                   /protein_id="CAC96301.1"
FT                   /translation="MRVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAV
FT                   ASGIEDILIVTGKGKRAIEDHFDSVPELENNLREKNKLELLHLVEQTTNINLHFIRQAK
FT                   PKGLGDAILQAKGFVGNEPFIVMLGDDIVESKIPCSKQLMNQYEKTHSSVIGVQTVPHE
FT                   ETYRYGIIDPINEYDKNLYNVKGFVEKPDPAKAPSDLAILGRYLLTPQIFDFLETQKPG
FT                   AGGEIQLTDAINSLNEVQRVFAYDFEGERFDVGDKFGFIQTTMQFALKHPEIKEDVKAL
FT                   IDDLYQQVHKNDKK"
FT   regulatory      complement(131126..131131)
FT                   /gene="lin1070"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      131329..131334
FT                   /gene="lin1071"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        131342..132055
FT                   /transl_table=11
FT                   /gene="lin1071"
FT                   /note="similar to CDP-ribitol pyrophosphorylase "
FT                   /db_xref="GOA:Q92CV0"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR034709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CV0"
FT                   /protein_id="CAC96302.1"
FT                   /translation="MIYAQILAGGKGTRMGNVSMPKQFLPLNGKPIIVHTVEKFILNTR
FT                   FDKILISSPKEWMNHAEDNIKKYISDDRIVVIEGGEDRNETIMNGIRYVEKTFGLNDED
FT                   IIVTHDAVRPFLTHRIIEENIDAAIETGAVDTVIEALDTIVESSNHEFITDIPVRDQMY
FT                   QGQTPQSFNMKKVYNHYQNLSAEKKQILTDACKICLLAGDQVKLVKGEIFNIKITTPYD
FT                   LKVANAIIQERIAND"
FT   CDS_pept        132048..133073
FT                   /transl_table=11
FT                   /gene="lin1072"
FT                   /note="similar to glucitol dehydrogenase"
FT                   /db_xref="GOA:Q92CU9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR034710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU9"
FT                   /protein_id="CAC96303.1"
FT                   /translation="MINQVYRLVSERQFEVANVDESLAGDVVVVRPTHLSICAADQRYY
FT                   TGSRGKEMLSKKLPMALIHEGVGEVVYDATKEFKPGTKVVMIPNTPFENDPVIAENYLR
FT                   SSKFRSSGYDGLMQDYVFMRRDRVVALPDDINMKVAAFSELISVAVHAILRFEGKSNAN
FT                   RDSFGVWGDGNLGFITSLLLKNWYPESKVYIFGKTPYKLDFFSFVDGAYSIDDVPADLV
FT                   IDQAFECAGGMGSQYAVSQIIDVIKPEGTISLLGVSEYPIEFNSRMVLEKGLTVYGSSR
FT                   SGRVDFEKTVEFLSTNKRGVEYLQNLVGEVHTVHSIQDVIEAFEADLRSPWGKSVMEWK
FT                   I"
FT   regulatory      133199..133204
FT                   /gene="lin1073"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        133214..134602
FT                   /transl_table=11
FT                   /gene="lin1073"
FT                   /note="similar to galactosamine-containing minor teichoic
FT                   acid biosynthesis protein GgaA "
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU8"
FT                   /protein_id="CAC96304.1"
FT                   /translation="MKFAIIIPFYNAEKRLALSIDSIIKQTYSFLKHVEVLLINDGSTD
FT                   RSSAIAHSYAEKYPSNIRVFDVPNGGPSKARNIGIHNVQEDTDFVGFLDADDLLSPNML
FT                   FSMVNFLEKSAVNMLVPAFYYLDDFGKKQKISPHKLNDRFTNGNRVVAIEKEPQAIHFY
FT                   IGGTFFRFESLKQFVFDETLNFAEDQLLITKFLLENRSYGLIADAGYYYYRDLKQKGSL
FT                   VSSAWKQPERYTPFLQKVYQTYLTNSKEIFGEVIPYVQYLIAYHAKLFFYKENIYFKEV
FT                   LNEQEQEIFVRELQKILQEVGPEMIVALDTPLVVKEMMLSILRNGWPVQFKTAELEEVP
FT                   LVTVKENYRPGKAVTVELLLEEARETLSDGGEFFASTSVGTAQTKVVKRKTAQTIWDIV
FT                   VREEGTLEKVVTRLKPYQLKVQVFYQDKNQKITMTDLNVIKSVLGKLKRNKALKRKFKQ
FT                   GGVS"
FT   regulatory      134586..134591
FT                   /gene="lin1074"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        134602..135756
FT                   /transl_table=11
FT                   /gene="lin1074"
FT                   /note="similar to B. subtilis TagF protein (probable
FT                   CDPglycerol glycerophosphotransferase)"
FT                   /db_xref="GOA:Q92CU7"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU7"
FT                   /protein_id="CAC96305.1"
FT                   /translation="MKFVQKIYYFLFKLVGFLPRRKELVMFESFSGKQYSCNPRAIFEY
FT                   MEEHNPEYELLWSVNPKYVDLFEAHGVPYVKRFSVNWLFKMGLAKFWISNSRLPLELPK
FT                   PKKTIYVQTWHGTPLKKLGVDIDEVHMPGQTTEQYKADFVKEAQKWDYLISPNAYSSTI
FT                   FRRAFGFTGEMIESGYPRNDILFSADKELKIANIKMALNIPEDKKVILYAPTWRDNDFY
FT                   EIGKYKFDLKIDIAKMQEKFGDEVVLLVRMHYLVAEHFDFTQYGDFVRDASKHEDIRDL
FT                   YLVSDLLITDYSSVFFDYANLKRPMLFYTYDLAEYRDTLRGFYFDFEQNAPGPLVEMND
FT                   ALMAEIEIMLENPPQIAESFLEQFCTWEDGHAAEKTVKKVFAEK"
FT   regulatory      135755..135760
FT                   /gene="lin1075"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        135769..136920
FT                   /transl_table=11
FT                   /gene="lin1075"
FT                   /note="similar to teichoic acid biosynthesis protein B
FT                   precursor"
FT                   /db_xref="GOA:Q92CU6"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU6"
FT                   /protein_id="CAC96306.1"
FT                   /translation="MKKIAIYMYMLAVKIIGFLASLLPVQQKVVFLISFEENPTAIIKQ
FT                   MKLSNVTPKTIVFYDPRVDVSKLSLDFIKVKPKTLQQFIPLMFHLNTAKVVVTDNYFVE
FT                   LAGLKLRNGVNCIQVWHANGALKKFGWEDKAAQKRSDRDKKRFQEVYKRFTKVLVGSDE
FT                   MASIFKKSFLLDESNMLKLGVPRTDYFFKEAQLQENYQWSYEHLHLTNRIKLLYAPTFR
FT                   DNELGMAKLHLDIAEMKQALGNEYQLILKLHPSISNDLEKLDDDFVIYVDKETPIETLL
FT                   PVVDILITDYSSIPFEFALLQKPMIFFTYDLTEYNNARGLSDGFLETIPGPHVFTTTEL
FT                   IEVIQNNTFDLEKVRLFAEKWNKYSDGFSSERFVSFLKEQLEK"
FT   CDS_pept        136985..137368
FT                   /transl_table=11
FT                   /gene="tagD"
FT                   /note="highly similar to glycerol-3-phosphate
FT                   cytidylyltransferase (gct), CDP-glycerol pyrophosphorylase
FT                   (teichoic acid biosynthesis protein D)"
FT                   /db_xref="GOA:Q92CU5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU5"
FT                   /protein_id="CAC96307.1"
FT                   /translation="MKKVITYGTFDLIHWGHIRLLERAKALGDYLIVAISTDEFNRIKH
FT                   KEAYHNFEHRKLILEAIRYVDEVIPESNWEQKLEDVKNRDIDIFVMGDDWEGEFDFLKP
FT                   YCEVVYLPRTDGISTSKIKDDLK"
FT   CDS_pept        137486..138976
FT                   /transl_table=11
FT                   /gene="lin1077"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YueK protein"
FT                   /db_xref="GOA:Q92CU4"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU4"
FT                   /protein_id="CAC96308.1"
FT                   /translation="MTNLFQDDSLTLHTDLYQLNMMKAYFDDGLHERRSVFEVFFRDMP
FT                   FDSGFVVFAGLERIINYMQNLRFTETDIAYLHDELGFDGPFLEYLRNFKFKGNILAAKE
FT                   GEFVFKTEPILQVEASLAEAQLIETALLNIVNFQTLIATKAARIRSVIDDETFAEFGTR
FT                   RAQEMDAAIWGTRAAYIGGCDSTSNVRAGKIFGIPVSGTMAHAMVQAYRDELEAFRSYA
FT                   KTHFDSIFLVDTYDTLKSGVPNAIKVAKEMGDKINFIGIRLDSGDMAFLSKKARQMLDE
FT                   AGFTEAKIFASSDLDEHTILSLKAQKAKIDSWGVGTKLITAYDQPALGAVYKMAAIADE
FT                   NDILQDSIKLSSNTEKVSTPGKKKVYRIITNEDGLKAEGDYIALADESLENVDKLTMFH
FT                   PVHTYIMKTVENFTARELLVPIFKDGELVYDMPTLDEIKAYKEENLALLWDEYKRTVRP
FT                   EQYPVDLSVKCWKNKMRNIEKVRKSVQLHSPVELDMPF"
FT   regulatory      138975..138980
FT                   /gene="lin1078"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        138988..139812
FT                   /transl_table=11
FT                   /gene="lin1078"
FT                   /note="similar to NH(3)-dependent NAD(+) synthetases,
FT                   nitrogen regulatory protein"
FT                   /db_xref="GOA:Q92CU3"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CU3"
FT                   /protein_id="CAC96309.1"
FT                   /translation="MEIRERILADMQVAETIDAHEEIRKSVEFLKAYLKKNTFLKSFVL
FT                   GISGGQDSTLTGKLAQMAISELRAETGDDEYQFFAVSLPYGTQLDESDRQDALDFMAPD
FT                   NRLTVNIKASVDASVAALAEAGVELSDFAKGNEKARERMKVQYAIAAMHKGVVVGTDHS
FT                   AEAVTGFYTKYGDGGTDINPLFRLNKRQGKALLKELGCPEHLYLKKPTADLEDNKPALP
FT                   DEVALGVTYDQIDDYLEGKEVPADAAAKIENWFIKTEHKRHMAITIFDDFWK"
FT   regulatory      139811..139816
FT                   /gene="lin1079"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        139825..140133
FT                   /transl_table=11
FT                   /gene="lin1079"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU2"
FT                   /protein_id="CAC96310.1"
FT                   /translation="MKVGYGLLTAFYTHPGEKDNLVKILLEAAEGLDDYNTCIQYIVSE
FT                   SETEPDTVFVSEIWVDKGHHKASLDNPAVQETIKRAKPLIKDIKQIQELDILGGKGI"
FT   regulatory      140149..140173
FT                   /gene="lin1079"
FT                   /regulatory_class="terminator"
FT   regulatory      140180..140185
FT                   /gene="lin1080"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        140194..140598
FT                   /transl_table=11
FT                   /gene="lin1080"
FT                   /note="similar to PTS system, cellobiose-specific IIB
FT                   component (cel A)"
FT                   /db_xref="GOA:Q92CU1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU1"
FT                   /protein_id="CAC96311.1"
FT                   /translation="MQTLMIVCAGGATSSLMAQNVVKSATSEGMDAVLLFPDDVKYKDS
FT                   FLEKYSERDLIVVMGPVGAITAGKFRDYKEQVDAVLVAPQVKYMYKTVEEVLGELNIPC
FT                   ANIDSLDFGRMRGDKILTQGLALMDAKNSK"
FT   regulatory      140718..140723
FT                   /gene="guaA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        140727..142283
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /note="highly similar to GMP synthetase"
FT                   /db_xref="GOA:Q92CU0"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CU0"
FT                   /protein_id="CAC96312.1"
FT                   /translation="MFKIMKDFTEQEKIIVLDFGSQYNQLITRRIREFGVYSELHPHTI
FT                   TVEEMKALNPTGIIFSGGPNSVYDEDAFRADERIFDMGIPILGICYGMQLMTTHFGGKV
FT                   ERAKDREYGKADIHVENPSRLFAGLPTDQVVWMSHGDLVVEEPAGFEVTATSKSCPIAG
FT                   IADEDRLLYGVQFHPEVRHSAYGNELLKNFALNICGCKGDWTMENFSEVEIAKIQEIVG
FT                   DKKVLLALSGGVDSSVVGVLIHKAIGDQLTCIFVDHGLLRKGEADQVMATLQGEFNMNI
FT                   IKVDAKKRFMDKLAGVSDPEQKRKIIGNEFIYVFDDEANKLDGVEFLAQGTLYTDIIES
FT                   GTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGP
FT                   GLGIRVLGEITEEKLEIVRDSDYILREEIKNAGLEREIWQYFTALPNIRSVGVMGDGRT
FT                   YDHTVVVRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDHVNRVVYDITSKPPATVEW
FT                   E"
FT   regulatory      142293..142325
FT                   /gene="guaA"
FT                   /regulatory_class="terminator"
FT   regulatory      142416..142421
FT                   /gene="lin1082"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        142430..143593
FT                   /transl_table=11
FT                   /gene="lin1082"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CT9"
FT                   /protein_id="CAC96313.1"
FT                   /translation="MRKKLIEQILISPSPFSIFEENYNELRNTRFLLFDNNSNNFGKKF
FT                   QKMEFNNFTISPLAEYHNTMVLDQYTVKESRELEVVHCVDFDSNIISNLRKLFFHTNYS
FT                   NEYLIKLLLYVKKERIQPNCSPYLIECAANNFNLDKQDIYESLLSFSLLENTNIEQLIT
FT                   NHLNKEPSSTDYLDTDERWRSLIELKKYATKEYIPRYYYIYCLLLKMYFLKFSSKKSAK
FT                   NKLIQLLDSINTELFSYWENELVICYLSLKEDSKTDSFFGSVKPNTKDMLIKIQGMAWD
FT                   LFHLRCAHEHMAERNNYSKRIFLHSFSSEDKGLNSIIRLNPIKRIAFDGKDVYTHHRYT
FT                   IFNMCPEVDVYTILNEYTHHRNKMCKETNYQELSKKLEFELLHLSSR"
FT   CDS_pept        143735..144385
FT                   /transl_table=11
FT                   /gene="lin1083"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CT8"
FT                   /protein_id="CAC96314.1"
FT                   /translation="MGPSYAVFMNSPYVTEKGLRFIDSMKPLRMNKKNQMEQKRVFLER
FT                   VENKDEDLNISNYRVDSDDYLEIVKLAIEEELVLGICIKYASNKGIVIHSNAHLSSKGI
FT                   EYLDNPDLVETESKVNVAPSQVINIYGGDQRGAGFGMNATINNNFDNSLEELGAFISRL
FT                   SENEQKEANEILDAIKNGDIKPGMLSRFSTFLESHPNLGAYTGKAIVWALTKL"
FT   regulatory      144405..144429
FT                   /gene="lin1083"
FT                   /regulatory_class="terminator"
FT   regulatory      144670..144675
FT                   /gene="lin1084"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        144683..144967
FT                   /transl_table=11
FT                   /gene="lin1084"
FT                   /db_xref="InterPro:IPR021477"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CT7"
FT                   /protein_id="CAC96315.1"
FT                   /translation="MTKIRINKEKMNNHATTLGESAGKLDYYPLKNENMSYTQTNSIHL
FT                   FRESLLELLEGIENLGSVAQDDATRIKQMGEAFAKQDKSISQKMNLEVR"
FT   regulatory      144954..144959
FT                   /gene="lin1085"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        144968..145324
FT                   /transl_table=11
FT                   /gene="lin1085"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CT6"
FT                   /protein_id="CAC96316.1"
FT                   /translation="MDKRTQELGEIKKEMEREDDALYAIKNKIRHLEDVEEDIHQARRE
FT                   MDDILYHMKEAWRGEHAEDTFWQIEDEVNHYNRKTACMTTDIQTELNNEQKKHQQNLHA
FT                   LETKQQDITKEMRL"
FT   regulatory      145308..145313
FT                   /gene="lin1086"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145321..146718
FT                   /transl_table=11
FT                   /gene="lin1086"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CT5"
FT                   /protein_id="CAC96317.1"
FT                   /translation="MTRIDIAEVNHFSHELKIANQQAKTQITAIQNAIIAYLQDDSLSG
FT                   EAISASKGYYAATYLPLCASIKQALHVSEESLRKYITDFHSQVDSSPSAKIDAEGLYEL
FT                   DQKINRLENKLEHIQLELSSMTAVSRQGEINALQTQIFANYKKEQLLEKFLDFERAHSH
FT                   FFQELSDLARAINRGVRDIQANISFNSQTGMYKVDKLNASNFERLVDLYASQKAIDDKV
FT                   KAMEDIGMLPYIPEGNRAGYVTTNGKLNTEATLDLVNQQMIYWQNETGMRELFGVGAFY
FT                   RVVYGLDAVTAERIGGGQRLVDGSTVFLQYVGAFGVSGFYAEFGQVRKLDYLPTSGIKL
FT                   KTSPWETTTVLGTFKDDTKYVLEELGNIKSTDFSMKKNRFNLLNTPDDLYKTPNQFWAE
FT                   YNQPWLDKVIARNDDVILSTEPIEDNLYRINRETGLKELTGFGKEYNYLLEHGYKYDSK
FT                   SSKMIKK"
FT   regulatory      146717..146722
FT                   /gene="lin1087"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        146731..147150
FT                   /transl_table=11
FT                   /gene="lin1087"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CT4"
FT                   /protein_id="CAC96318.1"
FT                   /translation="MDFYKEVEKIFKGYEQNYQLKLTKIDNNEVAFIGENYALGIGWST
FT                   DGVDLHYFKLDNSTLSKFSLDNLLNRNLTKIEREGILPSTTIYEKIINELIICERGFNN
FT                   HFQELLQGETLSGYGNKEFVSNLEKSIIERELLTR"
FT   regulatory      147223..147228
FT                   /gene="lin1088"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        147236..147709
FT                   /transl_table=11
FT                   /gene="lin1088"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CT3"
FT                   /protein_id="CAC96319.1"
FT                   /translation="MEFKHEVENIFADIIQEYQFNLIKVNEDEILLLHPNYALTIWKSR
FT                   EGIDVYYLFLHSLEKVKITNFLFSNYEKDLLANITPANNLTNQISNSLLIHARGLSKYF
FT                   PELLSGQNDWVKEFKENKFYNEPRAINKDEYSAYQTIIKNINGKKIEGFQNEI"
FT   regulatory      147685..147690
FT                   /gene="lin1089"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        147699..148136
FT                   /transl_table=11
FT                   /gene="lin1089"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CT2"
FT                   /protein_id="CAC96320.1"
FT                   /translation="MKYEADFINRFKSLIEEFQLNYKVISEEELALFGSNFAHVFLIHF
FT                   DEVSLNYVCRDKDNSLVSYDVWSYFLHVFDDKDRENLPKYNSVQERVDISFLILARGLP
FT                   RHWSSVLNGDDKWLEDYKQYELARVPRKVMGDLKDCLSLYI"
FT   regulatory      148526..148531
FT                   /gene="lin1090"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        148540..148875
FT                   /transl_table=11
FT                   /gene="lin1090"
FT                   /db_xref="GOA:Q92CT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CT1"
FT                   /protein_id="CAC96321.1"
FT                   /translation="MNEFPVVYEPEYMTIYLLVIIGVFSTTLALSLEKYKFTLAGKALI
FT                   GMCFISLAVLFIYVLELAYLSDTADLLFHTIGVWEVVLFTHPYIFLILAILLGGEKKPP
FT                   HVPKPKK"
FT   regulatory      148898..148925
FT                   /gene="lin1090"
FT                   /regulatory_class="terminator"
FT   regulatory      149065..149070
FT                   /gene="lin1091"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        149077..149379
FT                   /transl_table=11
FT                   /gene="lin1091"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CT0"
FT                   /protein_id="CAC96322.1"
FT                   /translation="MKSQQTFMVEVTFYSSARKTVPEAGYRPHFVMELDEDREYLGVEI
FT                   YDIEVDTLDSVGYAMCSFLYEQEGVGYSKIQPNRSFMVMEGASVVGRGKIVSFHL"
FT   CDS_pept        149550..150002
FT                   /transl_table=11
FT                   /gene="lin1092"
FT                   /note="similar to E. coli YjaB protein"
FT                   /db_xref="GOA:Q92CS9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS9"
FT                   /protein_id="CAC96323.1"
FT                   /translation="MILINKRAEKQDYQTILAIWEKSVIVTHDFLTAEDRQFYKEQIPL
FT                   FLDNVELFLWFAGEEVIGFSGTSERELDMLFLDPVATGNGYGSQILGWLIENKRINLVD
FT                   VNEQNENATRFYLKHGFVVSSRSDLDGFGKPYPILQLQLKERVNGV"
FT   regulatory      149977..149982
FT                   /gene="lin1093"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        149992..150447
FT                   /transl_table=11
FT                   /gene="lin1093"
FT                   /db_xref="InterPro:IPR011235"
FT                   /db_xref="InterPro:IPR038231"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS8"
FT                   /protein_id="CAC96324.1"
FT                   /translation="MEYEQLLQSELGELEIIREELQNKEYRGMIVKTAKDGTTIRTRLA
FT                   KKTDKKTGYFVAFWEKDELGKNCPFDENDSADFLCIVVIDGDLNGLFVFPRQCLIEKGI
FT                   LTSEVGIGKMAARFYPSWCQDLNKTAEKTQAWQQVYFKNYSIRKEDH"
FT   regulatory      150432..150453
FT                   /gene="lin1093"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(150436..150457)
FT                   /gene="lin1094"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(150461..151483)
FT                   /transl_table=11
FT                   /gene="lin1094"
FT                   /db_xref="GOA:Q92CS7"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS7"
FT                   /protein_id="CAC96325.1"
FT                   /translation="MAKNGVDTMKRWKKTTIVISAIIVILVAILFIGNDFEMNETRVAI
FT                   PTTGGKLSAVVTTPKHEKPKGIIVFVHGDGAQEATQNGGYKPLMERFAKQGYISVSWDK
FT                   LGVGKSSGNWLNQSMDDRANEVNQVIEWMKIKYPDSTTKIGLWGASQAGWVIPKAMNAN
FT                   NEIAFSILAAPAINWMRQGEYNTGWQAKDAGKTTKEVKQAQQNFLTDSTLISNNKTYES
FT                   YKKNGGKEKMTPDRYNFIRKNMNQDATLDLSKVKAKIYLVLAEKDKNVDSAETKDVYTK
FT                   QIKKENLETKTIKNVSHQMINPAIANSELLINIVGLMVPKYFLVDDAYLDYCEQVVSKQ
FT                   "
FT   CDS_pept        complement(151456..152052)
FT                   /transl_table=11
FT                   /gene="lin1095"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q92CS6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS6"
FT                   /protein_id="CAC96326.1"
FT                   /translation="MTLSIKSINSFEKENIVEEVTSLVFAGFKSKFTKTLFKETEARDI
FT                   IYAFCHYIYTEQGENLLIAIQDELICGCMFVTSKSDSHQKLYQNLRKFLSFSQCLKLIF
FT                   FLSLLSHKPVQNERYIDFITVSPNFRGQGIGKTLISHCLETFHDEQITLYVAKNNNGAC
FT                   KLYRTIGFQVIQKENSTLMGVLTGIKEWQKMEWIQ"
FT   CDS_pept        complement(152049..152768)
FT                   /transl_table=11
FT                   /gene="lin1096"
FT                   /note="similar to transcription regulators "
FT                   /db_xref="GOA:Q92CS5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS5"
FT                   /protein_id="CAC96327.1"
FT                   /translation="MLTLSTGEIAQLFQISKYKIRHYIDEGILVPKRNPENGYYYFEEA
FT                   DIYRLYQIILFRKIGFSIQEIKESLLSEKVTPMLEQAEQDLQQKIEELVEIQKTIQKII
FT                   HSQKEMRLNEITFVAKDDRYFKKVPNQIIDNNTINYAQAAKHNLPDLEEPFYIFSKQDT
FT                   GIICLKSIKKRSDYTFPAGEYACKSFIAKDEATIETQIQLFLEELKRPTTSMILYENIY
FT                   PSLAYPDAMVYTMEVPL"
FT   regulatory      complement(152060..152065)
FT                   /gene="lin1095"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      153008..153013
FT                   /gene="lin1097"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        153018..154733
FT                   /transl_table=11
FT                   /gene="lin1097"
FT                   /note="similar to ABC transporters, ATP-binding proteins"
FT                   /db_xref="GOA:Q92CS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS4"
FT                   /protein_id="CAC96328.1"
FT                   /translation="MIDKRLFQLVEKKSLVLLILFRVLSLGLMIGLWLIFAQQLTHYLE
FT                   GQSVNWLWLIGTVVVVLVGKAILTKLAEKQIYQASAELRLSMRRAVMEKAFRLGNNEGQ
FT                   LPASTLTQLAVDGIEQLEIYYSRFLPQLFYCLIASLMIFGSLVGFAWQPAIVLLICMPM
FT                   IPIVIMAVMKIAKRILSGYWSDYTNLGTKFHENLSGLSILKAYDQDKYKQEEIVSDAER
FT                   FRKATMSLLSMQLNSITIMDIISYSGAALGIGMSLIMFTNGNISMTGMLMFLLLSAEFF
FT                   IPMRQLGSLFHVAMNGISACSKLFAYLELKEQVYGSEELAKPLEKMEVRHLTYTYEEGK
FT                   AKALQDISAHFNKGSFSALVGKSGSGKSTFVRVLLNQLPGYQGEIIWNDVPLASLSGEA
FT                   IRKQAVLVDNHGYLYANSIRENLLIGNSAANDSDLWNVLEQVSLADFVRKLPEQLSENL
FT                   EENGSNLSGGQRQRLLLARALLRQAEVFVFDEITSGVDLESEKIILLVLQKLAKEKIVL
FT                   FISHRLYNVLDADQVLIFDAGKLVEVASPERLQQESNYFKNYFLEEEALLKGGA"
FT   regulatory      154721..154726
FT                   /gene="lin1098"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        154735..156381
FT                   /transl_table=11
FT                   /gene="lin1098"
FT                   /note="similar to ABC transporters, ATP-binding proteins "
FT                   /db_xref="GOA:Q92CS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS3"
FT                   /protein_id="CAC96329.1"
FT                   /translation="MSEWTIIGWLLKFVKPLRGKMILAILLGIISNLSVIMISLIGTYG
FT                   IIAVILKQPLNPYKWLFVMVACGVVRGLARYSEQYLNHDIAFRLLAIIRERIFATLRKL
FT                   GPARLSGKKSGDLVAAITTDVEALEVFFAHTISPVFIAVGTTIVTVGFLATYDVGLALI
FT                   LLLGQILVGVVLPMISYKRNKKIGTAYQKEFVGLNQMVMENIASLQDIFQFKLGEERLG
FT                   KLEEQGEKLNKQYKKRIRQGSELQIFGEWVLIGTATLILVLGSLWQLPLETVLIGTVLS
FT                   LSSFGSVLALNALGTALLTTFASGKRLYTLTEEKPVVLFNGQLELSDFESAELDKVSFS
FT                   HDGKQPLLNEISLALPKGKWLGIGGESGSGKSTLVKLLMRYWDPDGQIKLNDNALPEIT
FT                   ESSLHRLEGVMEQSTFLFEDTLGNNIRLGKKDATLEEVKEAARKAAIDTWIETLPESYD
FT                   TIIGGQSRNLSDGERQRIGLARLFLHDAPLLLLDEPTSNLDYINEQAILNTLRLEIQDK
FT                   TVLVISHRATTLDLAEEQLFIENGALKRAVK"
FT   regulatory      156388..156410
FT                   /gene="lin1098"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(156593..157300)
FT                   /transl_table=11
FT                   /gene="lin1099"
FT                   /db_xref="GOA:Q92CS2"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS2"
FT                   /protein_id="CAC96330.1"
FT                   /translation="MISMKFLLVYLVVKSSLMNLMIIFYNVIIKFNINSIKQVFIMIYY
FT                   KDKLKTIGTALTSLSFIFLFGLLTLLSIEKPESFYYGLITLFFIGYLIVKLLLPPKEWI
FT                   QVTKNAFIIHTRNKTKTIHLANVKRISYNFQPFRRFLKYQVPETMELFFQTENKMEKID
FT                   CAFIGRNNFVELINQFDAKLASLSEDIIEHDHRYPLDLVYGVFIFGIVMLFLIFILLFG
FT                   REFLFEQIGKVFV"
FT   regulatory      157278..157283
FT                   /gene="lin1100"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        157290..157760
FT                   /transl_table=11
FT                   /gene="lin1100"
FT                   /db_xref="GOA:Q92CS1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS1"
FT                   /protein_id="CAC96331.1"
FT                   /translation="MEITLQQPTTADFPFIEWLWGDLATTEVLGGPFSFPEETRMDWLK
FT                   SKSQASNAYFIIKKGTESVGEVSFRDFEKGTAHLNIKVAACYRGQRIAQKALQLFLDFF
FT                   QTDCGGIVLLDEVRRENEAGIGFLVKAGFEVIEEKEWTMVLKWSVQAEGSFE"
FT   regulatory      complement(157311..157316)
FT                   /gene="lin1099"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      157801..157830
FT                   /gene="lin1100"
FT                   /regulatory_class="terminator"
FT   regulatory      158060..158065
FT                   /gene="lin1101"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        158071..159624
FT                   /transl_table=11
FT                   /gene="lin1101"
FT                   /note="similar to internalin, putative peptidoglycan bound
FT                   protein (LPXTG motif)"
FT                   /db_xref="GOA:Q92CS0"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS0"
FT                   /protein_id="CAC96332.1"
FT                   /translation="MKKTIKITTSLLLSFACVFSVGDFTKPHTVEAETVYSLTNPKPIN
FT                   EIFSDPKLAQVVADWLKLPSATSAVTQSQLNTVKSLHFDSKGVQSLEGVEYLKNLTQVF
FT                   GYGNQVSDLGPLSNLTQLEIIQMPRNQISDLTPISNLTALMSLDFEFNNLQTIEPIKNL
FT                   TNMLELNVSANPISDISAVKNMTQLEFLTIRDCEVSDLSPVENLSNMLMFWAGRNNISD
FT                   ITPLKNMPKLLGLSLFGNQIKDVSVVKNLTSLEDFDLKANQVSDISSLATSTTLETLTL
FT                   SFNQIIDISPLKNLTNLTRLELENQTRVLDAVEVDNPLILPAPVIDENGSRVQPTKVSH
FT                   AGIYANGEITWEGLQSNYILNYEYNLPVAIGSLTTTYSGKITQPLLEKPVDPITPVDPV
FT                   DPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPIDPVNPVDPITPVDPSNQVNSTDP
FT                   VKSVLQATETLIKQTISVNPIVAKDNRNLPKTGDSGMTSSLVGGLILAVSSLVLLRKRK
FT                   "
FT   regulatory      159630..159654
FT                   /gene="lin1101"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(159630..159654)
FT                   /gene="lin1102"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(159658..160005)
FT                   /transl_table=11
FT                   /gene="lin1102"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR9"
FT                   /protein_id="CAC96333.1"
FT                   /translation="MELTKENFKKLDQIHLSLENRHSMSEIIDILSESYIEITQSGVVK
FT                   DFSYYKSLKTLGDSALEIMNYDIKILDETKVLSYYKLKNLSENSYTMRSNIWIFENGSW
FT                   KLTFHQGTKIV"
FT   regulatory      complement(160036..160061)
FT                   /gene="lin1103"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(160070..160642)
FT                   /transl_table=11
FT                   /gene="lin1103"
FT                   /note="similar to ATP-dependent Clp protease proteolytic
FT                   component"
FT                   /db_xref="GOA:Q92CR8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR8"
FT                   /protein_id="CAC96334.1"
FT                   /translation="MAENKNNENITNILTQKLIDTRTVLIYGEINQELAEDVSKQLLLL
FT                   ESISNDPITIFINSQGGHVEAGDTIHDMIKFIKPTVKIVGTGWVASAGITIYLAAEKEN
FT                   RYSLPNTRYMIHQPAGGVQGQSTEIEIEAKEIIRMRERINRLIAEATGQSYEKISKDTD
FT                   RNFWLSVNEAKDYGIVNEIIQNRDGIK"
FT   regulatory      complement(160652..160657)
FT                   /gene="lin1103"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(160770..161177)
FT                   /transl_table=11
FT                   /gene="lin1104"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR7"
FT                   /protein_id="CAC96335.1"
FT                   /translation="MFNQAKRISTFFTFNGNGEEAFNFYLDTFPDAKKIGLTYFTKPEQ
FT                   GGDIGKVLNATFEIKGASFMIMDMTNNASPDFSWATTTLYFADTEDEFDTLFEKLAKEG
FT                   TVMMGPEEVEALRKVAWVTDKFGITWQLAFV"
FT   regulatory      complement(161186..161191)
FT                   /gene="lin1104"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      161257..161261
FT                   /gene="lin1105"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        161269..161748
FT                   /transl_table=11
FT                   /gene="lin1105"
FT                   /note="similar to uroporphyrin-III C-methyltransferase"
FT                   /db_xref="GOA:Q92CR6"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR6"
FT                   /protein_id="CAC96336.1"
FT                   /translation="MKYPIMLDITGKRVVIIGGGKVALRKVKGLLHTGADILIVGLDVL
FT                   PEIKELQVQVKEEAYRAEHLAGAFLIFICTNNPEVNQMVLKDCLPEQLVNDTTEQKNSD
FT                   FFNMATVSKNELLVGISTGGGNPGYAKKVKREVSQLVENLETEEIGNRNKKDKTC"
FT   regulatory      161733..161750
FT                   /gene="lin1105"
FT                   /regulatory_class="terminator"
FT   regulatory      161858..161863
FT                   /gene="lin1106"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        161867..163231
FT                   /transl_table=11
FT                   /gene="lin1106"
FT                   /note="similar to Salmonella enterica PduS protein"
FT                   /db_xref="GOA:Q92CR5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017054"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR5"
FT                   /protein_id="CAC96337.1"
FT                   /translation="MSQMSILEKIKDAGVVGCGGAGFPTHAKFSGEVEYLIINAAECEP
FT                   LLKTDHFVMRNHAVETIKAIEMVKNQVGAEFAVIATKRYYTEEIAALRSAITELNASVT
FT                   IHEMDNVYPTGDEQVMVFEVTGRVVPPSGIPLMVGCIVSNVSTMWNVFHAIQDDAPVIR
FT                   KQLTVTGAVGEPKLLDVPVGTPFEVCLAAAGGTNLDEYLFLDGGPMMGKLNDQSTIAEK
FT                   VVTKTTSGLIVAEDTGYLHKLHYQTVEQIFNETKSACIQCSLCSDLCPRQQLGHDIHPH
FT                   KVMRHFAVAEDITDIKPDPIWEEAMICCECGICEVIACPMGLSPRQVNIHVKKELLKQG
FT                   VRYQTDKKEFTPDPMRDYKSIAPKNILIKMGLQQYADVHLETMHYLDVDEVFIPTKMHI
FT                   GAPSIPVVSEGDIVKKGDLIAKIPDTALGANIHASIDGQIIRITEEQVHIKRVMS"
FT   regulatory      163214..163219
FT                   /gene="lin1107"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        163228..163782
FT                   /transl_table=11
FT                   /gene="lin1107"
FT                   /note="similar to Salmonella enterica PduT protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR011238"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR4"
FT                   /protein_id="CAC96338.1"
FT                   /translation="MKMDTLGFLELNSISKGIEAVDTMLKAANSELIYAKASCPGKYYI
FT                   LIAGTVDSVAQSIEAGTKIGAANIVGNLVIPRVSDQVIKAINKTEVPDEMNAVGVMEYY
FT                   SCSGSIIAADAAVKAADVQLMDIRLATGIAGKSFVVLTGDTAACEAAVEAGLAAAKEEA
FT                   LLINKVVIPRPRKEVFESLIY"
FT   regulatory      163917..163922
FT                   /gene="lin1108"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        163930..164280
FT                   /transl_table=11
FT                   /gene="lin1108"
FT                   /note="similar to Salmonelle enterica PduU protein"
FT                   /db_xref="GOA:Q92CR3"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR3"
FT                   /protein_id="CAC96339.1"
FT                   /translation="MSFDDNKERVIQEYVPGKQVTLAHLIANPNRDIYTKLGLEEGASA
FT                   IGILTITPSEASIIASDIATKSGDVRIGFIDRFSGSVVLTGDVSSVESALQQVVYSLHE
FT                   ILDFSIPKITRS"
FT   regulatory      164272..164277
FT                   /gene="lin1109"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        164286..164717
FT                   /transl_table=11
FT                   /gene="lin1109"
FT                   /note="similar to Salmonella enterica PduV protein"
FT                   /db_xref="GOA:Q92CR2"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR2"
FT                   /protein_id="CAC96340.1"
FT                   /translation="MKKMMVMGSVGCGKTTLCQKLHGYDILYKKTQAVEYFQEMIDTPG
FT                   EFVQHRQLYSALTVTSADASVIAILQSVTEKKQTFSPMFASIFAKPVIGIVTKVDLAES
FT                   DKDIERAERELRMAGAKHIFYISSVEETGIEELRAYLED"
FT   regulatory      164730..164734
FT                   /gene="lin1110"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        164742..165485
FT                   /transl_table=11
FT                   /gene="lin1110"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR1"
FT                   /protein_id="CAC96341.1"
FT                   /translation="MPQVRDLSVIDVPGGCVLTSCDISAGFGEKVHDGLRVAPEVTARL
FT                   TLRVALLEMLASGAVVVAVSDVIGAEMEPTGKRVIAGLKDELFKADLGHIELNGSTEEN
FT                   MNVTQTSVGVLVTGFATKAALKLINVHEAAVLFAFGEPIVGAEVLQRMMEMPDYPLVKQ
FT                   LVSDSRVLEVVPVGSKGMAYEANTLARLNDCVFEASGVFNEATMNKTAGPASVILVAVK
FT                   ASEVKAFEQNFPAAKCLGELRNYHG"
FT   regulatory      165465..165470
FT                   /gene="lin1111"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        165478..166035
FT                   /transl_table=11
FT                   /gene="lin1111"
FT                   /note="similar to bifunctional cobalamin biosynthesis
FT                   protein CopB, (cobinamide kinase; cobinamide phosphatase
FT                   guanylyltransferase)"
FT                   /db_xref="GOA:Q92CR0"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR0"
FT                   /protein_id="CAC96342.1"
FT                   /translation="MAEMMLVTGGARSGKSNFAEKEAAKYDRVLYVATGIAFQNDTEFQ
FT                   ARIKKHQATRPEHWDTFEAFKGIATYLEQHGNQYDVIMLDCVTMLVTNLFFSLLGEREL
FT                   TNEIADEVEAAIQSEVRAILKAGKQSSAKLIFVTNEIGLGVVPENKLTRVFRDIIGRIN
FT                   QQIATEVEEVYFVVSGIPKRWK"
FT   regulatory      166024..166029
FT                   /gene="lin1112"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        166037..166783
FT                   /transl_table=11
FT                   /gene="lin1112"
FT                   /note="highly similar to cobalamin (5'-phosphatase)
FT                   synthetase"
FT                   /db_xref="GOA:Q92CQ9"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CQ9"
FT                   /protein_id="CAC96343.1"
FT                   /translation="MKTLILLIQFFTRIPLPIQINMDEINLKKGSALLPLVGVVIGAWN
FT                   WLVFSLVALVMPLPVAIIAGLFAEIIITGGFHVDALADTADGLFSSRKKERMLEIMKDS
FT                   RVGANGVIAICFYFLFYGALFLSVPNIQQIGWLFFVLPIVAKGVTMLLFAKMSYAGSKE
FT                   GLGSIFLGVPWWPIMIAQGIVLIVLALFFSYIGLIAYAGVLVFTIIYRLFVYKRIGGMN
FT                   GDTLGAGGQMGQLVCLFCLVLIWGLM"
FT   CDS_pept        166784..167359
FT                   /transl_table=11
FT                   /gene="lin1113"
FT                   /note="similar to alpha-ribazole-5'-phosphatase "
FT                   /db_xref="GOA:Q92CQ8"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ8"
FT                   /protein_id="CAC96344.1"
FT                   /translation="MQLIFVRHGETDCNALKKYCGQMDVALNENGIRQMKRLQERLTDY
FT                   SFDLVVTSDLMRVNQSAALLSNRKPIRFPGFNEMNFGDFEGYTYQEISTKFPVAWDDYC
FT                   SNWQTAPFPNGESFPVFYERVIATFKAEWENWQKLDTVLFVGHLGVLRAIALFLQDQKI
FT                   AQFWDTDFKQGCYSLWDNKSQSFLISNQ"
FT   CDS_pept        complement(167770..168654)
FT                   /transl_table=11
FT                   /gene="lin1114"
FT                   /product="Regulatory protein similar to Salmonella
FT                   typhimurium PocR protein"
FT                   /db_xref="GOA:Q92CQ7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ7"
FT                   /protein_id="CAC96345.1"
FT                   /translation="MLLQTKSNEMLLEKVMDEFSAATSLASVVVDIHGTEVSRLCNFTP
FT                   FCQLIRSNPKYRSLCQKCDMFGGLEASKTGKPLIYRCHAGLTDFSVPIVVENQLSGFLL
FT                   SGQVICEENSEVGNIQTEETDWKNDKDLISAFRSVPVFSSKKINSSAEMLTIISQYYLK
FT                   SEMEKSREEQKQKIVFHHNKPTHHEDNKEIRKALKYIEKNLNRPITLDEVASHVYLSSY
FT                   YFSKLFKKEMNVNFINYVNQKKMSLAKDMLKNPRWSIDNVARNLGFTQTSYFCKVFRKE
FT                   FDVTPKGYRETLK"
FT   regulatory      complement(168662..168667)
FT                   /gene="lin1114"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      168943..168948
FT                   /gene="lin1115"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        168956..169243
FT                   /transl_table=11
FT                   /gene="lin1115"
FT                   /note="similar to Salmonella typhimurium PduA protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ6"
FT                   /protein_id="CAC96346.1"
FT                   /translation="MQEALGLVETKGLVSAIEAADAMVKSANVTLTGYEKIGSGLVTVM
FT                   VRGDVGAVKAATDAGAEAARNVGTVMSTHVIPRPHTDVEEILPVRVKSDE"
FT   regulatory      169223..169228
FT                   /gene="lin1116"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        169236..170039
FT                   /transl_table=11
FT                   /gene="lin1116"
FT                   /note="similar to Salmonella typhimurium PduB protein"
FT                   /db_xref="GOA:Q92CQ5"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030984"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ5"
FT                   /protein_id="CAC96347.1"
FT                   /translation="MSKQNKLIDEILKQVMETVNDAPEKIVEDGGSRQMSEKAVQLTEF
FT                   VGTAIGDTIGLVIANVDGQLLEAMKLEKSYRSIGILGARTGAGPHIMAADEAVKATNTE
FT                   VVKIELPRDTKGGAGHGSLIIFGGDDVSDVKRAVEVALNELDKTFGDVYGNEAGHIELQ
FT                   YTARASHALNTAFGAPVGKAFGLMVGAPAGIGVVMADTAVKSANVDVVAYSSPADGTSF
FT                   SNEVILCISGDSGAVRQAVISAREIGKKLLGALGDEPKNDRPSYI"
FT   regulatory      170042..170047
FT                   /gene="lin1117"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        170058..171722
FT                   /transl_table=11
FT                   /gene="lin1117"
FT                   /note="highly similar to propanediol dehydratase, alpha
FT                   subunit"
FT                   /db_xref="GOA:Q92CQ4"
FT                   /db_xref="InterPro:IPR003206"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036999"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ4"
FT                   /protein_id="CAC96348.1"
FT                   /translation="MKSKRFEELAKRPVNQDGFVKEWIEEGLIAMESPNDPKPSIKIEN
FT                   GKVVEMDSKKLADFDLIDHFIAKYGVDLSRAEEVMKMDSVKLANMLCDPNVPREKIVLL
FT                   TTAMTPAKIVEVVSQMNVVEMMMSMQKMRSRRTPTTQAHVTNLRDNPVQIAADAAEAAI
FT                   RGFDEQETTVAVVRYAPFNALSLLVGSQTGRGGVLTQCSLEEATELELGMRGLTCYAET
FT                   ISVYGTEPVFTDGDDTPWSKGILASAYASRGLKMRFTSGTGSEVQMGYAEGKSMLYLES
FT                   RCIFITKAAGVQGLQNGSISCIGIPGAVPSGIRAVLAENLIAVMLDLEVASGNDQTFSH
FT                   SDIRRTARLLMQFLPGTDYISSGYSATPNYDNMFAGSNFDADDFDDYNILQRDLKVDGG
FT                   LTPVTEEEVVAVRNKAARVIQVVFDKLGLPAVTDEEVEAATYARGSNDMPERNMVEDIK
FT                   AAAEMMDRGVTGLDVVKALAAGGFDDVAESVLNMLKQRVSGDFLHTSAIIDKDWNVISS
FT                   VNDLNDYAGPGTGYRLEGERWEKLKDIAVAVDANELD"
FT   regulatory      171744..171749
FT                   /gene="lin1118"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        171760..172419
FT                   /transl_table=11
FT                   /gene="lin1118"
FT                   /note="similar to diol dehydrase (diol dehydratase) gamma
FT                   subunit"
FT                   /db_xref="InterPro:IPR003208"
FT                   /db_xref="InterPro:IPR010254"
FT                   /db_xref="InterPro:IPR025541"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ3"
FT                   /protein_id="CAC96349.1"
FT                   /translation="MVEINEKVLRGIISEVLDELQLKEDKVSFQKEQPSVAVSDESFLT
FT                   EVGDAKPGRQKDEVVIAVAPAFGKYQTKNIVGVPHKQILREVIAGIEEEGLKARVVRVF
FT                   RSSDVAFVAVEGDKLSGSGICIGIQSRGTALIHQKDLQPLSNLELFPQAPLITLETYRA
FT                   IGKNAAKYAKGESPNPVPMVNDQMARPKFQAKAALLHIKETKHVVQGKNAVELQVN"
FT   regulatory      172422..172427
FT                   /gene="lin1119"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        172436..172948
FT                   /transl_table=11
FT                   /gene="lin1119"
FT                   /note="similar to diol dehydrase (diol dehydratase) gamma
FT                   subunit (pddC)"
FT                   /db_xref="InterPro:IPR003207"
FT                   /db_xref="InterPro:IPR036091"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ2"
FT                   /protein_id="CAC96350.1"
FT                   /translation="MNQEALENMVRNILQEVNSGAVTTTTSQKASGDSLTVRDYPLGTK
FT                   RPELVKTASSKSLDDITLKSVLDGTIKPEDVRVTAETLKMQAQVARDAGRATLANNFER
FT                   AAELTVVPDERILEIYNAMRPYRSSREELLAIADELENVYQATICSNYVREAAQLYQER
FT                   KKLKGDN"
FT   regulatory      172981..172986
FT                   /gene="lin1120"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        172993..174813
FT                   /transl_table=11
FT                   /gene="lin1120"
FT                   /note="similar to diol dehydratase-reactivating factor
FT                   large subunit "
FT                   /db_xref="GOA:Q92CQ1"
FT                   /db_xref="InterPro:IPR009191"
FT                   /db_xref="InterPro:IPR028975"
FT                   /db_xref="InterPro:IPR030994"
FT                   /db_xref="InterPro:IPR040916"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ1"
FT                   /protein_id="CAC96351.1"
FT                   /translation="MKYIAGIDIGNSTTEVALAILDSVNNAEFVASAITDTTGIKGTKQ
FT                   NLHGIFKALKLALEKVNATTADLAEIRINEATPVIGDVAMETITETIITESTMIGHNPK
FT                   TPGGLGMGSGITVHLDEVASKSKDTDYIVIIPKTVDFEDAAQQINDYTELGYQITAAIL
FT                   QADDGVLVHNRLNHKIPIVDEVGFIDKVPVDMLAAVEVAAPGKVIETISNPYGIATVFR
FT                   LSSDETKNIIPVARALIGNRSAVVIKTPEGDVKARTIPAGHIELQSGTRTQRVNVAEGS
FT                   EKIMQAIMSLPKLDNASGEPGTNIGGMLEKVRQTMAGLTDKLPADIFIQDLLAVDTFVP
FT                   VDVQGGLAGEFSMEQAVGIASMVKSDHLQMAAIASEIEQELNVTVKIGGAEAEAAILGA
FT                   LTTPGTNTPLAILDLGAGSTDASIINGKGEIIATHLAGAGDMVTMIIQSEIGLEDRYLA
FT                   EDIKKYPLAKVESIFHIRHEDGTVQFFDTPLSPSVFAKVVIVKPDGFVPIPGDVSIEKI
FT                   KLIRRSAKERVFVTNTIRALKYVSPTGNIRDIPFVVIVGGSALDFEIPQLITDALSHYS
FT                   LVAGRGNIRGQEGPRNAVATGLILSGGANV"
FT   regulatory      174795..174800
FT                   /gene="lin1121"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        174810..175157
FT                   /transl_table=11
FT                   /gene="lin1121"
FT                   /note="similar to diol dehydratase-reactivating factor
FT                   small chain"
FT                   /db_xref="InterPro:IPR003208"
FT                   /db_xref="InterPro:IPR009192"
FT                   /db_xref="InterPro:IPR010254"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ0"
FT                   /protein_id="CAC96352.1"
FT                   /translation="MIPVVNKPAIYFHADQSANPDCIKQVLFGIEEEGIPCELEIMPLK
FT                   DEVQAAFRASASSPLLVGITLKNDHLVIHYRNLPPDQPLFSEYRFCAATLEKQRNMGMN
FT                   AARLVKGVPFK"
FT   regulatory      175157..175162
FT                   /gene="lin1122"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        175170..175607
FT                   /transl_table=11
FT                   /gene="lin1122"
FT                   /note="similar to Salmonella enterica PduK protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP9"
FT                   /protein_id="CAC96353.1"
FT                   /translation="MHQAIGIIEIKGLASAITVADTMAKVANIQIVDTEKAKGFGWITV
FT                   KVEGDVAAVNAALEAGEQTAIASDSFVAKKVIPRPGEEIFTVFLPKEEIVPEEPELIVE
FT                   TEDVAEPETPVEATCNLCHDPLCPRIKGDPRQDCIHFEEEK"
FT   regulatory      175619..175624
FT                   /gene="lin1123"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        175633..175908
FT                   /transl_table=11
FT                   /gene="lin1123"
FT                   /note="similar to carboxysome structural protein "
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP8"
FT                   /protein_id="CAC96354.1"
FT                   /translation="MNNALGMIETKGLVGAIEAADAMVKAANVSLVGYEKIGSGLVTVM
FT                   VRGDVGAVKAATDAGAAAARNVGEVQSIHVIPRPHNDVETLLPKGL"
FT   regulatory      175896..175901
FT                   /gene="lin1124"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        175912..176547
FT                   /transl_table=11
FT                   /gene="lin1124"
FT                   /note="similar to Salmonella enterica PduL protein"
FT                   /db_xref="GOA:Q92CP7"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP7"
FT                   /protein_id="CAC96355.1"
FT                   /translation="MEREELKAIIKKIVTDKYGGAETEIPIGVSNRHIHLTEKDYNQLF
FT                   PNEPIQVKKWLKQPGEFAAEQTLTVVSERGELKRVRILGPLRKFSQVELSKTDARMLGM
FT                   KIPIRVSGDIEGTPGIKLVSKHNEIFLPKGAIVAKRHIHLPESVANEYGVKQGDEVSVL
FT                   VGSEIRSLVLNHCTIRVNNQFIPEMHIDTDEANAADIAGDSFAKIIKS"
FT   regulatory      176555..176560
FT                   /gene="lin1125"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176568..177407
FT                   /transl_table=11
FT                   /gene="lin1125"
FT                   /note="similar to ethanolamine utilization protein EutJ"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP6"
FT                   /protein_id="CAC96356.1"
FT                   /translation="MDILQTANERMEQLAALMNKDTKQKVSADQKVKVGVDLGTSSIVF
FT                   VVLDENNVPLFGAFEFADAVRDGLVVNYRESVEVVKRLKDRAEKSLGISLTHASGAIPP
FT                   GTIGNNKKVVANVIESAGMEALYTIDEPTAAAAVLDLKDGAVVDVGGGTTGISVFKDGD
FT                   VIYTADEPTGGTHMTLVLAGYYGVSVEEAEENKRAQKDSSEHFSVMRPVVEKMAEITRV
FT                   HLEKSPSEPLYIVGGASAYSQFKDTFESYLKMPVFQPNYPQYVTPLGIAMSSGSGNL"
FT   regulatory      177390..177395
FT                   /gene="lin1126"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        177404..177883
FT                   /transl_table=11
FT                   /gene="lin1126"
FT                   /db_xref="GOA:Q92CP5"
FT                   /db_xref="InterPro:IPR030992"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP5"
FT                   /protein_id="CAC96357.1"
FT                   /translation="MIEKLVEIIVKRLKIRAANKTVIAVSKMPRDPVAIFMESGTVRLT
FT                   QVNKHFLERILGGNRAESLTIWLETAAEYGVTIELELYDNGEPWLDYKMLSQLVYPVFT
FT                   SAGERLFHPSSEVICYSDSALIPSGSTLCKFKKQLITPLANEYLTKNNIAVRERQ"
FT   regulatory      177875..177880
FT                   /gene="lin1127"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        177888..178151
FT                   /transl_table=11
FT                   /gene="lin1127"
FT                   /note="similar to carbon dioxide concentrating mechanism
FT                   protein "
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP4"
FT                   /protein_id="CAC96358.1"
FT                   /translation="MFMAKITGSVVSTKKEDSLTGKKLMIVQPIDANGEHVRSEEVACD
FT                   SVGAGIGEYVLVARGNAARSVFAEPNSAIDSAIIAIVDSFDK"
FT   regulatory      178151..178156
FT                   /gene="lin1128"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        178166..179161
FT                   /transl_table=11
FT                   /gene="lin1128"
FT                   /product="hyghly similar to Salmonella enterica PduO
FT                   protein "
FT                   /db_xref="GOA:Q92CP3"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR009221"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP3"
FT                   /protein_id="CAC96359.1"
FT                   /translation="MSIYTKTGDKGTTALFDGNRVKKYDDRVETYGSFDELNAEISVAE
FT                   KFVTSHENKTLLRNVERQLFYVCAELATEDESALASKIVITEDDINELEKVIDAYTLKL
FT                   PKVDSFVLPGSSKAGAFLHSARTIARRAERLLVRFSEQTAVRNELLKFVNRLSDFLYIL
FT                   AREEDFRQMLDKATKLIVAKYLEQTEQKPSTTSDLSFSFCEKLMHQVQVVSEEVGVPVT
FT                   LAIVDAHGNARFNYRMEHALLVSAELATKKAYSAVAMKTSTEKLTEAVQPGAPLYQLET
FT                   LTNGDIVTFGGGVPIYGKDGAIIGGMGISGGSVEEDIHIAKKALSMIEKG"
FT   regulatory      179153..179158
FT                   /gene="lin1129"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        179168..180577
FT                   /transl_table=11
FT                   /gene="lin1129"
FT                   /note="similar to ethanolamine utilization protein EutE"
FT                   /db_xref="GOA:Q92CP2"
FT                   /db_xref="InterPro:IPR012408"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP2"
FT                   /protein_id="CAC96360.1"
FT                   /translation="MESLELEQLVKKVLLEKLAEQKEVPTKTTTQGAKSGVFDTVDEAV
FT                   QAAVIAQNCYKEKSLEERRNVVKAIREALYPEIETIATRAVAETGMGNVTDKILKNTLA
FT                   IEKTPGVEDLYTEVATGDNGMTLYELSPYGVIGAVAPSTNPTETLICNSIGMLAAGNAV
FT                   FYSPHPGAKNISLWLIEKLNTIVRDSCGIDNLIVTVAKPSIQAAQEMMNHPKVPLLVIT
FT                   GGPGVVLQAMQSGKKVIGAGAGNPPSIVDETANIEKAAADIVDGASFDHNILCIAEKSV
FT                   VAVDSIADFLLFQMEKNGALHVTNPSDIQKLEKVAVTDKGVTNKKLVGKSATEILKEAG
FT                   IACDFTPRLIIVETEKSHPFATVELLMPIVPVVRVPDFDEALEVAIELEQGLHHTATMH
FT                   SQNISRLNKAARDMQTSIFVKNGPSFAGLGFRGEGSTTFTIATPTGEGTTTARHFARRR
FT                   RCVLTDGFSIR"
FT   CDS_pept        180593..181711
FT                   /transl_table=11
FT                   /gene="lin1130"
FT                   /note="similar to NADPH-dependent butanol dehydrogenase"
FT                   /db_xref="GOA:Q92CP1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP1"
FT                   /protein_id="CAC96361.1"
FT                   /translation="MNSFQIKTKVAFGTNSLQVLKEIKNKNVWIICDRFLADGEGLQGL
FT                   VGQLDASNNVHIFTDVVPDPPISKVASGVSEAGKIQPQVMIAFGGGSAIDTAKGIYYFA
FT                   KRLEKINISTFIAIPTTSGTGSEVTAATVITDPTTKIKYPLFLDELIPDMAILDAQLVV
FT                   TVPPAITANTGMDVLTHAIEAYVSKAASDYTDALGEKSVQLTLRFLTSCYDDGRNLANR
FT                   EKMHNASTMAGMAFNCANLGLNHSIAHQLGAQFHVPHGLANAILLDAVIRFNAFKNRDT
FT                   EQKYAELARICGMASRSDSNETAVRLLRERIVQMMEHMQMPRTLTDAGVAKEKVYAKMD
FT                   EIATNALKDACLPTSPTTPTHQELKEILEQII"
FT   regulatory      181726..181731
FT                   /gene="glpF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        181739..182443
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /note="similar to glycerol uptake facilitator protein"
FT                   /db_xref="GOA:Q92CP0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP0"
FT                   /protein_id="CAC96362.1"
FT                   /translation="MSAYLAEFIGTMVLIMFGNGLLAGLTLNKSLSQGANWVVVTFGWG
FT                   FAVMIGIYVAGAYSGAHLNPAVTIALAVGGSFSWAAVVPYIIAQIAGAFVGASIIILHY
FT                   YPHFKATPQEIDTHGIFSTGPAIRNTPFNLISEIIATFAFIFGLLMIGENSFTNGLNPL
FT                   ILGFLVVAIGMSFGPTTGYAINPARDLGPRLAYFLLPVPNKSGSDWRYAWIPIVGPIIG
FT                   GLLAIGLFNILL"
FT   CDS_pept        182511..183704
FT                   /transl_table=11
FT                   /gene="AckA2"
FT                   /note="similar to acetate kinase"
FT                   /db_xref="GOA:Q92CN9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CN9"
FT                   /protein_id="CAC96363.1"
FT                   /translation="MHKIMAINAGSSSLKFQIFTMPGEEVLVKGLIERIGLPDAIFNMS
FT                   FQNEKIKETRAINNHGEAVEILLEQLKTHQVINDLNEITGVGHRVAHGGEAFVSSCIVT
FT                   DDVVKGIEDVTSLAPLHNPANIIGIKTFRELLPNAVSVAVFDTAFHQTIPEENFLYALP
FT                   YELYEKHHIRKYGFHGTSHKYVAGKAAEVLKKPLEKLKIISCHLGNGASVCAIEAGKSV
FT                   NTSMGFTPNAGLMMGTRSGTIDATIIPYLVDELGYSLDEVTHMMSSESGVLGVSGISSD
FT                   FRDIEIAANEGNSRALLTLRMFTGQICNYIGAYASAMNGCDALLFTAGVGENSPLIRKM
FT                   VTEQLSYLGVTCNVTKNNAGDMIISNDDEAVKVCIIPTNEELMIARDVEKYTKQTIS"
FT   regulatory      183704..183709
FT                   /gene="cobD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        183718..184803
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /note="similar to Salmonella typhimurium CobD protein and
FT                   to histidinol-phosphate aminotransferase"
FT                   /db_xref="GOA:Q92CN8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN8"
FT                   /protein_id="CAC96364.1"
FT                   /translation="MKITTAMHGGNYNELAKQHGLTKEMILDFSANINPLGVPASLKQT
FT                   ITANLDKLVEYPEPDYLALRARIASFHQLDLANVIPGNGATELIFGIAKVTKAQKVLLL
FT                   APTFAEYERAFFDAEIIYAELTKETHFAAAETVLEMIKRETDLEAVCLCNPNNPTGQLI
FT                   SQQEMIQIAELCEERNIYLIIDEAFMDFLEGNETISMINYLGSFPHLAIIRAFTKFFAI
FT                   PGLRLGYLLTKNDLLAEALLQMREPWSINTFADMAGQVLLDDTDYITQTYNWISAERDF
FT                   LYQELSKFSELTVYRPSVNYIFFHLETPLDLRKELLLKGIFIRSCANYRGLTENYYRVA
FT                   VKARCDNTKLIRALEVIFSGN"
FT   regulatory      184778..184783
FT                   /gene="lin1134"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        184793..185668
FT                   /transl_table=11
FT                   /gene="lin1134"
FT                   /note="similar to Salmonella enterica PduX protein"
FT                   /db_xref="GOA:Q92CN7"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012363"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN7"
FT                   /protein_id="CAC96365.1"
FT                   /translation="MEIKATCPASCGELLQGFITGGEKLISYPINWYSEVTLSDKSGQN
FT                   SQGHTKAWLAFEVTCEYFGVTKKERPPISLLVKSTIPVAKGMASSTADIAATIGATAKW
FT                   LNKPITETEIAKLCLQLEPTDSTIFKSLTLFDHLKGSVIESSNWMPKLGVVVLEPLTVL
FT                   ETATYRQEDHHEQLLENEQQLAKAVQFFNQAAAQKSINLLGKAATVSAASNQIILPKPF
FT                   WNELLEVVSCLNLVGINVSHSGTVVGLLYELGKIDPLEILFELERRYVTTFYSRYYFRE
FT                   LVRGGVQIIS"
FT   regulatory      186246..186251
FT                   /gene="pduQ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        186259..187398
FT                   /transl_table=11
FT                   /gene="pduQ"
FT                   /note="similar to NADPH-dependent butanol dehydrogenase"
FT                   /db_xref="GOA:Q92CN6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN6"
FT                   /protein_id="CAC96366.1"
FT                   /translation="MQKVSFKTDLYIGQGATDRLLDFKDKQIFIVTDPFMVSSGMINAI
FT                   TEKIDKSNTYTIFSDIIPDPPIENVVAGIEVLNECDANLMIAIGGGSAIDAAKAMKFFG
FT                   QKLGTVRAMPFIVIPTTSGTGSEVTSFSVITNKEKAIKYPLITDAILPDEAILDADLVK
FT                   SVPPAITADTGMDVLTHALEAYVSTKANDYSDAMAEKVIQLVFTYLERAYKDGNDLEAR
FT                   EKMHNASCLAGMAFNITSLGLNHGIAHTAGAKFKIPHGRMNTLLLPHVISYNAGLTSDF
FT                   GNNPDNRAAERYTAIAKLLKMPASNTRLGVRSLINAIKQLQKKLNMPTTLSECGVSRTD
FT                   LNEHIAQIAEGALNDGCTATNPRTPTETDVSAILEKMLA"
FT   CDS_pept        187673..188254
FT                   /transl_table=11
FT                   /gene="lin1136"
FT                   /note="similar to similar to two-component response
FT                   regulator"
FT                   /db_xref="GOA:Q7AP10"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP10"
FT                   /protein_id="CAC96367.1"
FT                   /translation="MTGMNGRIVIADDEPITRMDIRDILEEANYNVVGEATDGFEAIEL
FT                   CKSHQPDLVIMDIQMPLLDGLKAGKRIISEGLAGGIILLTAFSDPKNTEKAKGFGALGY
FT                   LVKPLDEKSLIPTVEMSIAKGRETRKLEQQLEKLTKKLEERKVIEKAKGVLMIENNITE
FT                   EEAYNMIRNLSMDKRCPMMEIAETIVMSDD"
FT   regulatory      188237..188242
FT                   /gene="lin1137"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        188247..189704
FT                   /transl_table=11
FT                   /gene="lin1137"
FT                   /note="similar to two-component sensor histidine kinase"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN4"
FT                   /protein_id="CAC96368.1"
FT                   /translation="MTKTIREMCLRYTDLAEYDIDELIHTAKSLSESSMYQDVDVFIDV
FT                   YNKLTSEALVIHHTPPKSTKSLYKNNVVGETALRSNEPGVLRTLETGMNSNDLLAKTQE
FT                   NVLIRQKVYPIRNKQRVIAVLILENDISAEIKAHFEIDNEETAYRDVSTTLSAMSKLTD
FT                   SITDQLDDAILIFDRNGILQQKNCAADQYYERLGYMENIQGMHYDNLSLDQMMFDAIMY
FT                   QIETGKQPVQLKKEVVIAGNYFIMKQIFVKEEDEQECRFILILHDVTDIKVKEAEIVSK
FT                   SVAIREIHHRVKNNLQSVVSLLRIQGRRSTSVEAQKVLNESVSRILAIAATHELLSKQM
FT                   EDGINLYMVIEAVAYNIERCCNDCPQVAVRMDIDKRIYLDSDRTVALALVMNELLQNSY
FT                   DHAFHPNESGEILLQIKEEKNIIHAEVSDNGHGFNVRKVSEKSLGLSIVKSYIKDKLRG
FT                   KVTIESNEHGTKTMFDFKYNSIHATKK"
FT   regulatory      189724..189763
FT                   /gene="lin1137"
FT                   /regulatory_class="terminator"
FT   regulatory      189782..189787
FT                   /gene="eutA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        189795..191216
FT                   /transl_table=11
FT                   /gene="eutA"
FT                   /note="similar to ethanolamine utilization protein EutA
FT                   (putative chaperonin)"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN3"
FT                   /protein_id="CAC96369.1"
FT                   /translation="MTETILSVGIDLGTSTTQLILSELEIQNMASSFTVPRIVISDKRI
FT                   IFRSEILFTPILADNLIDVDAIRDFVTKEYANAGIKKEEIGMGAVIITGETARKDNASN
FT                   VLDAMSGFAGDFVVATAGPDLESIIAGKGAGAHTYSKENSTCVVNLDIGGGTTNLSLFD
FT                   RGELIDTACLDIGGRLIKVDRETRKITYIAPKIQALIEKRGYPITLGEKTSPENLQPIL
FT                   GEMVELLKNSVGLGAPNDFYETIITNKGLKFLAEIECISFSGGVADCISTGALSDPFRY
FT                   GDIGLLLGKSIAESSLMTEKKYIESVETIRATVVGAGSHTAEISGSTITYTEKIFPVKN
FT                   IPILKLAKQEENENMAEVIKEKLNWFKIDEDMERIALAIEGENSPSFQQVTEYAKAICE
FT                   GMKEPISLGHPLIIITWHDMAKALGQSIFGHLPAGYPLICLDSVKVDNGDYIDIGKPVA
FT                   DGKVLPVVVKTLVFN"
FT   regulatory      191243..191248
FT                   /gene="eutB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        191258..192622
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /note="similar to ethanolamine ammonia-lyase, heavy chain"
FT                   /db_xref="GOA:Q92CN2"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN2"
FT                   /protein_id="CAC96370.1"
FT                   /translation="MILKTNLFGHTYQFKSITDVLAKANEEKSGDRLAGVAAESAEERV
FT                   AAKVVLSKMTLGDLRNNPVVPYETDEVTRIIQDQVNERIHDSIKNWTVEELREWILDHK
FT                   TTDADIKRVARGLTSEIIAAVTKLMSNLDLIYGAKKIRVIAHANTTIGLPGTFSARLQP
FT                   NHPTDDPDGILASLMEGLTYGIGDAVIGLNPVDDSTDSVVRLLNKFEEFRSKWDVPTQT
FT                   CVLAHVKTQMEAMRRGAPTGLVFQSIAGSEKGNTAFGFDGATIEEARQLALQSGAATGP
FT                   NVMYFETGQGSELSSDAHFGVDQVTMEARCYGFAKKFDPFLVNTVVGFIGPEYLYDSKQ
FT                   VIRAGLEDHFMGKLTGISMGCDVCYTNHMKADQNDVENLSVLLTAAGCNFIMGIPHGDD
FT                   VMLNYQTTGYHETATLRELFGLKPIKEFDQWMEKMGFSENGKLTSRAGDASIFLK"
FT   regulatory      192627..192632
FT                   /gene="eutC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        192642..193523
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /note="similar to ethanolamine ammonia-lyase, light chain"
FT                   /db_xref="GOA:Q92CN1"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CN1"
FT                   /protein_id="CAC96371.1"
FT                   /translation="MNEQELKQMIEGILTEMSGGKTTDTVAAAPTKSVVETVVTEGSIP
FT                   DITEVDIKKQLLVPEPADREGYLKMKQMTPARLGLWRAGPRYKTETILRFRADHAVAQD
FT                   SVFSYVSEDLVKEMNFIPVNTKCHDKDEYLTRPDLGREFDDEMVEVIRANTTKNAKLQI
FT                   VVGDGLSSAAIEANIKDILPSIKQGLKMYNLDFDNIIFVKHCRVPSMDQIGEITGADVV
FT                   CLLVGERPGLVTAESMSAYIAYKPTVGMPEARRTVISNIHSGGTPPVEAGAYIAELIHN
FT                   MLEKKCSGIDLK"
FT   regulatory      193533..193538
FT                   /gene="lin1141"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193546..194199
FT                   /transl_table=11
FT                   /gene="lin1141"
FT                   /note="similar to putative carboxysome structural protein
FT                   (eutL)"
FT                   /db_xref="GOA:Q92CN0"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN0"
FT                   /protein_id="CAC96372.1"
FT                   /translation="MKNDKLPASVLSVKVVSNVDNGLFKQLDLKPHQRSLGIITSDCDD
FT                   VTYTALDEATKAAEVDVVYAKSMYAGAGNASTKLAGEVIGIIAGPSPAEVKSGLSVAVD
FT                   FIENGASFVSANEDDSVPYFAHCVSRTGSFLSKEANVAEGQAIAYLIAPPLEAMYALDA
FT                   ALKAADVAIGTFYGPPSETNFGGALLTGSQSACKAACDAFKMAVENVAENPLQY"
FT   regulatory      194199..194204
FT                   /gene="lin1142"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        194214..194711
FT                   /transl_table=11
FT                   /gene="lin1142"
FT                   /note="similar to putative carboxysome structural protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM9"
FT                   /protein_id="CAC96373.1"
FT                   /translation="MPNEALGLIEVTGFLGAVVAADTCLKAANVELIRCEVIKGGLTTV
FT                   ELTGDVGAVNAAVEAGKAATESLGCLISSHVIARMSEETKSLFVKAEQEIEETKEVIQE
FT                   VVEVKTTTDETEKKLREMKVIDLRKLAYTLDNVPIPKSKIKYANKDKLVHALKDIYGRS
FT                   EN"
FT   regulatory      194697..194702
FT                   /gene="lin1143"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        194711..196171
FT                   /transl_table=11
FT                   /gene="lin1143"
FT                   /note="similar to acetaldehyde dehydrogenase / alcohol
FT                   dehydrogenase"
FT                   /db_xref="GOA:Q92CM8"
FT                   /db_xref="InterPro:IPR013357"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM8"
FT                   /protein_id="CAC96374.1"
FT                   /translation="MALEDKDLRSIQEVRNLIESANKAQKELAAMSQQQIDTIVKAIAD
FT                   AGYDAREKLAKMAHEETGFGIWQDKVIKNVFASKHVYNYIKDMKTIGMLKEDNEKKVME
FT                   VAVPLGVVAGLIPSTNPTSTVIYKTLISIKAGNSIVFSPHPNALKAILETVRIISEAAE
FT                   KAGCPKGAISCMTVPTIQGTDQLMKHKDTAVILATGGSAMVKAAYSSGTPAIGVGPGNG
FT                   PAFIERSANIPRAVKHILDSKTFDNGTICASEQSVVVERVNKEAVIAEFRKQGAHFLSD
FT                   AEAVQLGKFILRPNGSMNPAIVGKSVQHIANLAGLTVPADARVLIAEETKVGAKIPYSR
FT                   EKLAPILAFYTAETWQEACELSMDILYHEGAGHTLIIHSEDKEIIREFALKKPVSRLLV
FT                   NTPGALGGIGATTNLVPALTLGCGAVGGSSSSDNIGPENLFNIRRIATGVLELEDIRKE
FT                   ENQATPELSVDADALIQSLVEKVLAELK"
FT   regulatory      196188..196193
FT                   /gene="lin1144"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        196203..196487
FT                   /transl_table=11
FT                   /gene="lin1144"
FT                   /note="similar to putative carboxysome structural protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP09"
FT                   /protein_id="CAC96375.1"
FT                   /translation="MANANALGMIETKGLVGAVEAADAMVKAANVTLMGKEQVGGGLVT
FT                   VMVRGDVGAVKAATDAGAAAAERVGELLSVHVIPRPHSEVDAILPKSAE"
FT   regulatory      196640..196645
FT                   /gene="lin1145"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        196653..197408
FT                   /transl_table=11
FT                   /gene="lin1145"
FT                   /note="similar to cobalamin adenosyl transferase"
FT                   /db_xref="GOA:Q92CM6"
FT                   /db_xref="InterPro:IPR009194"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM6"
FT                   /protein_id="CAC96376.1"
FT                   /translation="MAILTEDELRKAYLHTDLKTKKKLDIKKGTIITPSAKSFLSEKKI
FT                   DLHYIDEISETKVVVEPVKKETARAKFQTIYGGSVDEKPEHMTHLRGNLLVFKDHPQIA
FT                   FRGKLDTLEAEILETQCSVASEFKDLAEDLQEILTFVRNIVRSEVLNEQIETVNLLGMD
FT                   EKELRERSHNPKKYYQMTHFMPDYTMGNAVIRLNKLRTMVRETELTAFAAFKEADYSVK
FT                   RPDIIQALNRLSSLFWILMFRVRTGEYKK"
FT   regulatory      197408..197413
FT                   /gene="lin1146"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        197421..198062
FT                   /transl_table=11
FT                   /gene="lin1146"
FT                   /note="similar to Salmonella enterica PduL protein"
FT                   /db_xref="GOA:Q92CM5"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM5"
FT                   /protein_id="CAC96377.1"
FT                   /translation="MNNELITSLIEEVTRRALLETGVEVEASGRHVHLDRETVDALFGP
FT                   GYELTHFRDLSQPGQYVCKERISIVGPKSVIHNVVILGPIRKKTQVEISATDGTALGIK
FT                   APVRESGDIAGTPGILLLSAKNSVQLTEGLIVAKRHIHMTPEDAAKQQVTQSEIVQVKI
FT                   NGDRPLIFDDVVVRISPDFATYMHIDYDEANACGFKKGIRGQIIKKTKAK"
FT   regulatory      198096..198101
FT                   /gene="lin1147"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        198107..198631
FT                   /transl_table=11
FT                   /gene="lin1147"
FT                   /db_xref="InterPro:IPR013372"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM4"
FT                   /protein_id="CAC96378.1"
FT                   /translation="MRRLQLPDKKMIIMGQDSEHTLRQCYQKEYQVSLYDRSERTCDIL
FT                   LLEEMEIAELARISLLAPMNKKEQFITDHLLEERPTWIMKSGIKANAYKRSAKYGIRQL
FT                   LQEYEEKLARFGVEYIDNPVKNVKTSKVISEQDVIKLTKNKSEFILPEGSFLTPLAKDY
FT                   LQENRISIKES"
FT   regulatory      198634..198639
FT                   /gene="lin1148"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        198646..198915
FT                   /transl_table=11
FT                   /gene="lin1148"
FT                   /note="similar to carbon dioxide concentrating mechanism
FT                   protein"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM3"
FT                   /protein_id="CAC96379.1"
FT                   /translation="MQIGKVTGSLWATRKDEKLNGLKLLLVEICTDEVEDKRHSIVAAD
FT                   NAGAGNGDLVLVTTGSAARASTGDNTIPVDACIVGIIDSVERYG"
FT   CDS_pept        198908..199453
FT                   /transl_table=11
FT                   /gene="lin1149"
FT                   /note="similar to Salmonella enterica PduT protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR011238"
FT                   /db_xref="InterPro:IPR013501"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM2"
FT                   /protein_id="CAC96380.1"
FT                   /translation="MAEQSLGILELRSISKGYEMADVFLKAGNVTLFTFRPTCPGKFLI
FT                   ILQGASGELTSAMQDAKEEAGKFHVSSYILHMAHEELLAFLNNKHPKVDVDAVGIIEIS
FT                   QLGAGLNAVNEALKKSAIHLKRMTLGASIGGKFVAVFTGEVSAIQEGMRILIETAEPKK
FT                   VIHHTVIPSPDELLKRYL"
FT   regulatory      199456..199461
FT                   /gene="lin1150"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        199469..200590
FT                   /transl_table=11
FT                   /gene="lin1150"
FT                   /note="similar to ethanolamine utilization protein EutH -
FT                   Escherichia coli"
FT                   /db_xref="GOA:Q92CM1"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM1"
FT                   /protein_id="CAC96381.1"
FT                   /translation="MSINEIIIYLMVIFMILGAIDKIIGNKFGLGAQFEEGIMAMGSLT
FT                   LAMVGIITLAPVLAKILSPIVVPIYTALGADPAMFATTLLANDMGGFALAQELALTPDA
FT                   GLFAGAILGSMMGPTIVFTIPVALGIIKKEDHKYLATGVLSGIITIPIGCLIGGLVAGF
FT                   SPIMIFKNLVPILLVAVLIMLGLWFKPEGMIKGFTIFGKGVVIVATIGLVAGAIQQLTG
FT                   LTIIPGIAPIGEGIEIVGGIALVLAGAFCLVFVITKVFNKPLMKMGKLLGMNEVAAAGM
FT                   VATLANSIPMFQMLKDMDERGKIINVAFAVSAAFVLGDHLGFTAGVAQDMIFPMIVGKL
FT                   VGGVTAVAVAIYMANRMMKKNKAKEQTAVKDNG"
FT   CDS_pept        200583..201029
FT                   /transl_table=11
FT                   /gene="lin1151"
FT                   /note="similar to ethanolamine utilization protein EutQ"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM0"
FT                   /protein_id="CAC96382.1"
FT                   /translation="MADISKELIEQLVKQVVLEKMGQSSKHVDPSGILSVKLPEVRVSE
FT                   EDRLDTGNPSDVVYTKDLVTLEESKRLGFGLMEMKDTTFDWFLDYDEVDYIIEGRLDVV
FT                   IDGRNVSAGPGELIFIPKGSQIKFSVTGEARFIYVTYPADWQSQ"
FT   regulatory      201041..201067
FT                   /gene="lin1151"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(201041..201067)
FT                   /gene="lin1152"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(201072..201623)
FT                   /transl_table=11
FT                   /gene="lin1152"
FT                   /note="similar to transcriptional regulator"
FT                   /db_xref="GOA:Q92CL9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CL9"
FT                   /protein_id="CAC96383.1"
FT                   /translation="MEKEKVVNIQPLMNSQVENQFTQQIQEDFNKKNPDHSALLHSLET
FT                   VEVLDVLSDYYTAHEKQKQPKKEAATSSKTSGEHKEIKQAIRYIKKNIHRSITLEEVAN
FT                   YVYLSPFYLSKLFKNELNINFINYVNEQKMLYAKEQLEKSDWAVHTIAKNLGFSRASYF
FT                   CKVFKKEFDMTPKEYRDSLK"
FT   regulatory      201921..201926
FT                   /gene="lin1153"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        201937..202431
FT                   /transl_table=11
FT                   /gene="lin1153"
FT                   /db_xref="GOA:Q92CL8"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CL8"
FT                   /protein_id="CAC96384.1"
FT                   /translation="MKIQKLVLCAMLIAMCVIGANIKLMGSVAFDAAPAFIGTLLLGPM
FT                   YGAVLGIFGHLTSALLAGFPLTLPIHLIVAGMMGVTMIAYGFTRHKLAEKNQLVAISAS
FT                   SVVAFVFNCPLSLLALYPLMHQAVFVLFPVLAIGSICNIFVAEVVYQVLPERWKRRIAG
FT                   Y"
FT   CDS_pept        202763..204121
FT                   /transl_table=11
FT                   /gene="cbiA"
FT                   /note="similar to cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="GOA:Q92CL7"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CL7"
FT                   /protein_id="CAC96385.1"
FT                   /translation="MNKILIAAASSGAGKTTVTLGIMQALKKRGFAVQPFKVGPDYIDT
FT                   NYHQAITGVASINLDSFLIDDDEMLASLFQKHGESADISVIEGVMGLFDGLGTDRDNAS
FT                   TSFIAKCTKTPVILVVDGKAISTSAAAIVDGFNRFDPELKIAGVIINRVASENHFSLIK
FT                   GAIERYTDVPVLGYLPKNAAVALPERHLGLVPQEEMTELEAKWELLSDLITTHVDLDKL
FT                   LEISKSSENLSTSKAQMKVADFSGLRVAYALDAAFHFYYQDNLDLIRLTGAELIPFSPL
FT                   EDNEVPEADFIYIGGGFPEIFAKQLNDNRSMRKSILAAHEKGIPIYAECGGLMYLGSSL
FT                   EMEGKQYEMVGVFNGISKMTTRLRKFGYCIAEPLEETLIGKKGMSIRGHEFHHSVFETT
FT                   ETACMKLSKKRDGEIVKEWRGGYQKGNTFASYLHIHFYQNPAILMQMFGAGKR"
FT   regulatory      204103..204108
FT                   /gene="lin1155"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204118..205065
FT                   /transl_table=11
FT                   /gene="lin1155"
FT                   /note="similar to cobalamine synthesis protein CbiB"
FT                   /db_xref="GOA:Q92CL6"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CL6"
FT                   /protein_id="CAC96386.1"
FT                   /translation="MSVLFYTISFILDFILGDPYSWPHPIKVIGNFIQLLTNALRKIFH
FT                   GKSLYFAGGLLFILTVGMTGIVSWLILYISAKIAFWLYAAVFIYLGYTTLAMTCLAKEA
FT                   RKIQRTLADGDLEAARVQVGMIVGRDTDKLTAEQISKATIETVAENTADGVIAPLFYLF
FT                   IGGPVLALMYKAVNTLDSMVGYKNEKYRAIGFVSAKMDDLANFIPARLSWFFLVIASFI
FT                   LKYDGRTAWRIGLRDRKNHTSPNCAYPEGAVAGALGITLGGTHEYFGETVVKPTIGSGT
FT                   KAVTQKEISQTIHLLYTASIIAFLIFISIHLILF"
FT   regulatory      205066..205071
FT                   /gene="lin1156"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        205078..205710
FT                   /transl_table=11
FT                   /gene="lin1156"
FT                   /note="similar to precorrin isomerase"
FT                   /db_xref="GOA:Q92CL5"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CL5"
FT                   /protein_id="CAC96387.1"
FT                   /translation="MNYIKNPAKIEEKSFEIIQQIIDDIRPDYTFQNKLEEAIIKRAIH
FT                   TTADFDYLDSLVFQQDVIQKIIHVLKNKGTIFTDTNMALSGINKRLLDELGCSYHCYVS
FT                   DPETIEIAKQHGITRSMAGIKLASLKDGPKIFVLGNAPTAVYKIIEMTESGQLQAEAVV
FT                   AVPVGFVGAAECKEEILETDIPAIVARGRKGGSNLAAAIINAILITM"
FT   regulatory      205711..205716
FT                   /gene="cbiD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        205726..206847
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /note="similar to cobalamin biosynthesis protein  CbiD"
FT                   /db_xref="GOA:Q92CL4"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CL4"
FT                   /protein_id="CAC96388.1"
FT                   /translation="MEDFIYYNGKKYRKGYTTGTCAAAAAKACVEMIENQEEVSAVKVT
FT                   TTGGTILEIPVAYQQFSEKKATAAVQKDGGDDIDATHGMWIFVDVELTDSPEVTLDGGV
FT                   GIGRATQKGISVEVGEAAINPAPRKNILATVRESLGENRGATILVYAPEGEERAKRTMN
FT                   SNLGIIGGISILGTTGIVTPMSDEGWKKSLSMELEMKRNQGLDQIILVPGNYGDDFVQN
FT                   TLGFASDNIVSMSNFVGYMLKETQRLAFKKVLMVGHFGKLVKVSAGIFTTYSKDADARA
FT                   EILVANLALLGAPLSLLQEVEKCNTTEAAGELIEAAGFTQVYEVIAQKIKARSERFLKF
FT                   TKPSVEIDVVTFSTERGLLAATKDIEVLREEWR"
FT   CDS_pept        206844..207440
FT                   /transl_table=11
FT                   /gene="cbiE"
FT                   /note="similar to precorrin methylase"
FT                   /db_xref="GOA:Q92CL3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CL3"
FT                   /protein_id="CAC96389.1"
FT                   /translation="MITVVGIGPGDTNLLINAARQALSSADSVYGSKRQLQEIAELTTA
FT                   TCLLLPKKLADLKNIPHQNKNVVILASGDPLLYGIGNWAMTNFSEDIHIIPGISAIQMM
FT                   FHQIKLPMNDCFITSSHGKTPNFDFLLQHEKVAMVTDSIIGPYEIAAEISKRNLKKIMF
FT                   IGENLSSTEERIHKLRPEEVEKKYDMNVVVIVDER"
FT   CDS_pept        207430..207999
FT                   /transl_table=11
FT                   /gene="lin1159"
FT                   /note="similar to precorrin decarbocylase"
FT                   /db_xref="GOA:Q92CL2"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CL2"
FT                   /protein_id="CAC96390.1"
FT                   /translation="MKDDVFIRGKVPMTKSEVRAISIDLLGLDNTSKKLLDVGAGTGSV
FT                   GLQVAYNFPHIKVTAIERNKDAVDLIKQNQAKFGVENVAVIEAYAPIELSQEEKFDAIF
FT                   IGGSGGNLTDIIDWSLVHLKLGGRLVLNFILLENALQAMNHLEKLPVSELTMKQIQVSN
FT                   WHKLGAGHYFEPQNPTVIIGCKKLEE"
FT   CDS_pept        208005..208754
FT                   /transl_table=11
FT                   /gene="cbiF"
FT                   /note="similar to precorrin-3 methylase"
FT                   /db_xref="GOA:Q92CL1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CL1"
FT                   /protein_id="CAC96391.1"
FT                   /translation="MAEVHFVGAGPGDKELITLKGYQLLKNADVVIYAGSLVNPELLEY
FT                   CKPDCEIHNSASMNLIEIIDCMEAGVTAGKEVVRLQTGDFSIYGSIREQVEEMKKRSIP
FT                   FTCTPGVSSFLGAASSFGVEYTVPEVSQSVIITRMAGRTPVPSRESLRSYAAHQTSMVI
FT                   FLSVQGIRKVVSELIKGGYKPETPAAVIYKATWAEEKKVTGTLQDIAEKVTEAGITKTA
FT                   LIMVGDFLGEEFYYSKLYDKDFKHEYR"
FT   regulatory      208729..208734
FT                   /gene="cbiG"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        208741..209772
FT                   /transl_table=11
FT                   /gene="cbiG"
FT                   /note="similar to cobalamin biosynthesis protein G CbiG"
FT                   /db_xref="GOA:Q92CL0"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CL0"
FT                   /protein_id="CAC96392.1"
FT                   /translation="MNTDKIAIIAVTERGRDLAISLTKTLPGTVFVPEKHQNEQTAVLT
FT                   PNFGTAMREMFTTHQALICIMATGIAVRTLAPVIQDKLSDPAVIVMDEYGQFIISLLSG
FT                   HVGGANELTEQIAAITGGAAVITTATDRANVAAIDNIAKEIDGYLPDFKATTKRINGLL
FT                   AAGKEVSLHVDEPFEVDSRGFTNKEISPQIFISTKYNLPDTKIERIQLVPRKFVLGIGC
FT                   RKGVSAETMEEVFTHFCEQENIHPRAFREIHSITLKAEEPAILQLAKKWNIHFIVHSAE
FT                   ELQTVAEKYPTSEFVLKTVKVGNVALSSADIGSNGNVITKRFAENGVTFAAGKLIKNNE
FT                   VAK"
FT   CDS_pept        209769..210494
FT                   /transl_table=11
FT                   /gene="cbiH"
FT                   /note="similar to precorrin methylase"
FT                   /db_xref="GOA:Q92CK9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK9"
FT                   /protein_id="CAC96393.1"
FT                   /translation="MIYVIGIGPGDKRLMTGEALEAIADADVIVGYVTYIKLIKELIKD
FT                   KEVVKTGMRREIDRCQEAVNIALTGKKVAVVSSGDAGIYGMAGLVLELAEKSNPELEVK
FT                   VIPGITASIGAAAVLGAPIMHDFCHISLSDLMTPWEVIEKRLTHAAMADFVVCFYNPRS
FT                   KGRANHLANAFQKMMEHKSPKTVVGIVKDVGRKEERKIITTMEDIDYELVDMTTMVIVG
FT                   NKETYVKNGKMITPRGYSL"
FT   CDS_pept        210491..211243
FT                   /transl_table=11
FT                   /gene="lin1163"
FT                   /note="similar to cobalamin biosynthesis J protein CbiJ "
FT                   /db_xref="GOA:Q92CK8"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK8"
FT                   /protein_id="CAC96394.1"
FT                   /translation="MIFVLGGTSDSLLISDWLTETKRPFILSVATDYGETLAKQHAEKV
FT                   FCGRLAKEAMLAKWQLEQIKLVIDATHPFATIVSETAMEACKEAGIPYIRFERTSEQTD
FT                   NTYLVDDINEACKVAAKLGQRIFLTTGSKNLPEFVAGLKQQHIIARILPVSDVIRSAEE
FT                   LGLVADQIIGMKGPFTKEANRTQLEMTQADVLITKESGKQGGFQEKLTAAAELNIPVIV
FT                   IRRKKLNYPIEINHLTELPEILTQLEVY"
FT   regulatory      211230..211235
FT                   /gene="lin1164"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        211243..212724
FT                   /transl_table=11
FT                   /gene="lin1164"
FT                   /note="similar uroporphyrinogen-III
FT                   methyltransferase/uroporphyrinogen-III synthase"
FT                   /db_xref="GOA:Q92CK7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK7"
FT                   /protein_id="CAC96395.1"
FT                   /translation="MGKVMLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQER
FT                   KASCKLIYVGKEPLHHPIPQDEIEQILVREAATNELVVRLKAGDPYVFGRGGEEGETLH
FT                   KAGIPFEVIPGITSAIGGLAYAGIPVTHRDFASSFHVITGHLKKRRDPLDWEALARLEG
FT                   TLVFLMGMTNLPNICANLLANGQKPETGVAIVQWASRGKQLTVTGTLQTIEQKVAESGI
FT                   SSPALIVVGDVVSLRPQLNFFEEMPLFHTKVLLPRARAGKSMLAEKIRDLGGEVTMYPN
FT                   IQVLDILPTKTKAELCETSELLFTSKEAVERFFDYLATLELDIRSLKNTHLTAIGKQTK
FT                   EAFSEKGIIPDSFIKRRSTELILEHIARFQKNASNLIIGSVVDTAEVSAILSEVKTTEM
FT                   MPLYDMRPVTERPFDLESFEQICFSSSRSVQNLLDVLTTEEKAILQTKTILSIGRFTSA
FT                   TLQSFGINEFEEAENATPESLIELIQKTKLEGVPQ"
FT   CDS_pept        212721..213506
FT                   /transl_table=11
FT                   /gene="cbiK"
FT                   /note="similar to anaerobic Cobalt Chelatase In Cobalamin
FT                   Biosynthesis "
FT                   /db_xref="GOA:Q92CK6"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK6"
FT                   /protein_id="CAC96396.1"
FT                   /translation="MKKAILVVSFGTSYPETREKTIEACEKRVAQEFPEYTVFRAFTSN
FT                   KIIKKLKTRDNMHINTPSQALNQLKELGYKEVFIQSLHIINGGEFEKITAQVEKFKADF
FT                   DSIIISQPLLDSKEDYEKAIEAIRHQMPPLKENEALILMGHGSKHHAFSAYACLDHMLL
FT                   NEPIYLCAVESYPGLDQVIERLKQAKIKKAHLMPFMLVAGDHATNDMASDDEDSWKSIL
FT                   EQAGIETECHLQGLGENPLIQAQFIDHIKVATERVNTRG"
FT   CDS_pept        213499..214209
FT                   /transl_table=11
FT                   /gene="cbiL"
FT                   /note="similar to S-adenosyl-methionine: precorrin-2
FT                   methyltransferase"
FT                   /db_xref="GOA:Q92CK5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK5"
FT                   /protein_id="CAC96397.1"
FT                   /translation="MAKFYGIGTGPGDSKLVTMEAADRLGKLAILYTPQSKKGGESLAK
FT                   KIVNPYLKNTLIIKERHFPMSYNKTEKMQAWKEIAEEIKTDVQNGHDVGFITLGDPMVY
FT                   STYSYLLELLKGEIETVTLAGISSFSNIASKLELPLVMDEDSFAVIPVTAGAEKIEQAL
FT                   TLFDTIVLMKAASNLPLLTTLLKKLNLLDAAVVVSDVAMATEKITYGMGEINPEEKMSY
FT                   FTTIIVKKRREQYK"
FT   regulatory      214192..214197
FT                   /gene="lin1167"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        214206..214940
FT                   /transl_table=11
FT                   /gene="lin1167"
FT                   /note="similar to cobalamin biosynthesis protein M "
FT                   /db_xref="GOA:Q92CK4"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK4"
FT                   /protein_id="CAC96398.1"
FT                   /translation="MKKLWKFLPFVLIGVIYFTLTNPESAHAMHIMEGFLPVKWAVFWL
FT                   IVFIPFLVLGLIRIRKLIALDKNNKLLLALCAAFIFVLSALKIPSVTGSCSHPTGVGLA
FT                   TVMFGPLVVSVLGVIVLLFQALLLAHGGITTLGANAMSMAVIGPMVGFVVYKLARKLNC
FT                   NKSVSIFLCAMTADLATYLTTSVQLGVVFPDPASGMMASILKFMAIFCVTQVPIAIAEG
FT                   LLTVVMYNLISKNLPEKVAQLR"
FT   regulatory      214921..214926
FT                   /gene="lin1168"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        214937..215233
FT                   /transl_table=11
FT                   /gene="lin1168"
FT                   /note="similar to putative cobalt transport protein CbiN"
FT                   /db_xref="GOA:Q92CK3"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK3"
FT                   /protein_id="CAC96399.1"
FT                   /translation="MKKININIILILLVVLLMVSPFFFNKTGEYGGSDGEAEAEITKID
FT                   PSYEPWFEPLYEPKSGEIESLLFTLQGCIGTGIIAYVIGVSRGKRKAENDVNH"
FT   CDS_pept        215220..215897
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /note="similar to cobalt transport protein Q"
FT                   /db_xref="GOA:Q92CK2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK2"
FT                   /protein_id="CAC96400.1"
FT                   /translation="MLTIDKYAYQNRWIAFSPSLKALFYVAILILALTGPVLVQAILFL
FT                   CMVPLTLYVVKIHFKQYLKWLLLPFSFLLFSLLSILISISKDPSSFLASISIGSFYLGI
FT                   SDVTITTATQVFFRSIACLAATYFFVLTVPVVQLTKVMKQIFIPKVLIELTILIYRFIF
FT                   IFLEEAAAIRKAQSLRFGYHGIKNSYRSFGMLVNTLFNRVMKRYNEMVITLDVKLYQGE
FT                   FHI"
FT   regulatory      215896..215901
FT                   /gene="lin1170"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        215910..216716
FT                   /transl_table=11
FT                   /gene="lin1170"
FT                   /note="similar to cobalt transport ATP-binding protein
FT                   CbiO"
FT                   /db_xref="GOA:Q92CK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CK1"
FT                   /protein_id="CAC96401.1"
FT                   /translation="MLKTEHISFQYEDGKQALTDVSIDLDKGNIIGLIGANGSGKSTLF
FT                   MQLLGINRPTSGTVYFEGKPLAYNKKALFALRKKVSIVFQDPDQQIFYSNVRDDVAFAL
FT                   RNLGISEKEVESRVTNVLETVGATEFQHKPVQYLSYGQKKRVAIAGALVLDTDWLLLDE
FT                   PTAGLDPIGKKIMMEIIERLAKQGKKILISSHDIDLIYEICDYVYMLKDGTVLTSGETS
FT                   EVFLEKSHIEQAGLVQPWLIKLHQQAGYPLFKKEADFFAHTGKVIN"
FT   regulatory      216703..216708
FT                   /gene="cbiP"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        216716..218251
FT                   /transl_table=11
FT                   /gene="cbiP"
FT                   /note="similar to cobyric acid synthase CbiP"
FT                   /db_xref="GOA:Q92CK0"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CK0"
FT                   /protein_id="CAC96402.1"
FT                   /translation="MVEQIMIQGTASDAGKSVIVAGLCRLFKNKGKRVVPFKSQNMSLN
FT                   SFITATGDEMGRAQVFQAEAAGVFPDVRMNPVLLKPTNDRQSQVIFMGAILDNMDAVSY
FT                   HDFKQTLIPKIQAVYQSLADENDIIVLEGAGSPAEINLNDRDIVNMGMAKMVDAPVVLV
FT                   ADIDKGGVFASIYGTIMLLKEEERARLKGVIINKFRGDVALLQPGIEMIEELTNVPVIG
FT                   VIPYANLQLEEEDSVSLSGKNYVLDSSALLDIAIICLPRISNFTDFHILEIQPDISVRY
FT                   IRNLADFGNPDLVIIPGSKNTLEDMAFLEQSGLKKAIQNYAENAGKVIGICGGYQMLGK
FT                   RMLDPNQVESEKVEIAGLGLLDTETIFLDQKRTTQITGVTFSSEPVEGYEIHMGQTKRG
FT                   ENTQPFCKIKAVNGNQETHEDGAISANKNIIGTYIHGIFDNDIFLGNLFNELLTQKNKS
FT                   IYPHEIIKLKEHKETEYDKLAALLEANIQMDQLEKIMKGEKICVSTQKPAIKE"
FT   CDS_pept        218215..218781
FT                   /transl_table=11
FT                   /gene="lin1172"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q92CJ9"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ9"
FT                   /protein_id="CAC96403.1"
FT                   /translation="MRIYTKTGDKGMTRIIGGSKVSKDNIRINAYGTLDELNSLIGYTI
FT                   TTLGNEPEIQAELEQIQQQLFDAGGDLATEEGKRDYKLTAEPVAWLEDRIDIYADEPPE
FT                   IEKFILPGGTQAASLLHMARTVARRAEREIVGMLKIASTNQEVLKYVNRLSDYFFAVAR
FT                   VVNYRAGETDIFYKNSELVFRNKKK"
FT   regulatory      218789..218815
FT                   /gene="lin1172"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(218789..218815)
FT                   /gene="lin1173"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(218825..219292)
FT                   /transl_table=11
FT                   /gene="lin1173"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q7AP08"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP08"
FT                   /protein_id="CAC96404.1"
FT                   /translation="MTKRSSKSLLLFMAMGLVSGLLSPIQTSINSQLRLTVGSPFVASF
FT                   ISFLVGTTLLTLVCLIVERRLTFQLKGVGRIPWWVFTGGALGVLFVTSNILLLPLLGSA
FT                   MTVVLALCGQMIIALIIDHFGFFGVIPHPINRYRMIGVLLMLIGVFLIQRF"
FT   regulatory      complement(219300..219305)
FT                   /gene="lin1173"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(219307..219756)
FT                   /transl_table=11
FT                   /gene="lin1174"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q92CJ7"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ7"
FT                   /protein_id="CAC96405.1"
FT                   /translation="MIILFIVSGLLAGMVLPVQTAINTRLSTYTKSPFLASWVSFMVGT
FT                   TVLLIVCLFTQKSWPISSEMIASNPWYIWVGGGTLGVIFLTANILLLPRLGSALLVMIT
FT                   VCGQMIMAIVIDNFGLFQVPMHEINIERLLGVILMFGGIYLMQRF"
FT   regulatory      complement(219764..219769)
FT                   /gene="lin1174"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        219845..220375
FT                   /transl_table=11
FT                   /gene="lin1175"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ6"
FT                   /protein_id="CAC96406.1"
FT                   /translation="MKIRIIGSVGSGKTTLAKKVSKWLQIDFFETDRIVWKREETEVRR
FT                   SDSEKIAELNAILQKDNWIIEGVHLEAWTEESISQADIIIYLDLPKKQIRSQLIKRQFK
FT                   QLLRIEKAHYVVRFSMLKKMFYWDDLFDQRTKPLVNEKINQHPAKWLIIKENLAFHEIQ
FT                   QKILQIISSRDIL"
FT   regulatory      220391..220396
FT                   /gene="lin1176"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        220406..220717
FT                   /transl_table=11
FT                   /gene="lin1176"
FT                   /note="similar to unknown protein"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ5"
FT                   /protein_id="CAC96407.1"
FT                   /translation="MDEKLRKTYLPMTETAFYILLSLVKPKHGYAIIENVAQMTNERIK
FT                   LGPGTIYGSLSKMNKDNLIQIIQEESNRKIYQITEIGAEVLQLEKTRIEELYRNSREV"
FT   regulatory      220707..220712
FT                   /gene="lin1177"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        220720..221268
FT                   /transl_table=11
FT                   /gene="lin1177"
FT                   /db_xref="GOA:Q92CJ4"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ4"
FT                   /protein_id="CAC96408.1"
FT                   /translation="MEKKVLKFFTVDNMEKEEAYLNDMAQKGWLFKEYKSFRYHFEKGE
FT                   PNKYRYAIDYKVNQGDEASYKALFADAGWDNVFCYPVLNGNWMYFRKLQAEEAGSETIF
FT                   SDEVSYIHLYRSIRKRWTIFGILMSILLLLDLFFLNNAGSYQVITIFIFILFIILIGLY
FT                   GKMFIQLTRKINKFANKNL"
FT   regulatory      221554..221559
FT                   /gene="lin1178"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        221568..222437
FT                   /transl_table=11
FT                   /gene="lin1178"
FT                   /note="similar to N-acetylmuramoyl-L-alanine amidase
FT                   (autolysin)"
FT                   /db_xref="GOA:Q92CJ3"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR025987"
FT                   /db_xref="InterPro:IPR038200"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ3"
FT                   /protein_id="CAC96409.1"
FT                   /translation="MKYRKLSKKKKQKRLIGIAGILLLIILVGVIASVVRQQYLIMTAP
FT                   KPDPAFHSKEQNFLNELSPRAQEIQAEHGILTSITLAQAILESNWGQSDLAQQGNNLFG
FT                   VKGKAPQPMVNMTTKEFVDGKWIEIKANFRKYKDWNESLEAHAELFLKGTSWNKDKYNG
FT                   VIKADDYKKAAEELQTAGYATDPGYAEKLINIIEKYDLALYDRIDDKIYYDAKSTGYGN
FT                   VKKDVSGAIWTRPYGLSGAQKVEEINYYKREDLKLLREAKTDSGVWYQISVKNDPIGWV
FT                   KQELIDKK"
FT   CDS_pept        222734..223720
FT                   /transl_table=11
FT                   /gene="lin1179"
FT                   /note="similar to N-acetylmuramoyl-L-alanine amidase
FT                   (autolysin)"
FT                   /db_xref="GOA:Q92CJ2"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR025987"
FT                   /db_xref="InterPro:IPR038200"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ2"
FT                   /protein_id="CAC96410.1"
FT                   /translation="MTIGLGITITLCAVPIHSQAAGLEDGLTSKQERFINEIAPHAQKV
FT                   QREHGILASITISQAILESNWGESMLAKDGNNLFGIKGSYNGASIKLPTKEHNGLVWVG
FT                   TDANFRAYPGWYESMNDHALLFVNGPSWNPHLYGGLIKEYNFEKAAIALGKTGYSSDPE
FT                   YAAKLIDLIKKANLDKYDTVYSERVSDKAIKAAGEVAIKDNSFIWSAPGGTKGANPVEK
FT                   TTKYFGHQVSINREVKVTDSNISWYHIHHNGDSIGWIESTSIKKFYQLEDYAPTRDALL
FT                   KTDDQNRLVINMDIDTSELHKPTIAKEETKGKTALNLPLLNVQSIAW"
FT   CDS_pept        223832..224911
FT                   /transl_table=11
FT                   /gene="lin1180"
FT                   /note="similar to endo-1,4-beta-glucanase and to
FT                   aminopeptidase"
FT                   /db_xref="GOA:Q92CJ1"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ1"
FT                   /protein_id="CAC96411.1"
FT                   /translation="MDEQLKMLKALTDAKGIPGNERAVRNVFREYIEPLADSFETDGLG
FT                   SAVAKKVGAEDGPKIMIAGHLDEVGFMVTQIDDKGFIKFQTVGGWVSQVMLAQKVTIVT
FT                   RSGEEITGVIGSKPPHVMTAAERQKSFDIKDMFIDVGAVDKAEVESYGIRPGDMIVPAF
FT                   DFTVMKNEKFLLAKAWDNRIGLAIAIEVLKNLQKEAHPNIVYGVGTVQEEVGLRGAKTA
FT                   AHFVQPDIGFAVDVGIAGDTPGVTDKEAMSKMGEGPQIVIYDASMVAHAGLRDFVTDVA
FT                   DELSIPYQFEAIPMGGTDSGSIHLTGNGIPSLSITIATRYIHSHSSMLHRDDFENAVKL
FT                   ITEVVKRLDKEKVTEIRLG"
FT   regulatory      224922..224927
FT                   /gene="lin1181"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        224937..225695
FT                   /transl_table=11
FT                   /gene="lin1181"
FT                   /note="similar to rRNA methylase"
FT                   /db_xref="GOA:Q92CJ0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ0"
FT                   /protein_id="CAC96412.1"
FT                   /translation="MEQIQSVKNDRVKTWKKLQTRKGRDKTGTYLVEGFHLVEEALRQD
FT                   GLVLELLISSGVSVPEEWLKGDYDVFEISSEISHLISDTMTEQGVFAVVAISEPDMMLL
FT                   YGKKLLLVDAVQDPGNVGTLIRTADAAGYDCVVLGRGSADLYNPKVIRSTQGSHFHIPV
FT                   IQADLFEWVANLEEEGVPVIGAVLDDQAKSLNDMPKRETLALMVGNEGNGISEELQDRL
FT                   SEKVYIPIYGDSESLNVAVAAGILLYGLRK"
FT   regulatory      225701..225734
FT                   /gene="lin1181"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(225701..225734)
FT                   /gene="lin1182"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(225739..226098)
FT                   /transl_table=11
FT                   /gene="lin1182"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CI9"
FT                   /protein_id="CAC96413.1"
FT                   /translation="MPSIRYIVKTDVSETFEIIKAGQVGSNIVFSEIRTFDFGELATLA
FT                   CEKFYFRSSNRAALFVNINNFHGETEVTIISTGSSNGFFTGIDWGAAFDYMHSVVADLK
FT                   RVAIREVKMEKQEEI"
FT   regulatory      226241..226246
FT                   /gene="lin1183"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        226255..226578
FT                   /transl_table=11
FT                   /gene="lin1183"
FT                   /note="similar to unknown protein"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP07"
FT                   /protein_id="CAC96414.1"
FT                   /translation="MTDAHTVCPKFESAFQLLGKRWTGLIINVLLTGPKRFKQVAAEIP
FT                   QMSDRVLAERLKELEEMDICLRQVYPETPVRIEYELTEKGKALQEVMLEVQCWADKWVE
FT                   VPN"
FT   regulatory      226586..226614
FT                   /gene="lin1183"
FT                   /regulatory_class="terminator"
FT   regulatory      226931..226936
FT                   /gene="pheS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        226944..227996
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /product="phenylalany-tRNA synthetase alpha subunit "
FT                   /db_xref="GOA:Q92CI7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CI7"
FT                   /protein_id="CAC96415.1"
FT                   /translation="MLEQLQTLKSEAETQINEAADLKTLNDLRVKYLGKKGPMTEIMKQ
FT                   MGKLSAEERPKMGSLANEVRTALTEAISSKQEILETAAINEKLKSETIDVTLPGTAPSI
FT                   GTKHLLTQVIEEMEDMFIGMGYEIAEGPEVELDYYNFEALNLPKDHPARDMQDSFYITE
FT                   NTLLRTQTSPVQARTMEKHDFSKGPIKVICPGKVYRRDNDDATHSHQFTQIEGLVVGEN
FT                   ITFADLKGTLTVLAKTMFGEEREIRLRPSFFPFTEPSVEMDISCFKCGGKGCRVCKGTG
FT                   WIEILGSGMVHPNVLEMSGIDSTRYSGFAFGLGPERVAMLKYAVDDIRHLYTNDLRFTK
FT                   QFQSTETGEI"
FT   CDS_pept        227996..230404
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="GOA:Q92CI6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CI6"
FT                   /protein_id="CAC96416.1"
FT                   /translation="MLVSYNWVKEFFQDFPLTAEELGEAITRTGIEIEGVEELSASLKN
FT                   VVVGEVLSCERHPDAEKLNKCLVQTDEEEPVQIICGAPNVAAGQKVIVAKVGARLPGGL
FT                   KIKRAKLRGEVSEGMICSLAELGFESKVVPKAYADGIYVLPEHVETGVSAITLLGLDDA
FT                   ILDMAITPNRADALSMNGVAHEVGAIIHQKPAQPTEPDVSEKGKADDFISVEVENPTET
FT                   PYYAIKMVENIEIKESPLWLQTKLMKAGIRPHNNVVDVTNYINLLYGQPLHSFDYDKIG
FT                   SKKIVVRSAKDQEEITTLDGEKRILQTGHTVITNGTEPIAIAGVMGGEFSEVTETTTTV
FT                   ALEGAIFSSSSVGKASRELYLRTEASIRYDKGSDAWKVEKALAHGGALIAELSGGTLVG
FT                   GVVEVDNREKAVNKIETSLTRINRILGTEISLSEIETIFDRLGFVLEVKEDTLIIEVPT
FT                   RRWDITIEADILEEVARIYGYDEIPVTLPATSTTGGLSDSQKARRVMRAYLEGAGLNQA
FT                   LTYSLTSKKDATRLALSDEKTVALSMPMSEEHSHLRTSIVPQLIRSASYNIARKNMDVA
FT                   LYEMGTVFYATEGDNLPIEQEHLAGLITGNWHTADWQKTPKPVDFFVLKGIVEGLVNKL
FT                   GIEAELHWKQIEKEELHPGRTASIQLEGKEIGYLGALHPAVEASYDLKETYVFEINVKA
FT                   LLDATKEKVVYHPIPRYPEMTRDLALLVDKDTDHATISQVIKEHGGNLLVDIELFDIFE
FT                   GESLGENKKSLAYTLTFLDSERTLVEEDVQKATNKVVEALQAKLHAIIR"
FT   regulatory      230416..230456
FT                   /gene="pheT"
FT                   /regulatory_class="terminator"
FT   CDS_pept        230559..231260
FT                   /transl_table=11
FT                   /gene="lin1186"
FT                   /note="similar to ABC transporter, ATP-binding proteins "
FT                   /db_xref="GOA:Q92CI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CI5"
FT                   /protein_id="CAC96417.1"
FT                   /translation="MTYVEMKDVSKFYQMGENVVTANDKINFGIKKGEFVVIVGPSGAG
FT                   KSTVLNILGGMDSASEGRIMVDGQDIAQYNAKQLTKYRRTDVGFVFQFYNLVPNLTAKE
FT                   NVELAAQIAPNALDAETVLTQVGLSHRLDNFPAQLSGGEQQRVAIARALAKAPKLLLCD
FT                   EPTGALDYDTGKSVLKLLQETCEKTGTTVIVITHNTAITPIADRIIEINNAKVRSIKEN
FT                   TEPMSIDDLEW"
FT   regulatory      231263..231268
FT                   /gene="lin1187"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        231274..234684
FT                   /transl_table=11
FT                   /gene="lin1187"
FT                   /note="similar to different proteins"
FT                   /db_xref="GOA:Q92CI4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CI4"
FT                   /protein_id="CAC96418.1"
FT                   /translation="MKRSALWKDIYREIWHSKSRFISIFMLIMLGVAFFSGLKATGPDM
FT                   LLTADNYFNKYQLANFNVQSTYGLDDTDKEALEGISGVAQVDLGYTADTLMKENNIVTK
FT                   LYSSSASDNLNKYKVVSGRLPEKSGEIALDNNKVIQDNIKIGDKVTFVKNDGSELTHTL
FT                   KKSTYKVVGFVRSPAYIQKSERGSSTVGKGKTDAFGVIPEQDFDLPEYTIASLTFNNLA
FT                   DKEAFSDAYIRTEKKDNKKVEQALAGQPEKRLNKIKTSEQKKLDDATAEINKGKAELQK
FT                   NQAKLDAAKAQLDEGFSKYNAAKASYDAKIKQGESEIAAGEAELANAKKQLDAAKMQIN
FT                   QGEEAILQAERELEEGLAAWNEANNLLNTANGYLKNARSTLENALKQPDLTDFDIDRES
FT                   LTNAFNMAASELDISAEELAEYEETINTLLDDYENGAISDAQIREALNAALKQVAEGEK
FT                   AYQSARTVLDEEKQKIEQGEKTLASKQQQLEQAKIAYQAGLAKYQAGQEKISLAKKQLA
FT                   DGKETGAVELQNALKKLNNGQAEYNKNLALFEKEKKAAEAKLASAEKDVKIGQEKLDAL
FT                   KLPKYYVLDRNDNPGYSEYKENADRLTSLSTAFPIFFFLIAALVCLTTMTRMVEEQRTQ
FT                   IGTLKAFGYSNGSIILKYLVYGSIASIGGSIVGIIIGFQFFPNIIFNAYKTMYEMPAVD
FT                   IGFYWSYSLLSICVALFCTTFTAYAACRAELRANAATLMRPKAPKIGKRIFLERISFIW
FT                   KRMNFTSKVTARNLFRYKQRMLMTVLGVAGCTALILTGFGLRNSISDIAKMQYGQIMKY
FT                   DAAVYQDMSAPPTAKETYDNLMEDSNIKSKLAMSQTNIDAVKSGQSAQASSIIVPKNLN
FT                   ELPDYIVLRDRASHTTEKLTDDGAIISEKLAKLFDIKPGDSITVKNAKNDKYKIKVSAI
FT                   TENYAMHYIYMTPTYYQQIFDEKPSYNLDLLKLKDTSEKVETEFAEKLTDSKSILTITF
FT                   SNNISSMLTDTLDSLNIVIVVLITSAALLAFVVLYNLTNINVSERIRELSTIKVLGFYP
FT                   KEVTMYVYRENIILTLMGIVAGFILGFFLHRFIITTAEVDQMMFSPAIDWTSYLFSGIL
FT                   TLVFASIVMVVMHIKLKRIDMIEALKSVE"
FT   regulatory      234765..234770
FT                   /gene="lin1188"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        234781..235233
FT                   /transl_table=11
FT                   /gene="lin1188"
FT                   /note="similar to transcriptional regulator (MarR family)."
FT                   /db_xref="GOA:Q92CI3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CI3"
FT                   /protein_id="CAC96419.1"
FT                   /translation="MEKQKVKQLIKSYQQTYIFAMTHIHQAISEISANTVDLSIEQFFV
FT                   LREIATGDEISATELSACLNVNKSAITPKLKKLEEKGYIRRERNKHDKRAVVLTITEKG
FT                   NSVYEECEKQLELLVNEWLEILGEEDSEQFFELFQKINKSVVKPKK"
FT   regulatory      235235..235240
FT                   /gene="lin1189"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        235249..238449
FT                   /transl_table=11
FT                   /gene="lin1189"
FT                   /note="similar to transporter, (to B. subtilis YdgH
FT                   protein)"
FT                   /db_xref="GOA:Q92CI2"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CI2"
FT                   /protein_id="CAC96420.1"
FT                   /translation="MKWIMKLRWAILAFWLAAAVVLMFIAPPMADLVREKGELKLPDGY
FT                   PSSLATEMQKKHNPDDKGSAYIAVYTADHKLTGTELNNIKKSLDSIDKNKDELHVTNVV
FT                   SSFNQPELKDKFLSKDGKTMVASLTVDDTDASVKSIRNALDKKMDVKGVDTYLTGNKLI
FT                   QEDVVQGSEDGLHKTEGITVVFILVVLFLVFRSAVAPFIPLLTVGISYLVAQSTVAFLI
FT                   DIFNFPVSTYTQIFMVCIMFGIGTDYCILLMSRFKEEMGAGLDPRESVHATYRTAGKTV
FT                   IYSGVAVLVAFTSLYFVQFDLYRSAVAVGVGIVVLLAALYTLVPFFMSTLGTHLFWPLN
FT                   KNISHKENKVWGAAGKFTFARPWIALLIVAAITLPPILLHTGTESFNSLDEISDKYPSK
FT                   KGFEIVSDSFGAGQVAPTQVFIENDDNMRTTEYIAQIEKISDDLSHLKGIDMVMSASRP
FT                   AGKRVDDIYIKNQAGQVNDGVGQATDGVGEVKKGLDSASSELKKSEPALDKAVAGVGDL
FT                   QKGTVATEQGINQLQAALAQIQIGIESGATGAGDLKQGVAEAKSQLASLQNGEAQIQAG
FT                   YAEIQKNLQNVAEQLKGFGNPNSPAIDTSKLEAQFKKIGESFQTFAAAHPEVRNDPKFQ
FT                   KLAADIQGLQTAGNELKTTAGQQMAALQAKMKELNQGIQQLATAMNQLNEQSKQISDGL
FT                   SAFGTGLGQIETGLDQLENGLNQAADGQGQVVSKMPEISNALSQIAAGQGALKEGFAGI
FT                   SGQMGELTNGLTSGADGLGKVESGLNTANGLIDDWSKVPYASSGIYVPDALLKNADFQK
FT                   VLDQYISSDGKLATINVILTKNPYSNGAMDSIDDINEQLAASMKGTKLENAKIGIGGMT
FT                   SANYDTRDMSTADYHLVLVIVLASVFVTLVIVLRSLVMPIYLIASLVLTYFAALGFAEI
FT                   IFMRILGYSGLTWATPFFGFVVLVALGIDYSIFLMSRFNEYNGLSVRDRMIKAMKNMGG
FT                   VIFSAVIILGGTFAAMMPAGVLSLLEIATVVLIGLVLYAIVILPLFVPVMVKLFGRGNW
FT                   WPFITRKGDHQENVPPKK"
FT   regulatory      238458..238484
FT                   /gene="lin1189"
FT                   /regulatory_class="terminator"
FT   regulatory      238542..238547
FT                   /gene="lin1190"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        238555..239229
FT                   /transl_table=11
FT                   /gene="lin1190"
FT                   /note="similar to uracil-DNA glycosylase"
FT                   /db_xref="GOA:Q92CI1"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CI1"
FT                   /protein_id="CAC96421.1"
FT                   /translation="MIKLENDWDELLKDEFNQPYYLKLRQFLKNEYQTKRIFPDMYDIF
FT                   NALKHTAYKDVKVVILGQDPYHGPGQAHGLSFSVQKGVQIPPSLQNIYLELHNDLNCEI
FT                   PNNGYLIPWADQGVLLLNTVLTVRAGQANSHRGQGWELLTNRIIEMINQKEEPVVFLLW
FT                   GNNAKEKLQLLTNPKHIAFTSVHPSPLSASRGFMGCKHFSKTNHFLEQNGIKPIDWQIP
FT                   SI"
FT   regulatory      239237..239261
FT                   /gene="lin1190"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(239267..240193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhC"
FT                   /note="similar to B. subtilis ribonuclease HIII"
FT                   /db_xref="GOA:Q92CI0"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CI0"
FT                   /protein_id="CAC96422.1"
FT                   /translation="MANTVIIVDQSTLEKMKQTYLPFSSPKLPPGAVFAAKKPGVSITG
FT                   YKSRKVMFQGVNGEAEAKKWVATLPEAKTKAPSVSKGVLPANFAAKNVIGSDEVGTGDF
FT                   FGPITVCAAYVDAEMMPLLKELGVKDSKAMKDPEICRIAEKIMPIVPHSVLLCPNPKYN
FT                   ELQKRGMNQGQMKALLHNRAIENVLKKLAPIKPEAILIDQFAEKNTYYRYLAKEPSIIR
FT                   EDVFFATKAEGLHLSVAAASIIARYKFVQAFDAMSKEVGIPLPKGAGPHVDVVAAEIIE
FT                   RFGLETLAKYTKQHFANTEKALKIAKK"
FT   regulatory      240334..240339
FT                   /gene="lin1192"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        240347..240610
FT                   /transl_table=11
FT                   /gene="lin1192"
FT                   /note="similar to B. subtilis YshA protein"
FT                   /db_xref="GOA:Q92CH9"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH9"
FT                   /protein_id="CAC96423.1"
FT                   /translation="MANERNKVVTTIYGREYTIVGVETADHLRKVARQVDEKMHEIGSQ
FT                   NHALDSGRLAVLTAVNATHDYLKLEQKYLELEQELARIKGRD"
FT   regulatory      240598..240603
FT                   /gene="lin1193"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        240610..241152
FT                   /transl_table=11
FT                   /gene="lin1193"
FT                   /note="similar to B. subtilis YshB protein"
FT                   /db_xref="GOA:Q92CH8"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH8"
FT                   /protein_id="CAC96424.1"
FT                   /translation="MILNAIILILLVCGFFAGFRTGLIKQLILLLGYILAFFISYTYYE
FT                   DLAPHLTFIPYPGSDTSDGLSIILQELRTETAYYNVLGFAIIFIVAIIVVHMLASLVGG
FT                   LTKIPVLRQINGLLAAVFGVIKSYLIIFIVLFVMAIYPANWSENLIDSSTVAQWMLENT
FT                   PILSEQFYDWMTDILPK"
FT   CDS_pept        241245..242957
FT                   /transl_table=11
FT                   /gene="lin1194"
FT                   /note="similar to DNA polymerase beta, to B. subtilis YshC
FT                   protein"
FT                   /db_xref="GOA:Q92CH7"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH7"
FT                   /protein_id="CAC96425.1"
FT                   /translation="MATNKKEIIRLLEEIATYMELKGENSFKISAFRKAAQAIELDSRS
FT                   LAEIEDFTKISGIGKTTGEIIQRYLDSGECPELVELKKEVPAGLVPLLDVPGLGGKKLS
FT                   RLYHELGVVDKDTLLKEARNGHIEALKGFGKKSAEKMAEAVREMGERPDRYPLNDVLPI
FT                   IQKVEDYLASIDTIATFARAGSLRRLRETVKDLDYVIATEKPEDVQKALLEFPLITDVI
FT                   GAGETKVSAVLEDNITISVDFRLVEKKAFATTLHHFTGSKDHNIKMRQLAKQSNEKISE
FT                   YGVEQEDGSMRHFESEETFFKHFHIPFLPPEVRRDGTEIERVTKDTKFLELSDIRGDLH
FT                   MHTTWSDGAYAIPEMIEACIAKGYEYMVITDHGKFLRVANGLDEKRLLEQQAEIKKVAA
FT                   NYPEIDVYSGVEMDILADGSLDFDDDTLKQLDFVIASIHSSFQQSEEEIMKRLKTACEN
FT                   PYVRLIAHPTGRIVVKRKPYHVNMKELIKLAKNTGTALELNANPQRLDLNREHLEMAHA
FT                   AGVPIAINTDAHDTKHLDFMSIGVRAATKAWLDKSAILNTKSAAEFKQFLQNK"
FT   regulatory      242967..242972
FT                   /gene="lin1195"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        242980..245337
FT                   /transl_table=11
FT                   /gene="lin1195"
FT                   /note="similar to MutS protein (MutS2)"
FT                   /db_xref="GOA:Q92CH6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH6"
FT                   /protein_id="CAC96426.1"
FT                   /translation="MEKKVEAILEFDKIKKQLAEFASSSLGEQAIYELAPATDFQVVQK
FT                   AQLETEEGAKIIRLRGSAPITGLTDVFAHLKRLEIGGDLNGLEIYQIGSNLRVSRQMKN
FT                   FMNDLLEIGVEIPLLGALSDELLVLKDVEEDIAISIDESGKILDTASEALSSIRRTLRR
FT                   TEDRVREKLESYLRDRNASKMLSDAVITIRNDRYVIPVKQEYKGHYGGIVHDQSASGQT
FT                   LFIEPQSVVDLNNERKALQAKEKQEIERILAEISASLAGWINEIHHNTFILGRFDFILA
FT                   KARFGKALKAVTPHLSDTGIVHLIAARHPLLDAEKVVANDIYLGEDFSTIVITGPNTGG
FT                   KTITLKTLGLLTLMAQSGLQIPAQEDSTIAVFENVFADIGDEQSIEQSLSTFSSHMTNI
FT                   VSILEKVNHKSLILYDELGAGTDPQEGAALAIAILDASHKKGASVVATTHYPELKAYGY
FT                   NRAHATNASVEFNVETLSPTYKLLIGVPGRSNAFDISRRLGLSESIITEARSLVDTESA
FT                   DLNDMISSLEEKRNLAEREYEEARELARGADALLKDLQKEITNYYQQKDKLLEQANEKA
FT                   AGIVEKAETEAEEIIHELRTMQLNGAAGIKEHELIDAKTRLGKAKPKTINKAIPKAPKQ
FT                   KPHVFQAGDNVRVLSLGQKGTLLNKISDKEWNVQIGIIKMKIKTTDLEYIEPEKPKKQR
FT                   IITSVHSSDSPAKSELDLRGERYEDAIQKVDKYLDEALLAGYPQVAIIHGKGTGALRTG
FT                   VTEYLKNHRMVKSIRFGAAAEGGNGVTIVEFK"
FT   regulatory      245402..245407
FT                   /gene="trxA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        245418..245729
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /product="thioredoxin"
FT                   /db_xref="GOA:P0A4L4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4L4"
FT                   /protein_id="CAC96427.1"
FT                   /translation="MVKEITDATFEQETSEGLVLTDFWATWCGPCRMVAPVLEEIQEER
FT                   GEALKIVKMDVDENPETPGSFGVMSIPTLLIKKDGEVVETIIGYRPKEELDEVINKYV"
FT   regulatory      245792..245797
FT                   /gene="uvrC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        245805..247616
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /note="highly similar to excinuclease ABC subunit C"
FT                   /db_xref="GOA:Q92CH5"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH5"
FT                   /protein_id="CAC96428.1"
FT                   /translation="MSSEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSY
FT                   FSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIK
FT                   ITNERHPRLIITRQVKKDKGKYFGPYPNVYAANEVKRILDRLYPLRKCSTLPNKVCLYY
FT                   HLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEF
FT                   RDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFY
FT                   NDADEDFLTFIGQFYQKANHIPPKEIYLPDDVDSEAVQAVVPDTKIIVPQRGNKKELVK
FT                   LAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSA
FT                   MVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEGLPMPDLILIDGGK
FT                   GQIDSAKDVLTNELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQ
FT                   DEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASVEEIKEA
FT                   GVPLNVAEEVHKHITAFNEKAKNTEQK"
FT   regulatory      247629..247668
FT                   /gene="uvrC"
FT                   /regulatory_class="terminator"
FT   CDS_pept        247799..249013
FT                   /transl_table=11
FT                   /gene="lin1198"
FT                   /note="similar to aspartokinase II alpha subunit"
FT                   /db_xref="GOA:Q92CH4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH4"
FT                   /protein_id="CAC96429.1"
FT                   /translation="MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNKVIVVVSAMGK
FT                   STDKLVAMAEEISEAPDKREMDMLLSTGEQITIALLAMTLKEKGHDAISYTGWQAGIET
FT                   EAVHSNARIADIDSARIESALEAGQIVIVAGFQGITTDGEITTLGRGGSDTTAVAIASA
FT                   LKAEKCAICTDVVGVFTTDPRYVKKAQKLEQLTYDEMLELANLGAGVLHPRSVEYAKNF
FT                   RIPLEVRASHELEPGTMIEEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFT
FT                   KLAENNIDVDIIIQGITGLGHGNLSFTIKTSELLATLAVLEESKELLQIEKLESEQELA
FT                   KVSIVGSGMVSNPGVAAKMFEALTENNIPIKMISTSEIKVSTVVPARKMVEAAQVLHDQ
FT                   FELDK"
FT   CDS_pept        complement(249085..249570)
FT                   /transl_table=11
FT                   /gene="lin1199"
FT                   /note="similar to B. subtilis YslB protein"
FT                   /db_xref="InterPro:IPR019642"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH3"
FT                   /protein_id="CAC96430.1"
FT                   /translation="MVYESEVSEMTENEQNNYEEKALVPSFGLDVLRDYLIPEILGDEA
FT                   PHIMYWAGKDLARKFPLESMEEIREFFEEASFGTLSILKEKKDELRLLLEGDMVVSRFR
FT                   TQENPTFKLEAGFIAEQLQTQKKLYTESYDEIDKRKKQVTIIVKWDRKETIDNEERY"
FT   regulatory      complement(249583..249588)
FT                   /gene="lin1199"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      249715..249720
FT                   /gene="racE"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        249728..250528
FT                   /transl_table=11
FT                   /gene="racE"
FT                   /note="similar to glutamate racemase"
FT                   /db_xref="GOA:Q92CH2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH2"
FT                   /protein_id="CAC96431.1"
FT                   /translation="MKQAIGFIDSGVGGLTVVREVLKQLPHEQVYYLGDTARCPYGPRD
FT                   KEEVAQFTWEMTNFLVDRGIKMLVIACNTATAAALYDIREKLDIPVIGVIQPGSRAALK
FT                   ATRNNKIGVLGTLGTVESMAYPTALKGLNRRVEVDSLACPKFVSVVESGEYKSAIAKKV
FT                   VAESLLPLKSTKIDTVILGCTHYPLLKPIIENFMGDGVAVINSGEETASEVSALLDYHN
FT                   LLDATDDEIEHRFFTTGSTQIFKDIAKDWLNMPDMTVEHIKLGK"
FT   regulatory      250527..250532
FT                   /gene="lin1201"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        250541..251287
FT                   /transl_table=11
FT                   /gene="lin1201"
FT                   /note="similar to ribonuclease PH"
FT                   /db_xref="GOA:Q92CH1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH1"
FT                   /protein_id="CAC96432.1"
FT                   /translation="MRFDGREKNALREIEVTPDYLMHPEGSVLIASGNTKVICSASVET
FT                   KVPPFMRGEGRGWISAEYSMLPRATNTRNIRESSKGKVTGRTMEIQRLIGRALRAVVDL
FT                   DALGERTIWLDCDVIQADGGTRTASITGAFIAMVMAIAKLDEEVPFTKFPVKDFLAATS
FT                   VGVLEEGGTVLDLNYVEDSAAQVDMNIIMTGSGAFVELQGTGEEATFSETELAELIALG
FT                   KKGISELIEIQKETLGDKITARIKGE"
FT   regulatory      251278..251283
FT                   /gene="lin1202"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        251291..251902
FT                   /transl_table=11
FT                   /gene="lin1202"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YsnA protein"
FT                   /db_xref="GOA:Q92CH0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH0"
FT                   /protein_id="CAC96433.1"
FT                   /translation="MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGT
FT                   TFAENAALKAETVASLLNQTVIADDSGLIVDVLNGAPGVYSARYAGVAHDDAKNNEKLL
FT                   KNLEGVEPAKRTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPE
FT                   FGLTMAEIPAEKKNEISHRANAIKQLEKDLAEVVEKVTKK"
FT   CDS_pept        251940..252464
FT                   /transl_table=11
FT                   /gene="lin1203"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YsnB protein"
FT                   /db_xref="GOA:Q92CG9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR028661"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CG9"
FT                   /protein_id="CAC96434.1"
FT                   /translation="MKLLVVSDSHSERDCLIHLKEKYENTVDAMIHCGDSELEADDPAI
FT                   QGFHTVRGNCDFGGGFPNDWVGEVDGYRILTTHGHLYNIKMTLMNLRYRARELNADFAF
FT                   FGHSHELGVDMLDDTIILNPGSISLPRGRIRIKTYALIDSTPEGIKVRFMDRDDNELTD
FT                   LTQVFPLTKHN"
FT   tRNA            252575..252648
FT                   /product="transfert RNA-Arg"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 82.37"
XX
SQ   Sequence 253050 BP; 83778 A; 42718 C; 51059 G; 75495 T; 0 other;
     atgctggtgg agaattctac tatattacta aattcggacg ccatgtttat agtgacgttg        60
     attatagtga tccaaataaa aattatttct ttgtttttgg aaaagaaact actggtttgc       120
     ctgatgaact tttacaagca aatgaggaaa attgtttacg aattccaatg actgatcata       180
     ttcgatcttt aaatttatct aacaccgcag cagttttagc atatgaagcg ttacgtcaac       240
     agagttttgg cgcgctttta caagaaccaa attacgatcg gaaaatcttt aaagactaag       300
     ggggagttag ggtgaatcag gcgatagatg ccattttagg tcattattca gtacggaact       360
     ttgaagataa agctttaaca gaagaagaat tagctttact tattaaaagt gcgcaggccg       420
     catctacatc tagttttgtt caagcatact ctataatcgg aataacagat aaaaaaattc       480
     gagaacaaat ttctgctatt gcgggaaatc aaccatatac tgtacaaaca gggcaattat       540
     ttatctttgt tgctgatcta gcgagacacc aagccatcct agaagaacat caagtagaca       600
     cagccgcact agaaacttca gaaaaatggc ttgtttccat tattgatgcc gcacttgccg       660
     cgcaaaatat ggctgttgcc gcagaatcgt taggatttgg tatttgcttt atcggaggaa       720
     ttcgtaatga cgtagggcaa attgccgaaa ttcttgattt gccaccatat acgatgccgt       780
     tatttggttt aacaataggc cacccgatta aaggcaaaga aaaagccaaa cctagattac       840
     cgcaagattt ggtttatcac gaaaatactt atcaaaaaat gaatccagca actttagcag       900
     aatacgatga acaaataaaa acttactacg atgaacgaac agcaggaaaa cgagtagaag       960
     gctggtccga gcagattgca cgcgggcttg gaagaaaaag ccggttagac ttaaaagatt      1020
     ttttacaaaa gcaacattta aatcaaaaat aaaaagagtg gtttggcgca ttatcgtaat      1080
     gcgccaaacc actctttttt cagttattta cgtttattcc tagccatttg aattaagttc      1140
     caaataacga gtattaacac tactactagc aagatattaa ttaatccgcc cgctacatgg      1200
     aaaataattc caagtaacca aactgctaat aaaacaacta taattcccca aataattcct      1260
     aacatataaa aaacctcttt ctaatctttt gattgtactc ttatatattc ccgagtgaca      1320
     agcctctaaa catgttaggg ataaaaaagg ctattttttt gtaataaaag ctaaaagggc      1380
     tttgactcct tccgttacca ttcgctctgt ttcatcaaaa tcaccagtgt aataaggatc      1440
     aggaatttct tcctcttcct tgcctgaaac aaaggacatc agtgaacgaa gagttacgtc      1500
     tttgttttta ttaagagcat ttaaatcagc tatattattt tgatccatcc caataatata      1560
     atcagcttgt tcaaaatcgg catccgttac tttccgagca cgcattgctt cataattaat      1620
     accgtgcttt ttcaaaactt ctcttgtacc acggtgcggt ggttttccta agttccatgt      1680
     tcccgttgcc gcagaatcaa tttctatttc atccgttaac cctgcattag caacttcttt      1740
     tcgaaaaagt ccttctgcca ttggagaacg gcaaatattt cctaaacata caaatactac      1800
     ttttaccaat tgaattcctc cttattccca ctctttatat aattcagtag tagcactttg      1860
     atctattcca tcacagtcct taagcatcgc gaaaatcttt tccacaagtt caggaacaag      1920
     ttttctccgg aaatagagca attgattttc aaaggattga tagacgacta tattataggg      1980
     gatttcgttc ttttgaagta aacgaatgag tgtttctaaa taccactttt tatctggata      2040
     atcctctaat aactctagta attgcttggt ttttttgaca ttacttgaag caagaatttg      2100
     gtctagtttt tttactggaa attgttccgc gaaatctact gggaaggggc tgaaatatag      2160
     tgcctccaaa aactcagcca tgttttctgc aacaactaag gtctgtagcg tttcaaaatc      2220
     aacatatata atgctaggca gagacttatt atcagcataa gaaaaaccga tatagcgcga      2280
     ttcatctcgg tgaaaataaa cttgttttcc tgcaagatcg acatcatttt gttccggaat      2340
     gtccgttaat aattcattta aactagctaa ataataaatt tccgcgacat caagtccgta      2400
     agacgttggc tcgttcgttg gaaaatggtt ttttcgaatc aatccaccat tttgcttcaa      2460
     aagcagctct ttatattcag ctggtaagaa taaacctagt tccgtttctt ttgcagaaat      2520
     ctcttgctca gttgcagcgt tattcccgtt tctaacccaa atcgtcatca tcttcaactc      2580
     cttcctgtat tatcctaaaa aatactaaat agcgcaaata aaagaacata actagaaaaa      2640
     ctagctatgt tccaaatgtt acttcaaacg atcttgataa taactatttt catttcgtgc      2700
     atcaaatttt gcggttaaag tttcggctat ttccaccaag tctgtttctg tttcacgatc      2760
     caaaagagga taagcagctt gtaaaaataa taatcgatct agtccgcttt ctgatttaag      2820
     aacgatttct ttattcgtat caatgacttc tctagccttt tcagtttggt ttgtaagcac      2880
     tagatactta agcaaatggc taagtggtgg aattaatgaa ctttctttct ccacaagagg      2940
     gtagccttta tcaaaacatt cttgcgccat tttttcatca ccaagttcta aatacgctaa      3000
     agccatattt ccataagtta aatgaggaac ttctgcgcag ctctgtttcc ctttaataat      3060
     tggagcagca gctttcttcg ctttttcaaa atctttgata aaacagtaat aatgaacttt      3120
     atcatttgtt tcgcaagcag ggcagtcatt taaataatct gctttggtgt tattccattt      3180
     ttcaaagagt tcttctgcct tgtctttttc gcccattcga atggcagcaa gggtacaaac      3240
     tttatagtaa gggcgcaagg aataattttg ctgttcgaat tttactttca tatcattcaa      3300
     aagcccatct atttgcgctt tggatacttc atcaaaagtt gggacatgtt cgctaatcca      3360
     tttatatttc caaagtagat cgtaagcgtc aatatatgcc gcatcatctt cccatttttt      3420
     tactaaccaa ctaaaggctt gtaattgttt ttttggaaat ccggcagtta agcaagtatc      3480
     aatcagcata tcgcgtgcct caataccatt ttctacatcg ttatacatat ctgcgcttgc      3540
     aattgcacgc tcaagaattt tcactttttc agcattgtcg tccatacccc aagcttcttc      3600
     aatatcattc aaataatcca tttttttcct cctatagcat ttctaagatt cgtaacatat      3660
     tttgattcat taagtccatt tctttccgtt tgagtggata atgtcctaac agtaaagcct      3720
     gaatataaag aacattaaca atcaccgata actcattaat agatttacca gacgtgaaaa      3780
     gttttttata agctcattat ctaaatttaa atacaaatgg gcaagtggag caggggcttg      3840
     ttcttgctga atactctcta aaatatcact gaaaacagaa ctcgtttctt ctaaagagcg      3900
     ttccagttct ctgcttgcct gtgtagcggc agaatgaata aaaataatag ggagcgtttt      3960
     aggttcaaaa tgcttaattg ttatatcggc atcaaattcc gccatcattt tattcatttc      4020
     agctaagatt ggttgataag ttatttcttc ttcagcagac attggtaaca atttgttagt      4080
     gatttcttct ggttgaatta aaataaactc ggcttcatct accaaatgat ttaacattgt      4140
     taaaattggt gtatcgtagg agtaaccgcc attaatcaat gtcataccac tagagcgagc      4200
     aatatcagtt atctgtctaa aatcgtctac tgaaaaagta tagtagattg tcgtcgtttc      4260
     tttcattata tctgctaatt tttcttcacc attcaaagtt ttaaacggca gataagaata      4320
     aattaatttt aaaaatggcg catcttcact agctaatgct ttaaaaccaa gataatgcgt      4380
     cgataataat tttgttagtg cgctctcggg taacgtttca attccttttt ttagcgccac      4440
     acctagctcc ttagatacga tttcaaggcg ctcattttta taaaaagatt cccgtgaagc      4500
     gactggctga agctcatctg tccaaagtat acattcagca aaaaaagccc agttaggaag      4560
     aacgttattc gcttcgctcg tcacatacat attgtttaaa aataccgttt gtttgcgcac      4620
     cgcattcatt tgcaccgtat aaggaatcat aaaagcgatt ccaaaagtac gaccagattc      4680
     attttcaatt aagaaataat cttgaaagcg agtgccgagt aaatgttccc cgtagcgaag      4740
     aatttgctcc ctcggaagac tgaacagtat ttctttatca gcaaactgct tggtccacga      4800
     gttaatctct tgttcataac catctgcttc tattaaaatg gcgctttcta aagaagagcc      4860
     gtattttttt aatgtattaa tcaagtattc cgttttttcg cattcagggt gttcatccat      4920
     atgaggacgc aaccgtaaat aaacttgagt accaggttcg cgtttttcgg ttttaatttt      4980
     acggacagaa taagtaccat cagcttttcc atgccattca gtcgtttctc cgtttttttg      5040
     tgaggtagaa atcattacaa tctcatcgct aacaataaaa caagaaagta aaccgatccc      5100
     aaagcgacca ataaaatcat tggtatcttg accatcaaag tttttttcac ctttagatga      5160
     attagcaata gttgcaagga aggcatggac ttcatcttcc gttaaaccaa tcccattatc      5220
     ctctaaaatt aaagttttgt tgtttttttc accagataat gaaacatgga tttttccatt      5280
     taaagtaggc tctattttct tcctagctct aattgcatct gtagcattct gtaataattc      5340
     tcgaatataa acatcttttt cgtcataaag atgattagag agaatgtcaa tcataccagc      5400
     caagttcacc tgaaagcggt gagaataatt ttccattgtc tatcctccta gttgtgtaaa      5460
     tatcattttt attctatcat aaaagaagag ataaatattg gaaaaacatt aatagatgtt      5520
     taaaaaatca tatcagtggt aaatactttg tgatggtttc cacactggac attgtagtgg      5580
     aaatagatta tacttattat taagtgataa tcattacaaa ataggaggaa gataattatg      5640
     aaaacaatca actcagtaga cacaaaggaa tttttgaatc atcaagtagc gaatttaaac      5700
     gtattcacag taaaaattca tcaaattcat tggtatatga gaggccacaa cttcttcact      5760
     ttacatgaaa aaatggatga tttatatagc gaattcggtg aacaaatgga tgaagtagca      5820
     gaacgtttac ttgccattgg tggaagccca ttctcgactt taaaagagtt tttagaaaat      5880
     gcgagtgtag aagaagctcc ttatacaaaa cctaaaacta tggatcaatt aatggaagac      5940
     ttagttggta cattagaatt acttagagac gaatataaac aaggcattga gctaactgac      6000
     aaagaaggcg acgatgtaac aaacgatatg ctaattgcat ttaaagctag cattgacaaa      6060
     catatctgga tgttcaaagc attccttgga aaagctccat tagaataaga tgcaatcaaa      6120
     actgtgtggg atttatttct cacacagttt ttttacctcg aatctgttat agtacaatat      6180
     ccttatttta aggttgtttt aatacatagt ggtttgaatt ttattagaaa gaggtatact      6240
     aactgcataa caaaaagcag aaaaagtgaa attcgatgta aaatctgcta ttcttgagta      6300
     ataatcaata cgtacaaaaa atggaaacga ggagtgaaaa gtatgaatat cgaggtaacg      6360
     gaccaagcaa ataaatggtt tcatgatgaa tttgatgtag ctgatggtaa tggaattcga      6420
     ctttttgcca aatatggtgg ttctaatagt tccttgcatc ctggtttctc tatcggttta      6480
     gctgccgaaa aaccgcaaga agcagcagtc gctgaaaaga aagaagactt aactttcttt      6540
     attgaagatc atgattattg gtatttcaaa gaccacgact ggaaaattga ctatgaacca      6600
     aaaacggaag aagtatcctt ttcctttaaa gaaaaagtga aatgaataca acataaattg      6660
     ccgcgtgtaa atcgattttg atttcatgcg gtttttgttt taaaagcttt actgttctct      6720
     attcctttgc tattctacta agagagcagg aggagaaaga tgacaaagaa attagtaatt      6780
     tgtattagtt taatcgcgat atttttaagc ggttgtagtt tttcagaacc atccactaaa      6840
     ccatctaaca tcacagaaaa aaccttaaat ggtgcaagct ttactttttt tgatgttggt      6900
     caaggggaca gcacacttat tcaagcagaa gacggtacga ctattttgat tgatactggt      6960
     cgacaagatg atgaccggat tttaacttat ttaaaagaag caaatataaa aaagctagat      7020
     ttgctattac tgacacatcc acatgccgac catattggta atgccgacaa agtcattgct      7080
     acatataaac cgaaagaaat ttggatggat ggcttaactt tttcaagcag tatttatgag      7140
     aaggtaattg atgcagcact ggcctcaaat gcgaaatata aagaaccaag acgcggtgat      7200
     aaagcgactt ttggtccatt tgatatagaa gtcctaagcc cagataaact tcaaaacgac      7260
     gccaataatg actccattgc agtcaaaatg acatacaaag atatttctgc cattttcact      7320
     ggtgatgcgg aaaaagggcg ggaacgagaa atggcagata gtggcgccaa tttagaagca      7380
     gatattttag acttaggaca ccatggttca tccacttcta atcaaccatt tttcttagat      7440
     aaagtgaaac ctcaagtggc tgtatactcc gctgaaatgg ccaacagtta tggacatccc      7500
     catgtagaag tattggaatg gttaaaagaa cgagatatta aaacttacgg gacagatgtg      7560
     aatggaacaa ttacaatcga aactgacggc gaaaaaattc atgtccaaac cgaaaaagaa      7620
     ggcaccccta agcccggtag cagctataac aaagaaaata atacacaaaa aacagaagat      7680
     gccacatcag aagaattgcc tgaaagtatt aatctgaatt cagcatctag tgaagaatta      7740
     caactattac cacttattgg cccagcgctg gcagaaaaaa tcattgccga gcgcccgtat      7800
     cagtccatag atgaattgaa aaaaattaac ggcattggtg atggaattgt gcgccaaatt      7860
     aaagaacaag gccttgccgt aacaaagtag gtgaataggg tgaaaaaagc aatattagat      7920
     cgtatagagg atggaaaagc cgtttttcta atcgaaccga accatacaga atggttagta      7980
     aatcaagaag aacttgattc ctctataaaa gaaggggatg tcgtcactat ttcagaaaca      8040
     aatgaaataa tgaaacaccc ccaagaaact gatgaaatga aaaaacgtat tgcggaaaag      8100
     ctagaaagac taagaggaaa aaactgagaa aaactttttt aaactctcat gaaattttca      8160
     tctttctttc agcacattct tttttaggaa agttattata tgtataagct aacaacaagc      8220
     aaaacatttt catttctttc cctttttaga atgaaaatcc caaactccct tttagctagt      8280
     gcggtttact ccctttttcc gcgctagttt tttcatgcgc aaaaatcact ttttctgtgg      8340
     aaagagaaat ttattgcgtc cagcatctag gccgcaatat agcataatta gggtaatgcc      8400
     gatcagaaca tataacgttg gttgccaact gccaagagca tcatggagtg taccaaataa      8460
     tattggaccg gaagcagcaa acaaataacc tattgattgc gccattccag ataaatccgc      8520
     cgattcggta gcgcttgttg ttcgcaaatt aaagaacatc atcgaaagac taaatgacat      8580
     ccccgaacca atcccatata aaataatcgc agtagctaaa ataaatagat taccagaagc      8640
     gaacataatc ccaaaaatcc caatcataaa taataaaaca gaaatcccaa cgagcaactg      8700
     ctgatttttc attcgcccag ctataatagg aataataaat gtaatcggca taacagcaaa      8760
     ctgcattagt gagagcataa gaccgctaga agtacttgat aatccttgat ctgctaaaat      8820
     gttcggtaac caagcaatcg aaatataaaa aatcgcggac tgtgaaccca tatataatga      8880
     aattttccaa gcaagagggg acttccacac cgaagtagta actaaatgtg tggcaatttt      8940
     ttctgagctg cgttggttat atcttaactg tggtagccag ataactaacg ctaaaacacc      9000
     cagcattgcc caaaaaacca tgcttccatg ccagctgaat ttattattca tcgcaatcgg      9060
     caccgtcaaa ccagcagcaa gtgccgcaca taaattcatt gaaatcgaat ataccccagt      9120
     cattaatcct aatttaaaag gaaactcctt cttaatcaaa ctaggtaaaa tgacatttcc      9180
     cactgcaata gcaagtccaa tcataaatgt cccagcaaat aaatagaatt cgcctccaaa      9240
     aggtcgaagt aaactaccaa taacaagagt taaaagtgcg ataaaaataa gtacttctat      9300
     ccctagtgaa cgacttaatt tcgaaacaaa aggggataaa ccagcaaaag caagtagtgg      9360
     tatcgtcgtt agtaatcctg ccatcgtgtt tgttaaatgt aaatctgatt gaatcattcc      9420
     aagtaaaggt ccaactgacg taattggtgc acgcaagttt gctgcaatta aaataatgcc      9480
     gacaataagc atcacccgac ttgaacgcgt caggattttt ttatttgtta aatctgaatt      9540
     catttgttat ctccattctt agcagcaatt tgtttgaaga gcgtgatata ctcagttact      9600
     tcatgtgctg ctccttcttt atctcgtttt tcgatcgctg atacaagagt tgcatggcca      9660
     ttatgcttat taacagctgg attcatttct gttgtactcg taatcgaaaa ctgtatttcc      9720
     tctaaaatat ttacatacat atctaacaat aaatcattgt gcgctgcctt tacaattgtt      9780
     agatgaagag ctgaatcggc ttttacaaag gcagttacat cattatcttt attagctaaa      9840
     tagcaaagtt gcttatattt ttttagcatt tttaaatctt catccgtgcg ccgttcgcaa      9900
     gctaaaataa ctgcttctcg gtctagcgca tgcctcattt ctagaatttc ttgaacagag      9960
     gattctcgca cgcgtttttg cataatagca tgaagttcac tattattgcg tacaaaagtt     10020
     ccgtctcctt gctttgtttc aagtaaacca atatgggcca gcgcacggat tgcttcacgt     10080
     aacgtatttc gactgatgcc aaactgagtc attaaatcag cttctttagg aattcgttcg     10140
     ccgattttcc aagcgccact agtaatttca gcttttatct gatcatagac ttgctcagct     10200
     aaagatttcc gctcaatttt ttctaccaca aaaaaactcc cctttctaaa ggtaggatga     10260
     ttggttctat tctacagaag aaaaattttt ttgtaaaccc tatttaacta atttatgata     10320
     aaatgaagaa agaaaagggc tggtgaggaa atgaattggt tggagaagct aaaagaaaat     10380
     gacacggcaa gacgggtgct agtgtttgtt cttctaggga ttgtattata tttacttaga     10440
     agcatgatag atttaatatt actaacattt atttttgcat ttttagttac gcgattagaa     10500
     aatgtaattt taaaaagaat acgaatacca cgaaaattaa tcgttatcgt tttatattgt     10560
     ttagtagcaa tgtttttata tgttgctatt gttcatttct taccaatttt aattgaccaa     10620
     atatcgcaac ttgtagactc tcttgtaaaa atttataata acccgagtga taataagatt     10680
     gtgcagtgga ttgtcggatt tttgaaggaa tcgaatattc aaaaatacct ccaaactggt     10740
     gttgacttta ttattgcttc actttctgga atcggttcgg ttggattatc gtttttctta     10800
     gctttaatcc ttagtttgtt tttctcttta gaaaaagaac gggtaacttc ttttacaggg     10860
     caatttttaa caagtaaagt aggctttatt tttaaagaag cagcgttttt tgggaaaaaa     10920
     tttgttgcga ctttcggggt ggtgttagag gcacaattga tgattgcgct tgttaataca     10980
     atcattacaa cgatagcact atatttaatg aatttcccac aacttcttag tctatccata     11040
     atggtgtttg tattagggtt aattcccgtg gctggtgtaa ttatctcatg tgttccactt     11100
     gttcttattg catactctgt tggtggtttt caagatgtcg tttatatttt aattacggta     11160
     gttatcgttc atgcgattga aacatatatt ttaaatccga aactaatgtc ttccaaaacg     11220
     aatttacctg tattttatac ctttatcatt ttaatttttt cagaaacttt ctttggcgta     11280
     tggggcttaa ttgttggtat cccagtattt gtattcttac tggatattct agacgtacga     11340
     aattctgaag atattcaaaa aagaactata tttggacgta agaaaaaagt agattaagct     11400
     taatgcttaa tctacttttt cagttcccca taaaaaatta gctactttgg catctacatc     11460
     tgtattttca tgtagtttac tgtgagctgc tttttttcca gtaaagattt tttcttcgta     11520
     acttttagct tgtccttcaa aaataaattt accagagaga gcgcttgcga ccgatacact     11580
     accatcgctt ttggttccgt ctagcatatc accggcaata tttaatactt gtaaattagt     11640
     agggattttt tgtttgtttt tcataaattc actataacga tcagaggact gttttggtcc     11700
     ttcatccgtt aaatcgtagg cagttacacc attatcacca acaactagcc cattaagtgg     11760
     tgcgccaatt aaaactagat tttcaagaac tggataggct ttatcactac caactttctc     11820
     aatataactc gttaggctaa ctccgcccat tgaatgacca accgcatcta ctttttcaat     11880
     atgataatta ttttttaact ctttcatcac attttgtatc cactgagttt gattaaccat     11940
     cgaactttta ttatcctcaa aaatgacttg gatagttgga ttatgactaa atttatcgta     12000
     acttcctgtt gtgctcacac ttccatcagc agcaacagtc ataacaagtg attctgttac     12060
     gataccatca tcagcaaggc gattaatcat gcctttaaat gaattagctg tccctgaata     12120
     gccatgaaca aaaagcgttg gtacagcaat ttctgaaact ggatttttag cttttttgga     12180
     agatttttgt gcagtagcgt tagtaggttc tttagcagct tttttagtag gttcaaactg     12240
     aaggaaaatt atcccaaagc ctgtaattat gatggctaag atgataatcg tgagtataac     12300
     ttttttcatt cgaaacatcc tttaactttt atttctgccc ccataaaaat tgaccgacat     12360
     acttatcaac gacagtggat tcatgcatgc tactatgggt tgctttgggg cctttaataa     12420
     cgtgagtaat gactttctga tgtgcaaata acttttgacc atataagacg ctatttaatt     12480
     tgacttcgcc atcactgttt gagccgtctt ctaagtcgcc accgataatc ataatttccg     12540
     tattatcagg taatactttg gccatttttt gagcaaactt ggcatgaaca ttattggcat     12600
     ttttaatgtc cacttgctga tctccattta catattcttc tgggtaaaaa ggtactgcga     12660
     gaaaaacaat tttatttact tgtggataag atttgttttt ttcataagat gctaaatagg     12720
     aaacccaagc accgccaccc attgagtgac caattgcatt gaattttttg atgtcataat     12780
     ttttttgtaa ataggacatt attttttttg tccacatcga ttgctgaggg agggttgctc     12840
     ggttatcttc aaaaacaata ttaattaacg gatttttttc atttttacta taagtaccag     12900
     tagtagaaat gcttccgtct ggacttacat ttactgttaa tgactctgtg ccccaattat     12960
     atttttggtc gaagcgtcgt atcattccat gaagtgagcg atcagttcct cggtaaccat     13020
     gtataaatat agttggaata gcatcattag ctgcttttgg atatgtcgtg ttgatcgtaa     13080
     gtaaaataaa aattgctcca actaaacacc ctaaaggtaa gacaatcgag aagaacacac     13140
     gctttagcat tattttacgc ccctttaaat ttcgttatga acaaattata cattttttta     13200
     aagcaaaacg cacgactagt cttctttttc taatatttaa atagtttatt ctcactaaga     13260
     catatagtat actggaaaaa taagcgaaga aacggaggca tattttcatg attaaacgaa     13320
     ctggtgagat agttctcgct attattggac ttatttttag tgtacttatg caagcagcta     13380
     ttgctgtcat tggtctatta cttgtaaatg gctcaaaagg aaaagaaggc ttaacaactt     13440
     attacaataa ctactaccaa actgttaccg aatgggaaat tcctaaagat gagataccgg     13500
     acccggatcg tatctttgat tttgtacata cattatcttg gactgcactt tctggcggga     13560
     taatcacttt aattgttgga gcagcaggca tttactatat tatgaagaat aaaaacccaa     13620
     tacttgctgg atttttattt ttagcagccg gtattgtgtc acttttatcc actgcactta     13680
     ttggtttcat tcccgcttta cttttcgtta ttgcggcaat gctatgtttt attcgtaaac     13740
     ccaaaagcac tttttctgga ttctaatatc aaaacgagtt tgcatcatgc aaactcgttt     13800
     ttgttttatc tcgctttttt tagggaataa aatagtggat ttcaagagga ggttgatagt     13860
     gtgaaaaata aagtaggaat tattgctgga gctgttgcgg gtgtagtagc ttgtgctgca     13920
     atttatgtgg tgaaaaagca acagccaccc acgccttttg atgaagtaaa tgatattaga     13980
     acacgctatg cggacaaaga aatctcagaa acagagctag aggaaaacaa tatgatttct     14040
     gaaggcggag tttcatctct tcaatatgaa gaaaaaataa aatagccaaa aagcagtttg     14100
     tatcttgtgt tacacgagaa gcaagctgtt ttttgttcgt taaacatttc ttaatatgtt     14160
     atcctgtagt tagataatag gactcaagtt gtaggtgaat ttccttctac agtgggttct     14220
     tatacttgat acatagcgtt atgataggta cagtaataaa agaaaaatat ttcagctaca     14280
     cttggaaata aggaggtaga cagatgagag cgattttgat tggcgtatta atagttttac     14340
     tcttagcaat gatacttatc gtcttatggc cagcaattat ggcaactatt ggcgcagtgc     14400
     tcggcttttg gtcacttaag aaactactcg aagcaaggtc tgtaggtgaa aaaatcgttt     14460
     atggtgtatt aatcggcgta ggtgccttaa tcattctagc taacttaaaa ggaatactgg     14520
     ttgttgcaat cattggagca atcatttact ttctaactag aaataaaaat aaacctagaa     14580
     aaaatgatga tgtattcgac tacccataca ataaataatt ggaggagaaa aaaatggcaa     14640
     acctttttga aaaaatgaaa caatggaata aagaagtaag tgaaaaaatc gaaaaacgtg     14700
     aagaaaaacg tcgtaattcg gtaagttact atatggataa aacaaaacaa gaaatgaaag     14760
     acgcagaacg catggtagaa aaacaacgcg aactgaaatc tcttttctat aaagaatata     14820
     aagaaatgga agtttatgta gaaaaacgcc gtcatcaagc tgaaattgca aaagaagctg     14880
     gcgaaactaa attagctgat tttgcattag aagaagtagc tcaatacgaa gaacaattaa     14940
     aagcaactaa atctcattat gatcaagctt ctgaacaact tgaaaaatta gaactacgca     15000
     tgcacgaaat gcgcttaaaa tggaaaaatc ttaaaacaca acatctagct gaaatggctg     15060
     aaaaaaatgc gacagaaact tccgaaaaaa tggacaaagt tatccatgat atgagctggg     15120
     gtagcgtaag tgattatcat gaagctcaaa aacaacgcga cttagctgaa gaagctgaaa     15180
     agaaagctga tatgagcaaa gaactttccc aatcttttga tgatctaatg gatgaactag     15240
     aaaagaaaac caagaaaagc aaagagatta ttaaagacaa agcccaaaat ttcacaacaa     15300
     tggtagatga aattattgaa cgcgaaaaac aaaatttcaa gaaaccagaa aaagcttcta     15360
     tggaagatca gttaaatgaa cttgaaaaag aggctgctaa agaacaacca aaagaagaaa     15420
     aagaagtgct cattccagaa ttagagaaaa aagaagaaga aaacgaaaca gataaataaa     15480
     agtaacgagc gtagaataat cattctgcgc tttttttata acgaaatgct acgggccttt     15540
     taaatgctcg tggctttttt ggttacttta cttttttttc gggtaaatag gaaaagataa     15600
     gttgcatttt aatggataca tgctataata attggtatag accgatttaa cgaggaggca     15660
     atacgtaatg actaataaag taattactaa cgctacaatt tatactggta aaggtgttct     15720
     agaaaatgct tttgtacgat ttgataaaca gattttagaa gttggctcaa tgactgactt     15780
     tcaagcggaa aaagcagaag aagtaatcga tgcaaaagga caaaagttag ttcctggttt     15840
     cattgatgtc cattctcatg gtggttatag ttttgacgca atggatgcag atcctgaagc     15900
     acttaaaaaa caagtgaatg gtatgttaaa cgaaggtatc actacttact tcccaacaac     15960
     aatgactcaa tcacatgaaa atattgaaaa agctttaaaa gttattaatg aagtcgctca     16020
     aactgaacct gtaattggcg ggattcatct tgaaggtcca tttgtatcta aagtcttcaa     16080
     aggagcgcaa ccagaagaat acattcaagc acctgacttg gaacttttca agaagtggtt     16140
     tgatatttct ggtggcttaa ttcaattagt tacctacgcg ccagaacacg atacttcagc     16200
     tgattttgaa aacttgtgtt ttgaacttgg agttgttcca agtattggtc actccaacga     16260
     tgtgcgcgaa cacttaaaaa caagtaaagc gacacatgcg acacatttat ataatgcctg     16320
     tcaccgtatg acgcaccgtg aaccaggtgt tccaggccac gttttactcg aaaaaggtat     16380
     taatgcagaa ttaattgttg atggtattca cgttcaccct gatatggtga aattagcata     16440
     ccaaatgaaa ggcccagaac atttatgcat tattactgac tcgatgcgag caaaaggtat     16500
     gccagaagga aaatccgaac ttggcggcca aacagttatc gtgaaagata aacaagctcg     16560
     tttagaagat ggaacattag ccggaagtgt actcacttac gacgacggtt tccgcaatat     16620
     gattaaattt actggatgca cggtggaaga agcagttctt atgtcttctg gtaaccaagc     16680
     acgcgaattt aatttaacac aaaaaggtgc aatccaagct ggtaaggatg cagatttcaa     16740
     cttactagat gaagatttaa acattacagc aacatattca ttcggaaaaa aacattcttg     16800
     agaggaagat attattatgc aacttatcac aacagaaaat aaattagcag gttctaaaaa     16860
     agcactagaa attattgaaa aaggcattac atcaggtgaa gtaaatacac ttggtctagc     16920
     aacaggaagc actccagaaa cactttacgc tgagcttgta aaaagcgacg ttgacacaaa     16980
     aaatgtaaca acaactaacc tagatgaata tgtaggtctt gcagcagacg acccaaacag     17040
     ttatcattac tatatgaatg acttattatt ctctaaaaaa gcatttaaag aaagtttctt     17100
     accaaacggg gaagcgactg acgctgaagc agaatgcgca cgttatgaag gaattttatc     17160
     tgagcatcca atcgatattc aagtgcttgg aattggaaca aacggccaca tcggttttaa     17220
     tgaaccagga acttcttttg attcattaac acataaagtt gttttaacag attccactcg     17280
     tgaagctaac aaacgctttt ttgaaagaga agaagatgtt ccaacacatg cttattctat     17340
     gggaattaaa tcaatcatga atgcgaagaa aattatccta cttgcttttg gtgaaaacaa     17400
     agcacaagca atcaaagaaa ctattaaagg acctgtagat gtgaattgtc ctgcttctgt     17460
     tcttcaaaat catccagatg ttactgtgat tcttgacaac gaggcggcgt cacttctata     17520
     agaagagggc ggggaaatga tcgataaaca atcaggaata ccgatttaca ttcagattca     17580
     aagtgaaatt aaaaagaaaa tggaagatgg tgtctggaaa gttggcactt ctattccagc     17640
     tgaacgtcaa cttgctgaaa tgtttcacgt tagtcgaatg acagtaagac aagccattca     17700
     aggactagtc gatgataata ttttgcaaag acgcgttggc gctgggactt ttattgcgga     17760
     aaagaaatta accgaacgac tagaagctgt cacaagtttt acgaatttga tgttgcaaga     17820
     agggaaagtt ccttcaacgc gtatcgtatc gtatggcatt cgtccggcaa gtacgcaaga     17880
     acaagaagcg ttacaactac cagaaaacag caatgtaatg aaaattgaac ggattcgtta     17940
     cggcgaccgt gtaccaattc tttatgaagt tgccgccatt ccagaaaaaa ttgcttcact     18000
     gcttacaaag gaagacatta tggattccct ttataaagcg attgaattaa aacttggtca     18060
     aaaaatcgga gaagcagaac aaacgatgga agcttcttta gtatcagaaa aaattgcgcc     18120
     atatcttgat gtgaaactcg gatcaccggt tatgaaactt cggcagatta caactttaga     18180
     agatggtcga ccatttgaat ttacacgttc tcaatatgta ggtagtagat ttcaatttgt     18240
     agctaggatt aaacaataaa tagaaagctt gaggcatgct ccgtgcgctt caagcttttt     18300
     ttattaaaaa tgttcggata atgattttcg ttgtcttttt gataataaaa aagtataatg     18360
     agatgagtaa aaaatttgcg gggaggacta accatgagct ggatgataat ttttatatgt     18420
     tttggtgcgt ccgtgttact tacaccgcta attcgaaaga tagctcttta ttttgatatt     18480
     actgataaac ccgatcagcg acgcattaat gtgaagccga ttcctagttt aggtggctta     18540
     gcgattttta ttagttttgc cattggttta tttttacttc caattgaaaa cgaattctta     18600
     tgggctttat tgattgctgc atttgtaatg gtcataactg gcctgttaga tgatattatg     18660
     gaatttaagg caagatataa attaattggt caaattaccg ctgcttttat tatagtattt     18720
     tggggcgata ttagtattga ttttataaac ttaccttttg gtggagaaat tcattttggc     18780
     attttgagta ttccgctcac gattatttgg attgtagcaa ttacgaatgc gattaatctc     18840
     attgatgggc ttgacggact ggcagcgggt gtttccacta ttgctttact gacaatttta     18900
     ggaatggcat ttattatggg ggatgcgctt gttattatga ttgctagcgt tttaattgct     18960
     gggactcttg gcttcttacc atataatttc aatcctgcta aaatatttat gggtgataca     19020
     ggagcgcttt tcttaggttt cattattgcg gtactttcta ttatgggctt caagaacgtc     19080
     acttttatct ctttaattgt accaatttta attttaggag taccaatttc tgatacagtt     19140
     tttgctattg tgcgccgtat ggttacgaaa caacctattg ctatggcaga taaatcgcac     19200
     ttgcatcatt gtttactccg gttaggtttt acgcatcgac aaacagtgat attaatttac     19260
     gcgattgcag cattattttc cttatttgca ttcattttca cgatgtcgac cttgtggggt     19320
     tcgatgatat taattggagt acttttaatt ttaatcgaag tgctaattga aacgcttgga     19380
     ttagtaggaa gcacttatcg accattatta aacttattta agattacgaa agaagacaaa     19440
     atagattaga gattagctac tttagttagt ctcttttttt atgccaaaat tcttattgag     19500
     taacaagtct tcttgtgata catttatcaa gtaacgtttt tagtagaaat gaggagaaaa     19560
     acatggaaat catagcgaca gcagattcaa ttagtcaagc tgaacaattg cttcgcgcgg     19620
     gggtagacag attatatata ggtaacagcc aatttggctt aagattacct cattcctttt     19680
     ctgtcgaaga attacgtgaa atagttcatt tagcgcatca agaaaagaaa aaagtaaccg     19740
     tagctgtaaa ttcgttaatg cacaacgaac atatggaaga gctaccaaca tttttagacc     19800
     aacttgctga aatggaagta gatgcagttg catgcggcga cccaggagcg attatgcttc     19860
     ttggcgaaat ggctcgaccg atacctttta tttacgatgc ccaaacattt gtcactagcg     19920
     cagaacaaat ctcattttgg gaaaaacaag gagcagtcgg agcggtactt gcaagagaac     19980
     ttactgaaga cgaaataaaa gcaattgcta aaagtcttac tattccagta gaagtactgg     20040
     tttatggccc aacatgcatc catcaatcaa aacgcaaact agttactaat taccaacgaa     20100
     ttgttgaaat ggaagatgat acctcgaagg aacgtggact ttatttacgc gaacctaatg     20160
     atgaaactag ccaattacca atctatgagg acgaatctgg aacgcacatt tttgcttcag     20220
     aagatgtttc actggtacca tacttagctg atttatatga agcaggcttg aacacttgga     20280
     aactggacgg ggttcttgca gattcggata attttgtaca aattgccact ctatttgtcg     20340
     aggcaaaaga agccgttatt aatggacaat ttgttgcgga atattttgtg aataaattaa     20400
     cggaactaca acctaaaaca agaaaactag atgcaggatt ttatttgaaa aatccggatg     20460
     atgtgaagta gggggaatag cataatgagt aaagtattaa aaaaaccaga agtgctagct     20520
     ccggctggta acttagaaaa attaaaaatt gccattcgtt acggagcgga tgctgtatat     20580
     attggtggcc aggcgtttgg gctccggtca cgagcaggga attttagttt tgatgaaatg     20640
     aaagaaggta tcgcatttgc gcatgagaga aatgcaaaag tgtatgtagc tgccaatatg     20700
     gttgcgcacg caggggatac agaaggtgct ggtgaatttt tccggacact ccgggatatt     20760
     ggcattgatg cagtcatcgt ttctgatcct gcactaatta gcatttgttt tcaggatgcg     20820
     ccaggcttac cagtccattt atcaacacaa gcatctgcaa ccaattataa aacgctagaa     20880
     ttttggaaaa aacaaggatt agaacgcgtg gtgcttgcca gagaagtaag tatgcaagaa     20940
     atccaagaga tcggcgaaaa aacggatgtc gaaatggaag catttattca tggtgcgatg     21000
     tgtatttctt attccggtcg ttgtactcta tccaatcata tggcgaaccg tgatgcgaat     21060
     cgaggaggtt gtgcgcaaag ttgtcgctgg aaatatgatt tatttgagat agataatggc     21120
     gtttctaaaa atttagttga tacagacgaa gaaccgtttt cgatgagtgc ggtagattta     21180
     tctatgatta aatatattcc agatatggtt gatgctggcg tagatagctt aaaaatcgaa     21240
     ggaagaatga aatcgattca ttatgtctca acggtagcaa gtgtgtatcg ccgtgcggta     21300
     gatgcatact gcgcggaccc tgagaattac gaatttgatc cagcctggga agaagaatta     21360
     tggaaagttg cacagcgaga gttatcaaca ggctttttct ataaagaacc aaccgaggac     21420
     gagcaattat tcgggaaaac tcggaaaata cctcaatatg ctttcgccgc tcaagtactt     21480
     gaatacgacg cagaaacaaa aattgctacc ttacaacaac gaaataattt tggtgtcggg     21540
     gaagaaattg agttttatgg accgggagat actggtttta aacaagttgt cgaagttctt     21600
     tggaatgaag acggggaaga aattgaccgt gctccaaatg cgatgatgac gataaaaatg     21660
     ccggtagata gacctgttaa gccattttac tttatgcgaa agaaaaaata gaatctcatg     21720
     ctgcagtagg attgtcgtgt actccccaag taaggtataa tgggattagt acatatgaag     21780
     gaggagatta attatgatag gatggattat tgctatcgct gttgttgtaa ttctagtatt     21840
     gatttatttc ggtctataca acagccttgt aaaataccgt aaccgtgttg acgaaacttg     21900
     ggcgcaaatt gacgtacaat taaaacgtcg ctttgacttg attcctaatt tagttgaaac     21960
     agttaaaggg tatgcaacac atgaaaaaga aacactaaca caagtaattg aagctcgtaa     22020
     caaaatgatg gaagttcctg ctgacaaccg tcaagggcaa atcgaagcag ataatatgct     22080
     aagtggggcg cttaaatcta tttttgcatt aggtgaagct tatccagact taaaagcaaa     22140
     tacttccttc atcgaattac aacatgaact aactactacg gaaaacaaag tggcgtattc     22200
     tcgccaactt tataacacaa ccgtaatgac ttataacaca aaagtacaat cagtaccaac     22260
     aaacatcgta gcaaaactgc ataactttaa agaacgcgat atgctttcga ttccagaagt     22320
     agagcgtgtt gcaccaaaag tagagtttta agccatgaag gagagcgaaa attatgctat     22380
     ttgaacaaat tgcagcaaat aagcgaaaaa ctgtttttat cattcttggc ttttttattt     22440
     tcgttcttat ggttggggct gctataggta taattgtttg gaataactat ctaaatggac     22500
     tcatacttgc ggcggctatt ggtgcggttt atattttgat aatggttatg agcagttcgt     22560
     cggttgtcat ggcgatgaat catgcgaaag aagtcacctc aaaagagcaa gcaccagttt     22620
     tatgggatac tgttgaaagc atggcgatgg ttgctggtat cccaatgcca aaagtttata     22680
     ttgttgaaga tccaagtccg aatgcatttg caaccggtat ttctcctgaa aaaggcgccg     22740
     tagctgtcac tagaggattg ttaaataaat tagaacgata tgagttagag ggcgttattg     22800
     cgcatgagat ttctcatatt cgtaactatg atattcgctt gtcgactatt gcgattgcct     22860
     tagtcgcggt tattgctatc ctaagtgatt tagctatgcg tttgattttc tggggtagct     22920
     taacaggcgg aagaaatagc cgcaaaagtg acaataataa tggcggcggg gcacagataa     22980
     ttatctatgt agtagcacta atttttgtta ttttagctcc gattattgct acggcgattc     23040
     agttcgcttt atctagaaat agggagtatt tggctgatgc aagtgcagta gaattaactc     23100
     ggaatccaga tgggcttatc caagcattac aaaaaattag cggtgatacg aaaaaaatgg     23160
     aagaagttag cgcttctagc gagtccattt acttttcgtc gccattgaag tctaaaaaag     23220
     ataaaccagg tcttttcgat tcccatccgc cgattagttc gcgaattgag cggttggaaa     23280
     atatgtaata aaaaagtagc agccgagatt aggctgctac tttttttatt ataagctacc     23340
     gatatatttc cagtgaggct tgccatctgg agcatcgatt aattctactt tttgttgaag     23400
     gcgccatttc ttcatttggc ggtcaatttg ttgttcagaa accccgtaaa aggctgccat     23460
     ggaagcagaa gaagtaactt ttactttagc taaatattct tccatttgtg ggcgctcttc     23520
     tggttctggg aaatcattta aaagctcgga taaaacatgt acgtagacct cataacgatg     23580
     taggccactt aattttaacc cagcgtcttc tatattttta ttgaagaaaa ctactgttgg     23640
     attttcgcgt atttccattt cttgtgctac tttttggtcg ccaatatagg cgcgcttagc     23700
     agcagtagat gctaaatctt ttttgaattc agtaagatct agaccggtgg aaatagcgat     23760
     ttcatagagt acttcttcac tagcgatgtc tttattctca agaaaataag cttcttgaat     23820
     cttacgcagg aatgtaatac cttgtttttt tccttggagt tcagcggctt tgactgcaag     23880
     acaagaaata taggaaaggt gcgcccctat ttgttgttct tttaagctta ggttactatt     23940
     tccagcgcgt ttttgtttac atacaaatgt ctgcaaatta ttatgcaaca catagcgcaa     24000
     tttaaaatag ttcccgtact ccatttgtaa ccggagcatg ttcgcttcaa tattccaaca     24060
     gtcatcacaa gcaggatcaa aaaatagata aatttcgatg ggcttggaat tagctactga     24120
     ctgataatat aaattttggt taatcatttg ctatcacctg attttcaaat tctaaatacc     24180
     ttcaagcaga tattcatttc aatgtaccag tgtgaaaaga aataattcac tgctaagtaa     24240
     aagctgatac aaaatttggt tttgtaactt acatatctat tttatcagcg taatgtaaat     24300
     ttaacaaata attgtcattg gcttaatata tttattcgtt attttttaag aatttgtgtc     24360
     atttcgctat aaattagtac gtttttcgtt agttagtcat tatttttata cacatgatta     24420
     taaaaacgag ctactttgtt ttctgctgga tgattcgtta tttgatattc tttgagtagt     24480
     ttatcaaaaa tttcttttcc tttatcgtaa tcagaaactt catattctaa atcaaaatct     24540
     gaaatagaac catagaaatt tttgtcgaat acgagtagtc cttttttata atctttttcg     24600
     gcacggattg ttttaagcga accaaagact tgcaaatctt catgattaat accgatttct     24660
     tttaaagtat cgcgcactgg accaactgga atatttgctc cgtctgtaat ggctgttgct     24720
     tgatctgcgg ctaaaatttg agttgtttcc attaaaccgc gagcctcagg agtttttagt     24780
     gttaattggt actgtgtttc taacttacga atccgaagag cagagttacg ttcttttaag     24840
     ccgaaatctg ccgtatctaa ataaaaatta gtttgttcaa aaaaatcatc ttctttaatt     24900
     cgaaaatcct ctataagtcg atcatattcc tcttttgtca aaagattgcg gaattctatt     24960
     tctagttctt ttaccatgaa aattcatctc ctcttaatga aataacgcat ctaaatcttg     25020
     tgcataaaat tgaatcgctt ttttgtaact taaaatatct ttgtcattag ttgtatttgt     25080
     tagtaacaga agtgcttctt gtaaggcttc tttttcctta ccttgattat acttagccat     25140
     gatgaaaaaa gtacgtaaag cattattttc tgggaactct tctatcgctt tttggaaaag     25200
     aaggacggct ttttcgggag aacctgttat gcggtaggtg ctaccaaggc caatatatgc     25260
     ttctttttta tctgtatcag gaagaccaag ctccagtgct ttctcataaa aagggatagc     25320
     ggcatcttct ttaccgagcg catcgtgtgc ccatgctgca aaataattta gttccgcatt     25380
     ttctggggcg ttttttaatt ctgcaagagc ttttagtcga gcagtttcgt aatcgccatt     25440
     ttgaagtaaa gtaagaatca tttccatcat ccttttcatt gtatcgttag cgcttcagtt     25500
     ttattttaac atgtgattga aaaaaaggtt acttttagca aggtggatta atcacttttg     25560
     tgttaaaata taactgatgt tgcataaatt taatcatgaa tatacttgag gtgagcgatt     25620
     tgaatcattg ggaagacttt ttagcgcctt ataaacaggc agtagaagaa cttaaaatta     25680
     aacttaaagg aatgcgttca caatttgagc ttgaaaataa tcattcgcca attgaatttg     25740
     ttacaggacg agtgaagcca gttgcgagca tattagacaa agctaatcaa aaacatatcg     25800
     cacttgacca tttagtggaa gaaatgcaag atattgcggg actgcgaatg atgtgtcaat     25860
     ttgtagatga tattgaggtt gtcgttcgtc ttttaaggca acgcaatgat tttcggattg     25920
     tggaagagcg cgattatatt acaaataaga aacccagtgg ataccgttcg tatcacgtcg     25980
     ttattgaata cccagtggaa acaattcaag gtgagaagaa gattttagct gaaatccaaa     26040
     ttaggacatt agcaatgaat ttttgggcga ctattgagca ttcggtaaac tataaatacc     26100
     aaggcgaatt tccagaagcg attaataagc gactaaaacg cgctgccgag gcggcttttc     26160
     aattagatga ggaaatgtcg caaattcgtg aagaaataca agaagcgcaa gtctattttt     26220
     ctcaaaacaa agatgtatca aaggataaaa aagcggtgca tcaagtaatg ccaaagaaaa     26280
     ataagtaatt aagcgtagga ataggggcga atagaaataa tgaaatatat gattacttca     26340
     aaaggggacg agaagtcaga tttgctgcga ttgaatatga tcgctggttt tggggaatat     26400
     gacatggaat atgatgagat agaacctgaa atcgttattt ctattggcgg agatggaact     26460
     tttttgtctg cgtttcatca atatgaagag cgcttagatg aaattgcttt tatcggaatt     26520
     catactggtc atcttggctt ttatgctgat tggcgcccag ctgaagcaga taaattagtt     26580
     aagttattag caaaaggaga atatcaaaaa gtttcttatc cactgcttaa aactacagta     26640
     aaatacggca ttggcaaaaa agaagctgag tatttagcgc taaatgagtc aaccgtaaaa     26700
     agttcaggtg gaccttttgt tgtggatgta gttattaatg atctccattt tgaacgattc     26760
     cgcggagatg gtttatgtat gtcaacacca agcggaacga ctgcatataa taaatcactc     26820
     gggggagcgc taatgcatcc gtccattgaa gcaatgcaat taactgaaat ggcgtcgatt     26880
     aataatcgag tttaccggac aattggtagt ccactcgttt ttccgaagca tcatgtagtt     26940
     agtttgcaac cggtaaatga caaggatttt caaatttctg tggatcattt aagtattttg     27000
     catcgtgatg ttcaggaaat tcgttatgaa gtatcagcga aaaaagttca ttttgcgaga     27060
     ttcagatcat ttccattttg gcgtcgagta cacgattcat ttattgaaga ttaagctagc     27120
     aggaggaagc atgtgttttt agaatggcaa gtaaaaaatg aagaagatgg gttgttgctt     27180
     agaacttttc tgaaaagcaa gcacatatct aaacaattat taaccgcagt aaaatttggc     27240
     gcggatggta aaattgaagt taataacgaa gaacaaaatg ttttatatca tgttaaaact     27300
     gacgataaag ttcgacttac ctttccaaca gaacaacaaa atgatcgatt attggcagaa     27360
     catacagatt tagaagtagt ttttgaagat gactttttat taattattaa taaaccggcc     27420
     ggaatggctt caattccgtc tcaatatcat ccgaccggtt cagtagcaaa ttttgtaaaa     27480
     ggacactacg aaaatcaagg gcttacaagt gctatccata tcgtaacaag gcttgaccga     27540
     gaaacatcag gattaatgtt aatcgccaaa aatagatacg cacacgccag gctcagtagt     27600
     tttttacaac aaggactact caaaagacga taccaagctt tcacttcagg taccctggaa     27660
     gaagaagcag gatctattga agcaccaata ggacgtaaag atgtaagtat aatggagcgt     27720
     tttgttactc cagaaggaaa atatgcgaaa acaaactacg aagttctcat gcgttataac     27780
     gggtttgatc atttagcgat ccagcttgag acagggcgaa cacatcaaat tcgggtgcat     27840
     ttttcttata tcggtcatcc gcttattggc gatgacatgt acggcgggga tcaggaacta     27900
     cttaaaagac aagcacttca ctcttgtcat ctacatttag tccacccagt cacagaagaa     27960
     tatatggcgt ttgatttgcc tttaccagaa gatatggaac agataattca aaaatcgaag     28020
     taataagtgt tttaaaaagt tatttggtca tgtaaaatgg aagaagcgaa caaatcgcat     28080
     caaaattagg aggaaagaac atgaatttat cattagaggg aaaaacatat gttgtaatgg     28140
     gagtagctaa taaacgcagt attgcttggg cgattgctcg ttcattaaat gaagcaggag     28200
     caaaactagt atttacatat gcggatgatc gtgcgaaaaa aagcattact gaactagtac     28260
     cttcattaaa cgaaataaat caagatccac ttattttagc atgtgatgta acaagtgagg     28320
     acgctattac agcgacattt gaaacaatta aagataaagc aggcaaactt agtggtttag     28380
     cacattgtat tgcttttgct aataaagatt acttaactgg tgactattta gaagtagatc     28440
     gtaaaagctt cttacaagcg catgaaatca gtgcttattc gtttacagcg gtggcgcgtg     28500
     cgttaaaaca cttagatatg ttaactgaag atgctagctt gcttacttta acttatcttg     28560
     gcggtgagcg tgttgtagaa aactacaata tcatgggtgt tgctaaagct tctcttgatg     28620
     ctagcgtgag ataccttgca atggacctag gagctatcgg agtgcgtgtg aatgctattt     28680
     ctgctggacc aattagaaca gtctcagcac gtggcgttag cggcttctct gactcgattt     28740
     cacttgtaga agaaagagca ccattaaaac gtgcaacaca agcagaagaa gtaggagata     28800
     cagcttatta cttattcagt aacttatcac gaggcgtaac aggtgaagta attcatgtgg     28860
     atagcggtta tcatattatt ggattctaac aataaaaaaa atccaggagt agtttaaata     28920
     ctacttctgg attttttttg gtccattatc tggatgactt ttaatataat aatcatctac     28980
     tgttggtgta tagtttgttt gaaccggtgc tttgacaaaa tcagcaagga cttggtcgat     29040
     ttttacccaa ccgcgccagc ttaaatgaat aggatcttct aaaaagaaag aatcattttg     29100
     atattgttct agagagtaat aacggaagcc ttgactctcg atttgttgtt ttgttttagc     29160
     atagtaacca tctaagcctt gtttgttcat accaatgtag tcaatccatt taccgttgat     29220
     aggaggattg atgaaaataa catcagcgcc agcttttttg aatgcgtcca ttagaagttg     29280
     taaatcacca aattctggag attcatcgta acgcaaatct ttacggctgt cttttagctt     29340
     accttcaatt ggtttgattt ttttctggta atatttttct ttcacttgga aaggattgtc     29400
     accgatactt ttctcaccag tttcttttgc taggtcatct agttgtttat aatctaattt     29460
     ttctgggaga tcttttagac ctttttctat acgatcttgt ttagaacctg aaactgtttt     29520
     cgattctaaa tcgtctttac gttctaaaat tttcagttcg acattaccag caagttttac     29580
     aagttttgga tcatgaggtt ttttaggacc ttttgcgacg atgttttcaa gtaatttctt     29640
     taaagtagag tcgctttgaa ccacttggaa tgataataat cttttagctg catatctgcg     29700
     ttcaggtgtg tttttcgcgt cttcaagtgc aaatttataa gcatgaagag gggagaagtt     29760
     agcaccaaac gatggatcag aaacgccttt aggttggaac cattgtggag ataaaactac     29820
     agccactttt ttgcctctta agtcatcacc aagtgcattt acatcaagaa aatggcttaa     29880
     tgattgtgta cccggtcgac ctaataggaa tggtgtataa ccttgatcat atttttttga     29940
     gactacgcta ggatgaaatg ggtcgacacg agaaagctct gaagaaccat aaattggtaa     30000
     atagtttcct tcttttaaag cttctttctg gatgtctaag ccttggatga cgtattcgtt     30060
     catagacgta gcgctctttt ctacagtctc cgaagacaca taagaaaata agctgctagg     30120
     tccaaataga acgaaaagga aaaccgcgaa tgcgaccagt aaaggcccaa atgtcatcca     30180
     cagctttttt ttcattattt tagcgcctca agttgtgtaa taatcatttc aggagtagcc     30240
     cattcgtcgc ggtcaaattc tgaaacgggt acagtaatat ctagtcttga ttcaatttca     30300
     attaaaagtt gaacagttgc cattgagtct agtaaacctt catcaaataa tttgatattt     30360
     gtattttgta ctacttcatc agtttctgta atttcttcta agatttctaa tacattttca     30420
     cgaaaagcca tttaaattac cacctttagt tagttttaaa aattaatttt atctaaaata     30480
     cctgagaaaa tcaggaatcc gaaacaaaca aattggaatg taatgataac gccgattaca     30540
     taagttattt tgttttttgg atagaacttg tgctttttgt taaagcgttc gattaggtcg     30600
     aaaccaacaa ttaaagtggc ttgataaaga ccataaacga tgtaatacca gtgaagtccg     30660
     tgccatacac ccataatgaa aaagttaaca aaatatgcga tataggcgat ggtgaactta     30720
     ctcttgaacc atttcttttt tgtaagccat aagacaaaac gcataaatac ataatcacgg     30780
     aaccagaagg aaagagtcat atgccagcga ttccagaatt ctttaatgtt tcgtgctgca     30840
     aaaggcttat tgaagttcat tggtgtttga acgccgagta gataactcac tccgactgcg     30900
     aaggcactgt agccagcaaa gtcaaagaat aagtacatac tgtatgcgta catataacca     30960
     atcaaacttg ttgttgtatc aacattgtgt gtaatcgcga tgtctagtgg aacaacaaaa     31020
     tgtttgttta ctaagtatgc gataatgaat ttatagagaa aaccaaggaa gataaggaaa     31080
     attcctcgat tcagtaaagc aacataagct tctttactag gcggattatc aacgtctttt     31140
     ttaaagcgac ggaaccggtc aatcggtcct gatgaaatag ttgggaaaaa tagtaagaaa     31200
     ttaacaaaat cccatgcgtt gtactgttta attaagttat cgcgtatttc aataatcatt     31260
     tgtgtcgctt taaaagttaa gtacgaaatc cctaggaaac caaccattgt tacttggtct     31320
     cctaaaattg gaactacttt agagattaca agcgggagaa tggagagaat cactgctatg     31380
     acgaatacgc cgccatgatt ctgttttttc tcctgcctgt aatggaagta aagtcgtacg     31440
     agtgcaagtt gccagaaaac aaagaagata aaagtaactc cttggactgg atttgcagcg     31500
     aataaaaagt ataaaaatac taatgtgaca aaagcgttat atatcggtaa tctttttcct     31560
     aacaaaccag ctactatgat aggaatgaaa aacagaagaa gtactccaaa ataaagtatt     31620
     gtaccgtatg gtgtgctcac ttgttaacct cgctgttaag tgcttttcga tcaattttgc     31680
     cattcattgt caacgggaat tccgttttat aaatccattt tcttgggatc atatatgctg     31740
     gcataaattc ttttaattcg tttttgattg ctgcacttag ctggtattct ttttcaaaat     31800
     cgtgggaaga cgggatgacc tgagcgacca acatatcaac cttttcatct ttcattttag     31860
     gaataatagc gcagttttgg atgtaactta ctttttttag attgttttca atatcttcaa     31920
     gttcgattct gtaaccatga agcttaattt ggaagtcaag acgaccttgg aagaagagat     31980
     aaccatcttt tataacacca gagtcaccag tatggtaggc ttggtaacct ttgtaatcaa     32040
     agaatacttg gtctgttttt tctggttcgt ttaaatatcc ttttgaaaca cttgcaccga     32100
     ttaggatgat ttcgcctttt tcgccttcag gaagtatttc accagtttct tgatcgacaa     32160
     tatgaagtcg catatctggt ttaataactc caagtggtag gctcggataa gcatcaatca     32220
     actcgcgtgt tacttttact tgtgtaacag caacagtagc ttcagtcggc ccgtatgtgt     32280
     tataaatgac tgcatctggg aaacggtcaa gtagttcact tgctgttttc ttagcaagta     32340
     cttcaccaca gaataagaaa cgtgttaaat tagggttgtt ttcttggttg aaattatcat     32400
     ctagtaaaca taagtctgca aatgatggag tagaaaccca tacatcaaaa ttttgagcag     32460
     gtatttcgcg atataaatct ttcatattag cagtgattgt tttatctagt ggtacaagag     32520
     ttccgcctga aagtaagctt ggatataagt ccataaccga caagtcaaag gaaaatggtg     32580
     cttggtttaa gaagcgcaat ccttgtctta acgagaaatc ttgtaaaatc caattgctaa     32640
     aactaactaa attgttttgg ctaatttgaa cgccttttgg atttcctgtg cttcctgatg     32700
     tgtatataat ataataatta tcatcatttt taacacattc agcagggtct ggcacttctt     32760
     caaaatgttt ttccaaagca tccatcaatt ggtcttgtgt tagaacggga caacctgtaa     32820
     ttgtaaggtt gcttggaagc tcttctgtgc aaatgaatag tgcaggatct gctgcttttt     32880
     tgatttgttc tatacgttca actggcatag aaacatctac aggaacataa gcacgtcctg     32940
     atttaatagt acctaaaaac gcaataagca ttagtgggga catgtgtccg tacacgataa     33000
     taggtttttc tttgtcagag tttaaagtat ttagtagaaa agagccgaat gcatccgatt     33060
     gccgtttaag ttctttgtag gaaagacgtg ttccagcata ttcatagcaa gggaaatccg     33120
     gtgtcttttc tgcccatgca tcaattcttt caatgatact cgttgtcata attgatattc     33180
     ccatttttta acagtccttt ctttttttaa aattcattgt aaataaattt ggcgccttca     33240
     gggtttttga aaccataaaa ccatagcaac ccaagcaaaa cagtcaagta aaaaatagtc     33300
     ttcattgtaa aaattgttgc tggatgatgc aaaaatagtt ttactttatt cataaatcca     33360
     cctctttatt atttcagtta tgttacaaat attaaaatta aactcttaat acttacttac     33420
     tgtaatacat ctgtctttaa atgtctaatt acatttttgt aaggttagaa aaataaactt     33480
     actttgaact taaaagtagg tggcgtataa tgaaaatatc gatatcgcaa tgctttaatg     33540
     ctaagttggg aggaaaataa atgattaatc aaaagaaaat cgcaggtgaa aaagcgtgtg     33600
     aatggattga agatggaatg gttgtcggtc ttggaacggg aagtaccgtt tattatacga     33660
     ttgaaaaatt aggggaaatg gtgcaaaaag gcttaaacat tactggggtg tctacttcta     33720
     tagaaacaga acaacaagct cggacattag ggattccgct aaaatcttta aatgatgtaa     33780
     cgaaaattga tgtcacaatt gatggcgctg atgaaattaa tcaagctttt caaggaataa     33840
     aagggggcgg aggagcactt ttacgagaaa agatggttgc tcaagctagt tcaaagaata     33900
     tttgggttgt tggggaagag aagcttgtga cagagcttgg aaaatttcct ttgccacttg     33960
     aagtgattcc ttttggatgg aagcaaatta aacgaatgct agaaaatgac ggggttgaaa     34020
     ctactttacg caaacagtcg tcaggagaaa tatatgaaac aaataacggc aattatattt     34080
     tagatattat aaatcagacc tttactaatc cagaagcctg gcatgaaaag ttagcgggca     34140
     ttcctggggt acttgagcac ggcttatttc ttcattatgt agatataatt atttgcggca     34200
     aagcatcagg agaaatagag ataataaaaa aatagttatt tcttctatta gaaagaaata     34260
     actattttta ttaataagtt aatgtttttt tcatttcttt atgtttaatt cctgcatcta     34320
     agaatacatc agagcacgtt tcatagccaa gtttttcata aaaggggatt gctgttaact     34380
     gggcgcctaa ttttagtgtt gttaatccac gcgttttagc ttccagttca atagcttcca     34440
     tgattctacg tccactgccg gagccacggg ctattttttg ggtgcaaatg cgttcgactt     34500
     taccgtaacc atcctttacg cgaaatctgc ctgtcgcgag cgctgtgccg tcttcagcgt     34560
     aatcaacaaa catatccacc gaagccattt catcaaattc atcccattct aatgcaggat     34620
     ctacattttg ttcgacaacg aaaacgtcat ttcgaatttt tagtgctgct tgtttaccta     34680
     gttcatctgt tacttttttt accgtcaagt tgttccgtcc cttcctatgc gcgcatgctt     34740
     tctaaatcaa acgtatttac tggaagcata aattgtaagg attctttaat aaatggctgc     34800
     cagtatttcc agcgatgatc gccgttaaat acgcggaaat aataatcaaa cccacgagag     34860
     gttaaaattt gttctaaaga tttgtttggt gatagaaaat cgagtatttc atctccagta     34920
     gtttcaactg cagtttcttg gtcgccaata atatggtaga tttttacttt ggcagggtca     34980
     gctttttctg ctaatgtaag gattgcatca tcgacataag gagaatgtaa gataacatta     35040
     ccgaacgtaa acggaaatag tagtgcggct tttaatgaaa cagatgcacc aagggagtca     35100
     cccataagaa atctactcgt tggcatttgg aaagaaggga agcgttcttc aagataagga     35160
     acaagttcga atgctaagaa ccggatgtat gcttcatttt gttcaccatc tggatgatac     35220
     ttttctcggc gatccatgac agttttgtaa ggaataccaa tgaaaatggc tttttgaatc     35280
     tgctcgttta ctgctaattc ttccgagtga cgcgcaagtt taccaaactg aaaataatct     35340
     tttccatctt gtacaataaa taaaggatat ttgtaaagtg gcgaaaaatc aggtggtaag     35400
     caaataatta aatcgagttc ctctcctagc aatttactgt aaaatttctc atctaacatt     35460
     ttatgagctg tcattttcat tctctccttt cttgaaatcc ttccttctaa gatgattgtt     35520
     ttttgaaaag ttactctatt ttagcatgaa ttacgttaaa agaaagaaca ttttgcctat     35580
     ttattagaaa aaattttctt tttcatagga cttcactgca ataataccgt ttattgtgct     35640
     atactgaaac atacaataat tctgatttat cgatagaaag tggggatttt gaatgagtaa     35700
     agatattgac tggagtaatt tagggtttag ttatattaaa acggacaagc gttatatttc     35760
     acattggaaa gacggagcgt gggatgaagg tactttgacg gaagataata cacttcatat     35820
     tagtgaaggt tctactgcac ttcattatgg ccaacaatgt tttgaaggtt tgaaagcata     35880
     tcgttgtaag gatggttcca ttaacctttt tcgtccagat cgtaatgctg ctcgtattca     35940
     aaaaagttgt gaacgtttat taatgcctca tattccaaca gaaaaattta ttgatgcttg     36000
     tatgcaagtt gttcgtgcaa atgaagaatt tgttccacct tatggtactg gagcaactct     36060
     ttatttacga ccgtttgtaa ttggcgtagg tgataatatt ggcgttcatg cagctccaga     36120
     gtatattttc tctgttttct gttcaccagt tggtccttat ttcaaaggcg gaatggcacc     36180
     aactaacttt atcgtttctg actttgaccg tgccgctcca aatggaacag gtgcagcaaa     36240
     agtaggcggt aactatgcag caagtttact tccagggcaa aacgcaaaag atcgtaattt     36300
     tggggattgt atctacttgg acccagctac tcatacaaaa attgaagaag ttggctcggc     36360
     taatttcttt ggtattacaa aagacgataa atttattacg ccgtattctc cttctatttt     36420
     gccaagtatc acgaagtatt cattacttta tttggcagaa caccgtttag gtttaaaagc     36480
     agaagaaggc gatgtattta ttgataagtt agatgaattt aaggaagcag gcgcatgtgg     36540
     aaccgccgca gttatcacac caattggcgg tattcaaaca aaagatgact tccatgtatt     36600
     ttacagtgaa acagaagtag ggccagtaac aaaacgccta tttgatgaac tatgtggaat     36660
     tcaatttgga gatgtagaag ctccagaagg ttggatttat aaagtgaaat aatgacaaac     36720
     cgtccgttta tcgggcggtt tttttatgct taaatatagg tgttttattt taaaaaaaga     36780
     atataagttt tttgttgaca gtatatcaac taagtgttac tatatagtgg taataagtga     36840
     tacagaatac ccgtgatact aagtagtgaa ataaaatagg aaattggaag gaagggtgag     36900
     ttcaaatgaa cgaatggatg attgaagcta gtgggttaag aaagtctttc aaaaaaaccg     36960
     aagtcttaaa gggcgttgat tttggagtaa ggcgcggtga gatttttgct ttacttggct     37020
     ctaacggtgc tgggaaaaca acgactattc aaattttaac tacacttttg aaagcagata     37080
     atggaaaagc gagtgttgct gggttagatg ttacgaaaga accagagaaa gtgagagagc     37140
     atattagtct tacaggacaa tttgctgcag tagatggttt actaactggt cgtgagaata     37200
     ttttactcat tgcaaaatta cgaggagaaa aaaatcctga tcaaacagcc aaagatttac     37260
     tagcccgttt tggtttagaa aaagcttcag accgaagagc agacacatat tcaggcggga     37320
     tgatgagacg tcttgatatt gcaatgagtt tagtgggatc tccggatgtg atttttcttg     37380
     atgaaccgac gacaggtctt gatccagaag gacggattga ggtatggaaa acgattaaag     37440
     ctctttctga tggaggaact actattttac tgacgacaca gtatttagat gaagcggagc     37500
     aactcgctga tagaattgca atccttcacg gcggaacgat tattgcaaat ggtactttag     37560
     aggaacttaa aaaattgttc ccacctgctg aaattgaata tgtcgagaaa caaccgtcac     37620
     tggaagaaat tttcttagca attattaatg gtaaggaggg agtaaaatga aagcaattcg     37680
     cgatacaaga atcttgtttg gtcgctcgat gcgtcacatt ttgcgtagtc cagatacaat     37740
     tattacagta gcaattatac ccattatgat tatgttgatg ttcgtctatg tactaggtgg     37800
     agcgattcaa acaggaacag ataattatgt tgattacttg ttaccaggga ttattttaat     37860
     ggcaattgca agtgggatag cttatacggc agtacgatta tttacagatg tgcaaaaagg     37920
     gctgttccaa cgatttcatt ctatgccaat tagtcgttct tctgtattat ggggacatgt     37980
     tttaacttct ttagtttcta atgcaatttc agttgttttg attattctag ttgctttatt     38040
     aattggattt aggtcatctg ctgggatttt agaatggctt gctgtagctg ggatattgct     38100
     acttttcacg ctagctttaa cttgggtggc tgttattcct ggtttgactg caaaatcggt     38160
     tgacggggcg agcgcttttt cttacccact gattttcttg ccttttataa gttctgcttt     38220
     cgttccaact gatacgatgc caactgcggt tcgggtattt gcggaaaatc aaccagtaac     38280
     ttctattgta aatacaattc gagcattgtt atattcaggg tccgttggta atgaaatctg     38340
     gattgcactt gcctggtgtg ttggtattac agtcgtagct tatatctttg cagtactaaa     38400
     atataaaaaa acaatctaac aaaaaaggat tggctcaaag gagccaatcc tttttttaat     38460
     tttcaccaga aatatgtttt ttcggtaaaa tgaaatggat aaaataacta acgatacaac     38520
     aagcaaacat tacccagaat accatgtgga gtccgctata taaaatatct ctaagcggtt     38580
     cgactagatc tggattaaca ttacctgaag tttgtgggct gattagctga tttaaattac     38640
     tacgatttac ttcgctacca gctgctgcac ggaattgtgt ggttaatacg gagttgaaaa     38700
     tagttccaaa gacagcgaca ccaatcgttt gaccaacagt tctaaatagt gtgttggaag     38760
     cagtagcaat accagtttgg aatctcggta cagcatcttg gacggttaca gttgtagtag     38820
     taaaaataat cccaaagcca aatcccataa aggcactatt taaatagaag aagatgtcat     38880
     ttgtagaagc tgggaataaa gctaaaataa gtccacttgc agctgttatt aatacgccga     38940
     ttccgactgt atggcgattt cctagtgtca ttaaaagctt tccgcctata aatgaaccga     39000
     taatccacgt gacggaaagt ggtgcaagca taaatccagc aattgtggct ccgtgaccaa     39060
     gcattccttg agcccacatt ggaatataaa cattaatacc aattaaaaag gcactaatta     39120
     gaaaaccaat taagtttcca attaaaacaa ctggattttt aaataaaaca aatggcataa     39180
     tcggatcttt ggcacgtttt tcgacaaaat aaaaagcaac aaataataat atcgaaacgg     39240
     caaaaagaat gactacgagc ggttctgtcc agttgaggga ctctccagct cgctgtaatg     39300
     caaataataa tcctaaaagt gctacggtaa atagtgaggc accaagataa tcaattggta     39360
     attttactcg ttcgacctct tcacgtaaat aaagcaaaat aagtaagata gttagaagtc     39420
     cgattggcac attaataaag aaaatccaat gccaagaaag ttggtctact aaaaatccac     39480
     caacgagcgg cccgaaaaca cctgcaatac cccaagcaga acccatgaaa ccaagtactt     39540
     ttgctcgttt ttcaaatggg tagacgtctg cgataatcgt catagtagat ggtaaaatcc     39600
     cgcctgctcc aataccttga atcgcgcgaa aaataattaa ttgctccata ttttgtgcaa     39660
     atccacaaag tgatgaacca atgataaaaa taattgtcgc aattacaaag atattttttc     39720
     gtccatacaa atcagacagt tttccgtaaa taggaaccgt cactgctgat gttagtaaat     39780
     aaacagaaaa aatccagttc attaactcta tgccgtccaa ctgacttaca atcgttggca     39840
     tcgcagtact cacgatggta ccttcaatag ctgccataaa tgttgcgaca aatacggcga     39900
     tggtaacggc ttttactttt gtttgttcca aaaaattccc tcccttttcg tctaccgaat     39960
     tatagcatat aaaaggactg atttggaaaa aaattaatct taagaaatgc gttaggtgaa     40020
     gataagcgct ataatataat agaataaagc gaactaaagg aggaatattt ttgagttacg     40080
     aaccaaatac aacacaaacg atgcaaaaaa ttaaagagtt aacttctatc cctagtccga     40140
     cagggaacac agggcaaatc attgaaaaac tagtgaggga tttagaagct tctaacatcc     40200
     catataaatt gaacaataaa ggcggattaa ttgtaactct accaggaaaa gatgactcca     40260
     aacatcgtat gctaacggca catgttgata cgttaggcgc gatggtaaaa gaaatcaaag     40320
     cagatggaag attactatta actttaattg gtggctatcg ttttaatgcg attgaaggcg     40380
     aatattgtac gattgaaact agcgaaggcg atttatatag cggaacaatt cttatgcatc     40440
     aaacctccgt tcacgtatat aaagacgctg gtacggctga acgcaatgat aaaaatatgg     40500
     aagttcgttt agacgtaaaa gcgctagatg ctgacaaagt tcgcgctctt ggaatagaag     40560
     ttggtgattt tgtttccttt gatccacgcg tccaaattat taatgatgag tatattaaat     40620
     ctcgccattt ggatgataaa gcaagtgtcg cgattttatt acaactcatt aaccatattc     40680
     atgaaaataa attagagcta ccacatacaa ctcatttcct tatctctaat aatgaagaaa     40740
     ttggttatgg tggtaattca aatatcccag ctgaaacagt ggaatattta gctgtagaca     40800
     tgggagcgct tggtgatggt caaacttctg atgaatacac tgtttctatt tgtgctaaag     40860
     atggcagtgg cccttatcat ttaggtttgc gtaaacattt agttgaacta gctaaaaaga     40920
     ataatattga ttataaagta gacatttatc cgttttatgc atcagatgcg agtgcggcga     40980
     ttaactctgg taatgacatc gttcatggtt taattggccc gggaattgat gctagccatg     41040
     catacgaacg aacacaccgc gattcactct atcatacaga aaaattagtt tatgcttatt     41100
     tattttcgaa tatattgaaa taggaggaat tctacatgaa tgtccatgat ttttctgaaa     41160
     aagcaatgaa tggtaaagaa atagcattaa gtgactataa aggcaaagtt ttactcattg     41220
     tcaacactgc gagcaaatgt ggtttaacac ctcaactgga aggtcttgaa aaaatgtata     41280
     aaaaacttgg cggagataac tttgaaatcc ttggtttccc gtgcaatcag tttttacgtc     41340
     aagatcctgg tagtgatgaa gagattttag aattttgtca aatgaattac ggcgtgactt     41400
     tccaaatgtt ctctaaaatt aaagtgaaag gcaaagatgc tgctccactt tataaatatt     41460
     taactgaaca aactggaggc aaaaaagtgg aatggaactt tgccaaattc ctcattgatg     41520
     aaaatggcga agttgttgaa cgtttcccat caaaaatgaa accggaagat tttgaggaca     41580
     aagtagaagc gcttgttgca gcagtcaaat aaatagtaaa actcggtagt gaataatccg     41640
     ctaccgagtt tttttgcatc ttagggaggt taatttgcaa gttacagaaa tcaacttgta     41700
     gtttttagtg tagcgtttat aataaaaaga aaaaagggag gcaaccagat gaatttccat     41760
     gtaaagcaaa ataataattt agcgattggc gaagtagaca tatattgcca cccaaataat     41820
     ctggaagaag taactaaaat agtgatgggg ctagaagagc aaaccgagaa aatctctgtc     41880
     aaaaaagacg gagtgacata tttactcgca aaaagaaaga ttttatattt tgaggctgta     41940
     gaaagtaaaa tttttgtgta tacagaaaaa gacgtatatg aaactacttg gaagttatac     42000
     gagttggaag aaaaatttaa agatagttcc tttttcaggt gttcgaaatc catgatttta     42060
     aatatcgaat ggattgaaaa aattgcgcct ggctttcacg gaaaatttga agctagcctt     42120
     tttaatagag aaaaagtgat tatttctagg caatatgcca aaatcttaaa gcaaaaatta     42180
     aacttgggag ggaagggcaa atgagcacaa aattaattca atttattcaa tcagcgtgta     42240
     ttatttttac agctgcaatt atcacgatga tttgttccta tatctcaacg ggagaatctg     42300
     aaacagtagc tattcgcgac atttttacta tgctaggttt tagtgttatt actacttttg     42360
     ttcagcaatt acttttcaat aattcgataa aaacgaaatt tgctttttat attcgtttaa     42420
     ttgttttttt cttttttatt agtgcagcaa ttttaggtct tggttggttg tttgattggt     42480
     atcattcctt aactggcttt atgattattt ttggatttat ttgcgtgact tttcttgtaa     42540
     tgcatctgtt tttcagtttt agagatgcca aatttagtaa tgaaattaac caaaaactag     42600
     cagaaatgcg agaaagggag acaaaatgat aaaattaacg aatgtagtta aaacgtttgg     42660
     aaaagtagaa gcagttaaag gcattaattt agaagtcgaa aaaggttcgt tgtttgcatt     42720
     cttgggtgag aacggggcgg ggaaatcgac cacgcttagc atgatttgca cagaaagcga     42780
     gccaacatct ggagaaattt ttattgacga tgaaaaattg acctttaaaa ataggaaaaa     42840
     tttcagacaa aagttgggcg ttgtttttca agaaaacgtg ttggacgatt tacttaccgt     42900
     gcgtgagaat ctgtataatc gtgccagttt atatggaaaa acaaaagcgg aaattaccga     42960
     acgtttagag cttgtttctt ctattatggg aattgaggat atcttaaatc gccgttttga     43020
     aaaactatca gggggacaaa aacgccgagc tgaaattgct agggctatta tgcatgatcc     43080
     agaaatttta ctactcgatg aaccgactac tgggctggat ccgaaaactc gagtgagcgt     43140
     ttggaagatt attgattatt tgcgagaaga attcggcatg acggtgtttt taacgacgca     43200
     ttatttagaa gaagcgaagg atgcggatca gctggcagtt attcataagg gaaatattat     43260
     cgctcaaggc actcccgcta atattagaag tcgtttttca gtagataaaa tcttctttta     43320
     tgatgcaaat gtggaagaac ttcaggtaat tattgaaaaa gcaaatttac cttataaagt     43380
     gtcaaaagga acgatacgtg ttgacgtaat agatgaaaat atcggaattt tggctatttt     43440
     gaatcaagca gcgggacttt atagttcttt tgaagtaata aaaggaaatc ttgatgatgc     43500
     atttatctcg atgattaagg aggattcaaa tgattagtcg taatttaaaa atctattttc     43560
     gtgatagaac tgcggtattt atgtcgctac tcacgatttt aattattatc ggactctatg     43620
     ccattttttt aggaaataat atggaagaaa tgtttaagca ggcttctgga aaaacgattg     43680
     gaatacagga attagtgaat acgtgggtaa ttgcggggat tttgtctatt acgccggtca     43740
     ctgtttcttt agctgttttc tcattaaaag tgcacgatga agagcagagt attgccagaa     43800
     gttttgcaat aactccagct tccagatggc gaattgtcgc aagctacatc gttagtggtt     43860
     tagttgcttc atttgttttg tcagttatca ctctttttgt tggtgaaatg tacatctggt     43920
     tgacaggagg agcattttta ccgcttgaaa gttgggttag tttaatcggc attattttaa     43980
     ttaatgttct atgttgtagt agcataatgt tttttatcgc aagcttagtg aaaaaagcga     44040
     gcgcctttag ttcggtttcg actattgttg gaactgttat cggttttatt gctggaattt     44100
     atttgccgat tggttcgctt cctgctgcgg ttcaaacggc gatgaaatgt tttcctttca     44160
     catacggggc gtctactatt cgtgaaatca tgacaaaaga gccattgcaa caagttttcg     44220
     caggtaatac tcaggcgatg gatgcgacaa aagaaatgat tggtattact atttattggg     44280
     gtgataaaac agtaacgaca ggagtaagtt tgctgatttt aagcgtcttt gcagtgcttt     44340
     ttggcatttt atctgtcgtc ttaatgaaac gacaaacaaa ataatttttg aataaaaaaa     44400
     cagccgaaat tctcctagtt atgctatact aatggaatgt gaatgaatct aggaggaaaa     44460
     taacaatgag tcaagatttg caaaaagaag ttgcttcacg caaaacgttt gcgattattt     44520
     ctcacccgga tgctgggaaa acgacgatta ctgagcaatt actattattc ggtggcgtta     44580
     tccgttcagc tgggactgta aagggaaaga aatctggcaa gtttgcgaca agtgactgga     44640
     tggaaattga aaaacaacgt ggaatctcgg taacgagttc tgtgatgcag tttgattata     44700
     atggttcaag aattaatatt ttggatacac cgggtcactc tgacttcagt gaagatacgt     44760
     accgaacctt aatggcggtt gatagtgctg tcatggttat tgatgctgcg aaaggtatcg     44820
     aagcccaaac gctaaaactg tttaaagttt gtcggatgcg cggaattcca atttttactt     44880
     ttattaataa aatggaccgt caaggaaaaa tgccactaga actacttgct gaattagaag     44940
     aagttttggg tattgaatct tatccaatga actggccaat tggtatgggg aaagaattag     45000
     ctggtattta tgaccgctat catcgcgtta ttgagcaata tcgctcagaa gaagatgaac     45060
     gtttcttacc acttggggaa gatggagatt tgaaggaagt acacgctatt caaaaatcac     45120
     tttattacga tcaagcttta gaagaaatca tgctgttaga cgaagcggga aatgacttta     45180
     gtcgggaacg cattattgca ggcgagcaaa caccagtatt tttcggaagt gccttaacta     45240
     actttggggt agaaactttc ttgcgtacat ttgttgattt tgcaccatct ccttcaagcc     45300
     atgaatcgaa tgaaggcgtg attgaagctg ataatccgaa gttctctggc tttattttta     45360
     aaatccaagc gaacatgaac cctgctcacc gggaccggat tgcttttatt cgaatttgtt     45420
     caggcgaatt tgaacgcggc atgaacgtta cattaacgcg aactgggaaa agtatgaagc     45480
     ttgcgaactc aacgcagttt atggcggatg accgggaaac tgttaatcgt gcggtagctg     45540
     gtgatattat cggtttgtac gacacgggta attaccaaat tggcgatacg ataacgaatg     45600
     gcagtaaaaa actcgaattt gaaaaacttc ctcagtttac accagaatta tttatgcgtg     45660
     tttatgcgaa aaatgtaatg aagcaaaaac actttcataa aggcgtagag caactcgttc     45720
     aagaaggtgc gattcaatta tttaaaacgt ggcgcacgga agaatacatt attggggctg     45780
     ttggtcagtt gcaatttgaa gtattcgaac acagaatgcg cggcgaatat aattctgaaa     45840
     tccggatgga gccaatcggt aaaaaaatcg ctcgttgggt gaaagaagaa gatgcggatg     45900
     aaaaactatc taccgctaga agtatgctag tgaaagaccg ttttgaccaa ccgctattct     45960
     tattcgaaaa cgaattcgcg attaattggt ttaatgataa aaatccagat attgagttaa     46020
     cttcattact ataatagcta caacctattt gtactttcgc aaataggttg tttttttttg     46080
     cttgacaatt ttttgaaacg cgctataatt agttagaatt ctaattaata aggaggaata     46140
     ctcgtgagaa gagagaagac gatggataca ttaattcgtt ctattatgat taaatccaag     46200
     cgaaaaatgg acgcaaaagt agctcagttt gggctgacaa cacaacaagc aagagttctg     46260
     ggatttttaa atgataatgc tgcaaatgaa ataatccaaa aagatcttca gcgaatcttc     46320
     caaacacgtg gcgcaagtat cactagcctc attcaaggac tcgagaaaaa acaattaatt     46380
     tcacgcaaac caagccttcg tgatggccga gaaaaagtcg ttacgttaac aaaagaaggc     46440
     aaagatattg tggatgaatt taatgcctct tttccacgag aagatgataa agcgaagaaa     46500
     atcctttccg ctgacgagta taaaaccttt attgaactac ttagtaaaat tgacgatcag     46560
     acagattaaa aaaatttaac tatatagtta gagttctaac taatttttag ggggaattaa     46620
     aatgaaacac tcagataact attatttaac aaaagcgagc attcctaaag cgattgctca     46680
     cttatctatt ccaatgatgc ttgggatgtc cgttggggtc atttataata ttatcaatgc     46740
     attctttata gggttgttgc atgatacgtc gatgttaaca gctgtgacac tcggtttacc     46800
     aatgtttacg attttaatgg ctattgggaa tatgtttggt gttggcggcg ggacgtacat     46860
     ttctcgttta ctcgggaaag aagacgggat taaggcaaag caagtatcgg cttttgtttt     46920
     atatggaagt ttggttttag gtattatatg cgcgattata ttaggctttt taattaatcc     46980
     agttactcat tttctaggag cagacgcgac aagtttttta cacacgaaaa attatacatt     47040
     ggcgcttctc atttgtagtc cgtttattat tgctaacttt gctttagaac aagtcgttcg     47100
     ggcggaggga gcttctcgta tttctatgaa tgggatgctt attggtacgc ttgtaaattt     47160
     agtgtttgat ccactgctta ttttgtattt taattttaac gttgtaggtg ctgcagtttc     47220
     aattggaatt gcaagtacgg tttcacttat ttattatgcc tggtatttgg agaaaaaaag     47280
     tgactattta tccattcggt ttaaatggtt taaagcaacg aaagaaatcg ttcaaaatgt     47340
     ttttaaaatt ggcgtttcag aactactttt atcattattc ttgattgtta ctacacttgt     47400
     tttaaatcat tattcgatga tttacgggga aggcgttgtt gcaggttttg gggtggcact     47460
     acgagtagtt cagttaccag aatttatttg tatggggctt tatatgggaa ttattccact     47520
     cttagcatat aactttagtg cgggaaatat tgcacggttt gaaaaagcga ttaggtttac     47580
     agctgttagt attggcttga ttgtgcttgt gatttctagt tttgtattta ttttccgttt     47640
     ccaagtgatg catctattta gtgacagtca aagtgttata tcacttgggg tgcatattat     47700
     ggttgcgatg ctgatttctt ctctattcag tggttttact ggtctcttta cgagtacttt     47760
     tcaagcgatt gggaaagcta ttccggctac gattatgtct gtttcacaag gaattatttt     47820
     tatcccagta attattttgg gacaacatta ttttggccta atgggcgtga tttggtcttt     47880
     aacaacaaca gaaattctta cttgtttaat cggtgtgatt ctattcacaa tccataatat     47940
     taaaatagcc agtagcgcaa aaactaaaga cttggcggtt taaaaagttt gtgagaaaaa     48000
     ttagttgacg agaacttcta aattatggta ttattctcta ggtaatcata tatcgttctt     48060
     tgacaaatgt cagaggggag tagcgctgat tagcttttaa tcaggataaa gtcgtcatta     48120
     catgatagag atatcatcgg ttttatcaca tttaacttta aatgttagcg agacctttgc     48180
     ctttatgggc aggtctcgct tttttgtttc ttcaaaatag gagatctttg acattttaat     48240
     agaacaaagg aggaaaagaa ttagtggata cagcaatgat tttagagtac ggatgggtat     48300
     tacttgtcct aatcggtctt gaggggattt tagcagcgga taatgcagta gttatggctg     48360
     ttatggtaaa acatctccca gataaacaac agaaaaaagc gttattttat ggattgatgg     48420
     gtgcctttgt tttccgtttt ggcgcattat tcttaatttc ctttttggca aacgtttggc     48480
     aagttcaagc gcttggtgcc gcatatttac tatatatcgc gattagtcac atttggaaac     48540
     atgcaaaagg aaaagacgga gaaaaagaga agaaggaaaa agctggctct ggtttttgga     48600
     tgacagttct aaaagtagag attgcagata ttgcgtttgc gattgattcc atgcttgcgg     48660
     cagtagccct tgccattacg cttccagaaa caggatgggg acacattggg ggaattgata     48720
     ccgggcaatt tgcgattatg ttcttaggtg gacttgttgg cctaattatt atccgttttg     48780
     cagcaactca atttgttaaa ttactaaaaa gctatccaag tctcgaaaca gccgcatttt     48840
     taattgttgg ttgggtaggc gtgaagctag ttatttatac attagcacac cctagtcttg     48900
     gcgtaattcc acacagcttc cctgaatcaa cactttggaa attgattttc tggggcgtga     48960
     tgattctgat tattctatgg ggatggttcg tttcctaccg tagtaagaaa aaaacagaaa     49020
     caactaaata attttaactg accagaagtg caaatgtgta cttctggttt tacatacaac     49080
     cagatgctga aaacacaatt ttatgataga gtagtagaag gatggtgaat gaggaatgga     49140
     tgtttctatt tggggagaat atgcgttagt tttccttgtt ttagttgtac ttgaaggaat     49200
     tctttccgca gataatgccg tagttatggc agtaattgtt aaaggtttac cgcacgataa     49260
     acaacgaaaa gccttatttt atgggttagt tggtgcattt gttttccgtt ttgttgcact     49320
     atttttaatt tcatttttag taaaaatttg ggaaatacaa gctatcggcg cggtttattt     49380
     attgtactta gcaatcaagc atatgtggcg ccttaaaaaa ggtaagcaag aagaagtcaa     49440
     agaagcatca gaagccaaat caacttcctt ttggggtgta gttgcacgtg tggaattgac     49500
     agatatagct tttgcactgg attccatgtt agctgcagca gcacttgttg ttactttacc     49560
     agatttaggg aattttgata ttgggggaat gaacggtgga caatttatcg tgatgttcct     49620
     tggtggtatt gcaggacttg ttgtaattcg ttttgcagcc acacaagttg ttaaattatt     49680
     agagcgttac cctacacttg aaacagcagc gtttttaatt gtcggttggg taggtgtgaa     49740
     aatggcggtc ttaacgctag cacatccatc tgttgcaatt attccagaag attttccgga     49800
     ttcagcggtt tggaagctga cattctggtc ggttatgata attataggtt tgggtggtta     49860
     tatcattgcg agaaaaaaag agaagaaaac caaaagagtt tgaatatgat caagaagtaa     49920
     aattgcgcag aagattaaaa ctggtgttag cgcgtatgac acccgttcaa gtaattatcg     49980
     cgtattattt tattgcggtt acgatttcta ctatcgtctt aagtttgccg ttcactttac     50040
     aaaaaggggt taaggtgtcg tttattgata ctttattcac agcggcgagt tctgttagtg     50100
     ttaccgggct tgcgacagta gatgttagcc agacgtatag tactgctgga atttgggtct     50160
     taatggcgat tttccaaatt ggtggattgg gcgttatgat gattagcacg ttcttctatt     50220
     tgattttgaa gagacggatt ggactgaaac agcgccaact tattatgaca gatacgaatc     50280
     aatttacgat gagtggaatg gttcggatgt tgcgcgaaat tcttgtcttg atttttggaa     50340
     ttgaattagt gggcgcgttg attttaggga tttattttat ccctctgtat cctaattttt     50400
     gggaagcgat gttccaaggt ttatataact cagtttcgct tgttaccaat gctggtgtgg     50460
     atattactgg taaatcgcta ataccattcg caaatgatta ttttgtccaa tttatttcga     50520
     tattactaat tattgctggt gcgattgggt ttccggtttt actggaaaca agacgatttt     50580
     tatttgagaa aaatacgcta ataccgtttc gtttttcgtt gtttgtaaag gtgactacac     50640
     ttacttattt tgtacttttg attgtcggcg gcttactcat ttggttgttt gaatacaatc     50700
     acttctttag tggcaaaagt tgggactttg gtttctttaa ctcgatgttc ttatcggcga     50760
     catccagaag tgctggactc caaacaatgg acagcggggc gctttcagtt tctacccttt     50820
     tacttgtgtc gttcttgatg tttatcggag cttcgccaag ttctgttggt ggtgggatac     50880
     gaacgactac ttttgcgatt accattttat ttatttattc ggttattcgc ggtcggaagc     50940
     atgtttatat ttttgggcga gaattgcatc aagaagatgt tcgcaagtcg cttgcagtca     51000
     cgcttgttgc aggatttctc agtatttctg cgatagtcat actcatgcaa acagaaacgg     51060
     cctcgctcat ttcagttatt tttgaagtgt tctcggcgtt tggaacgtca ggtttatcag     51120
     ttggtttgac gcctgatttg tccaccccag gtaaattaat tattatcgtc ttgatgttca     51180
     ttggacgggt tggcatcatg tattcaatgc ttagtttaag aaataaaaat caacccaaaa     51240
     atgccattcg attaccaaaa gaaaaaatta ttactggcta aaataaaaat cctttctgca     51300
     aaacgcggaa aggatttttt tggcattaaa aacccctaac caatttgatt aggggataat     51360
     aattaatatt ttgattttgg aattggtctt ctgaaaattc ccattaaacc agttagtgta     51420
     attaagatac ctgatacaat ccaagcagta ccaataacaa agaataaaac gataccgata     51480
     actactaaga taacacccca accacgagga gctgatttaa ttaagagaga agcaattaat     51540
     gcaactactg aggcaattaa tgtaatccac cctagatttg ccaactcatt tcctagttca     51600
     cctggtaaat aagtaaatgt ctgtatataa tctgtgactg aatctccata attaataatc     51660
     caaaaaccaa ctacaatccc aatgatggag ccaattaatc cgataataac ttctggcttt     51720
     cttgagccca taataaaacc tcctttttct atctatacgt ttaataactt tcccgctttg     51780
     ttaatcggct aaacacgtta tagagcattg aagcacgcag ctcaatcact ggctgaacaa     51840
     ctgtttttac caatcgactg gataataaca ccgtcaaacc aaaagtaatt ccaaataata     51900
     gtaaaaacgt agacgggcta tattgaaagt cagtttggcc accttcacga aagaacttaa     51960
     taaagaagcc atgtaacaaa taaacatata acgtattttt accccattta gtaaaaaata     52020
     accttttttg tgggataaaa ctgaaaaaag cagcgataga gcaaaaacta atcatgtaga     52080
     cgagcgcgcg aatgaaaaga ccaagcgact tcacttcgac aaagttagca tatggttttg     52140
     atcctaaaaa ccatttatcg tttagattcg gatgcatggt aataaaaatc agtaataata     52200
     caacgaaaat tcccccaacg atagaagcta tatgcgtttt aagaaagtaa aaatgttcct     52260
     tttttaaaaa gtagcctact aagaagaatg ggaagaagac aagggttcta gataaactta     52320
     aataaccacc aataatatca aagtatccag caaccagtcc taataaaagc gcaatactca     52380
     cagacttcca aggtttgatt tttgaaaaaa caagcaacat taaattccag aaaaataaac     52440
     tgagtaaaaa ccaaagcgac cattctggat ctaaaaattt aatagaaaga ttctccttat     52500
     ttaaaagaaa ataataaaaa atactgtaga ttagttggaa aaaaacatat ggtaaaatta     52560
     attttttcat cgtctttttt aaatatcctg gcttaccaaa acttttagca aaaaaaccag     52620
     agattagtat aaaggcaggc atatggaaag tgtaaatata aatgtaaagg acacgaaccc     52680
     cagcatattc tgtaataaat gtttgaagaa aatgcccgaa tacgactaag aaaattaaaa     52740
     taaacttagc attatcgaag taactttccc gtttgatttc ggtttgctcc ataaaaaaca     52800
     ttcctttcta ttctaagttg gaaatatctt gttttatttt accctagaat ctgtaacgaa     52860
     tatccaacag ttcgataaca aaaggtatca aatattaata ggcgatgaca tacgtttgcg     52920
     cattattaaa agaagtgcta tctttagagc aatatcatat tcggagggaa gtatggaaga     52980
     tgttgaaaca aacaagcgat tcgccggtgg gtacgttgtt tatcataata gaggatgcgc     53040
     atattacaaa gatttcatac gatgagccga ctaattggga aattttagcg ggagagaagg     53100
     gcgagatagc aatatatcag cagcttctag aacaattagc aggttatttt gaaggagagc     53160
     gggaagtatt tgatttacca attttcttgc aaggaactcc ttttcaacag cgtgtttggc     53220
     aagcacttag tgaaattcca tacggggtag ttgttagtta taaagatata gcaatagctg     53280
     ctgggagtcc aaaagcagtg caagcagtgg ggcaagctaa tcgcgctaat cctattccta     53340
     tacttattcc atgtcatagg tgtgtgaaaa gtgatggggc gcttggtggg tataacggag     53400
     cggacattga taagaagcaa tatttacttg cattagaaaa aggcttgcgt ttaagttaac     53460
     gcaagccttt tttattaaac tgttacttgt tcagttataa cgatattttt atcgtcattt     53520
     agtgtggcat ttaatttctt cgcttctggt tgatcaatta aactatcggc aatcgcatct     53580
     tctaaatgtt cttggattgt gcggcgaagt ggtctagcac caaatttagg atcatatcca     53640
     agctcgatta aatgttcttt aacttcttta gaaacgtcta tagttacgcc ttcttgtgcg     53700
     agcattgaat ttaagtcaac gagcattaag tcgataattt gtactaaatc atctttttca     53760
     agagatttaa attcaataac gctatctaga cggtttaaaa attctggttt aaagtatgcg     53820
     cctagttttg caaggatatc tgagcctttt tcaagtttat tgtcagttgc tgtattaaag     53880
     ccaacagaag cttctgtatc agtcgtacca gcattacttg tcatgataat cactgtatct     53940
     ttaaagctta ctgtgcgtcc ttgagaatca gttagacgtc catcctctag aatttgtaaa     54000
     aacatatgtt gcacatccgg gtgtgctttt tcaatttcgt ctaaaaggat gatgctataa     54060
     ggattacgac gaactttttc agttaattga ccagcttctt cgtgaccaac atagcctggg     54120
     ggagaaccga ttaatttaga gacgctgtgt ttttccatga attcactcat atctaaacga     54180
     atcatcgctt cacttgtacc aaataattca cgagcaagtg tgcgaccaag ttctgttttt     54240
     ccgacaccag taggtccaac gaataagaac gaaccaattg gacgattttt agcttttaaa     54300
     ccaacacggc tacgacggat tgctttggct acttttttca ctgcatcatc ttgaccgatt     54360
     acttttccgg ttaagttgct ttctaggttt ttcattttgg attgttcgtc ttcttgtaaa     54420
     cgtcctactg gaataccagt tttttcttca ataatcgctt gaatatcaga agattgaata     54480
     actggccgtt ctgaaaagga gttactagtt ttattttctt caagtcgagt aatttcgtcc     54540
     cgaactttgg ctgctttttc gtagtcttcc atttggagag cttggttttt ttcttcttct     54600
     aaacgagcaa cacgttcact aacggtgttt tcatccaatt tttcaataga tagattgtat     54660
     tttgaaccaa cttcatccat taaatcaatc gctttatctg gcaaatgacg gtcttgaatg     54720
     tagcgagagc ttaattcaac cgctgctttt aaagcttccg gagaataaac aacttcatgg     54780
     aaatcttcat atttggattt caagccattt aaaatagtaa gtgtttcttc gttagaaggt     54840
     tcattcaccg ttactggttg gaaacgacgc tcaagtgcag catctttttc gatagtacga     54900
     tattctttta gcgttgttgc accaatcatt tgtaagtcac cgcgagctaa ggctggtttt     54960
     aaaatatttc ctgcgtccat tgaaccttct gcggatccag cgccgacaat tgtgtgcact     55020
     tcatcaataa acaagatcgt gtttttgcgt tcttgtaatt ctttaattaa ttgtttcatt     55080
     cgttcttcaa actgtccgcg gattcctgtt ccagaaacga gagaagcaac atctagtaag     55140
     ataacttctt tgttcattaa cttacttgga acttcacctg cgacaattgc atttgcaagt     55200
     ccttcgacaa ccgcagtttt accaacacct ggttcaccga taaggacagg attgttttta     55260
     ttacgacgat tcaagatttc gatgacacgt ttaatttctt tgtcacgacc aattactgga     55320
     tcgagttgat cgtttttcgc catatctgtt aagtttgttc caaattcatc tagtaagccg     55380
     tttccagcgc caccagtttg tgtttgtact tgtgcgtttc tttgactttg ttgttcacgg     55440
     cttgcttggt ttgcagcgcc acttagttga cggaaaatat catcgaacgg ggaaccgcca     55500
     gcacctggaa attcatttgc cccaaagttt gcttgatttc taacttctgc gtaacaagag     55560
     gcacaaagcg gcatttctac acgcttgccg ttaatattca tatatagttg gattgttgct     55620
     tgattttgat tgcatttttc acagttcata gttaatttcc tccttttaaa aatgagaaat     55680
     gaaaggtctt gactttgact atctttgacc ttatgaatta attatatact gacctatttt     55740
     gactttcaag tattttgctt caaatttttc ataaaaaaac attcctataa aaaaggaatg     55800
     tttctaagtt ttttaataaa ttggcaatgc cgcgagtaat aaaaaggcaa aggtcaaatg     55860
     cgacagataa accatgagaa ggctcgggcg ataagagtac atcacattcc atacaagaga     55920
     tgcaacaaaa ataccgatga tagcggcaaa attaccacta ggcaacatca tgaccataca     55980
     tagtaaggcg gcaaaaatat tagagaacca atgattaaaa taatggttca aacgttttaa     56040
     tacaaatcca cgccagaaaa tttcttcacc ggggataatc gcgacaatca aaagcaacca     56100
     tattactaaa gagtgggtgg aatacttatt aaatgcagct tctacagaat gttctagacc     56160
     acctggcatt actttaataa taaaggcacc tatgtaaaaa ataatataaa ggacaattcc     56220
     ggaaaaaatt ccaggtaaaa tgcctttaac gaacgaaaat tcctttttta aatcgtcatt     56280
     aaatatcaca aaactaagta aaaataacat cccagctcca tataaatacc aaaaaacacg     56340
     tgggaactga tatgttaata taacaagtag ggcacataaa ataagtccca atacgagttt     56400
     ataatcaatc ttgatgctct tcaaatactt tacacctctt cttaacaaat acttctcata     56460
     ctactttaaa acaaatgaaa tcgtttggca acaattaaac aaaagataag ataaaagttg     56520
     tgcaatttaa taaatcctat ataatgaaaa aataggagtg gttcatagat gttagaaaaa     56580
     aactacaaat ttttactttg ggtatatata ttctggtttt taggtagtgt attgctagtt     56640
     tctttacaca ttattccgcc gcgtttaaca acaatccagt cactgttttt agtatttact     56700
     ggagtttttg cagcagtttt ctttattatg caatatggca aatggcttgg atctgctatt     56760
     actctactta tttttgttgt cagtacttgt attgaatgga tgcaattaag ttatacggat     56820
     gaatatattg gctctacgct aggcgggagt ttgtatggta ttcctattac gatgggattc     56880
     atttgggtcg gaatgattgc cgggacacac attatcgcac gtgaaatcac acttaaaatc     56940
     aatgttgatt ggattcgtgg aggaatttat tcttttatcg cagctacgat ggtgatgatt     57000
     tttgaagtct taattgaacc aatcacaatg cagtctaaac aactatatat tacgcaaaat     57060
     ggttttacga tcttacagct atctgatttt ataaattggt ggctcttagg cctgatttta     57120
     catttaatga tttattttat tttaagttta acggatagtt gggaacgact taaatatcca     57180
     gatttaaaat cagaaattgt tatcgtttat tggattatta tcgctttctt tgtcttttta     57240
     tcgttttatc ttgatttatg gacctcgatt gctattatta ttgtttcaaa tattattttt     57300
     acagcttgtt atttcttcag ccttgaaaaa gaaacgaaga ctacaaagaa atccgagtaa     57360
     tcagctaatc gattactcgg atttcttttc tttttgcaaa aatttcttgg tagcaatttg     57420
     tgcgttttca ataatgaaag ggagggagct actagacatg gctccagctc cgacaacaaa     57480
     taagttctta aacttaggtg actttttcgc aggatgtaag aaaccttgtt gatgccataa     57540
     atgttgtaaa ccgaatattg ccccgtattt tacatgatat ttttcttccc aatcagttgg     57600
     agtaataata tattcttctt caatataatc ctctaaatca ggaatctcta atctcgcctt     57660
     taccgtatct aatattaatt gacggaatgc aggtgtttgt tctttccaat caatgccact     57720
     agtagtattt ggagcagaaa ccataatccg aacgcttgaa tgattcattg gcgccattgt     57780
     gttatccgtg gctgaaggat tagttatatg aatcgctaag tctttagaaa ggattttttt     57840
     atggatggta ttattcgcaa attctcggta attatctgga aaaataatgg attgatgtga     57900
     aaagggaagc actgttttca aaccaaggta caacataaaa gcagaagagg agtattcttt     57960
     ttctttctcc tttactttcg tgttacttgt taacgaataa ataaaatcca aattagtaaa     58020
     gtaataatca gcttcaatcg attgtccgtt agcaagagtt gcactagtaa tttcttttcc     58080
     attcgtttca aaggaggtta cttcagaatt aaagtagaat ttccctttat tttccataac     58140
     gacttgttgc atcgcttcga caattttatt ttgcccaccg attggatgaa aagtgccgaa     58200
     ataatactca gaaaaaggaa taatactata tgctgctgga atatcccatg gtgacattcc     58260
     taaataacgc atttgtaagg aaaaagcgat acgaagatat ttgctattaa aatatctggc     58320
     caaatcatcc attaaagagc gcccaagtgt gagacttgga agtgcgcgta ttgtagttgg     58380
     tcgaaagaaa tcaaacaagg aactgtagtt aaattgatta agcggcgaaa tataaagcat     58440
     ttttttcgta ttttctctca taaaacgatc aaatccatct tcttcaccag gaaagtaagt     58500
     tttaataact gtttttgttt cagaataatc gctataaagt ggaaaagtaa tatctttaaa     58560
     ataaagcgtg tgtattggat tgatcggtaa aagggagaca taatctaaaa tattacggtt     58620
     acaatccata aaaagagaag ttaacacatg cgtcattgtt aaagcggaag gccctacatc     58680
     aaatgaatat ttacccattt tatgcagcgc agttctacca ccaatacggt catttttttc     58740
     atagatgctt acttgatagc cgagttgact taaaagcata ccagtagcta aaccacccgg     58800
     acctgctcca ataatggcaa ttttcttttt actttccaca ttaaaacgct ccttttcccg     58860
     tttttaaaca tataaaaaac gcaaaaacat aaagcattgt taaacgaaaa tgctttactt     58920
     ttgcgcagtt agaaataatt ttttattctt ctgtctcttc ttcgtcttct tctacagaat     58980
     gaataatttg ataatttttg tgatttacca ctgttttttc ttcaatacct aaatctttaa     59040
     aattttccat ataagttaag tcgacaataa cagaattttc gttgagcttt tcaacaattc     59100
     ctgttaagcc atccttaaat tcaataatgt ctccaacatg tgcctttgcc attgttatca     59160
     ctccttcaat tttcggtgtt gcgtttatct tgatgaaaaa gaatgtatgc atttttgaac     59220
     cttccttaaa ttctgcacta aaaacctatt aaaatcaact ataagccttt aaaaagtgca     59280
     ttttaaatca aaaatgcaac aatttagtga caaaattata gaaaacgctc cctttcttcc     59340
     agttgtaaaa gaacgaaaga agccgtaata gaaaaaaaca ttctaaaaaa tttttaatca     59400
     aatagttgta acaataggta aaacatggta ctctttttaa ttgagggata gtcttttttg     59460
     ctgaaaattt ttcggcttaa aaggttacaa caaatttctt tacaaaggag aatgtaaatt     59520
     atggaacaag caagttttgt agtaatcgat gaaacaggaa ttcacgcacg cccagcaact     59580
     ctattggtgc aggctgcaag taaatacagc tctgacgttc aaattgaata cactggcaaa     59640
     aaagtaaatc ttaaatcaat catgggtgtt atgtcccttg gtattggtaa aggcgctgac     59700
     atcactatct atactgaagg tagcgacgaa aaagaagcaa ttgaaggact aactgaagtt     59760
     cttaagaaag aaggattggc tgaataatgg ctaaagagtt gaaaggtatc gcagcatctg     59820
     atgggattgc cattgcgaaa gcttatctgc tcgttgaacc tgatctttcc tatgaaaaaa     59880
     ctgaagttac ggatgttgaa agtgaagtaa aacgttttga aagcgcgtta gaagtttcta     59940
     gaacagaact ttcaacgatt cgtgaaaaag cagctaaaga cttaggcgaa gataaggcac     60000
     aaatttttga cgcgcatctt ctagttttaa acgatcctga attaacagga ccaattgaag     60060
     aaagcatcaa aaatgctaaa acgaatgcag aaacagcttt acaagaaacg acagacatgt     60120
     ttattggtat gtttgaatct atggacaacg aatacatgcg tgaacgtgca gctgatatta     60180
     aagatgtacg caaacgtgtt ctttctcact tactaggtgt gactattcca aatccagctt     60240
     taattgatga ggaagtagtt gttgtcgcag ctgatttaac gccttctgat accgcacaac     60300
     ttaaccgtaa atttgttaaa ggttttgtga cggatattgg tggtcgtact tcgcattctg     60360
     ctattatggc acgctctctt gaaattccag cagtagttgg aacaaaagaa gtaactgcta     60420
     gcgtagcgaa aaacgatatt gttattattg atggtttgga aggtaatgtt atcatccacc     60480
     caacagaaga acaaatcgct cactatgaaa aaattaaatc tgattttgct ttacaacaag     60540
     cagaatggga aaaacttaaa aatgaaaaaa cagtttctaa agacggcgtt cacgttgagc     60600
     ttgcagcaaa catcggaact ccgaatgatt tagaaggtgt catttctaat ggcggggaag     60660
     cagttggact ttatcgtaca gaattcttgt acatgggtcg cgacaatttc ccaacagaag     60720
     aagaacaatt cgaagcgtat aaagcagtag tttctggtat ggacggaaaa tctgtggtag     60780
     ttcgtacatt agatattggt ggcgataaaa cgttacctta tttagaactt ccagaagaaa     60840
     tgaacccatt cctaggattc cgtgcaattc gtctttgttt tgcgaatgaa gaattattcc     60900
     gtacacaact tcgcgcacta cttcgcgcaa gtgtatatgg taacttaaaa attatgttcc     60960
     cgatgattgc aacagtaaat gaattccgcc aagcgcgcga tattttacta gatgaaaaag     61020
     cgaaactaaa agctgctgga acagaagtat ctgattccat cgaacttgga attatgattg     61080
     aaattcctgc tgctgcagtt ttagctgatc aatttgcaaa agaagttgat ttcttctcaa     61140
     tcggaacaaa tgacttgatt cagtatacaa tggctgctga ccgtatgaat gaacgcgttt     61200
     cttaccttta ccaaccatac aatccatcta ttttacgctt agtaaaaatg gtaattgatg     61260
     cttctcataa agagggcaaa tggactggta tgtgtgggga aatggctgga gatcaaacgg     61320
     ctgtaccact tcttttaggc ttaggcttag atgaattttc aatgagtgct tcaagcattc     61380
     ttaaatctcg ttcgttaatc aaacgtttag atcaatctga aatggttaaa ttagcggaag     61440
     aagctttaaa taaatctaca gcagaagaag ttgtagaatt agttgagaaa tatactgcag     61500
     agtaagctct gatgaagacc tagacaaatt tctttgtcta ggtcttttta tattgtgaaa     61560
     aaagggtgtg caaagtataa ttaaaaatac agttagctta aaaaggaggc aacaagattg     61620
     gttatctatt cattagcagg attttttctt ctgcttttca ttgttttatc ttttatagat     61680
     agacgaagaa taagtaacgg gattgtttta acacttgcac tatttttctc tttactttcc     61740
     cttatttacg ttactctttc aaacgggaac gaattgtttg tttcaattat gagtacggtg     61800
     ttgattttac tgttcttact tattccattt tttataattg gacttgcaac aacactaatt     61860
     atgaacgggc gtttaatgtt aaaacgggaa ggacgaaaac tcgctaatat gctaccgtta     61920
     tttattggct tagttatcgt cattttattt attttttggt tcggtagtat tttgaaaaac     61980
     ggcagcccga tacttggaat ggttgtagta tttgtaatgg cctttgtagg atatttttcg     62040
     tttttatttt tatcatttct tctatcaacg ttcctatatc aattcaattt cccaagatat     62100
     aatcaagatt ttcttattgt gcttggtagt ggcttgattg atggggatag ggtgccaccg     62160
     ttacttgcga gcagattaaa tcgtgctatc gcgttctatg agaaacaata tgacaaaaaa     62220
     gggaaacgcg ctactttcat cgtttcgggt ggacagggcg caaatgagac ggtctcagaa     62280
     gcaagagcga tgcgtgacta tttaattagt aaaggtattg atgaaaactt cattattatg     62340
     gaagacaaat cggttaatac acttcaaaat atgcaatttt caaaagcaaa aatggatgca     62400
     attatgccga catataacag tttattttcg actaataact ttcacctttt ccgagcaggt     62460
     ttatacgcaa gaaaagctgg tctgaaaagt caggggattg gtgcaaaaac agcactttat     62520
     tatatgccaa atgccttgat tcgtgaattt attgcgatta ccgtaatgta taaaaaagtt     62580
     catttgatac tacttggctt agttgtattg ttctttgtat ttttagcgat aattggtatt     62640
     acatttaggt aggaggtttt ttaggtggaa aaaataggtt ttgttggtac tggcgtgatg     62700
     gggtcaagca tggctaaaca tctgcttgag gctggctatg aggtgcatat ttatacgcgt     62760
     acgaaagaaa aagcagaagc acttcttagt caaggggcgc tatgggaatc tgatccgggc     62820
     tcactaggag ctaaagtgga tatcttaatt tcaatggttg gctatccaaa agatgtggag     62880
     caactatact taggtgaaaa tggtttctta gataatttga aagctggttc tgttgcgatt     62940
     gatatgacga cctcttcacc tgcattagct aaaaaaattg ctgaagcggg ccacgaaaaa     63000
     gggataggtg tacttgatgc gccagtttca ggtggtgata ttggagcaaa aaatgggacg     63060
     cttgcgatta tggttggtgg agccgaagat gtattcttaa aagtgaaacc gatttttgaa     63120
     attcttggta gcagtgtgat attacaagga gatgctggct ctggccaaca tacaaaaatg     63180
     gtaaatcaaa tcgcaattgc ttctaacatg attggtgtga cagaagcgat tatttatgca     63240
     gaaagagcag gacttaatcc ttcacgcgtt cttgattcta tttcaggtgg agcagcgggt     63300
     agttggtcac ttacaaactt gattccacgc gtactacaag atgatttttc accaggattc     63360
     tttattaaac attttattaa agacatggga attgctttat ctgaagcaaa acaaatgggg     63420
     ttagagcttc ccggacttac cttggctgag caaatgtatc agactttggc agaacaaggt     63480
     ttgagcgagg aaggtacaca ggcgctcatt aaatattatc ggtaaataag aaacacccgc     63540
     taaattagtt agcgggtgtt ttttattttg ctaaaaattg agccatccga tctaacgctt     63600
     ctgcaaggtt attaacggaa gtggcataag aaagtcggaa gtaacggtca cctttttctg     63660
     aaaaagcatt tcctggtacg acagctactt tggcttcttc tgcgagtcta acagcccaat     63720
     caaaggagtt ttcagttatg tcatctggga gttttacaaa gaaatagaaa gctccatcag     63780
     gtgggatgac tgtaaagccc attttttcta agcgatcttg tgtgaagttt gctcgtgttt     63840
     tatattccgt gcgcatttgg aacgcatcgt cttttccgtt tgtaatggct tctaaggctg     63900
     ctttttgaga aattgagctg gcgcatgtca ccgaatattg atgaattttc agcatttcgg     63960
     tagtgatttt ttctggggct agtaggaagc cgattcgcca accaatcatt gcatgcgatt     64020
     tagataggcc attgattaca attgtttgat cacggagcat tggtgcaata cttacgtgct     64080
     cttcatggta cgttaattca ctataaattt catctgcaat aacgaaaata cctgtttctt     64140
     ttaaaacttc tgctagatct cttagttctt gtttagaaag tgagacacca gttgggttag     64200
     acggataagg aataataagt gctttcgttt ttggtgtaat atgtgctcgt aattgttctg     64260
     gcgttaattt gaaattggat tccgttgtat ctactttgac cgggcgggct ttatttagtt     64320
     ttataagtgg ttcataccca ggataaattg gatcaggtaa gataacttca tcacctggct     64380
     ctaagatagt ttgcagcgcg actgaaatag cctctgtagc acctactgta acgatgattt     64440
     ctttattact ataagttagg tcatatttct cctcaaagta cgaagaagcc gcttcgagta     64500
     gttctggcat acctgcattc ggtgtgtaat tggtgaaatt ctcttgaatg gcggtgatgg     64560
     ctgcttgttt tacatgctct ggcgttggaa aatcaggttc cccaagtgtt agacgaatca     64620
     tatcaggaat accagtaact cttgtattaa atgttctgat accactaact tcaatgtcgc     64680
     gcaattctgg tcgaatggat ttggtcattt ttgtcacctt tctttataag aaaatcccgt     64740
     gaaaatcagg tgggagtaag cttcataatt tcattccatt atagcttaaa aagggagaaa     64800
     agcaaaatat ctgaaaatat tactaaaaag ccttgcactt ttatttagaa tgctataaga     64860
     tagttttaat aatgataatc attttcagtt agaaatgatt ggttgaatgt ggaaggggcc     64920
     accggatatg actaaaccag gtaaatacga agctctcttt tttccaacaa aagacggctt     64980
     gctaaaaata catgcttacg gctttaatcc ctgtggttca tggggtgaag tatttgctac     65040
     aattggcgac caaacgattt gtgtcaaagg atttaatcgc cataaaacaa ttgttcgagc     65100
     aacaaaaatg attataagtg ctacggcaaa ccgaaaaaat gaattttaat tatcaaagac     65160
     tgtaaaaaag ataaatactt ttttatagtc tttttttgag ataaaataag catgaaaata     65220
     gaacaaatcg tgtcattctg gttaatttaa aataatttct ttttctgaat atttccagaa     65280
     cccttgcgtt atacgtgcgg tttgcgataa aatttggtag tatagtgaaa gaaataagat     65340
     atggcgaaaa aaccagatat gaggaaatat gtaaaaaagc attgccacgc gcgtattaca     65400
     attacagcaa ggtagcaaat tttttgcacg tcagatggtg gatttgagag gagagtataa     65460
     gatgtctcag ttactgggaa ttattcaacg tttacatgca atgcaagaag atgagtcagc     65520
     tgaaacacaa gcaagacgtt ttgaaaaaaa tggtacgcct gtgtgcgaag tgaagttttt     65580
     ccaagcttct aactcatttg aagtagaaat ctatggcgac aatagcaaat atcaatttga     65640
     tgatattgat atgactgcaa tcgaaatttt tgaaacgtta caagaaaacg aataacaagg     65700
     taaacaatca gtcaatctgg ttatttactt agaagccgtg aatatttatt cacggttttt     65760
     tttatgtaaa aattcacttt caagcactaa atgaaagaaa tcagactaaa tagtatggta     65820
     gaataggaga tggaaaagtt tcgttttatt ttttttaaag ttgaaaggaa cttcgcagag     65880
     cttgaaaata caaggaagag gaagattcta aatgatctct aatagatttg gacaatttat     65940
     tgacaatgaa ctagctgatt caatgatttc cgctgaaaaa gtagctcacg tgcaactggg     66000
     taataatctc gaacatgcgc tacttgtatt aacgaaatgc ggttattctg ttattccagt     66060
     actagacttt gaatttaaac tccatggatt aattagcgca gcaatgataa cagatgccat     66120
     tctcggactc gaacggattg aatttgaacg actagaagat ttaaaagtgg aagatgttat     66180
     gcaaacggat ttcccggtga ttaaagattt taataataac gagcgaattg tacgcttact     66240
     tgttgatcat ccttttgttt gtgttgtaga tgaagaccac cattttgaag gaattgtgac     66300
     aagacgcgtt gttttaaaac aagtcaatcg ttatattcat ttacaggtgg aggaaaatag     66360
     atgattgtaa cggaatatga acttcttgtt tgtttggcag aagaactaaa tatgcgtaaa     66420
     agtgcggaga aattattttt aagtcagcct gcgttgtccc agcgtctgca aacgattgaa     66480
     agcagatgga atacaaaaat tttcattcga acgcaaaaag gtttgcttct aacacctgaa     66540
     ggagaagcca ttgtccgtca tgcatccagt gtgattgagc gcgagcatac cattcaagaa     66600
     aaactagaag caatggaagg cgtcgttcgc gggacactgc gcattgcttg tgcgagcgtt     66660
     gtggctcaaa tgtggttgcc acgtgtatta aaggcatttg caagtgctta tcctaatgtc     66720
     cagatttccc ttgttactgg ttggagcagt gaagtaactc agcaattagc ggctggtaat     66780
     gtccatatag gtattgtacg cggaaactcg acatggaaaa gtgttcaaaa acccttattt     66840
     aacgataaac tcgttttagt tgatacagaa atcactaaaa ttgaagaagt tttccagaca     66900
     aatcgtccgt ttatccaatt ccgtagtgat tcgaattact atcaagtgat tcaagattac     66960
     tggcaaagaa atttcgggaa aatgccgcgc caagctatgt tgatggatca aatggaaacc     67020
     tctagacaaa tggctttaaa cggtattggt tttgccattt tgccagaagt gacgatgtta     67080
     ggctatacgg acaaaatcaa taaaatacca ctaagagaaa aagatggctc gattttaagc     67140
     cgagaaacca acttattgac ctatgaacag tctcttggtc taccacaagt gaaggcgttt     67200
     ttagaaataa cagataaatt ccttgaacaa gttaaatagc tatggcaaaa tagaaagcag     67260
     aacatatcgg aaggagacaa aaattcatgg aacaaatgga tgcgcaccaa attatttctt     67320
     ttattcaaaa tagcaagaaa gcaacaccag taaaggttta cctaaaaggg gacctagaaa     67380
     aaatcgattt tcctagtgat gtaaaaacat ttatcactgg aaatgcggga actatttttg     67440
     gagaatgggc agttgttgag ccactattag aagcaaataa agcgaatatt gaagattacg     67500
     ttatcgaaaa tgatcgtcgt aactctgcta ttcctttgtt agatatgaaa aatattaacg     67560
     ctcgtattga gcctggcgca gttattcgcg accaagttac aattggcgat aatgctgtaa     67620
     ttatgatggg agcaagcatt aatatcggtt ctgttatcgg tgatggtact atgattgata     67680
     tgaatgttgt tcttggaggc cgcgcaactg ttggtaaaaa ctgccacatt ggtgctggtt     67740
     ctgtccttgc aggcgttgta gaaccaccat ccgctcaacc agttattgtt gaagacaatg     67800
     ttgtagtggg cgcaaatgtt gttgttttag aaggcgtacg tattggagaa ggcgcagttg     67860
     tagcagcggg cgcgattgtt actaaagacg tagctcctgg aacagttgta gcgggaattc     67920
     ctgcacgtga acttaaaaaa ttagatgcga aaacagcttc taaaacagaa attatgcaag     67980
     aacttcgcca actttaaaaa tcaaagggaa ctgttccgtc tgttggcgga gcagtccttt     68040
     tttagaagga gagagcacca tgttaaatga atttattgcc attcgacgtg atttgcacca     68100
     aattcctgaa acaggatata aagagctaaa aacccaagct tatttactcg attatattag     68160
     caaattacca aacgagtttt tagaaataaa gaaatggcgc acaggaattt tagttttagt     68220
     aaaaggtact aatcctggaa aaacaatcgg ttatcgtacg gatattgatg cgctgcctat     68280
     tacggaagag actgggttgc catttgaatc gaaacatgct gggaatatgc atgcttgtgg     68340
     acatgattta catatgagta tagcgcttgg agtattaacg cattttgcaa gtaaaccggc     68400
     aaaagataac ttattatttg tgttccaacc agctgaagaa gggccaggcg gagcaaaacc     68460
     gattatggaa agtgctgaat tttccgagtg gcgccccgat acgatttatg gtcttcatat     68520
     tgcaccagaa tataaagtcg gccaaatcgc aattaaacca ggcttactat tcgcaaacac     68580
     ttccgaactc tttatttcat ttaaaggaaa aggcggacat gcggcttatc cacatttggc     68640
     aaatgacatg gttgtggcgg caagcgcttt tgtcggacaa atgcaaacta ttattagtcg     68700
     gaacattgac ccgatggata gcgcggttat aacaatcgga cgcattcacg gcggagaaat     68760
     ccaaaatgtt attgcagaaa ctgccttttt ggatggaacg attaggacgc tttctccaga     68820
     aacaatggaa atcgtttgga ctcgtttaaa acaattagca aaaggatggg aagaagccta     68880
     ccaatgtgaa gtagaattcc atcctggatc cgattactat caagtggaca atgatccagt     68940
     tgaaacagaa gaattcatcc actttttgga agaacaatat ccagaaagct atgtgccagc     69000
     tcgttcagcg atgactggag aagattttgg ttacttttta tctgaaatta aagggtttat     69060
     gttttggtta ggcgtggatt ccgagtacag tttgcatcac gcgaaactta gtccaaaaga     69120
     agaagctatt ccatttgcaa tagatgtatt agtgaacttt ttggaaagca aataaaaaag     69180
     acatcaattc gttctcaaaa ggagcgaatt ggcgtctttt taattattat ttggtccgaa     69240
     tgtgctaaca aaattaagtg gtaattcaat ttcgttttct gcgagtgctt cgcgaatatc     69300
     tttgagtaag tcacgttgaa cagaatactg ctcgccgttc actgctttac caactacgcg     69360
     gataatcata tttgttgcgt caatgttttg cacgcctaag acaacagggg gctcaacgat     69420
     atttttattt tcttttgcag caacgtcaca aacctcacca ataattttaa ttgctttttc     69480
     cggatcttca tgtggactaa tttgaatgtc caccatcaca cgcatattac cgcgcgaatg     69540
     attactaacg accataattt gtctgttagg aatgaaatga agcgtgccat caaaatcacg     69600
     tacctgtgtt gttctaaggc caagtgcttc tactgttcca ttaactagtc caatggtaat     69660
     cgtatcacca acatcaagtt gacgttcaag tagaataaaa aatccagtca caacgtcact     69720
     aacaagccct tgagcaccaa aggcaatggc caaactcgcc accccagcac ttgcaataat     69780
     cgctgtaaca tccataaagt tctgtaataa taaaatcgca aaagtgaaga ataaaacata     69840
     gccgtaaaaa ttagaaatta agctttctaa cgtatccgcg cgcccaacag aaactgcttg     69900
     ttgttgccga tatttgcgga agaaactacg gataatttta ttaccaacca cgcggaaaat     69960
     aaaataaaga gcaattaaaa tggcaatttt tattccaact gaaataatat gattccaaaa     70020
     ttggtcccag tcaatagaac tgaaccactt tttgagtaaa ttcatcttct ggtccacatc     70080
     ctttgaaagt tctccatcca tttcatctcc cccttcctaa tgaaatgtcc ttttctattc     70140
     taacaaaaat ttcacaaaaa tgctgttata agaaataatt tttcactgaa aaagattcgt     70200
     tttcaacaaa aaaagttaat tttattaaaa aaaatttaaa aaagcgctag ccattcttgt     70260
     agtaagatgg aggcgctttc taaaatgtgt gaaatagcgc aaatcaaact gtatgatgtg     70320
     aaactaatgt gaaacttgtg tacaatgata aatgttattg ctttttttaa aagtgatatg     70380
     ggccgaattt ttgcctagta aataattcaa tttaaaaaag aaaggggatt ttattttgag     70440
     caagattaaa gtggaagaac taacgaagat ttttggaaaa aaggcttcta aagcatcttc     70500
     tttactttct caagggaaat cgaaaacaga gattttgaaa gaaacagggg cgactattgg     70560
     tgttaataaa gcatctttta gcgtagaaga aggagaaatt ttcgttataa tggggctttc     70620
     tggtagtggg aagtcaactt tggtacgact tttaaaccgt ctaattgagc ctacgagcgg     70680
     aaaaatttgg ctggacggaa aagaactctc tagtttaaat aaaaaagaac ttttggaagt     70740
     tagaagaaaa agcatgagta tggtcttcca aaattttggt ttatttccaa atagaacgat     70800
     taaccgtaat gttgaatacg ggcttgaaat tcaaggaatg aacaaagaag aacgtgagaa     70860
     aaatgcagca gaatcgcttg cacttgttgg tttagctggt tacggcgaac aatatccttc     70920
     ccaactttct ggtgggatgc agcaacgtgt agggctagcg agagcacttg ctaacaatcc     70980
     agatatttta ttaatggatg aggctttctc agcacttgac ccacttaaca gaaaagacat     71040
     gcaagatcaa ctactagatt tacaagataa aatgaagaaa acaatcatct ttattaccca     71100
     tgatttggat gaggcgcttc gtattggcga ccacattatg attatgcgtg atggttctgt     71160
     tgttcaaact ggttccccgg aagaaattct ggcacatcca gcaaatgaat acgtagaaaa     71220
     attcattgaa gatgtagacc gttccaaagt ttatacagcg agcaacgtaa tgatacgccc     71280
     agaaatcgtt aattttgaaa aagacggccc tcgtgtcgct ttaaaacgga tgcgtgaagc     71340
     tggaacatct agtgtatttg ttgttaagcg taaccgtgag ttagttggta ttgtccatgc     71400
     agcggaagtt tctaaactag ttaaagaaaa tattacttcg cttgaaactg ctttacacag     71460
     tgatgtaccg acaactggtc cggatacgcc acttgcagaa atcatggata ctatctcgac     71520
     aacaacgatt ccaatcgctg taaccgaaga tggaaaatta aaaggaatta ttattcgcgg     71580
     atctgttctg gccgcacttt ctggaaacga ggtgaacgtt aatgcctaat attccaacga     71640
     ttccattagc tagttggatt gataaattag ttgatggctt aacgcaattt gaaggatttt     71700
     ttaatgtaat tacaaatatc attggcggaa ttgttgatgc attccaatgg gtattcgact     71760
     tagttccacc atggttattt attattttac tagtatttgg gactttctgg gttaaccgca     71820
     aaggaaaaaa atggggatta attatttttg aagttgtcgg tttactatta atttggaact     71880
     tagatttctg gcgtgatatg actcaaacgc tgactcttgt tcttacgagt agtttaattg     71940
     cacttgttat aggtgttcca cttggtattt ggatggcgaa aagcggtatc gttgaaagca     72000
     tctttaaacc ggtgcttgac tttatgcaaa caatgcctgc ctttgtatat ttaattccag     72060
     ccgtagcatt tttcggaatt gggatggttc caggggtagt tgcttctgtt attttcgcaa     72120
     tgcctccaac tgttcgtatg actaacctag gtattcgcca agtttcgact gagcttgttg     72180
     aagcagcaga ttcatttggt tcaacacctt ggcaaaaact ttggaaagta cagctaccaa     72240
     tggcgaaatc gaccatgatg gctgggatta accaaagtat catgttagca ctttccatgg     72300
     ttgtaattgc ttcgatgatt ggtgcaatgg gacttggaac acgtgtttac tttgcagtag     72360
     gacgtaatga cgctggtggc ggatttgtag ctgggattgc gattgttatc gtagcaatta     72420
     tcctagaccg tctaacacaa gctttcaata aaaaagcgaa atcagaataa ggaggagagt     72480
     agattgctaa aaaaattaat caccaccgca gttttggcta tgcttatttt cactttagca     72540
     gcctgcggga caacccttgc tccttatgac gcgaaaaaag atttaggcga acaaatcaat     72600
     tatacaatca caggaattga tgctggagca ggaattatgc ttgcaacaca aaatgcgatt     72660
     aaagattatc atttagatga tgacaattgg cagttacaaa caagttcgac tgcggctatg     72720
     actagtacac tacaaaaagc gatgaaagat aagcgcccga ttgttgtgac tggttggaca     72780
     cctcactgga tgtttacaaa attcgacttg aaatttttag atgatcctaa aaatgttttt     72840
     ggaaacgctg aaaatatcca cacaattgtc cgcaaaggtt tgaaagaaga aaaaccttct     72900
     gcctacaaag tgctagataa tttcttctgg actgctgaag atatgtctga agtaatgcta     72960
     gaagttaatg acggagtaga tccagaagaa gctgctaaaa agtggattaa aaacaatcca     73020
     gaaaaagtag caaaatggac cgatggcgtg gaaaaagtag atggcgatga aatcaagctt     73080
     acttatgtag cttgggattc agaaattgcc tccacgaatg ttgttgcaga agctttgaaa     73140
     caagttggct ataaaccaac cattcaagca atggaaattc aaccaatgtg ggcgtctgtc     73200
     gccacagatg cagcagatgg aatggtcgct gcatggctac caaacacttc cggaatctac     73260
     tacaaagatt acaaaggaaa gtttgaagat ttaggaccga acttaaaagg tgcgaaaatc     73320
     ggcttagcag ttccaaaata catgacaaac attaactcca ttgaagattt aaaaataagt     73380
     aaataaactt tggaaaaggc atgaagaagt tcaagctata cttgatactt tctccgtgcc     73440
     ttttcttcac taaaaaggta aaataatagt taattgatga atttgctagg aggaagatgg     73500
     atgtttaaaa aattcttgaa aaaaagtaaa aatgaaaccg tatttgctca tgtgactgga     73560
     caactgattg cgttagaaga tgttccagat ccagttttta atcaaaagat gatgggcgaa     73620
     ggtattgcaa ttaaaccaga aagcggcaca atcgtagcgc cagttgatgg gaaaattatt     73680
     caacttgcag aaacgaaaca tgcttttggt attcgcacgg atatggggca ggaaattctc     73740
     gtgcatatcg gtttagaaac ggtatcatta aacggagaag gttttaacgt gttagtaaac     73800
     gttggcgata aagtaaaagt aggcgatcca atcgttgaag cggactttga ttttatcaag     73860
     aaaaatgccg caagcacagt ggtaccaatg gttgtaacta atagttcaga aggcaaatac     73920
     gattttgaat tcgctggaac tccaaatacg gttgctggga aaacagaagt atttactaca     73980
     aatttaatat aataagcaca aaatccatga gaagccaatt ttcttttcat ggatttttta     74040
     gtattcattt gcgtgttaaa agggtagaat gaaggtaatt agtattaaaa aggagcgaaa     74100
     ataaatgtta gaagtgatag ttcaaaaccc aagagatgcg tacttagcag aaaaatatgg     74160
     cgcaaataga atggaagtag tttccgctat aagtgaaggt ggcctaacgc ctagctacgg     74220
     tgctattaaa gaaatcgttc gtgcttcaaa acttccggcg atgatgatga ttcgccctca     74280
     tagtttttcg tttgtatacg atgagcctgc tagaattgtg atggaacgag atattgaact     74340
     tgcaaaagaa gttggggtca aaggtatcgt ttatggtgga ataacggaag acggaaacat     74400
     cgatcaagag cttctagaaa aagtgattga gtggaaaggt gacttagacc ttactttcca     74460
     tcgtgcgcta gaagcaacaa aagatattga agcaagctac caagttttac gtacatacgg     74520
     ccaagacatt aatcaattat taacttcagg tggaacagct agtgcacttg attctttgcc     74580
     acgccttaaa cggtggataa atgacagtaa agaaaatcca agttcattta aaattctagt     74640
     tggaagtggc gttaaacctg aaaatattgc tatctttcaa gaaacactaa atcatacaga     74700
     ttatcacgtc ggaagtgcag ctagagaaac gaatgatttc gcaaaagaca ttttaaaaga     74760
     aaagatcaat attttaaagc agcatattaa ccaagattga ttctacgtag caggtagcct     74820
     tacgagtcta gatacgctat aatgaaacaa gactattctt aaaataaagg tggaaaaaaa     74880
     tgaataacta tattggcaaa agccaagtaa tgacagtaaa ggaaattaaa gaaacaggtt     74940
     ggctcctaga gaaagatgaa gtgactgttt ttttatctaa atcgaataca catgaaacag     75000
     aacttgctgt tggagatgaa gtaacagcat ttatttttgt tgactacgac cgagaaatcc     75060
     gcgcaacaac aattattcca aaaattcaag ttggacatta cggctggggc acagtaaccg     75120
     aagtacgcaa acatttaggt gtatttgtgg atattggtat tgaaaaagat gtcgttgtat     75180
     cattagatga tttgcctgca ctaccacatt tatggccgaa aaaagaagac cgagtgatga     75240
     ttgcacttcg agtagacgaa gaaaatcgcg tgtggggagt tctcgctgaa gaagaacaat     75300
     tccgcgctat tgcggttcgt gcagatcaag acctttttaa tcaaaatgta gaaggaacca     75360
     tttatcgatt acttaaagtt ggctcctttg tctttacaga tgatttccat attggcttta     75420
     ttcatgaaag tgaacggact gcagaaccga gaatgggaga acgtgtaaaa gcccgtgtta     75480
     ttgcagtgaa accagatggc tcacttaatt tatcattacg tggtagagcc catgaagtat     75540
     taaatgacga tgcggaaatg atattaactt acttacgaag tgttggcggg gaaatgccat     75600
     ttggagataa atcagatcca gatgcaatcc gtgctaaatt cggaattagt aaggcacaat     75660
     ttaaacgcgc aattggtaca cttttaaaag caagacggat tacacaagaa aatggagtaa     75720
     ttactaagtt aacagaagag gcatccgact aaagtagtag agattgttcc aactagcgcg     75780
     gtttgtttcc actagcaaat catcgctata ataaacacag ctgtacaaag tagcgaaaaa     75840
     tcgagaaata actttgtcta aagaatggct taaggaggtg tgtcagcttg aaaaaaatgg     75900
     aaagctcggt tgtttttata tttttaattg cgattattgt tggcgttggt cttgagatgt     75960
     tattccagtg ggaattactc attttatttg cactcggaat attcttcatt tttacatcaa     76020
     ggaaagcaag tgccacgaaa aagagcgcaa aaaactcact atttattggt atcgtattta     76080
     tcattattgc agtgctgtta acaactactt ttaaagttgg acttgttgtt gcaggtattt     76140
     atgcgattat tcattatata agccggaagc gggcacccca attattaatg cttaaaacga     76200
     gagagccaga cagtaaaatt gatcgcacgg gtaaatttat tcgtaatcag tggtttggta     76260
     atcagcggat attagatgtc gtgtacgaat gggatgacat caatattcaa acaggaatag     76320
     gcgatacgat tcttgattta ggaaatacgg tgcttccgac tggcgaaagt attattatga     76380
     ttcgcagtgt atccgggaaa attcgtatcc tcgttccatt tgatattggc atttgtattg     76440
     aacactccgc gattttcgga aatatccaat atgataaaga aagcacctct atccaaaata     76500
     atagcatcaa ggtctactca gataattacg aaagttccgc acgaaaagtg aaaatcatga     76560
     cttctgtaat cttcggagat ttagaggtga tcaggttatg agtttttcga aactaatgat     76620
     ggtagtttgc tcaggattac tccttgttgc aacagccatt ggaacggtag gatactattt     76680
     tttcagtgaa ggttcttggt ataaaatctt aattgaacaa aaaatatttt acattccttt     76740
     tatcgtcttt gttccgctga cagctatttc gataggttta attattggcg gcttacttgg     76800
     ctattttgtt aagcaaaagt ttgagtcgat tgacttttcg attcggctgc taggacaagg     76860
     cgatttagaa aaaaagatta ctagtgaaga agatgaaact tttttagaag tacagcaagt     76920
     ctataagcaa atcgaccgtt tgcgtgataa gatgaaagca caaacgattc tgactcaaaa     76980
     gctagcaagt gatcgcgctg aatcaagtgg tcaaacgaaa gaagctattt tgtcagaaga     77040
     gcgtcaccgg attgcgcgtg agttacatga ttctgtgagt caacaattat tcgcagcgat     77100
     gatgctatta tctgccttaa atgagcaaag cgaaaaaagt gcaactcccg ccatgcaaaa     77160
     gcaactaaaa atggtagaat ctattgtcaa tgaatcccaa tctgagatgc gtgcactatt     77220
     acttcatttg cgaccaacgc agctcgaagg aaagtcatta aaaacgggta tagaacaatt     77280
     attaaaagaa ttaacaacca aattacccat cgaagtcgaa tggcaaattg aagatattaa     77340
     tttgcaaaaa ggtattgaag atcatttatt ccggatagtg caagaattac tatcgaatac     77400
     tttgcgtcac tctaaagcaa aattattaga agtacggtta gtgacgatgg ataatttagc     77460
     cgtaatgaaa gtagttgatg acggcgtagg attcgatatg gataatgttc gtcaaggttc     77520
     ttacggttta caaaatatgc gtgaacgagt cgctgaattt ggtggtacca ttaaaataat     77580
     tagctttaaa ggacgaggaa ctagcgtaga aataaaaatc ccacttgttg cgaaaaagga     77640
     cgtggaaaac gaatgataaa agttttacta gtagatgatc atgaaatggt acgtataggc     77700
     gtgtcagctt atctttctgt tcaagatgac atggaagtag tcggcgaggc agaaaacggc     77760
     cgagaaggcg ctgatatggc tttagagttg cgtccagata ttatcttaat ggatttagtt     77820
     atggatgaga tggatggcat tgaagcaacg aaagaaatta tgaagaattg gaaagaagca     77880
     aaaattatta tcgtcaccag ttttattgac gatgaaaaag tatatccggc actcgaagct     77940
     ggagcgagca gttatatgtt aaaaacctcg acagcgagtg aaattgccga tgcgattcga     78000
     gctacatacg gcggtgactc tgtccttgaa ccagaagtaa ctggtaaaat gatgcaaaga     78060
     ctaaccgcta aaccagaaaa aaacctacat gatgatttaa cgaatcgcga aaatgaaatc     78120
     ttacttctta ttgcagaagg taaatcgaat caagaaatcg cggatgaact attcattact     78180
     ttaaaaacag taaaaacaca tgtaagtaat attttatcca aattagatgt acaagaccgc     78240
     acacaagctg caatctatgc atttaaacat gatttagtag aaaaaaagta acagggaggt     78300
     aagctacaca tgaaagaggg atttgcagtc atcggtcttg ggcgctttgg cggaagtatt     78360
     tgtcgttcac ttgtcgaaca aggaatggaa gtgcttgcca tcgattctga tgaagaacgg     78420
     gtaaatgaat atatgtcgat tgctactcat gcagttatcg ccaattcaac cgatgaaaac     78480
     gcgcttcgtc aattaggtat tcgaaatttc gagcatgtta ttgtcgcaat tggtgaagat     78540
     attcagtcga gtattttaac gacgctgatt ttaaaagaaa tgggcgtaaa atatgttact     78600
     gcaaaagcaa caaatgataa gcatgctaaa ttactagata aaatcggagc tgaccgagtt     78660
     gtccatccag agcgggatat gggacgacga attgcgcatt atatcgtatc gaaaaacatg     78720
     cttgattatc tagaactttc tgatgaatat agcttagtgg agatttcggt ttctgatccg     78780
     cgtttcctcg gcaaaagcct tgttgactta gattttcgta actcatttgg cgttaacatc     78840
     gtcggcataa aaaaagacaa acaaatgatt attactcctg aagcaaatga tgtacttcat     78900
     gaaggagata ttttaatcgt tattggttca gatgacgaca ttgagcgatt acaagaaaaa     78960
     attcaataaa cataaaacct atgcaatata tgaagatgtg caacaatatc tattatatgc     79020
     ctaggttttt ttattgttta cttgctatct aatcatttat tttctattat agttacagag     79080
     cttaagtaaa cgtgatagaa gagaggggaa ctgatgaaaa aatttttgct agataaaatt     79140
     ggggcgcgag gattaattca aatgttgcaa gcatttattt atgcaagtat ttgtgttatt     79200
     gttcatactg ttatttttcc tgatttggct ggagttttac ctattgttgt tttaataggg     79260
     attatttcca tgcaacctac atatgggatt actcgaaaag tcattcctca aattgcgata     79320
     gcttttacgt tagcgtgcgc attcgttatt atcagtactt acttttttcc aatcaatgta     79380
     tatatttatt attttgtaat gttaattgtt attttaatag tgaattttac gatgccgcaa     79440
     aaatacatgg tgatgacgct agcaattgga acagcacttt attttcttgg gacagaagac     79500
     ttaccaatgc cgctttacgt aatggtgata gtagcactcg ttgatgtatt tgtatttttt     79560
     attttagtaa gactcgttgt aaggtacgtc catttgccgc ttgaaaaaac tgtccagacg     79620
     atcatgaagc aattaatggg actatttgat aaagaaatgg aaagcgtttt taaaaataac     79680
     gggaaatttg tatcgaaacc actgtatagt atttttgtac aatcgcaaat gtttattaaa     79740
     gaatatggca ctagtaaaaa tatgaatccg cgtcatgtgg aaatttatca agcgttactg     79800
     ccgaattatt tacagctctt ttttcatatg caaacgcttg aggatattgg tagggtaggt     79860
     ttgtcggaag aagcaaaaaa agcgctagcc acaataaatg tcgaagtttc aactgagatt     79920
     aatgccaaag aaacaaaccc agttgcttct tttcacgtga aaaaattcgt tgaaaacttt     79980
     ctagctatta aaaaaggaat ggctgaatta gctgaaggag gggacaagaa atgaaaaaaa     80040
     tttcaatgaa agagcgactt gctctagacc cccgtgttgc taaagtctta attagtatta     80100
     caatagctat tttgcttttc ccggtaatgg gcgattggat tgtttatccg acatatgtct     80160
     ttaatgccat ttatatcact gctcaaatga caaaaggggc aacatataaa tctagtattg     80220
     aacgtattgt tgggacgata gttggtgggt tacttgcagc atttgtatat cttttagtac     80280
     caaaccatca ctatattatg attccaattg gcgcggcgct tgctgttgcg ctgagctatc     80340
     ttttcactaa aaaattcacg atggttattg ttgttattac ggtgatggta ttagttggta     80400
     aaggagacgg ggagccgatt gtctttttaa gagatcgctt atttgatacg atgatcgggc     80460
     tagcgattgg ttttcttgtt tatgcccttt atccacggaa aaaagctaaa aaattaaatc     80520
     aagttttcat ctctaaggaa aaagatctac tggcaaacat taaagcgata gagattaatt     80580
     ctgatgatgc taaagcgctc gcaccgaaga ttaaaggctt atggaagcaa ttaattgaac     80640
     tacgaaaaac gcgagaacaa attattactg atagtagttt tgttggagat gtaaattcag     80700
     aagaaccaat gctccaattt accattttag ttgaacgggc gattaacaat attgaaatcc     80760
     tttatcatgt gactttagat aaagaggtag aacctgatta tgaaattgtc tttgattatc     80820
     atcaacaagc gtgcaaaaag gtgattaatg aaatggaaac cttgattacg aagcatcaat     80880
     aaaaaagatg actgaagctt aatgggcctc agtcatcttt tatttttatt cagttatatc     80940
     taaactcttc ttaaacatgt taattacacg ttctaagtcg gtttcatctg gtgcaaaata     81000
     atataaatcg aatccgtatg actcactata aatcatttct ccttcacctt taagctcttg     81060
     cgaatcaacg tttttaagaa cggaagaata attggtagcc atagaagtaa tatctgtaag     81120
     cgtcatatta gtttggaaat tatctccaac agctttcatt atgctttcga aattggatac     81180
     gcctgatgaa cttataactt tattcgcgat accgataata acgtcgcgtt gtctatcttg     81240
     acgaccaaag tcaccgcgag gatcttcgtg acgaatacgg acatattgta aagcgtccgt     81300
     cccatttaaa gtaatatttc cttttacaaa tttgctattt acttctgtta aatcaatgtc     81360
     gttataaact gtaataccac caactgcgtc aacaaggtct ttaaagcctt ccatattgat     81420
     agaaataaaa taatctaccg gaacacctgg cattagtttt tcaactgctg aaacggttcc     81480
     tgaagggcct ccgttcgaat aggaagcatt gatttttcca atatcgccat ttccataatc     81540
     tacttttgta tcacgaggga tgctgaccat ttcgacagcg ttttgttgtt tattggctgt     81600
     tgcaaggata attgtatctg ctcgaccatt cgtttcaccg gggcgagcat cagaacccat     81660
     aagtaatacg gaaaaaggtt ttttcttttc taaatcactt gttgttttat tacttgtttc     81720
     taaagggaca tttatttttg taaaagtatt ttgaacggtg atgtaatact tcgctgccaa     81780
     acctgtaatg gagaaaaaga gaattcctaa aagtgtaacg ctagcaattt tcataacttt     81840
     agtaaaagtg gacggttttt tttgcttcgt ttctgtccta gtttctgtca taaaattttc     81900
     ctcgtctttc ttatttagtt tgtttaaaca taccatcgtc tttctgagaa atcaacaaaa     81960
     aacgataaat gattttgaaa ccatttatcg tctttaaaac tatacttcca tgattatagg     82020
     taaaatcatt ggacgtcgtt ttgttttttc gtacaagaaa ggttgcaaag tatctgtaat     82080
     ttcgttcttg atttcagacc attgcgttgt tttttgctcc attactttat ttaagtgacg     82140
     tgttagaaga ccttgagctt ctccgattaa attaccggat tcacgcatat aaataaatcc     82200
     gcgagagatg atgtcaggac cagccatgac acgtgagttt ttcatatcaa ttgaaacgac     82260
     gacaataaca agtccttctt cagaaagaat gcgacggtcg cgcaggacga tattaccaat     82320
     atccccaatt ccgctaccat caatatagac gctagcagca tggattttac cagcaacatg     82380
     agctgtctca cttgttaacg caaggacatc accgtttgcc ataatgaaac tattttcttc     82440
     tggtacgcca cactcttcgg cagattcagc atgaattttt tgcattctga attcaccgtg     82500
     aattggcata aagaatttag gtttcataag acgtagcata agtttttgct cttgttgacc     82560
     accgtgacca gaagtatgga tattatttac tttaccatgg ataacttctg caccagcttg     82620
     ataaagtaag ttaattgtac ggttaacact tgtcgtatta ccaggaatag gggaagacga     82680
     gaagactacc gtatcacctg gttgaatttg gatttgacgg tgagtaccat tagcaattct     82740
     tgaaagagca gccattggtt caccttgact tcctgtacaa aggatcgtca catttcctgc     82800
     tggtgtttta ttaagttgat gcacatcaat aaatgtatct tttggagctt gaatataacc     82860
     taattgctta ccgatttcca tagctgattc catactacga ccgaaaacag cgattttacg     82920
     gccagtttcg atagaggatt caactacttg ttgtaaacgg taaatattgg atgcgaaggt     82980
     agcgaagata attcgtcctt caacgtcgcg gaaaatgttt ttaatacttt caccaacaac     83040
     gcgttcactc attgtgaaat ttggtacctc agcgtttgta ctatctgata gtaaacaaag     83100
     gacgccttct ttaccaattt cagccatttt tgtcaggtta gctggttcac caactggtgt     83160
     gaaatcaaat ttgaagtcac cagtgtgaac aatattacct gatggagttt tgacaacaat     83220
     accatacgta tcaggaatac tatgtgttgt acggaagaat gagatgctag tttttctgaa     83280
     tttaaaaacg tcatcttctt catattcata aattttagtt tgacgaagca aaccatgttc     83340
     ttctaatttg ttgcgaataa gagcactcgc aagcttccca gcataaattg ggatattaag     83400
     atcgcgaagt aagtaaggaa cgccaccgat gtgatcttca tgaccatggg tgataaaaag     83460
     tcctttaatc ttatctttat tttttactag ataactgtag tcaggaataa catagtcaat     83520
     cccaagaagt tcgtcttctg ggaacttgat tcctgcatca attaaaataa tttcgtcttg     83580
     aaattgtacg ccatatgtgt ttttaccgat ttcgcctagt ccaccgaggg cgaaaacagc     83640
     tgtctcatta ttttttacaa atttcatata ggcttatttt tcccagagcg cgaagtctgg     83700
     gttttccttt tcgtaagcta agtgcgcgtc actaattttt tcgacaaatt cgatgtggaa     83760
     aggctcatct tttaaaagtt ggcgtacttt tacttcgctt tccgcttcta cgtataaaga     83820
     ttgtgttttt tcacgtacgg gtgtttctgt aagtgtttct tgataaaata ctttaaaaat     83880
     catgtttttc tctccttaaa ttttaagttt agtttttaaa aatagattct ctggtcgaaa     83940
     atctaataat tattcagtaa taattggctt gctttcagtt gtggacttag tagcaagcgg     84000
     atatgggtgc acgagatact aacaattagg cataaaaaag acaaagaaaa attaccacag     84060
     actaatgtat aaaaatagct gtgcacgtat aacaattttc ttatccgtta taattgcata     84120
     cctttatttt gggaatttga aacaaatttc cgagtaaaag atgtaattat aaactttttt     84180
     tcacgttcca ttgttgttct ataaatgttc atccgatcta tatccttctt tctaatatac     84240
     cataaatcca gataattgct actagaaagt ataattaatt ttgccaaagc ccgacagttt     84300
     gtgatttttt ggtcgctttc tgctataatt taagctaagt gattttaaaa tggatagagg     84360
     attgaggcgt ttaattgatg agtaaaattg tatttttcga tgtagatggt acgcttgtag     84420
     gtgaaacaaa agaaattcca gcttcagcaa aacaagcgat tgctaaattg aaagaaaatg     84480
     gcgtttatgt cgctattgca acggggcgcg gcccatttat gttagatgaa ataagaaaag     84540
     aactagatat taattcctac atttgttata acggacaata tgttattttt gaagggaaag     84600
     aaatctacgc taaaccatta ccaaccgagt cattagaacg actaattacg gtggcatcgg     84660
     agcatgagca tccaattgtt ttttcaggaa aagattccat gcgtgcgaat ttaccagatc     84720
     atgaccgaat tacgattgga atgaattcta ttaaaaggga ttaccctaaa gtagatgcta     84780
     attattacaa aggtcgagat atttatcagt gcttactgtt ttgtgatgag tcgtatgatg     84840
     cttattaccg caaagaattt aaacaatatg gtttcttacg ttggcatgat gtttcagtag     84900
     atgtttgtcc agcagacggt tccaaggcgg aaggtattaa gcagatgatc aaaaaacttg     84960
     gcttttcgat ggaagatact tatgcatttg gcgacggact taatgacatc gcgatgctac     85020
     aagctgttgg aaccggtgtt gcaatgggaa atggtcgcga cgaagtgaaa gcagttgcgg     85080
     attatgttac tgaccatgtg gatgaagatg gcgtttataa agcgcttcag catctaaaac     85140
     taatttaaat caaaagcgag gccactattt cagtgtagcc tcgctttttg ttgttatttg     85200
     gtcctgttcc catttctgtt taatgaattt aagttgcgcg acgataataa tactaataat     85260
     cacaagtaag taccaactcg ttatttttga gacatgcact ggccgccaag caacaagctg     85320
     atcaggatac gcccaagcac cgtaaaaact agcaatattt tccgcgagat agataaaaaa     85380
     tgcaatacat aaaaatgaaa aagataaagg cattttgagc tgagtagcgc taactttaaa     85440
     ataaacatat gtttttcgga atagtaggag aactaaaata atcaaaatcc accgaaaatc     85500
     cataataaaa tggtgcgtga aaaaattcgc gtaaatcgct atgcaaagac tacttactaa     85560
     ccaaatattt ggccaattgg tcatgttaag atcaaacctc ttccaggcct gacaaatata     85620
     acttgccacg cttgaataca taaatccgct atacagtggt acgccgaaga gtttcattaa     85680
     accgggttct ggataactcc aagatcccat atgtacttta taaatttcaa gccccagacc     85740
     aatcaagtga aaaatcatga taactttaag ttcatcccaa gtttctaacc caaactttat     85800
     caggaaaatt tgtgtcacga ggcaaatgat taaaagtaag tcatagcgcg caataaaagg     85860
     aatttcaatt agttttgtaa gggcgagtga aatgaaaata atgcccggaa aaagacaaca     85920
     aagtgcttgt ttccaagtaa atacccacag taagcgaaaa aatttcataa aaaaacctct     85980
     ctcatgcttt tctctagttt accaaacata actaaagaaa agcataagaa aaggttaaaa     86040
     aagttcattt tggcggttga tattcgtaaa tggtgcttca ttttcaaatt ctaacggctt     86100
     agtttgtagt ttttcaagta agccgcgaac acgatgttgt tctttttgca ataaattatg     86160
     taagatttca cgcgagtagg gaatgttcaa aaccaaatag tgattttcct ctgctgtttt     86220
     tgcaaagtga tttggaaatg cagctaatcg actaatttcg ctggaagtta aaaaaggcat     86280
     atcgacagga agtatcaggt agttagcttc ggggtaagca tttttttgaa ccatgacagc     86340
     gtaaattcca ccaagcggcc cgaaatcttt atatgctggt tggtcgggaa taatttgaat     86400
     agctgagtcc tcatgaaaaa gcgcaattag tttttgataa ttttcttgat ttgcggatac     86460
     gaaaaccatt tcgcaaaatg gcttcaactt attaacagtg agctccaccc atgttttccc     86520
     agtcgcctca ttctggaaaa gggcttttga cttgccaaaa cggctagact tcccaccagc     86580
     taatacaata cccacattaa cttttgcgtt tttcaagtcg accatctctc ataactaaaa     86640
     tttcttccgt catcatttct gcttccgagg cataatgcgt tacaaaaata actggtatat     86700
     ggaaatcttt ggccatctga ccaactaatt tcatacaaat taaacgtgtt tcttcatcta     86760
     gcccattgaa aggttcatca agtaacagta atttcggctc agtaatcatc gctcgtgcca     86820
     tcgcaacccg ttgtttctca ccgccagaaa gtttttgaac agaagaatat agtaggtgcg     86880
     aaatttgcag ataatcactc atttttctta cttgctgctg gatttctgcc tgttcttttt     86940
     tcttcttttt tttcactttt aagccaaacg cgatattttc ataaacattc atatttggaa     87000
     ataaagctag attttggaat aagtaaccga cttttcgttc agttactgga aggtgtaagg     87060
     aaatattcga atcatcccac ggtgtcccat caaactcgat aatcccgccg tcgatgctct     87120
     ttaatccact cacacattgg aataacgttg attttccaga accacttgca cccatcatcg     87180
     cagttactgg tttttcaaac gtataatcaa tatttaaatc atgaaaagga agttttttat     87240
     gaaattgtaa tctcagcata attacatccc cctcgttaaa ttactttggc gtacggtcaa     87300
     aacatgaatg acgagtaacg caaatacgcc gataatgacg ttaattagtc caaggtaaat     87360
     cgcagtacgc atgtcgcctt gttgaaccat aaaatagatg cttgaagcta ttgtatcggt     87420
     ttttccttct atgtatccgg ccaccatcaa acttgcgcca aattcaccca tcgcccggca     87480
     aaaactaagc aaaactcctg ctaaaattgg ttgccagcag ttcggtaaaa taatttttgt     87540
     gaaaatctgt tttttattcg ctgaaagagt ctctgctgcc catacaagtt cgtgatcaat     87600
     cgataaaaat gctgatttaa gcccttgata cataattggt aaaataataa tcgtcgtcgc     87660
     aacgatagca ccactaaggg aaaagataaa actaaaatca aatgtatccc aaagcacacc     87720
     accaataaaa tcattgcggc caagcacatt cagtaatact aaaccgacca cagttggcgg     87780
     taaaacaagc ggaagtaaaa ttaaaatttc cacaagtaac tgaaaacgtg attttcgacc     87840
     agcaaaataa taactcagtg gtaacatcgt cataaatgcg agaaacgtag aaattgtggc     87900
     aacaagtagt gtatgccaaa cagatgtaaa cataaaactc ctcctgaata accctctagt     87960
     acttctatta ttatcgttct ctctggtata aaatgtcaaa cttaagtaca atgtaactaa     88020
     ataaaaaagg gggatgaacg atgaaaaaaa tagcgatact tataagctgc ttattagtac     88080
     tacttgtagg tgcatgcgcg aatacttcag agaaagcaaa aacaacaaca actatacata     88140
     tttcagcagc agcaagctta aaagatacga tggatgacgt aaaaccactt ttcgaaaaag     88200
     catatccatc tattaaatta tcttttgact ttggtggttc tgggcaaatt cgtgaacgcg     88260
     tggaaagtgg tgcgccaatt gatggtgtcc ttttagcaag taaaaaagat gcagatacat     88320
     taagtaatca aaaattagcc gaaaacacga aagaatttgc cgggaatgac cttgtgttaa     88380
     ttgaaccgaa aaatgctgat cagaaggaag gattaagttt agaacaatta ctggataatg     88440
     ccgataaaat tgccattgga gatccggaat ctgtcccagc aggcgcttat gccaagcaaa     88500
     ctcttggaaa tttaaatctt tataatacag aaaaagcaaa actcgttctt gcgacagatg     88560
     ttcgccaagt tttatcatat gtcgaagcgg gaaatgcaga tgcaggcttc gtttaccaaa     88620
     cggatgcgat tttaagtaaa aaagtacaag tgaaagcgaa aattgatgca aaacttcatg     88680
     acccaattgc ctactatagc gcacaagtaa ctgattcaga gaaaaaagaa cctaccacaa     88740
     cattcctcga ctttatgaat aaatcagaag cacaaaaaat acttgaaaaa tacggattta     88800
     aagcagcgga ttaattagaa gtcgctttac tttttaaaac gggaaaactc ctgtatattg     88860
     gtactaaaga aaacgcatac atgatttata gaagggaagt gcgcccagat gattgaaaaa     88920
     agaaacacca taagaatgga gcaagcgaga gaagtattat gtaaccaaat aacgcatctt     88980
     ccagtcgaac gaaaaaacgt cacggaagcg ttaaatcaag ttttacaaga accgattttt     89040
     gcaccgtttc ccgcgccgta ttttagacgt tctggttatg atgggtttgc aattacagaa     89100
     gaagatgacg gtaattatcc gattacttta catgtcgtag cagaggttcc ttgtggtaaa     89160
     acatatgata aaccactaaa acccggcgaa acagtgagga tcatgacagg agcaaaagta     89220
     cctgataacg cctcaaaaat tattatgctc gaacaatcaa gagaagctga aaataaaaat     89280
     gatattgttc ttataaatac gcaaaaatct agtaatatta cggaaatcgg tgccgaattt     89340
     gcgaaaggtg atttgctctt agaccgcggt cacactctaa atgcaggctc gataagttta     89400
     ctatcatcat tcggtatttc ggaagtccaa gtaattagaa agccaaaagt tgctatttta     89460
     tctacaggaa gtgaacttgt acctgctgga aattcgctcc cagatggcaa aatttataat     89520
     agtaatcaac cactacttga aaatcttcta acagtgcacc atgcagaaat ctgcgcggct     89580
     gaacaactac cagataacta tgaagataca aaagcccgtt tacttgagct gacgaaaatt     89640
     gcggacttaa ttgtcactac tggtggcgtt tctgttggag attatgattt tatggcggat     89700
     attgcaaaac aagaggcaga attacttttt aataaaatcc aaatgagacc tggtagtccg     89760
     acaactggaa tgtggttgaa taagacactt attatcgcgc tttcgggtaa ccctggtgca     89820
     tgtttcacag gtttttattt attagtagaa cccgtactcg caacctttat gggaaaagat     89880
     aatacggcaa ctactaaagt ccgagcaaaa atggcgagtg attacacgaa gaataatggc     89940
     tttgaccgat ttttacgagg aacctatcat ctatcagaag aaggagagta tttggttgaa     90000
     ttggtaggaa gtgatatgtc gagtgcgcta ggaaaccttc atttaacaac ctgtttattt     90060
     aaaattccag gcggtaaggt tggaaaatat caaggagaag aggtcgaagc atggctacta     90120
     tcctccaaat aatcggtttt aaaaatagcg gaaaaacaac cttgcttaat gcgctaattc     90180
     gggctagccg caaagaaaat tatacggttt ctgccattaa acacgatgcg catgactttt     90240
     ctgttgatca cgctggaaca gattcgtatt cttttcaaga aagtggcgcg gaagctgttg     90300
     tgattgcgaa ttctagacaa tatgctgtca tggaacaaac tggcattgat ttaaaaaccg     90360
     ccattcaaaa actaccggat tcagatattg ttcttataga aggctataaa gaaggacctt     90420
     ttccaaaaat cattttaatt cgagaaaaag cagaaatcga gattttaaaa aatagtaagg     90480
     ccgttcataa aatcgctacg cacaatccag ctttaaaaga agaggcaatt tttatcggag     90540
     aagaagaagc tttaaacgcg tttgctgaaa cgttaatcaa ggagttttta caatgaaata     90600
     tgtagcttta caacacgaaa aaattgaaat cggaccactt tctgaaaaac taatcaataa     90660
     aaatcacggc ggaattaatc tgtttgtcgg cacaattcgc gaatggactg gcgatattca     90720
     aacagaagaa attcgctaca ctgcttatga agcaatggcg ttaaaagagt taaataaatt     90780
     agccacagaa gtagaaacta agtggggtgc agatgtagtc atcgtccacc gattaggact     90840
     tttagaaata actgatatag cagtgtttat cggcgtatca acaccacacc gggctgcttg     90900
     ttatgaagga tccagatata ttattgaacg tttaaaagaa cgagtaccaa tatggaaaga     90960
     agaaaaagat gtcgatcaaa taaggtgggg tggcatagat gctcacaacg gttaagtttt     91020
     tcgctttttt agctgagaaa acaaagcaaa cagaagtaaa gttaaattta cagcaatgcg     91080
     aaacagttgg tgaagttcgg gaagtcatta gtagtgaatt tcctgaaatc gctgtggatt     91140
     tggcaacgtg tatgttggca gttaatatgg aatttcaaca cgatcaagat attttgccaa     91200
     atgaaataac agaaatcgcg gtaattccac cagttagcgg tggataagga ggatactaga     91260
     tggataaaga cgatttaacc cattttaatg atgaaaaacg tgcgaaaatg gtcgatgtca     91320
     cgagcaaatc agaaacgaaa cgacgtgcaa tcgctagagc taccatacat atgaacgaag     91380
     aaaccttagc gcgtattcat gctggtaaaa ttgctaaagg agacgttttg gctgttgcac     91440
     aagtggctgg catcatggcc gcgaaaaaaa cgagcgaact tatcccgatg tgtcatccaa     91500
     tcatgacaac caaagccgat atttcttttg atgatgatgg aaagacggca ttaacgatca     91560
     catcagaagt agtgactgtt ggaaaaacag gggtagaaat ggaagcactg acagcagtta     91620
     ccattgcagc tttaacaatt tatgatatgt gtaaagcaat ggataaagga atgcaaatag     91680
     aaaaaacata tttagtcgaa aaaacaggtg gaaaaagcgg gacatttaaa gcagaagcgt     91740
     aactattttg taggatagga gttttgtttt atgcaattat taaaggataa atttgggcgg     91800
     gtacacgatt acattaggat ttcagtaaca gatcgatgca atttaaggtg tgtgtattgt     91860
     atgcccgaag aaggcctgac atttttgcct catgaaaaag tactatccaa agatgaaatt     91920
     gtcagtttta tggagttaat ggtgaaattt ggcatcaaaa aagttcgcat cacgggtgga     91980
     gaaccattac ttagaaccga tattgtggaa attgttcgtg gacttggagc aattcctgag     92040
     atagaagata tttcgattac aacgaatgcg atgtatttgg caaaaaaagc agaggccttg     92100
     aaagaagccg gattaacacg tgttaatatt agtttggatt ccttgcatgc agaccgtttc     92160
     caagcaatta cacgtggagg ccgtttgcaa aaagtactcg atggtattca aaaagcggaa     92220
     gaagttgggc tattcccaat taaactaaat gttgttttaa tcaaagggca aaacgacgat     92280
     gaaataacgg atttccttca atttacaaaa gataaagaca ttaatattcg ctttattgaa     92340
     tatatgccga ttggtcatgc gggtacgagt tggaaagaaa agtacttacc tctagatact     92400
     atttttaaag cgtgtgatga tgctagtttc gaatatgagc cagttgattc gattcgcgga     92460
     aatggtcctt ctgaaaactt ccggattaaa ggagcgaaag gaacatttgg tgtaatacat     92520
     ccagttagtg cgcatttttg tgatagctgt aaccgattgc gactcacggc tgatggctat     92580
     attaaagcat gtttatactg ggatgaggaa atgaatattc gtccatttat acatgaacca     92640
     gtaaaattaa tgcaacttgt tcaaaaagca attgataata aaccagaaaa tcatgaaatg     92700
     gcattgaaat tacaagatga agttcaatct aataaaccaa cttggcgacg tatgagccaa     92760
     attggtggat aaataaaacc atccggcccg cgagccggat ggttttattt ttgtcgttcc     92820
     gctattaaat gcggcaattc aggtataatt aatttttccg tagcgagtct cgaagcatta     92880
     cttgaccccg gtaaggcaaa aatcagcaaa ccgctcttcg aaaaacctgc aaaagcacga     92940
     gataccatcg cgcggctacc aacttcctcg taactaagca tccgaaaaat ttctccaaaa     93000
     ccaggaattt cttgctgaat agttgcgaat aaagcttcat aagtaacatc gcgcttagca     93060
     attccagtac cgccatttgt aattaaacaa aaggaaccgt tagctgctaa tttgtccatt     93120
     tcctgtttta tacgaggggc gtcgtcagga acaataactc gtgtaatcac ttggtgtccc     93180
     gcagcctcta acaaagattg aatcagtttg ccgctcgtat cggtttctaa attccttgta     93240
     tcactaatcg tcaaaatact acaagttacc ttaataaacg ttttttgctc cataacttcc     93300
     tcccttaatt aaaaaatagt tggtatattt tctttgcttc cgctaaattt tcagttccat     93360
     gcagtaaaac acgaccattt ttaaaaataa caaattgata tttttcataa ttaaaactta     93420
     gtaaagctgg attttccgta taaagcattt tttgttccgc taatcgttgt tttatttcgc     93480
     ggtagttact tttattttgg aggtgaaact gtacggtatc tcgtccacaa agtgcgatag     93540
     tttgctcaga aaagggaact tctgaaagta ctttttcagg tgagcagcct gtgcagtgag     93600
     ggcgtttttt gacagctagt gattggaaat tcaactgcca attatctatt tgatagtatg     93660
     tatttgcagt gaaatcaggg tttaaaatca tttgtgtaag taacgaaact tgcattcccg     93720
     cgaccatcgg aatgagcgcg ccatcaactc caataatatc gcaacttgca gcatttgttt     93780
     ggggaatatc accaagcaaa cagtgtaaac aagcagaatc aggaggggta atcggcataa     93840
     gattagcata atttcccgca caagaagtaa aaatccaagg aatttgatgg ataaaacaaa     93900
     attggtttaa aaaatcgcga gtcataaaat tatccgtaca atcaagtatg taatcaattt     93960
     tcttagcaaa aggggttaaa cttgtcatat tcgcatcgtc aacaatatat tccacttcaa     94020
     tctcgctatt aattaacaat attgctttct gagctgcata cgcttttgct tgtttctcga     94080
     gcgcatcttg ttccgtataa agtgattgtc gttgtaaatt acttaattcc acataatcgc     94140
     ggtcaattaa aatcaatttc ccaaaaccca tgcgcgcaca aatctcagcc gcgtaggaac     94200
     caattgcccc aacaccaaca atcagaatcg ttttcgaaag caatttctct tgaccgattt     94260
     cacctatatt tgcgactcgc atttgtctat cataacgttc caagttttcc accttctttc     94320
     ctatttatct taccagaaaa tcactgcaag aagctatcta cgaggttccg atttattctt     94380
     gtaattccac ttcacgaact ttataataga aagaaaatta aaacctagag gtgctaacta     94440
     tgaaaaagaa actagacaca accaaatttt accctgctta tccagttttt ctattaactt     94500
     acttaaatga actaggagaa gcgcaaatgt caacgggatc atcatcgtat acacttggag     94560
     atactttagt cattggtata tctgccgaaa gtaacgcgag caactattta aaaccgggag     94620
     agaaattcgc cgtgaatttt ccgaccacta aacagttcga tttaattgaa caaggtggct     94680
     tttcatccgg aaagcgtatc gataaagtaa aagaatacca gattgagcta accaaaagtg     94740
     aaagcggagc actatacata gattcatgcc cgattatttt tgaatgtacg gtaggtcaaa     94800
     cgattagaga tgctgactat catactgttt ttgctaaaat tgacacgcgt ttaatggagg     94860
     aaactttaat tgatacagct ggtaatttcg tacatgatga actagactta gttctttttt     94920
     caggcgatgc ttatgaacgt aaatttcgca agttagatat aaaaatagaa aaagttggcg     94980
     gacatttata aaataaaaac cccacaggat atagattcct gcggggtttt attcatttca     95040
     tccaaataca tccacatcag gtggcaagta agatggattt tctttattaa tatggtcata     95100
     aaacataacg ccattcaaat gatcaatttc atgttgcaca acaattgctg gatagccttt     95160
     aaaacggagc ttaagtggcg taccattttc atcaaaggca tcaattgtca ctcgttcact     95220
     acgtacaaca taaccaggaa cttcacggtc aacggaaagg caaccttctc caccagaaag     95280
     acaagcttgt tgtacagaat ggctacgaat ttttggatta taaagcacat aactataaag     95340
     acgatctttt tcatcgtgta catggatagc taggaaacgt tttgttacag ctagttgtgg     95400
     agccgcaatt ccaacaccac cacgcaaacc gtatttttct gctaactctt catcctgact     95460
     attaattaga aactcgagca tatcgtgccc taattttttt tcttcatctg aaagcgggaa     95520
     agtcacttct gttgcaactt cgcgaagtgc tggatgacct tctcgtacaa tatcgtccat     95580
     tgtaagcatg atttgattct ctcctgttct ttaataacat atccttattt taacaaaaga     95640
     acgaaaaaaa aggaatgaaa tattactttc caagaaaaaa ccgtgttttc ataggactaa     95700
     aggcatattt gttaaaaata gcaaagttta aataacgaac atttataaat aaaatagata     95760
     tattgttcgt ataaatgaaa cggtaaaaaa ttttataagt ttgtgaattc acaaactaac     95820
     aatattttat aaataaaact tcggaatagg tgtgataatg cgagagttgc aatattatat     95880
     aacagtttgc atctgtttta tcttttttta atacagaact ggaaagcgaa tgatttaagt     95940
     tataatgcca ttgtaagcga taaaataatt agagattaac ttattgactt cataatcttg     96000
     gtagtgtaaa ttaagagaga agattagtgt attaataaaa ttcttgtttt tgagtaaaac     96060
     agaattaaca ttttaaataa aaggaaagtt cctgtttttt tatgaaacat tgtgaaggaa     96120
     tgaatgtttt ttcacaaact ctcttaaaac ccatgttttc aatgaggatt ttgtggtaat     96180
     aactggagag gctgcgtaat tagttgatag gaatttagaa aaaagcttcc ggaatctgct     96240
     tctttctata gaataacttt tctttttact acgctattat aattaataca caatcaggat     96300
     ggcagtttta aaagaatcca tttagatggg taaatgaccg gacgagcgtt acataaaacg     96360
     catacctaac taatgaagaa tttgaaactg tacaatgtga atgacgaaag ggtggatacg     96420
     aaatggcttc taaaacaaag aaggctatta tcgacgtaaa gaaacaattt gaggctgttc     96480
     ataaacaatt tgaattagtt caaattctaa atgaaaaagg agaaatcgta aatccagatt     96540
     taatgccgga tttaactgat gacgagttag tagaattaat gactcgcatg gtttggactc     96600
     gtgtacttga ccaacgttct atttcactta accgtcaagg acgtctaggg ttctatgctc     96660
     caactgctgg acaagaagct tcccaacttg caagccacta tgcacttgaa aaacatgatt     96720
     atattcttcc aggttaccgt gatgtgcctc aacttatctg gcacggactt ccacttacaa     96780
     aagcgttcct tttctctcgt ggacactttg taggtaacca attccctgaa gatttaaatg     96840
     tattatcacc acaaatcatc atcggtgcac aaatcgtgca agctgccggt gttgctctag     96900
     gtcttaaaaa acgtaaaaaa gacgctgttg taatcactta tacaggtgac ggtggttctt     96960
     cacaaggtga cttctatgaa ggaatgaact ttgcgggtgc ttaccatgct ccagcaatct     97020
     tcgtagtaca aaacaataaa ttcgcgattt ctacacctcg tgaaaaacaa tcagctgctg     97080
     aaacattagc tcaaaaagca gttgcagccg gaatcccagg cgtacaagta gacggaatgg     97140
     atccacttgc agtatatgct gtaactaaat tcgctcgtga acgtgcagtt gctggtgaag     97200
     gcccaacatt aatcgaaacg atgacttacc gttatggtcc acatacactt tctggtgatg     97260
     atccaactcg ttaccgtaca aaagaacttg acggagaatg ggaacttaaa gatccaatcg     97320
     ttcgcttccg tactttctta gaaggtaaag gcctttggaa cgaagaaaaa gaaaatgctg     97380
     ttatcgatca agctaaagaa gaaatcaaag tagcaattaa agaagcagac gctacaccaa     97440
     aacaaactgt aactgatctt cttaaaaata tgtacgaaac accaactgct cctatcaaag     97500
     agcaactggc aatctatgaa gcgaaggagt cgaaataatc atggcgcaaa aaacaatgat     97560
     tcaagcgatt acagatgcgc ttgcagtaga acttgaaaaa gacgaaaacg tattagtttt     97620
     tggggaagac gttggtaaaa acggcggcgt attccgtgca acagaaggat tacaagaaaa     97680
     atttggcgaa gatcgtgtat tcgatactcc tctagcagaa tctggtatcg gtggtcttgc     97740
     tatcggtctt gcacttgaag gtttccgtcc agttccagaa attcaattct tcggtttcgt     97800
     atttgaagta atggattccg ttgctggtca aatggctcgt atgcgttacc gtacaggcgg     97860
     aactcgtact gctccaatta caattcgcgc accttttggt ggtggagttc atacaccaga     97920
     aatgcacgct gataacttag aaggattaat ggctcaatct cctggtttaa aagtggtaat     97980
     tccttccact ccatacgatg caaaaggtct tttaatctct gcaattcgtg ataacgatcc     98040
     tgttattttc ttagagcata tgaaattata tcgttctttc cgtgaagaag ttccagaagg     98100
     cgaatacaca gtagaaattg gtaaagcagc tgttcgtcgt gaaggtactg atgtttctat     98160
     catcacttac ggtgcaatgg tacaagaatc aatgaaagca gcagaagctc ttgaaaaaga     98220
     tggcgtatct gtagaagtta tcgatttacg tacaattagc ccaattgatg tggaaacaat     98280
     cattgcttcc gttaagaaaa caaaccgtgc tgtagtagtt caagaagcac aaaaacaagc     98340
     aggtattgca gctaatatcg ttgcagaaat taacgaccat gcaatccttt ctctagaagc     98400
     accagttatg cgtgttgctg ctccagatag cgtattcccg ttctctcaag cagaaacagt     98460
     ttggttacca aatcataacg atatcattga acgagtaaaa gaagttattg cattttaatt     98520
     cataatgacc gttttaaaac ttatggggag ttttagaagg ggaaagaaat atttttatac     98580
     taaggttcag tttatctgaa ccttagaaat tacaggaggc ttaataaaat ggcatattca     98640
     tttaaattac cggatatcgg tgaaggtatc catgaaggtg aaatcgttaa atggtttgta     98700
     caaccaggcg ataagattga agaagatgaa tccctatttg aagtacaaaa cgacaaatca     98760
     gtggaagaaa tcacttctcc agtttcagga acaattaaag aaatcaaagt tgctgaaggt     98820
     acagttgcta cagttggaca agtactagta acatttgatg gcgtagaagg tcacgaagac     98880
     gacgccgaag aagaaagcgc agcaccaaaa gcagaatcca cagaatcaac tccagcaccc     98940
     gcacaagcta gcggaaaagg aatttttgaa ttcaaattac cagatattgg tgaaggaatt     99000
     catgaaggcg aaattgttaa atggtttatt caaccgggcg ataaagtaga agaagatcag     99060
     tccatttttg aagtacaaaa cgacaaatct gtcgaagaaa ttacttctcc agtagatgga     99120
     actgttaaag atattttagt tagtgaaggt acagtagcga cagttggtca agtattagta     99180
     acatttgaag gcgattttga aggagaagct agtcatgaat ctactccaga atccccagca     99240
     gaagaagctg aacttacaaa caacgatgca acttccgctc cagctacagg tggaaacgga     99300
     actccatcat ctaaaaaaga tcctaatggc cttgtaattg caatgccttc tgtacgtaaa     99360
     tatgctcgtg aaaaagacgt taatatcgct gaagtagcag gctctggaaa aaataaccgc     99420
     gtagttaaag ctgatatcga tgctttccta aacggcgaac aaccagctgc agcaacaact     99480
     actgctcaaa cagaagaaaa agcagcagca ccaaaagcag aaaaagcagc agcaaaacaa     99540
     ccagttgcaa gctccgatgc ttacccagaa acacgcgaaa aattaacacc aactcgtcgt     99600
     gcgattgcaa aagcaatggt aaactcaaaa catacagcac cacacgttac tttaatggac     99660
     gaaatcgaag taactgcact tatggctcac cgcaaacgtt tcaaagaagt agctgccgaa     99720
     aaaggtatca aacttacttt cttaccttat atggtgaaag ctcttgttgc aacgcttcgt     99780
     gacttcccag tgcttaacac aactttagat gatgcgacag aagaacttgt ttacaaacat     99840
     tacttcaacg ttggtatcgc agcagataca gaccacggtt tatacgtgcc agtaattaaa     99900
     aatgctgata aaaaatccgt attccaaatt tctgatgaaa tcaacgaact agctggaaaa     99960
     gcacgtgatg gtaaattaac agctgacgaa atgcgccacg gttccgcaac tatttctaat    100020
     atcggttctg ccggcggaca atggttcact ccagtaatta attacccaga agttgctatc    100080
     ctaggtgttg gtcgtattgc tcaaaaacct atcgtaaaag atggcgaaat tgtagcagca    100140
     ccagtactag cgctttcctt gagctttgac caccgtgtaa ttgacggcgc gactgctcaa    100200
     aaagcaatga acaatattaa acgtttatta aacgacccag aattattact aatggaggtg    100260
     taacaaaatg gtagtaggcg attttccaga agaaagagac accatagtca tcggtgcagg    100320
     cccaggtggg tatgtagccg caatccgagc tgcacaactc ggacaaaaag ttaccattat    100380
     tgaaaaagaa tattacggtg gtgtgtgctt aaacgttgga tgtattcctt ctaaagcact    100440
     tatcacaatc ggtcaccgtt ttaaagaagc tggacactct gataacatgg gtattacagc    100500
     ggacaacgtg aacttagatt tcacaaaagc acaagaatgg aaaggcggcg tagttaacaa    100560
     gcttacatca ggtgttaaag gccttcttaa gaaaaataaa gttgaaatgt tagaaggaga    100620
     agcgttcttc gtggatgatc attccctgcg tgtgatccac cctgactccg ctcaaactta    100680
     tacattcaat aacgttatca ttgcaacagg atctcgtcca atcgaaatcc caggtttcaa    100740
     atatggtaaa cgtgtattaa gctcgactgg tgcacttgca ttaactgaag ttccgaaaaa    100800
     attagtcgta attggcggcg gatatatcgg aacagaacta ggtggagcat tcgctaacct    100860
     tggtacagaa ctaactatcc ttgaaggcgg tccagaaatc ttaccaacat acgaaaaaga    100920
     catggtttcc ctagttaaac gtaatctgaa aagcaaaaac gttgaaatgg ttactaaagc    100980
     acttgcaaaa tctgctgaag aaactgaaaa cggcgttaaa gtaacttatg aagctaacgg    101040
     tgaaacaaaa actatcgaag ctgattatgt tttagtaaca gtaggtcgtc gtccaaatac    101100
     agacgaaatc ggtttagaac aagctggcgt taaagtaaca gaacgcggtt tagtagaagt    101160
     tgacaaacaa ggtcgctcta acgtttctaa cattttcgcc attggtgaca tcgttcctgg    101220
     tgttcctcta gctcacaaag ctagctatga agcaaaaatc gctgctgaag caattgctgg    101280
     cgaaaaagca gaaaacgatt atacagcact tccagctgtt gttttcagtg acccagaact    101340
     tgcaacagtt ggtttaacag aaaaagaagc aaaagaaaaa ggctttgatg taaaagctgc    101400
     taaattccca ttcggcggta acggtcgtgc gctttcttta gatgcacctg aaggatttgt    101460
     tcgtctagtt actcgtaaag aagatggcct agttatcggt gcacaagttg ccggaatgaa    101520
     cgcttctgat attatttcag aaatcggctt agcaatcgaa tcaggtatta cagctgaaga    101580
     catcgcgctt actatccacg ctcatccatc ccttggagag cttacaatgg aagcagctga    101640
     acttgcttta ggtcgtccaa ttcacatgta atcaacttaa agcggaagta tcctttacgg    101700
     gtatttccgc tttttatcta tataaataag tgcgtgattt cacaaaaact cttttagttc    101760
     attttttgaa atatttaaag tatccgtttt agaaaaaaag gagtataatg taacaagtga    101820
     acgtaacaag tcaaatctaa ttgaatcagg tgaaaaaatg gagaaacaaa cagcaacttg    101880
     gaagaaagct ctattttggt ttgcgtatgt agtagcagga atttgttttt tattaacgat    101940
     tgtggccttt attgtaggat ttattcatca catgcatgat acaggtggat ggcgttccgt    102000
     tattcaaatt ctcgaaaccc caattacggg ctttgtaaaa atgactggtg gctacatcgg    102060
     taaaggaatc ttagaagtaa ttattcttat tatcgttagc tatgtattac caatcttctt    102120
     ctgttttgca acgcattatt taaaagtaaa acgacgtgaa atggcttaaa ataagattat    102180
     tttgtaaaaa gcaaagcgaa tgagcattgc tttttattta tgcggtcaag ttattttatt    102240
     tttgccgtag aagcatgcta aaataacaat aagagacttg atgaggagga gacccatatg    102300
     ccatctaaga agaaaaagat tgtcgttatc ggcagaagta atctacaaaa tctctacatt    102360
     catacaattc ttttaaaaaa actacccgct gagatttact taatagatga acaagctaaa    102420
     acaagtgtgc aagactttga atatgcgagc tactatcatt cttcagcaac cgttaacaca    102480
     ggaaccttta atgaatgtcg aagtgcggat ctcgtccttt tttttcaaga agaaatgtca    102540
     aatgagtctt tctcaaatga agataattta gcattaatca aagaaaaagt gaagaagatg    102600
     atggcgactg gttttcaagg aatagtgtta gtggcgactg ccgaaagtaa tattgttgct    102660
     tccttaatta aacatttttc tggcttacca gcaaatcaaa ttattacacc tggcaccatg    102720
     ctagcaactt cttattttca agtagaaatt gctaaactat ttaaaatcag tcctaaaaac    102780
     gtgcatggct atattattgg agagagtact caggatgtca ttcccgtttg gagtcgagcc    102840
     ttccttggtg gcaaaccgat tttaagttat ttagccgaag aacaaaaaag aatcacatcg    102900
     gatgatttac aaaatttaac aaacatgatt acaaaaattc ctgattttcc tgttgaaact    102960
     aaagatggct gtagtttccg ctttagtact gtaactgtgc tcgctgaatt aacagaagtc    103020
     attttacgag atgaagcaag ggtgcttaca gtaggcgtag aagtgaagga agcatatggt    103080
     ttagaaagac cagttttcgt tagcgtacca gctgttgtgg gcgctgaggg agtcagagaa    103140
     ttactggagt taaatctatc cgatgacgaa caaaaagaat taaagcgaat tacaacaaaa    103200
     actaccgaga aattggggtt actgcataat aagggaggaa ttagttaatg gaatatagtt    103260
     atccactaaa tccagactgg acaaccgaag aaatgacgat tgttgtacaa tttttagaag    103320
     ctatcgaacg agcatatgaa aaaggtattg atacacttga actcaaagaa aaataccgag    103380
     catttaaaca agtagtacct gcaaaaggag aagaaaaacg gattggcata gactttgaaa    103440
     aagcaagtgg atattcagcc tataaagtca tgcaactcgt aaaaaacgca acaacaagca    103500
     aaataaaaat gcaaccataa ttaagaggag gaaatttttc atggatatta gtcaaattaa    103560
     agcagaagta gtaacaccag aaacaggaat acacgtaggt gaaaagggag ctccagttaa    103620
     agtaatgtca ttcattaacc tacgttgccc attttgtcgt gagtggaatg aaaaatctaa    103680
     agacgtctta actgaatata ttcaagcagg aaaaatcgaa ttaatcatta aaccatttga    103740
     taaagaaaaa gaatctttac aacgcggaaa tgtagcgcat cgttacttag attattctaa    103800
     accagaagaa acgcgtgaaa ccatcaataa aatctatagc acccaagatg aatggggtag    103860
     cctaagtctt tcagaagtag ctgattatat ggagtctaca ctaggcctaa cagagcaaga    103920
     caacaaagct gcatctgaaa aaataatcgc tgaagcaaac gcagcaaatg ttgtttttgt    103980
     accgactgta attgttggtg aacatatttt tgatgaacac attagccctg aagagttacg    104040
     cgacttactt gacggcgaat tagctaaata aaaaaacgaa tgtattgcct atcaatttag    104100
     gcgatacatt cgttttttat tttaaaagaa tttcctccgc cagaatacaa tcgcaagcgc    104160
     tccggcaatc ccaaaagcaa aaccaagcgt taatatccaa gctaaaggtg tttccataaa    104220
     cggtaatttc acgttcattc cataaaaact aaaaaccatc gtcggaatcg tcaaaatgat    104280
     agtaaaagaa gtgagaaatt tcatcacgat attcatattg ttggagataa ttgaagcata    104340
     agcatccatc atcccactta aaatattcga gtgaacttcc gccatttcga ttccctgacg    104400
     attttcaata ataacatctt ctagtaagtc ttgatcttcc tcgtacattt taacgatatt    104460
     ttgacgcatc attttatcga gtacgacttt attcgattta agggctgtta caaagtaaac    104520
     taaacttttt tcaattccca ttaaatcata aagctgttta tttttcatgg attcatgtag    104580
     ttctttttcg atttcatctg tttggcggtt caagcgtttt aagtgacgca ggaacgtagt    104640
     tgaaatcata tatagaattt gtaaggcaaa tcgtgttttc atgtgcgtat aaaagccttt    104700
     aatacggttt ctaataaatg attgtacaat agaagaatca atcgtacaaa tcgtaataaa    104760
     gtagtccttt gtaataataa tccccatcgg aatcgtttca aatgaagcgt aatgaatatc    104820
     atcttcatca actactggaa agtcacagac gattaaaacg gaatctgaat catcatcgcg    104880
     ttcaatacga gcactttcat ctttatctag tggatcttct aagaactcca aagggatttc    104940
     atagttatcg gcaattttat taatttcttc tgaagtaggg gcaacgatat taatccaaca    105000
     gttgcgtgtc acttcttcta attcaattaa tttgccgttt tcatctgatt tgaaaatttg    105060
     atgcatgctt tttacctcct tttttaacag gtaaatttca cgcggttaga gtatcgttcc    105120
     cgtgaaaaat cacctgtatg aatacttcga tgtggaccag ggtcacttgc tgtttgctgc    105180
     tcctttttca cgttcctcaa ctccttcaaa ccatagtaat tcacaactct accattatac    105240
     ctagattata gtcatttgta catcttttat tgaagagcag ccttataaag cggaataagc    105300
     tcatcaagta ccatttcagc ctctttgatg aagtcttttc caggggataa atggttatcg    105360
     tcaggtagat aaatttttcc aaccaaaaat tcaccttttt ttacatcacg gaaacgttta    105420
     agcgttgcgt caagttgacc gccgtgcacc gggtaagttt tctcttccgt atggtctggc    105480
     gaaatcgcaa atgtatcagg taattcagca agtagtttct tttctttcaa aaagcgattg    105540
     gcgatttttg tgctttcttc attttcataa ataaaagcga gccagatgaa caaataatta    105600
     tcaaaaagtc ctacttgaaa atgagggtgc tttttataac cgcgtttatc gtggcaaatc    105660
     gcaagccatg tgctttcagg tgggttaacc gaacgtcttt ggtgacgagc aatatgtaaa    105720
     aacatttcat cgccaagttt ggcacttaaa taagtagtta attcttcccc aactgcttta    105780
     aatttcggct gaatatcatt ttgaattcca gccatacgtg cgtccagacc aggaatttgc    105840
     attgttttaa aatctttctt actaaatcct ttaaaagtca tctgttttcc tcctaatttt    105900
     gcatatagtt tcattatacg gaagttaagt tctaagtgaa agaatcttgt tctattcaga    105960
     taattcattt ttgtgataaa ataaacaaaa cgagtctaaa agaggtgtta gcatggacag    106020
     cgaaaaaata gattatttag caaggttatg gattatggaa gcagcagcaa aaatcaaaca    106080
     atcttttaaa gaaacattag acattgatat aaagtctggc cgaaatgatt tagtgacaaa    106140
     catggataaa gaaacagaag ctttttttgt caaacaaatc aaagaccatt ttccaaacca    106200
     tcgcttattt ggagaagaag gtatgtcaga tgatgtgacc gatttaaatg gaattgtttg    106260
     gattcttgat ccaatcgacg gcacacttaa ttttgtggag caacaacgag attttgccat    106320
     ttcacttgca atttatcaag atggagtagg gcacttggct tatatttatg atgttactcg    106380
     tgatgaacta tacttcgcgg aaaaaggaaa aggcgcaaca gtaaatggca aacaaattcc    106440
     taaaatcgat aaagacatgg atttgcaaga tgcactacta attgccaatc taagtgtgac    106500
     aagaaaattt ccaactatgt gggaagccgt aaaagtctca agagggctac gacttcacgg    106560
     agcagcttca cttgaatata tggacgttgc aaccgggcga gcaggggcat atctttcggc    106620
     taatttagct ccgtgggata ttgctgctgg aaaaattatc gtggaagaat tagggggaat    106680
     tgtcacccga attgacggct caaaaatcaa tatgctggaa aaaggaagtt ccatcgttgc    106740
     aacaccaaaa attcatcaaa ccctattaga caactacctg ccttaaagaa agcgctcaac    106800
     ataaaaaaac tcattttcag aaaataaaaa tagtgctaaa tccgcttagc tatgctataa    106860
     taggtaagtt gatttaaacg agacgatagc gacggaggaa aataaatcta ttttcctctt    106920
     tcttttggct aatcttcacg ataaatgttt ggatttttaa tttaggagga aacaagattg    106980
     aatttaagaa acgatattcg taatgtagca attattgccc acgttgacca tggtaaaact    107040
     acactagtag accaattact acgccaatca ggtactttcc gcgacaatga aacagttgca    107100
     gaacgtgcaa tggacaacaa tgatttagaa agagaacgcg gtattacaat tttagcgaaa    107160
     aatacagcaa ttaagtatga agatacacgc gtaaacatca tggatacacc tggacacgcc    107220
     gattttggtg gagaagtaga acgtatcatg aaaatggttg atggtgttct tttagtagtg    107280
     gacgcgtatg aaggtactat gcctcaaaca cgttttgtac taaaaaaagc actagaacaa    107340
     aacctaactc caatcgtagt agtaaacaaa attgaccgtg actttgctcg cccagaagaa    107400
     gttgttgatg aagtactaga attattcatc gaactaggtg cgaacgacga tcaattagaa    107460
     ttcccagttg tttatgcttc tgcaattaac ggaacttcaa gctttgaatc cgacccagca    107520
     gaacaaaaag aaacaatgaa accactttta gacactatta ttgaacatat tccagctcca    107580
     gttgataaca gcgacgagcc attacaattc caagtttctt tacttgatta taatgactat    107640
     gttggtcgta ttggtattgg ccgcgttttc cgtggaacaa tgcacgtagg acaaacagtt    107700
     gccttaatta aactagacgg cacagtaaaa caattccgtg taacgaaaat gttcggtttc    107760
     ttcggactaa aacgtgacga aattaaagaa gcaaaagcgg gtgacttagt agcacttgca    107820
     ggaatggaag acatcttcgt cggtgaaaca gtaacaccat ttgaccacca agaagcactt    107880
     ccacttttac gtattgatga gccaaccttg caaatgactt ttgtaacaaa taacagtcct    107940
     ttcgcaggcc gtgaaggtaa acacgtaaca agccgtaaaa ttgaagaacg cttacttgca    108000
     gaacttcaaa cggatgtatc tttacgcgtt gaaccaacag cttctccaga cgcatgggta    108060
     gtatctggtc gtggtgagct tcacttgtct atcttaattg aaacgatgcg tcgtgaaggt    108120
     tatgagttac aagtttctaa accagaagta atcatccgtg aaatcgatgg cgtgaaatgt    108180
     gaaccagtag aagacgttca aattgatact ccagaagaat tcatgggttc agttattgaa    108240
     tctatcagcc aacgtaaagg cgaaatgaaa aacatgatta acgacggcaa tggccaagtt    108300
     cgtttacaat tcatggttcc agctcgtgga ttaatcggtt atacaactga tttcctttca    108360
     atgacacgtg gttatggtat tatcaaccat acattcgata gctaccaacc aatccaaaaa    108420
     ggtcgcgttg gtggacgtag ccgtggtgtt cttgtatcca tggaaacagg taaatctact    108480
     acttacggaa caatgcaagt agaagatcgt ggtactattt ttgtagaacc aggaactgat    108540
     atttacgaag gtatgatcgt tggagaaaac aaccgtgaag gcgatatcgc tgtaaacatt    108600
     gtaaaagcaa aacaaatgac taacattcgt tctgctaaca aagaccaaac caacgttatc    108660
     aaaaaacctc gtcacttatc attagaagaa tcattagaat tcctaaacga agatgaatac    108720
     tgtgaagtta caccagaatc catccgttta cgtaaaaaaa ttctaaacaa aaacgaacgt    108780
     gaaaaagcag caaaacgttc aaaaactgct gaataattaa tttaaaaata agccaaatag    108840
     tttttttaga gatattagta tcttttaaaa atttatttgg ctttttttat gcattaatag    108900
     gaggaaaaca gggaataaaa taatgtcttt gtaacactat tgtaatatga atagctattt    108960
     ggtatattat aagtaagtag aaaaggtggt tattattatg aaaaaacgga taattattct    109020
     tgcagtatta gtggtacttc ttatcggtgg cgttgtaatt ggagtttatg caaatggaaa    109080
     caccgcaaaa gataatgaag ataaaaaaac aacagcaaaa aaagccacat ctacaccaaa    109140
     agatacaaac aaaacagttg atactgagaa aaaagataca gtaaaagact ctgtaacaga    109200
     tgataaaggt gtagtaacta aaggtagctc agatattgaa aaaaatgcac cgacaaaaag    109260
     cagtggtaat tcaacagaat caaataaaaa cactccttca acaccagcgt tttctctatc    109320
     taccagtgga tttaaaacat ctaatgtagc atctgtactt ggcggaacag tgacaacaac    109380
     ttatttgtcc agtagtccgt catttcaaaa aatctttcaa aatttaacca ttgatgttaa    109440
     ccagtacaaa gtagaacatg ttgttggagc aaacaaatca gtaagtgcga gcaatccaga    109500
     aagttattta gcaaataaaa atggttacgt tattacatta gatatttcta tcaaaaacac    109560
     atcttcgaaa gataaaatgt ataaagccga tcaaattacc cttgtaggag caaatgaatt    109620
     tgtaggagga agtttagata actttgtacc ttctaatttc catcttatcg gaagtaaatc    109680
     tgatcccaat aacttcgcag ccggtaaaac agcgcgtggt ctattaactt tcacaatgac    109740
     tgaagctgtc tataatgatc tagcagctga ctcgaaactc ggtgtaccaa accctgataa    109800
     atttgattca actgtttcag aagcaaaagc tggcgacgac gttgttgttt cctttccagt    109860
     aaaatagaaa aaaaccgccc agttaattgg gcggtttttt tatttctccg tactttctat    109920
     taaattcttt aactcactat tcgacattac aactggttta tggaaattaa aatgaccaga    109980
     attcacgcga ctgatagttt taatagctac acgatgttca cattcaggac ataaatacat    110040
     tctaattggt ttattacgta attgctttgt tttaaattca cgattgtcta gttcgtctac    110100
     acgctcgcat aagatacatt ttgcattcaa tttatcttca cctcacacaa gtattatagc    110160
     acgattatcg aaaaaggcga gtaaaagcgg atttttcaaa aaattttagc ctattcttgc    110220
     ttgcgtggct tttaatttgt gatatactag acttatctag tattaaattt tacttaaggg    110280
     ttctcttaag atgaaaataa agcgcttatt atagcggatg atagggggtt ctgtgatggc    110340
     aaataaaaag atagatcaca gagaagaggc aattgagctt ttaaaacaag acgcaaaacg    110400
     aatcttacag ttgattaaag ttcaaatgga taatttaaca ttaccgcaat gtccagcata    110460
     tgaagaagtt cttgatacac agatgtatgg cttatcccgt gaaattaatt ttgcaacccg    110520
     cctaggacta attgaaccgg aagaaggaaa aaaattaatt tccacactgg agaaagaatt    110580
     atccgcgcta catgaacttt ccatgagcaa aaaataatga tttaattgaa aagatgtctg    110640
     attctttctg acatcttttt ttgtttggca ggaaaaatga gccaaaagaa ggaggcaatt    110700
     cttcttttca tttgaaggct ttttccttta taatagaaag aatagaatac aagatgggat    110760
     agtaacttct cagggattgg aagatgccaa tgttaaaacg aattttaaaa tcatatgatt    110820
     atgcatttat tgctgttttt atagtgcttt gtttatttgg aattataatg atttatagtg    110880
     caagctggtc tctagctatt ggtaaagatt tacctgctga ctactattat gcacgccaag    110940
     taaaaaactt tataattagt tttattttct ttgttctttt tgcgcttatc ccttttaagt    111000
     tttatcaaaa caataaagtt cttatgttaa ttgtatttgg ctcaatcggt gttttgttac    111060
     tgattttctt agttgggaag acggtgaata atgcgaatag ttggctagta gttggaccac    111120
     gttcacttca acccggggaa tttgcaaaat tagctgtcat tatttatatg tctgcaattt    111180
     atgcgaaaaa gcaaagttac attgatgact ttaaccgcgg tgttttgcca ccaatattct    111240
     tccttgcttt tgtttgtttc ttgattgcga ttcaaccgga tacaggtact gcgtttatta    111300
     ttttccttgt tggttgttgt attattattg cttctgggat gagacttcga acaattatga    111360
     aactaattgg aattggagtc ggggtcattg tcgcccttac actaattttg ttcgctttac    111420
     cagataaagt cagaacggaa atcgtatcac caacaaaagt agcgcggatt acgaccttta    111480
     tgaatccgtt tgaatacgca gataaagaag gacatcaact aattaattcc ttttatgcaa    111540
     taggttcagg tggtgtttct gggcaaggtc tcggcgaaag tgttcagaag ctaggctatt    111600
     tacctgaagc gcataccgat tttattattg ctgtagttgc agaagaatta ggtgtgtttg    111660
     gcgtaatgtt cattatttta gcgctgtttt tcattatttt taaaacgatt tctaccggac    111720
     tcagggcgaa agatcctttt gcttcattaa tgtgctacgg gattgcaagt ttgattgcta    111780
     ttcaagcatt tattaattta ggcggtgcaa gtggacttat cccgctaact ggggtaacac    111840
     ttccatttat cagttacggt ggttcttcat taatggttct ttccatgatg cttggaattg    111900
     tagcaaatat ttcgatgttt aataaatatc accgtttgta tagtgcagat ggttctaaaa    111960
     aagaagttcc caaaaagcaa aaaagacgat agatttcaaa agaaaaagtc atttaattgg    112020
     ctttttcttt tttcgtttta ccgattgttt ttggcggttt atagccagtt tattcgtgtt    112080
     ttcgatattg ttttaaatat ttagaaagaa aataatttac atctgatggc atttaatact    112140
     ataattgaag ttatataccg ttttacagcc taaaaaaggg agagcttaaa agtatacata    112200
     atcatttcgt ccatttaggc atcgtatcaa gtatagaaca gatcagtgtt ggttaggagg    112260
     aaaaaaatga atcgaataaa aaaagtatta gtagcaaacc gtggagaaat tgctatccgc    112320
     gttatgcgtg catgtactga actcaaaatc aaaacagtgg ctatttattc acaagaagat    112380
     actggtagtt ttcaccggta taaatcagat gaagcctatc tggttggagc agggaaaaag    112440
     cctattgatg cgtatctaga tatcgaaaac atcattgaaa ttgctaaaga atctggtgca    112500
     gacgcgattc atccgggata tggtttcttg tccgaaaaca ttgaatttgc tcgtcgttgt    112560
     gagcaagaag gcattatttt cgttggtcct aaatcaaaac acctagatat gtttggcgac    112620
     aaaattaaag caaaagaaca agctttatta gctgatattc cagtaattcc aggcagtgat    112680
     ggtccggtag ctggtattaa agaagtagaa gaattcggtg aaaagaacgg ctatccttta    112740
     atgattaaag cttcccttgg aggcggcggt cgtggtatgc gtgtcgtaga atcaaaagaa    112800
     catgtgaaag aaagttttga acgtgcgtct tctgaagcaa aagccgcttt cggaaacgat    112860
     gaagtatacg tagaaaaatg tgttatgaat ccaaaacata ttgaagtaca aattcttggt    112920
     gacactcacg gtaatatcgt tcatttattt gagcgtgatt gttctattca acgccgtcac    112980
     caaaaagtag tggaagttgc tccgtgtaat gcgattactt ctgaacttcg taaccgtatt    113040
     tgtgatgcag cagttaaatt aatgaaaaac gttgattata tcaatgcggg aacagtagaa    113100
     tttttagttg aaggcgataa tttttacttt attgaagtaa atcctcgtgt gcaagtagag    113160
     catacaatta ctgaaatgat tacagggatt gatattgttc aatctcaact attcattgca    113220
     gatggttatg cgcttcacga tcagctagtg gctattccta aacaagaaga catccatatt    113280
     cacggctctg caattcaaag ccgtattact actgaagatc cacttaataa ctttatgcca    113340
     gatactggtc gagtagacac ataccgttct acaggtggtt ttggtgttcg tttagatgct    113400
     ggtaatggtt tccaaggaac agtagtaaca ccgttttatg attctttact tgtaaaatta    113460
     tgtacttggg gcatgacatt tgagcaagca acgcgcaaaa tgcgtcggaa cttaattgaa    113520
     ttccgtatcc gcggtgtgaa aacaaacatt cctttcttat taaatgttgt tcgtcatccg    113580
     gattttgcaa gtggtaatta taatacaagc tttatcgata ctacgcctga actatttaaa    113640
     ttcccacata ttcgcgaccg tggtacgaaa acgttgcgct atattggtaa tgtaacagta    113700
     aatggcttcc caggaattaa gcaccgtgac aaacctgtat acgcagagcc acgtttgcct    113760
     aaaattcctt atggttcgca aatcgcaccg ggaactaaac aaattttgga tgcaaaagga    113820
     ccagaaggcg ttgtagactg ggtgaaaaaa caagaagaag tgcttttaac agacactaca    113880
     cttcgggatg cgcaccaatc tttacttgcg acacgtgttc gctcgaaaga cattttccaa    113940
     atagcagatg cgatggctca tttattacca aatatgttct catttgaaat gtggggcggg    114000
     gcaacttttg atgtagctta tcgcttccta aatgaagatc cttgggtgcg cctggaaaca    114060
     cttagaaaac aaattccaaa tgtaatgttc caaatgctac ttcgcggagc caatgctgtt    114120
     ggatacaaaa actatccaga caatgttatt cgcgaattcg ttaagcaatc agcgcaatcc    114180
     ggtgtcgatg tattccgggt gtttgatagc ttaaactgga tcaaaggtat ggaagtgtca    114240
     attgatgctg ttcgtgaagc agggaaggtc gtagaggcta ctatctgcta tacaggagac    114300
     attgatgatg acacaagaac gaaatacacg attgactact ataaagatat ggcgaaagag    114360
     ctcgttgctc aaggtacgca tattttagga attaaagata tggctggact tttaaaacca    114420
     caagcggctt accgtttaat tggtgaatta aaagatacag tagatgttcc aatccacctt    114480
     catacgcatg acacaagcgg taacggtatt tatacgtatg cagcggcagt cagtgcaggt    114540
     gttgacattg ttgacgtagc atcaagtgcg atgagtggag cgacaagcca accaagtatg    114600
     actggtcttt attacggatt agttaatggt aatcgtcaaa ccaacctaga cgcacaaaac    114660
     tcccaaatta ttaatcatta ctgggaagat gttcgtcatt attataaaga ctttgacaac    114720
     gcacttaact cgcctcaaac agaagtatat atccatgaaa tgccaggtgg tcaatatacc    114780
     aaccttcaac aacaagcaat tgctgttgga cttggcgatc gttgggatga agtaaaagaa    114840
     atgtacactg ttgtaaacca aatgtttgga gacatcgtta aagttacacc atcttctaaa    114900
     gttgttggag acttggctct atttatggtt caaaacgaac ttacagaaga agatgtctac    114960
     gaaaaaggcg atactatcga cttcccagat tccgttatcg aattctttat gggcgaaatt    115020
     ggccaaccat atggcggttt cccagaaaaa cttcaaaaat tagtactcaa aggacgcacg    115080
     ccacttgcag atcgtccagg agctcttatg gagccagtta actttgcaga ggtcaaagct    115140
     gaactaaaag agaaaatggg ctatgaacca tctgaaaaag atgtcatttc ctatatctta    115200
     tatccaaaag tattcctaga ttatcaagag atgattagta aatatggtga tgtaacagtc    115260
     cttgatacac caacatttta caaaggtatg cgcttaggtg aaacgattga agtagaactt    115320
     gaaaaaggaa aaattctcct aatcaagctt aattcgatcg gtgaaccaat tgcggatgga    115380
     acacgtgtca tttatttcga actaaatggt caaccacgtg aaatcaacat ccaagatatg    115440
     aatgttcaat caacagttat tgcccgccgt aaaattgata caacaaaccc agaacatgtt    115500
     ggagctacaa tgacaggttc cgttattcaa gttgttgtga aaaaaggcga ctctgtgaaa    115560
     aaaggtgatc cattattaat cacagaagca atgaaaatgg aaacaaccat tcaagcgcca    115620
     ttcgatggag aagttagcag catttatgtt tctgacggcg acactatcga atctggtgat    115680
     ctattaattg aagtaaacag aaaataaaaa aacataaacg attaacgggt gggaatataa    115740
     cgctaattta aagtagcaaa ctttaaatat cgatatttta aacgtagtaa acagacgttt    115800
     tttcgaatca atagcgctat atttcgcacc cgttttttct gaaaaaggag aacttacata    115860
     tgaaatggtt taaaggaatt gccgtagcat tattacttgt gattttaact gcatgcggga    115920
     atactgaaac aaaagcgcca acagaaaaaa caaagaaaat tgaagtgaaa gatgcaacag    115980
     agcaaaaaat cactttaaaa gaagcaccaa caaaaattgt ttcattaata ccgagtaaca    116040
     ctgaaatttt atttgcgctc gatttgggag ataaagtaaa aggtgtttcg gcttacgatg    116100
     actatcctaa agaagctcaa aaaatcgaaa aagtcacttc aactactgta gacactgaaa    116160
     aaattatcgc acttaaacca gatttagtac ttggtcatga gtctatgctt gccactgaaa    116220
     aagacgctta tcaattactc aaagatgcag gaattaatgt gtttgtcgtg ccagatgcaa    116280
     ctaatttaaa agaagtcgaa aattccattg aaacaattgg taaattaact ggaaaagagc    116340
     aaaaagcaaa agacgtaact gcctcgatgg agaaacaaaa agccgcagtt gaaaagaaag    116400
     tcaaagagct gaaaacatct ccaaaagtgt ggattgaaat tagcccagac ttatatacag    116460
     caggcaaagg aacgtttatg aatgaaatgc ttgaacttgc tggtggtaca aatatcgtta    116520
     ccgaaactgg ttttattcca tacaatgaag aaaaagttgt agaattaaaa ccggatatta    116580
     ttttatccgt ttatccagat gcaaaagcaa ctattttaaa acgcgctgca tggaaagacc    116640
     ttccagctgt taaaaatgaa cagatttttg aaatggatgc gaataaatta agtcgtccag    116700
     gtccaagatt attagaaggt gcagcagata ttcaagcagt ttttgaaaac taattctttg    116760
     ataatgacag atgaagcttt acaaaaaacg acttttaagg taatttaaca tagggtggat    116820
     tttttgctaa agcttattag taaagtgatt cacctaataa agaaagcaat ttacacttag    116880
     aagatcatgc ataaacagca agaatacggc aacttagacg acaaataata caaacaaggt    116940
     gtacttggtt ttaagtggag gagttgccta taagtaaata gtgagctgaa tctggttttt    117000
     aaaaccatat tatttttcgg gaagaagtgt ttttgtgaaa caagttatgg aagttattaa    117060
     agaacaaatt aaaaatttac caatgatatt tcgcattgcg cgctatgaag ataaggctac    117120
     atatcaaagt cattatctag ggctagcttg gcagatttta aacccattaa tccaaattgc    117180
     tatttattat ttcgtgtttg gattcggtat gaatgcaaaa tctggttctg atgcaagtta    117240
     tattgaatgg atgctggctg ggattattcc ttggttcttt attagtgcgg ttattttaca    117300
     aggtgcgaat agtatttata ataaaatagg tatggtttca aaaatgaatt tcccaatgag    117360
     tattttaccg aatataacga ttgtttctaa tttaactagc tactttacga tgatggtaat    117420
     tttgcttgga ttacttgcct taaatggaac tcctgttacg atttattggg gccaatattt    117480
     gtattatttt gtagcaatga ttgctttttt atttagtgtt acattattta atgcaactat    117540
     tagtgtttta gttagagatt attatattat gttgcaatcc gttatgcgtg tacttttcta    117600
     tgtaacgggg attgtttgga atttagaaac tatgttgcca caatggttag ttcatttatt    117660
     aaaattaaat ccaatatact atgtggttaa tggttttagg gaaacattct taatgaatag    117720
     aggtttttgg gaatctccgt cctacacgat gtatttctgg ttgattacac taacactatt    117780
     atttgttgga gcgacactgc acatgaaatt ccgtgaacgc ttcgtggatt atttatagga    117840
     ggttagacag atgggtaaaa atattaaaat agcatttaaa catgtgtcga aagaatatga    117900
     cctctatcaa aataaatcag acaagattaa aggcttgttc atgccgaaaa gtcaaaaaat    117960
     gcaatccttt tgggctttac gagacgtttc ttttgatatt catgatggtg aaacagttgg    118020
     tttaatcggg attaatggtt ccggtaagtc gactatttct agtattatgt caggtgttat    118080
     cccgccaaca caaggcgaag tcgttattaa cggggaaact tcattaattg ccattgcagt    118140
     agggttaaaa ggcccgttga caggttatga gaacatccgc ttaaaattac ttatgcatgg    118200
     tatgaaaagt tcccaaatta acaaactaat gcctagtatt attgaatttg ctgatattgg    118260
     cgatttcatt aaccaaccaa ttaaaaacta ttcgagtggt atgcgttcac gtctaggttt    118320
     tgcaatttcc gtgcatacta accctgatat tttggttatt gatgaagctt tatccgtagg    118380
     ggaccaaact ttttatgaaa aatgtgttaa taaaataaat gaatttaaag cacgtggaaa    118440
     aactatcgtc tttgtcagtc actcacttgg acaagttaaa agtttgtgtg acagaatcat    118500
     ctggatgcat cacggcgaaa tacgtgaaat gggcgaggcg aaagaagttg ctcaaaaata    118560
     tgatgaattt gtaaaatggt ttaacaaaca accaaatgac tacaagaaaa aatatcaaaa    118620
     agaacacaaa gaacatcaaa aagctccaca gaaaaaggtt tatcctaatc caaatgctaa    118680
     caagtatcga ttaactctgt ttgataaatt tcttttaaca gctttaattg ttttaaccat    118740
     attatttgga actttagtag caactggtaa atctttcaaa ggtttaatta gcgaaacctc    118800
     aactaaccaa gtcgagcaaa ttgcatatgt agacaacaat gaaataacga tacgctaaaa    118860
     agaaaaacat ctctctattg gagggatgtt tttttatgaa aaagtaagct gaatttgtct    118920
     aaaattttaa caaaaatata tttaaaacta ctttctttta ttttgtaatg tatctgtaac    118980
     ttacgatggc ttaaagtttg gtaaaatata ggacagtaaa caaattaagg agtggttgga    119040
     gaataatgat aaataaaaag tggatgaaaa ttgtaatgat tccaatgcta gttgtcccaa    119100
     tgtacggttt gacaactgtc agtggacaat tacagaattc attaactgga gaaaattcct    119160
     ttgttaaaga cgctcaagct gcaacaacag catcgcaaca agcgtttata gacaaaatag    119220
     cacctgctgc ccaggcatct caagaaaaat atcatctgtt gtctagtata actttagctc    119280
     aagcaatttt agaatccggt tgggggaaaa gtggacttgc tacacaagga tataatttat    119340
     ttggtattaa aggaaagtac aatggacaat cagttatcat gtcaacctct gaatatgtga    119400
     atggtgagtg gattaagatt gatgctgagt tccgtaaata tcctagttgg aacgaatctg    119460
     taactgatca tacactttta ttagtgaatg gaacttcttg gaataaaaac ttatacaaaa    119520
     aagtagttga tgcaacagac tataaagtag ctgctaatga gctacaaaaa gctggatatg    119580
     caacatctcc aacttatgct gctagtttaa tccgagtaat tgaaacttat gatttagcaa    119640
     aatatgatgt tttatacgac aaaattctta ctcaaaaatc cacttccggt aaagcgactg    119700
     taacaagtcc aacagggaat ggtgtttgga ctctacctta taaagttaaa ggtgtacaat    119760
     ctgttagtcc agctagcaca tacgctaaca aagatattga tttagtatct gttgctacaa    119820
     ctaaaagagg tacgtactat caatttaaat ataatggtaa agtaattggt tgggtagatg    119880
     gaaaagcact gaccatatac gatagcgtca attatgataa agtaaacgtt ggacgagcta    119940
     agattacgag cgcacctggc aatggtattt ggtctaaacc atacaatgta tatggacgag    120000
     aatttgtaac caatgcaact acttatgccc aacaagaaat aaaactctta cgtgaagcgc    120060
     aaaccgcaaa aggaacttat taccagttta gtattaacaa taaaacaatt ggttggattg    120120
     ataaacgtgc tttgactatc tatccatatg attctgttat ttctagcaaa gctgttaacc    120180
     ttgatggaca aattactaac ccaacaggaa acggtatttg gacaaaagca tataaattag    120240
     aaggcacaac ttctgtcgcc caggctactc aatatgctaa ccaagatgtt aaaattagtg    120300
     aagttgttga aactcaacat ggtacttatt acaatattag tatcggcgga agagcaatcg    120360
     gttggttaga taaaaatgcg attactctat atgaccaagc tgagtacaat aaagctgtta    120420
     cactagacgg aactatcaaa aacgtacaag gtaatgctat ttggacagaa ccttatcgga    120480
     ctgctggcac aaaattagtc gctcaagctg aaaaatatgc caacaaagat gttcaaattg    120540
     tccgtgaggc gaaaacacca agaggaactt actaccaatt taaatcaggt ggaaatgtga    120600
     ttggctggtt agatgtaaaa gcttttgata tgtatgatga aataacttcg aacaaagctg    120660
     taaatatgga agcagttatt gaaaatgtcg agggaaatgc tgtttggact gcaccttata    120720
     agagtgtagg tgtaaaactg attggtccag caagtaatta taaagataaa actgtcaaaa    120780
     taactcgtga agctcaaaca agtagaggaa catattatga atttagctct aatggtaaaa    120840
     ctgtaggctg gttagataag aaagcattta aaacttatag tactatagaa tatgatgaat    120900
     cttatgtacg tgatgcagtt gtaacgaatg ttagtggtca tactgtttgg acattgccat    120960
     atcaagttta tggtgtgaaa tcagttgggt cagcatcaaa ctacaacaat aaacaagcta    121020
     aaattacaag acgtgctaaa acagatcgag gcatttatta ccaattcagc attgatggta    121080
     aaaatgtagg ttggttggat gaaagagctt ttgatgtcta tgatacggta gaatacaata    121140
     atgtaattaa taaaactgca ttattgagca acccaacagg aaacggtata tggtcagcac    121200
     cttatagagt tatcggtgtt aagaatgtag gacaagctac ctcatatgct aataaaaccg    121260
     tgcaattagt tcgagaagcg aagacaactc gagcaactta ctctcaaatg agcgtagatg    121320
     gtaaactaat tggttggatt gaccaaagag catttacgaa tattagataa ttgaacgtta    121380
     aataaaaaaa cagagtgatt ttaatcactc tgtttttttc gcttacgatt tagttatata    121440
     aataagctct ttcaaaaagt ctttgtaata agctgattca aaatgggaaa acgaatgacc    121500
     aaatggatag ttgaaatcac caatatatga tttctttgaa aaatcgatga cttttgcttc    121560
     aggcagtttc gacaagaagt agttgtttat tctatcccag aagtaattat ttttctcaat    121620
     tgccatttta tttttataaa ctactacttt tccattttca tcgtaatatg aggttgtaaa    121680
     gccacctaag tttaaaatca ctcgatcagc agggaatgtt tctgttaatt ttgcaataaa    121740
     ttgatcagca taacctttcc actcattaaa gaatgcttca ttatcaatat gatctagaat    121800
     tctttcataa ggaaggtcat taagtaattg actatcttct ataatatatg ataaagtgat    121860
     tgccgttttg ttatttaacc aaatgactgg acgaataaca tcaggataaa gatcaataag    121920
     gaaataatca gaattagact cttttaggtt aacgaaaaag tctttcttcc aatcttcttc    121980
     cacgattgtt ttctctgctg gtttcatatc attgtacttg tccaaattaa aactctcagc    122040
     aggttcagtc attacactaa taatagaaga gtgaaactgc gtaaagctac attcgaaaaa    122100
     tgctttataa tcaggattga aaaaaggaga tgagttaaaa gcattgcgac taaaacaagt    122160
     gcccataaca gcaattttag ttatatcttc tttaattttt ggcgcgggag ccgttaagca    122220
     tgacaaatta ttgaaatcat ttttagttaa ttgtgctagg aatttcttgt tggcaatatt    122280
     aaaaaactta gtattactaa ggtcaattgt atttggaact agaataggta aatcaggcat    122340
     atctttggaa cggaggaaaa aatcccatgt cgcatatgct ttgttattag ggccagctaa    122400
     gaattcactt ttactaatgc gtacagagtg tttccctatt ccttttttta gtggccaagc    122460
     ttgttccata tgatattcaa atacatctgc ttttttatct agtcgttttg ctacaacttg    122520
     tccttcatgg aagtttcctt ctaatttaaa ttgtaaagtt atatcgctac ctgattcttt    122580
     tagttgactg acacttacta atccttgaat attctttttg aaatagaagg ataatctgct    122640
     tgagccagtg acataagagc gcagtgtagc aaagtgcggg gaagccaatt ccacttcttt    122700
     cggaatggat ggttttcttt cggcgtcaat agataggaat gtagttaatc cttgctctac    122760
     ttctttaggc gatatttcaa tcatggcatc taaaatattt gtattatcta ctaagaagtt    122820
     agttgctaag tctttaacag gaatcgaaaa gctaacgact ttatctgtaa ccagtcctaa    122880
     gtcaaatgat tgttcttgct catggaataa ataaaagcta ggtgttggtc tacgttttag    122940
     tagtagcttt gctttaaacg gtccatctgg aagcgaagaa ttaattttga tagtacctgt    123000
     catcaatttt tcgcttaatg aaaaactttc taatgaagct aaaagttcca ctggtctact    123060
     aataagcgtt aatacacctt ctggaaaatc aaaatgatat tggtaaagtg aattagatgg    123120
     ttggaaaggt tgattaataa taggtccatc tgacatcaaa tgattatatg gataatcgcc    123180
     attcacttta aatttccaag cagtctcatt atttgggaga gaatactcag caagttcgtc    123240
     aatcgaaata actgcagtga atgaattttt ttcttgagta aaaggaatgt ttaacttttg    123300
     ttcagggtgt ttatattctc ggatttcgtt gtaatatgct tgaatgctac tgatttttcc    123360
     ttctgaaaaa ccatgtatct tccatgtttt agattctatt aactcaattt cctttatata    123420
     aaatttcatc gctagctcct taaaatttaa ttatgatact ttttatttta tcatatttca    123480
     ataaaattcc ctacaaaatt gataaaagtt gaaagttttc agaataattg cagataatga    123540
     aaagcctttt tttattaagt gaagctaaac actgataaat tttgcacaga tggttgataa    123600
     actgctgtaa ataagatatg ctgtagatac tgaattttat acaatagcat atcagtaagg    123660
     ggttgtagtg agagtggaaa aaccattttt aaccgttgtg gtgccttgtt ataatgaaga    123720
     agaggtatta agcgagagcg taacacaact aacaaatatt ataaaaaaat tagtgatgaa    123780
     tgattctatt agtaacaata gtcaaatcat gtttgttgat gatggaagta aggatcgaac    123840
     ttgggaactt ataaagcaat attctgaatc acatgagcat gtatcagggc taaagttgag    123900
     tcgtaattat gggcatcaag gtgcattatt agcaggatta acagctgcac atgaacattc    123960
     agactgtgtt gtttctatcg acgcagattt acaagatgac gtaaatgcaa ttattgaatt    124020
     tatggaaaaa tatcatgaag gtttcgatgt ggtttatggt gtgagagata aacgcgatac    124080
     agatactttt ttcaaaagaa attctgctct aactttttat aagattatga gtaagttagg    124140
     tgttaatatg gttcctaatc atgaggacta tagattactt agcaaacgcg cattaacaga    124200
     atttttacgc tataaagaag aaaatatgtt tattagaggt attgtaccat tacttggatt    124260
     taaatctacc aaagtttatt ataatagaaa tgaacgcttt gctggagaat cgaaatatcc    124320
     attaaagaaa atgttattat ttgctgttga tggtattact tcttttagtg tggcgccaat    124380
     tcgcttattg ctagtgattg gttctattac tttcttagta ggtgtagttt taggtattta    124440
     tgcaattgtt caaaaaataa tcgggggcgt agttcctggt tggacctctt taattgtttc    124500
     tatttggtta ctcggcgggg tacaattaat tggtatgggc gttttgggcg aatatattgg    124560
     aaaaattttc cgacaagtaa aagaacgtcc tcgttttaca attgaagata atgtctttga    124620
     aatgaaatgc gagaaaaata aaaacaacga gagtttggtg taagtaaagt gaagaataag    124680
     ttagtttaca cttttaatgc tttatttatc ctcctatttg gctacttgct ttgcctaagc    124740
     attttcaaac cacaaacttt tacttttgaa catccttttg tcttaatagt tcttagcgct    124800
     gctgcgttat tagttcttat tgggattttc cagtttagta ctagattaaa taaaaaagga    124860
     gatggttttt taaccatctc tttagtgatt ttgatattag cagtccaagt atatctatta    124920
     gtttcgctgc aaatgaattc atatgcggat gcctatgtaa ttaagggcga gtctttaaaa    124980
     atgctggcaa atggaggaca tgctactggt caagaatact ttatgatgta tccaaataat    125040
     atctttataa ccattatacg atactggtta tatgcttttg gaggaatgct tggagtttcc    125100
     aatgtattct tacttgaaag tgtatttcta tttttatgta tgaatattac tatttttgta    125160
     ttgttttgga ttattcgtaa agaaaatggt agcaaatatg cgaatattta tcttatcatt    125220
     atactatttt gtgttccatt actaggttac atttggtatt tttatactga tactctagtc    125280
     ttgccttttg cttcccttat tactttattt tattatttat atacgaaaaa taataaatgg    125340
     tggtatttta ttattatcgg gttattgttt gccgttgggt atcatattaa gccaaatatc    125400
     ataattttat tgccagcgat gattattcat caatgtttca taagaaattg gcgtaaggtc    125460
     ttgctaaata caatggtgtt agcgattttc tttgtaagtt taaatgctgt tttcacgcca    125520
     ttatctaatc attatggatt taagaaaaat ttggctatag aatttccgca aacgcactgg    125580
     gtgatgatgg ggcttggtga gccagcaggt cgttacaata gtgaagacgt ggcttttaca    125640
     aatcaataca agacaaaaga agagaaacaa gaagcgaata tagagaaaat aaaagaacga    125700
     ctaaaagagc atgggcccat tggacttgca aaattatata ataataaaat gataaacaca    125760
     tggacagatg gtacacgcgc ttatacgtgg tacacgaatt ctgcattaga ttatccagct    125820
     tcatttgatt atttctttgg agataagcgc ttttttacag agttcgctgc ccaaatgttc    125880
     catatcatta atttactgtt aatatgttta ggtgcgttac gtttttataa aaaaagagaa    125940
     cttgatatat ctttctttat aaatatcacc ttagttggtg tctggttatt tcatttaatc    126000
     tgggaagcaa atcagcgtta tatattattt gtaactccat taatgattgt gtcttctatt    126060
     tatggattta agtttattat agaaagttta tttacagaaa aagtagtttt aaaagataag    126120
     ttaaaaaaat ctttcttaat tacgagtttc cttatctttt tgttaagtag tgtttttctt    126180
     gcgtttggtg gaaaaatgat tgcgactgat aaacaagata ttaatcatta tattgttaag    126240
     caaagttatg ctcatatagc gttaccagtt aataataaac aaactatttc acaagaattt    126300
     acatctgata gtccttttaa ctcaattgac atatatgtga tgaaaaaacc ggaagctagt    126360
     agttcatatc gaataaaagt tatcaatgaa actaatgaca ctataattta taatcaagag    126420
     aaaaaaggta cagattttcc aaatgaggct taccttaaat tgagcgttaa cgataatcct    126480
     aaaggaaata ataggtatcg catcgtaatc tcagaagtag aaaatagcca tccaaatcaa    126540
     cctttagttt taggaaccta ttttgataat gatttagacc tttacccata tggcgatttg    126600
     tacgttaatg atgacaaaaa agaataccaa gacataggct tttttgttac aaatacaacc    126660
     tcaaaaccat taatgccaaa atatgcatat attatgtttg atttatgtat catgcttgtt    126720
     tttgcaggaa cgtattatgt ttttaaaaga agacgttaat actatccaat attaggttat    126780
     gtatataaac atggagaaca tctaattaac atgtgacata tattttgaat tagggagagt    126840
     ctataaatga gtaaagattc aaataaaata attgaacaaa gccgagaaat aggaataagc    126900
     ataattatgc cactttataa tgtggaagaa gtaatacttg aaactctcga aagtattcat    126960
     gagcaaactt ttgatagtta tgaagtgtta ttaattgacg atggttcaac agataaaaca    127020
     atagaaattg taaccgaata tataaaagat aagccacggt ttaaattata cactcaacca    127080
     aacggaggac cagcttctgc aaggaaccat ggtttacgac ttgcaatagg tatgtatatt    127140
     tgttttgttg atagtgatga tatactgcct aactattcct tacaactaat gtatgatggt    127200
     gctatttcta caggggcaaa actaattact ggagcaacca aacgttttaa ttcagagggc    127260
     gaatggttta taccaatgca tattcaatat aatattgcta aaccaggaat gaaaacctta    127320
     ttaaaaaatc ctgagttgtt ttattcaatt ggaccatgtg cgaaattgta tcaccattca    127380
     ctaattgatg gcgtattttt cccagagaat attcgctacg gggaagatca accgtttgtt    127440
     ttacatgctt tattgcaagc caaagatatt tatacagtag aaaaagttgt ttattattat    127500
     cgtttacgcg atggtgaatc gcaatcatta acgcaatcag tagataaaga tccaattcgt    127560
     attttaaagt ctgttttcca gatttttgac tatggtgaag aagaactgaa aaaaaacaac    127620
     actgattacg aggttgcttt aaaatattat caacgcgttt ctagtgtgga gctttgggga    127680
     gcgttacgag cagcaataga aagcaaaaaa agtgagaacc aaaaaattgc ttttacaatg    127740
     actttagact ggttgaaaac aaaatcagat gactttttaa atattatccc ttcatttaga    127800
     tacttcttgt tatttagtag tattgagcgt gtacgttata taacgaaaga caataaagaa    127860
     aactatcgta atttaattgg ttatttatgg agccgacaag gggaagaagc taaaattgca    127920
     tttagaaaaa cttacccaat tcccatgaag gctgctctac aaataattga aaataataat    127980
     tggcgtgatg ctcgtaaaat ttcatttaaa tttattgttc gacgcaagtt taaagctcca    128040
     attttaattc gtaaaataag tagagggatt atttttagaa ttgctacatt aatgccacgg    128100
     aagaagaacc aagtgatatt agctacagaa cgtagcacca ctttggaagg taatttatta    128160
     gcaatttatg attatatgtt ttataacaat atgcctcaaa aagtatatgt gtttttacga    128220
     aaaaatcgga attggtttga aatgtttcag ctatattata cgctggggcg aacgaaaaca    128280
     attgttttag atgattatta caataaaatt tacggtttga aatttaacaa aaatacacat    128340
     gttgtgcagt catggcatgc aacaggcgca tttaagaaat ttggatttag tgcgctggaa    128400
     ggtacagatg caaatacaga agaatttgaa actcgtgcgc attcccctta tactgatgtg    128460
     cttgtaagct cagaaggaat tattccggaa tatatggaag cttttagaaa acaagctaat    128520
     caaattaaac caattggtgt acctcgaact gatgtgtttt ttgatgatga atatgtgaat    128580
     tatacaaaag aaaaatatat gaaaatgtat ccgcaattgc gcgataaaaa aatattgtta    128640
     tatgcaccta ctttccgtgg tggaccgaat gagcgtttta attatagtgt agttcttgat    128700
     attgcagcgt tgaaaaaaga acttggcgat actcatatct taattttgaa attccatccg    128760
     gttattaaaa acgtttcatt caatgtagaa gaagatgatc cgtttatttt gaatttaacg    128820
     ctaaataatg atattaatga cttaatgtta ttcagtgatg cgcttattac tgattattct    128880
     tctgtcattt tcgaatttag tttgatgaac aaaccgattt atttctttgc ctacgatatt    128940
     gatgattatc ttgatgaacg tggtttctac tttgattata aagcgaccat tcctggtgaa    129000
     gtgtttagag atacaccatc gcttattgaa gcggttaaaa gtggtctata taattacgac    129060
     gagttggaaa tctttaaaaa gaaatttgtt ggtagtttgg atgggaattc aacgaaacgt    129120
     tttgttgaga cttatattgg aaaagcaaat gagaaagtga aggatatatg agtatagtaa    129180
     tagaacaact cgttgtaaag gaatctagtg gtaaatgggg aagtcctcat cttttagaac    129240
     aaataaaaaa taatatttct atgtcaaacg ctgatttttt aattatttgt tcaaaacctg    129300
     aagaaaacat cctttcacaa attcaagact atattgctcg cttccccgaa aacatggttg    129360
     gagcagatat tcatttattt agtcaaaatc ctgtattttt acaacatctt cgtaaattac    129420
     caaatgaaga tagttacgaa atgactgaca cacttcaatt cttagttgaa ttaacaccaa    129480
     agccaactag tacgtattta gaacgtgatc ctcatatgct cctagaagaa atgggacaat    129540
     accaattata taatgtatcc tttttgaaaa attattttga ggagaggata aacgaaacaa    129600
     ctttgattga tatttttcat caggcaaaaa tggtttggaa gcacagtgtt ttagaagaaa    129660
     caaaaataaa cgaggctaaa aatcaagttg caaataatta tagaataaca gatatggttg    129720
     attgctggga attttatcga aagttagaaa ataactacac aagtttaaga ctggaacttc    129780
     ttgattttga taagaacttg tttaattatt tgattcgtac taaattaggt ccaactttcc    129840
     aaaagcaatt aatgtctgga aatcttaccg aggcaaccga ggcaattgag gcccttactg    129900
     tttttctaga agataatgat aagcatcttg taagtgaact tgtttcctta ggatatttct    129960
     atctacaagt accagtgaaa gaatatcctg agtggggtaa taataaagcg tttagtaatg    130020
     cgtatttaaa attcttaaat gtactttttg aaaaaatgca ttatcaaaca aagcaatata    130080
     atttaagatt ttatcgacgc gctacaaacg ctgtctataa agcagttggt ttaaattctt    130140
     taaaaccgat tgctaagtgt tacaaacttt atttttaagt tgatgcaaaa agagagctga    130200
     caaatgaaaa aatgtcagct ctcttttttt attttttatc gtttttatgc acttgttgat    130260
     ataaatcatc aattaatgct ttgacatcct ctttgatttc tggatgtttt agcgcgaatt    130320
     gcattgtagt ttgaataaaa ccgaatttat cgccaacgtc aaaacgttcg ccttcaaagt    130380
     cataagcaaa tacgcgttgt acttcattta ggctattgat tgcgtctgtt aattggattt    130440
     cgccgcctgc accaggcttt tgggtttcta agaagtcaaa aatttgtggt gttagtaggt    130500
     aacgaccgag aattgctaaa tcggatggtg ctttggcagg atctggtttc tcaacaaaac    130560
     cttttacatt gtataaattc ttatcgtatt cattaattgg atcaataata ccgtaacgat    130620
     atgtttcctc atgtggcaca gtttgtacgc caattacaga actatgtgtt ttttcgtatt    130680
     gattcatcaa ttgtttggaa caagggattt tggattctac aatatcatca cctaacataa    130740
     cgataaatgg ctcattccca acaaaacctt ttgcttgaag gatggcatca ccaagtcctt    130800
     ttggttttgc ttgacggata aagtgcaagt taatgttagt tgtttgctct acaagatgta    130860
     ataactctaa tttgtttttt tcacgcaaat tattctcaag ttcaggcacg gaatcgaaat    130920
     ggtcttcgat agcgcgtttt cctttaccag ttacgattaa gatatcctct atacccgagg    130980
     caacagcctc ttccactatg tattgaatag ttggtttatc cacgataggt aaaatttctt    131040
     taggcattgc tttagttgct ggtagaaagc gtgttcctaa tccagcagct gggattacag    131100
     ctttttttac tctcatattt aataatctcc ttctaatcta taattcaagt agactcacct    131160
     aattatacgc taagcttctt tgaatttaca agtttttatc ggcaaaggag ataaatttca    131220
     aaagttttgt taaaatgata ttgaaaatag atattcgctt agatagaagc tagtttgtta    131280
     gacaagtttt gtgttataat ataacaggtt aatataaaaa acagttaaag gagattagag    131340
     gatgatatac gctcaaattt tagctggagg aaaaggtacg cgaatgggta acgttagcat    131400
     gccgaaacaa tttctacctc taaatggtaa accaatcatt gttcatacag tagaaaaatt    131460
     tattttaaat acacgatttg ataaaattct tatttcttca cctaaagaat ggatgaatca    131520
     tgctgaagat aatattaaaa aatatatttc tgatgatcga attgtcgtaa ttgaaggcgg    131580
     ggaagaccgt aatgaaacaa ttatgaatgg aattcgttat gtcgaaaaaa catttggttt    131640
     aaacgatgaa gatattatcg taacacatga tgctgtgcgc ccatttttaa cgcaccgaat    131700
     tattgaagaa aacattgatg ctgcgattga aacaggcgct gtagatactg ttattgaagc    131760
     acttgataca atcgttgaat caagtaatca tgaatttatt acagatattc ctgtcagaga    131820
     tcaaatgtat caagggcaaa caccacaaag tttcaatatg aaaaaagtat ataatcatta    131880
     tcaaaactta agcgcagaga aaaaacaaat tttaacagac gcatgtaaaa tttgtttgct    131940
     tgctggcgat caggtgaagc ttgttaaagg cgagatattc aatataaaaa ttacaactcc    132000
     atatgatttg aaagtagcga atgcgattat tcaggagcgg atagccaatg attaatcaag    132060
     tatatagact tgtgtcagag agacagtttg aagttgccaa tgtggacgaa tctttagctg    132120
     gtgatgtggt cgttgttaga cctactcatt tatctatttg tgcggcagac caacgctact    132180
     atacagggtc tagaggaaaa gaaatgcttt ctaaaaaact tccaatggcg cttattcatg    132240
     aaggcgttgg cgaagtcgtt tatgacgcaa caaaagagtt taaacctgga acaaaagttg    132300
     tcatgattcc gaacacacca tttgagaatg atccagtcat tgctgagaac tatttgcgtt    132360
     cgagtaaatt tcgttctagt ggttatgatg gtttaatgca agattatgtt tttatgcgtc    132420
     gtgaccgggt tgttgcgtta cctgatgaca tcaatatgaa agtagcggca ttttctgagc    132480
     ttatttctgt tgctgtacat gcgattttac gttttgaagg aaaaagtaac gctaaccgtg    132540
     atagctttgg cgtatggggt gatggaaact taggctttat cacttcctta ttattaaaaa    132600
     attggtatcc agaaagtaaa gtttacattt ttggaaaaac accatataaa ttagacttct    132660
     tttcttttgt agatggcgca tattcgattg atgatgtgcc agctgattta gtcattgatc    132720
     aagcttttga atgtgctgga ggaatgggta gtcagtatgc agtcagtcag attattgatg    132780
     taattaaacc tgaaggaact atttcgttac taggagtttc tgagtatccg attgaattta    132840
     actcacgtat ggtactcgaa aaaggactta cagtttacgg aagtagtcgt agcggccggg    132900
     ttgactttga aaaaacagta gaatttctat ccacgaacaa acgcggggta gaatatttac    132960
     aaaacctagt tggtgaagtg catacggtgc attcaattca agatgtaatt gaagcctttg    133020
     aagctgattt acgtagtcca tggggcaaaa gcgttatgga gtggaagata taataaaaca    133080
     tgggggagtt taggctatac gcttatgaat ttgtttgcta aagtatattt aggaagcaag    133140
     gcagtcgaga ggaaattcgg cgttcatatg cgagacctta acttcccagt tttatatgga    133200
     gagggaaaaa agaatgaaat ttgcgattat aattcctttt tacaatgcgg aaaaaaggtt    133260
     ggctttatcg atagatagta taattaagca gacttacagc tttttgaagc atgtggaagt    133320
     tctgcttatt aatgatggga gcacggaccg tagtagtgcg attgctcata gctatgccga    133380
     aaaatatccg agtaatattc gcgtttttga tgtcccgaat ggtggtcctt ctaaggcgag    133440
     aaatattgga atacataatg tacaagaaga cactgacttt gtaggatttt tagatgcaga    133500
     tgatctgtta tcgccaaata tgctttttag tatggtgaac ttcctagaaa aatcagctgt    133560
     taatatgctt gtcccagctt tttattattt agatgatttt ggaaaaaaac aaaaaatttc    133620
     tccacataaa ttaaatgacc gtttcacaaa tggaaatcga gttgtagcga ttgaaaaaga    133680
     accgcaagca attcattttt atattggcgg tacttttttt cgtttcgaaa gtttgaagca    133740
     atttgtcttt gatgaaacgc ttaactttgc ggaagatcag cttttaatta cgaaattttt    133800
     gcttgaaaat agaagttacg gattgattgc cgatgctggt tactattact atcgtgattt    133860
     aaagcaaaaa ggttctttag taagttcagc ttggaagcaa ccggaaagat atacgccatt    133920
     tttacaaaag gtgtaccaaa cttatttaac aaactctaaa gaaatttttg gcgaagtgat    133980
     tccatatgtg cagtatttaa tcgcgtacca tgccaagttg tttttttata aagaaaacat    134040
     ttattttaaa gaagtattaa atgagcagga acaagaaatc tttgtgcgtg aattacagaa    134100
     aatattacaa gaagttggtc cggagatgat tgtagctctg gatacaccgc ttgttgtaaa    134160
     agaaatgatg ctctctattt tgcgaaacgg ctggccagta cagtttaaga cggcagaatt    134220
     agaagaagtt ccgcttgtca cagtaaaaga aaattaccgt cctggaaaag ctgtaacagt    134280
     ggaactctta ctagaagagg cgcgggaaac tttatcagat ggcggagaat tctttgctag    134340
     tacatctgta ggtacggcgc aaacaaaagt ggtaaaacga aaaacagccc aaacaatttg    134400
     ggatattgtt gttcgtgaag agggtacact tgaaaaagtg gtgacacggt taaaaccata    134460
     tcaattgaaa gtccaagtgt tttaccaaga caaaaatcaa aaaataacaa tgacagattt    134520
     aaatgtcatc aagagtgtgt taggaaaatt aaaaagaaat aaagctttaa agcgaaagtt    134580
     taaacagggg ggagtatcct gatgaagttt gtacaaaaaa tatattattt cctatttaag    134640
     ctagtaggat ttttacctcg aagaaaagaa ttagtgatgt ttgaaagctt ttctgggaag    134700
     caatatagtt gtaatccacg tgctattttt gaatatatgg aagagcataa tccagaatac    134760
     gagttgttgt ggagtgtaaa tccgaagtat gttgatttgt ttgaagcgca cggggtaccg    134820
     tatgttaagc gtttttctgt taattggttg tttaaaatgg gcttagctaa attttggatt    134880
     tctaatagta gactgccgct tgagctacca aaaccgaaaa aaactattta tgtacaaacg    134940
     tggcacggaa cgcctttgaa aaaactaggt gtcgacatcg atgaagtaca tatgcctggc    135000
     caaacaaccg aacaatacaa ggctgatttt gtgaaagagg cgcagaagtg ggattattta    135060
     atttcaccta atgcgtattc tagtacgatt ttcagacgtg catttggttt cactggggaa    135120
     atgattgagt ctggctatcc gagaaatgat attttattta gtgcggataa agagttgaaa    135180
     atcgctaata tcaaaatggc cttaaatatt ccagaagata agaaagttat tttatatgcg    135240
     ccaacttggc gtgataatga tttttacgaa atcggaaaat ataagtttga tttaaagatt    135300
     gatattgcca aaatgcaaga aaaatttggc gatgaagtcg ttctgttagt tcggatgcat    135360
     tatctcgtag cagaacattt tgatttcacg cagtatggcg attttgtacg agatgcttca    135420
     aaacacgaag atattagaga tttgtattta gtgagcgatt tattaattac cgattattct    135480
     tccgtatttt ttgattatgc taatttaaaa agaccaatgt tgttctatac gtatgatttg    135540
     gctgaatatc gcgatacact tagaggcttt tactttgatt ttgaacaaaa tgccccagga    135600
     ccacttgttg aaatgaatga tgctttaatg gcagaaatag aaatcatgct tgaaaatcct    135660
     cctcaaattg cagaaagctt tttagaacaa ttctgtactt gggaagacgg gcacgcagca    135720
     gagaaaacag tgaaaaaagt ttttgctgaa aaataggcgg tgggaatatt gaaaaaaata    135780
     gcaatttata tgtatatgct tgctgttaaa ataattggat tcttggcgag ccttttacca    135840
     gttcagcaaa aagttgtttt tcttataagt tttgaagaaa atcccactgc gattattaag    135900
     caaatgaaac tgtccaatgt caccccgaaa acaattgtct tctatgatcc tagagtagac    135960
     gtatcaaagt tatctttaga ctttataaaa gtaaaaccga agacactgca acaatttatt    136020
     ccattaatgt ttcacctcaa tacggcaaaa gtagttgtca cagataatta ttttgtggaa    136080
     ttagctggct tgaaattacg aaatggcgta aattgtatcc aagtttggca cgcaaacggt    136140
     gcgcttaaga aatttggctg ggaagataaa gcagcgcaaa aaaggtcaga tcgggataag    136200
     aaaagatttc aagaagtata taaacgtttt acaaaagtac ttgttggttc tgatgaaatg    136260
     gcatcaattt tcaaaaaatc atttttacta gatgaatcga acatgttgaa acttggtgtt    136320
     ccacggactg attatttctt caaagaagcg cagttacaag aaaattatca gtggtcatac    136380
     gagcatttac atttaacaaa cagaataaaa ttactatatg cgccgacttt tcgggataat    136440
     gagttgggaa tggcaaagtt acatttagat attgcggaaa tgaaacaagc cttaggaaat    136500
     gaatatcaat tgattttaaa attacatcct tctattagta atgatttaga gaaactagat    136560
     gatgattttg tcatttatgt ggataaagaa acgccgattg aaacgttact accagttgtg    136620
     gatattttga ttactgatta ttcttccatt ccgtttgagt ttgctttact tcaaaaacca    136680
     atgattttct ttacgtatga tttaacggaa tataataatg ctagaggact ttcagatggc    136740
     tttttagaaa ccattcccgg tccgcatgtt tttacaacga ctgagctaat tgaagtaata    136800
     caaaataata cgtttgattt ggaaaaagtt cggttatttg ctgagaaatg gaataaatat    136860
     tcggatggat tttcaagtga gcgttttgta tcctttttaa aagaacagct tgaaaagtag    136920
     cactgctaac aagtagagaa atttttgttt tcttgatata ctactaaaga aagtaggtgg    136980
     gctgatgaag aaagtaatta catatggcac atttgattta attcactggg ggcatattcg    137040
     tttattagaa cgagcaaaag ctttaggtga ttaccttatt gtagccattt caaccgatga    137100
     atttaatcga atcaaacaca aagaagcata ccataacttt gaacatcgca aattaatttt    137160
     agaggcaatc agatatgtcg atgaagtgat tccagaaagt aactgggaac aaaaattaga    137220
     agatgttaaa aatcgtgata ttgatatttt tgtgatgggt gatgattggg aaggcgaatt    137280
     tgacttctta aaaccttatt gtgaagttgt ttatttacca cggacagacg gtatttctac    137340
     ttccaagatt aaagatgatt taaaatagtc gtagcacaaa acaggcagac cggtaatgtt    137400
     caattattag gtggtaggct tgttttgtgc tattattatg tataaataat aacgcaaaga    137460
     actagttatg ataggagcag aagaaatgac aaatttattt caagatgata gtctaacgct    137520
     gcatacagac ttatatcaac taaatatgat gaaagcgtat tttgacgatg gacttcatga    137580
     gcgtagatcg gtatttgaag tgtttttccg agacatgcca tttgattcag gttttgttgt    137640
     atttgctgga ctggaacgaa ttattaatta tatgcaaaat ttacgtttta cagaaacgga    137700
     tattgcttat ttacatgatg aacttgggtt tgacggacct ttcctcgaat atctacgtaa    137760
     ttttaaattt aaaggaaata ttcttgctgc aaaagaaggg gaattcgtgt ttaaaaccga    137820
     gccaatcctt caagtagaag caagcttggc agaagcacaa ttaatcgaaa cagctttgct    137880
     taatattgtg aatttccaaa cgctaatcgc tacaaaagct gcgcgaattc gttctgttat    137940
     tgacgacgaa acgtttgctg aattcggaac aagacgcgcg caagaaatgg atgcagctat    138000
     ttggggcaca cgagcggctt acatcggcgg ttgtgattcc acaagtaatg ttcgagctgg    138060
     aaagattttc ggtattcctg tgtctggtac gatggcacat gcgatggttc aagcctaccg    138120
     cgacgaacta gaagcattta gaagttacgc aaaaacgcat tttgattcga ttttcttagt    138180
     agatacatac gatacgctaa aatccggcgt accaaatgcg attaaagtag cgaaagaaat    138240
     gggcgataaa atcaacttta tcggcatccg cctagatagt ggcgatatgg ctttcctatc    138300
     taaaaaagcg cgccaaatgt tggatgaggc tggttttaca gaagcgaaaa tttttgcttc    138360
     aagtgactta gacgaacata ctattttatc cttaaaagcg caaaaagcga aaattgattc    138420
     ttggggtgtg ggtacgaaac ttatcacggc ctacgatcaa ccagcgctgg gagcagttta    138480
     caaaatggcg gcgattgctg atgaaaatga tattttacaa gattcgatta aactttctag    138540
     taacaccgaa aaagtttcaa cacctggtaa gaagaaagtt taccggatta ttacgaatga    138600
     agatggttta aaagcagaag gtgattatat tgctttagcg gatgaatcac ttgaaaatgt    138660
     cgacaaacta acgatgttcc acccagttca tacgtatatt atgaagaccg tcgagaattt    138720
     cactgctcgc gagttacttg taccgatttt taaagatggg gaacttgttt atgacatgcc    138780
     gactttagat gaaattaaag catataaaga agaaaacttg gcgctgcttt gggatgagta    138840
     taaacgaact gttcgtccag agcaataccc agttgattta agtgtaaaat gttggaaaaa    138900
     caagatgcgt aatatcgaaa aggtacgtaa aagtgtccaa cttcattcac cagttgaact    138960
     agatatgccg ttttaggagg aattataatg gaaatcagag aaagaatttt agcagatatg    139020
     caagtggcag aaacaattga tgcacacgaa gaaatccgga aaagtgtcga gtttttaaaa    139080
     gcatatttaa aaaagaatac gttcttaaaa agctttgttc tggggatttc tgggggacaa    139140
     gattcgactt taactggaaa actagcacag atggcgataa gcgaattacg agcggaaaca    139200
     ggtgatgatg agtaccaatt cttcgctgtg agcttgccat acggaacaca actagatgaa    139260
     tcggaccgtc aagatgcact tgattttatg gcaccagata atcgcttaac cgtgaatatt    139320
     aaagcttcgg ttgatgcgag tgttgcggcg cttgcggaag cgggagttga actatctgat    139380
     ttcgctaaag gtaatgaaaa agcgcgcgaa cggatgaaag ttcaatacgc gattgcagcg    139440
     atgcacaaag gcgtcgttgt tggaaccgat cactccgcgg aagcagttac tggcttttat    139500
     acgaaatacg gcgacggggg aacggatatt aatccactgt tccgcttgaa taaaagacaa    139560
     ggcaaggcgc ttcttaaaga gcttggctgc ccagaacatt tatatttgaa aaaaccgact    139620
     gcggatttag aagataataa gccagcactt cctgatgaag tcgcgcttgg tgtaacttat    139680
     gaccaaattg acgattactt agaaggcaaa gaagttccag cagatgctgc ggcaaaaatt    139740
     gagaattggt ttattaaaac cgaacataaa cgccatatgg caattactat atttgacgat    139800
     ttctggaaat aggaggctgt ttaaatgaaa gttggttatg gtttattaac tgcattttat    139860
     acacatccag gagaaaaaga taatttagtt aaaattttgc ttgaagcggc tgaaggattg    139920
     gatgattaca acacgtgtat tcagtatatt gtcagcgaat ctgaaaccga gccagacacg    139980
     gtgtttgttt ctgaaatttg ggttgacaaa gggcaccata aagcatctct tgataaccca    140040
     gctgtacaag aaacaattaa acgcgccaaa cctttaataa aagatataaa acaaatacaa    140100
     gaattagaca tactcggtgg aaaaggcata tagatgataa aacatgaatg attctaggac    140160
     tctcctggaa tcattttttt ggagggatga caaatgcaaa cgttgatgat tgtttgtgct    140220
     ggcggtgcga cgtcaagctt aatggcacaa aatgtcgtga aaagcgcgac atcagaagga    140280
     atggacgctg ttttactatt tccagatgac gtaaaataca aagatagttt tctcgagaaa    140340
     tatagcgagc gggatctgat tgtcgtgatg ggtccagtcg gcgcaattac agccgggaaa    140400
     ttccgtgatt acaaagagca agtcgatgcc gttttagtag caccacaagt gaaatatatg    140460
     tacaaaacag tggaggaagt attaggcgaa ctaaatattc cttgcgctaa tattgattca    140520
     ctcgatttcg gtcggatgcg cggagataag attctcacgc aaggtctagc cttaatggat    140580
     gcgaaaaatt ccaaataagg tgttgcaact ttagagggga aacgttaaaa tgaaagaaga    140640
     tgaaaaggac aagtgatttg tccttttctt atattattgt gaagtaaccg cgattttgcg    140700
     gtttcatttt atagataagg gtggttttgt ttaaaattat gaaagacttt accgagcaag    140760
     agaaaattat cgttctagat tttggtagtc agtacaatca actaattacg cgccgcattc    140820
     gtgaattcgg tgtgtatagt gaattacatc cgcatactat tacagttgaa gaaatgaaag    140880
     cactaaatcc aacggggatt attttttcag gaggacctaa cagtgtgtat gacgaagatg    140940
     ccttccgcgc agacgaaaga atctttgaca tgggaattcc gattttagga atttgttacg    141000
     gcatgcaatt aatgacaacg cacttcggtg gcaaagtaga acgtgcgaaa gaccgcgaat    141060
     acgggaaagc ggacattcac gttgaaaacc caagccgttt atttgctgga ctaccaaccg    141120
     atcaagttgt ttggatgagt catggcgatt tagttgtcga ggaaccagct ggatttgaag    141180
     taacagctac tagtaagtct tgcccaattg caggtattgc ggacgaagat cgtttgcttt    141240
     acggcgtgca attccaccca gaagtacgtc actcagctta cggcaacgaa ttactgaaga    141300
     attttgcatt aaacatttgt ggctgtaaag gcgactggac aatggaaaac tttagtgaag    141360
     tagaaatcgc taaaatccaa gaaatcgtag gcgacaaaaa agtcttgctt gcactttctg    141420
     gcggcgtaga ttcctctgtt gttggtgtgt taattcataa agcaattggc gaccaattaa    141480
     catgtatttt cgttgaccac ggacttcttc gcaaagggga agctgaccaa gtaatggcaa    141540
     cattacaagg cgaattcaac atgaacatca tcaaagtaga tgcgaaaaaa cgcttcatgg    141600
     acaaacttgc tggcgtttcc gatccagaac aaaaacgtaa aatcatcggt aacgaattca    141660
     tttacgtatt cgacgacgaa gccaacaaac tagacggcgt agaattcctt gcacaaggaa    141720
     cactttacac agacatcatc gaaagtggta cagcaactgc ccaaacaatc aagtctcacc    141780
     acaacgttgg cggcttacca gaagatatgc aatttaaact aatcgaacca ttaaatacac    141840
     ttttcaaaga tgaagttcgc gcactaggaa cagaacttgg catgcctgac gcaatcgttt    141900
     ggcgccaacc attcccaggc ccaggcttag gaatccgcgt tcttggcgaa attacggaag    141960
     agaaattaga gattgttcgc gattctgatt acatcttgcg cgaagaaatc aaaaacgcag    142020
     gcctagaacg cgaaatctgg caatacttta ctgctcttcc aaatatccgt agcgttggtg    142080
     ttatgggtga tggtagaacg tatgaccata ctgtggttgt tcgtgcagtg acgagtattg    142140
     atggtatgac agccgattgg gcacgtattc cgtgggatgt actggagaaa atttcggtac    142200
     ggattgtgaa tgaagtggat catgtgaatc gtgttgttta tgatattacg agtaagccac    142260
     cagctacggt tgagtgggaa taattaaaga aaccgtgaaa ctattgatat cagagggttt    142320
     cacggttatt ttttgtttta tgcaaccatt ttgcaaccaa tagttcaaaa attgaccagt    142380
     tatttaattc tattgaatga ttataataat taagtaggag gtaatctatg tgagaaaaaa    142440
     attaattgaa cagattttaa tatcaccttc acctttttct attttcgaag aaaactataa    142500
     tgaattgaga aatactagat ttttattatt tgataacaac tcaaataatt ttggaaaaaa    142560
     atttcaaaaa atggaattta ataactttac aatttctcca ttagcagagt atcacaatac    142620
     aatggttctt gatcaatata ctgtaaaaga atcaagggaa ttagaagtag ttcattgtgt    142680
     agattttgat tcaaacatta ttagtaactt aagaaaactt tttttccata ctaattacag    142740
     taacgaatac ttaataaaat tacttttata tgtgaaaaaa gaacgtatac agcctaattg    142800
     ttcgccctat ttaatagaat gtgccgcaaa taattttaat ttggataaac aagatattta    142860
     tgaaagttta ttatccttct cactattgga aaatacgaat attgaacaat tgataactaa    142920
     ccatctaaat aaagaaccct catcaacaga ttatttagac acagatgaaa gatggcgatc    142980
     tttaattgaa ctaaaaaaat atgcaactaa agaatatatc ccaagatact attatatcta    143040
     ttgtttatta ttgaagatgt attttcttaa gttctcttct aaaaaatctg caaaaaacaa    143100
     actcattcaa ttattagata gtattaatac agaactattt agttattggg aaaatgaact    143160
     tgtaatttgc tacttatcat taaaagaaga ctctaaaact gattcgtttt ttggttctgt    143220
     aaagcccaat acaaaagata tgttaataaa aatccaagga atggcttggg atttatttca    143280
     tttgcgatgt gctcatgaac atatggcaga gcgtaataat tattcaaaac gtattttttt    143340
     acattcattt agctcagagg ataaaggatt aaactcaatt attagattaa atccaataaa    143400
     aagaattgca ttcgatggta aggatgttta tactcaccat agatatacca tatttaatat    143460
     gtgtcctgaa gtagatgtat atacgattct aaatgaatac acacatcata gaaacaaaat    143520
     gtgcaaagaa acaaattacc aagaactatc caaaaaatta gagtttgaac tcctacatct    143580
     atcatcacga tagttcgcat agaaggtaaa gctatcttct atgcaattta attttctatt    143640
     aattaatcta ctttgaaatc gatactttct cctcattttt aagcttttca attttttctc    143700
     taacttactt acatctctaa aataactttc atttatgggc ccctcttacg cagtttttat    143760
     gaattcccca tatgttactg aaaaaggttt aagatttatt gattcaatga agccgcttag    143820
     gatgaacaaa aaaaatcaaa tggaacaaaa gagagtattt ttagagcgag tagaaaataa    143880
     agatgaggat ttaaatattt caaattatag ggttgattcg gatgattatt tagagatagt    143940
     taaattggct attgaagagg aattagtttt aggcatatgt ataaagtatg cttctaataa    144000
     gggaatagta atacattcta atgctcattt gagttcaaaa ggaattgaat atttagataa    144060
     tcctgattta gtggagacag aaagtaaagt aaacgttgct ccttctcaag taattaatat    144120
     ttatggtgga gaccaaaggg gcgctggttt tggaatgaat gccactatta ataataattt    144180
     tgataattct cttgaggaac ttggtgcttt tatttctaga ctttctgaaa atgagcaaaa    144240
     agaagcgaat gaaatattag atgcaattaa gaatggggat attaagccag gtatgctttc    144300
     taggttctct actttccttg agagccatcc taatttaggc gcttatactg gaaaagctat    144360
     tgtttgggca ctaacaaaat tataaaatta ataatagtat gctaatatta attttgaaaa    144420
     ataaaatggg tagatttgaa taatagtagt aaaattaatc attagtgctt aataacacaa    144480
     cattaaaaaa gctaataaat aaaaggtctc atatttaaat tttgagatct ttttttatag    144540
     tttttatcga ttcctaaaag aattttctaa ttgatatatc cgtctaagta aaatctccta    144600
     ttgttactaa atgacagctc gtgtaaatat cattataata gaaccatgat acaaacttca    144660
     catacagaaa gggaaaacaa ccatgacaaa aattcgtatt aataaagaaa aaatgaataa    144720
     tcatgctaca accctaggtg agagtgcggg aaagttagat tactatcctt tgaaaaatga    144780
     aaacatgagt tatacgcaaa ctaattctat ccaccttttt cgggaatcat tacttgaact    144840
     acttgaaggc atcgaaaatt taggatctgt tgcgcaagat gatgctactc gaatcaagca    144900
     aatgggggaa gcttttgcaa aacaagataa atccatcagc cagaagatga atttggaggt    144960
     gcgttaagtg gataaacgta cccaagaatt aggtgaaata aaaaaagaga tggagcgaga    145020
     agatgacgct ctatacgcta ttaaaaataa aattagacat ttagaggatg tggaagaaga    145080
     tattcatcaa gctagacgtg aaatggatga catcctttat catatgaaag aagcttggcg    145140
     aggagaacac gcagaggata ctttttggca aatagaagac gaggtaaatc attacaaccg    145200
     gaaaactgct tgcatgacta ccgatattca aaccgaacta aataatgagc aaaaaaagca    145260
     tcaacaaaat ctccacgcgc tcgaaactaa acaacaggat atcacaaagg agatgcgttt    145320
     atgactcgaa tagatattgc tgaagtaaat catttttcac atgaattaaa aatagccaat    145380
     caacaggcta aaacacaaat tacggcaatc caaaatgcta tcattgctta tttacaagat    145440
     gattcgctct ccggagaagc aattagtgcg tctaaaggat attatgcagc gacttattta    145500
     ccgctttgtg cttctatcaa acaagcacta catgtcagcg aggaatcttt aaggaaatat    145560
     attaccgact ttcacagtca agtagatagt tctccaagtg caaaaattga tgcagaaggt    145620
     ctgtatgaat tagatcagaa aataaatcgt ttagaaaata aattagaaca cattcaatta    145680
     gaattaagtt cgatgacagc agtttctagg cagggcgaaa ttaatgcgct tcaaacgcaa    145740
     atatttgcca attataaaaa agaacaactt ttagaaaaat ttcttgattt tgaacgtgct    145800
     catagtcatt tttttcaaga attaagtgac ttagctcgag caatcaatcg tggtgtgcgt    145860
     gatattcagg cgaacatttc ttttaatagc caaactggga tgtacaaagt agataaatta    145920
     aatgcttcaa actttgaacg acttgtggat ttatacgctt ctcaaaaagc aatagatgac    145980
     aaagtaaaag ctatggaaga tattggaatg cttccttata ttccagaagg aaatcgtgcc    146040
     ggatatgtta caactaatgg caaactaaat acggaagcga cgttagattt agttaaccaa    146100
     cagatgattt attggcaaaa tgaaaccggt atgcgcgagt tgtttggcgt tggagctttt    146160
     tatcgagtag tttatggttt ggatgcagtt actgctgaaa ggattggtgg cggacaaagg    146220
     ctagtggatg gctcaacggt gtttttacaa tatgttggag cttttggagt gagtggtttt    146280
     tatgctgagt ttgggcaagt acgaaaactt gattatttgc ctacctctgg cataaagtta    146340
     aaaacgagtc catgggagac cacgacggtt ttagggactt ttaaagatga tacaaaatat    146400
     gttcttgaag aattaggtaa tatcaaatca actgatttta gtatgaaaaa aaatcgtttt    146460
     aacttattga atactcctga tgacctatat aagacaccga atcaattttg ggcagaatat    146520
     aatcaacctt ggttagataa agtaattgca cgaaatgatg atgttatttt atctacagaa    146580
     ccaattgagg ataatttgta taggattaat agggaaactg gattaaaaga attaactggt    146640
     tttggtaaag aatataatta tttacttgaa catggttata aatatgattc aaaatcatct    146700
     aaaatgatta aaaaatagga gagtgatcaa ttggattttt ataaagaagt tgaaaaaata    146760
     ttcaaaggat atgagcaaaa ttatcaattg aagctaacta aaatagataa taatgaagtt    146820
     gctttcatcg gagaaaatta tgctttaggt ataggatgga gcacggatgg ggtggattta    146880
     cattatttca aactagataa ttcgacactc agtaaattta gtttagataa tttattaaac    146940
     agaaacctaa ctaaaatcga acgagaagga atacttccca gcacaacaat ttacgagaaa    147000
     ataattaatg aattaataat ctgcgaaaga ggattcaata atcattttca agaattgcta    147060
     cagggtgaaa cattaagcgg ctatggaaat aaagaatttg tttcgaattt ggagaagagt    147120
     attattgaac gtgaactatt gactcgataa taatgcatat taggagaacc gcattatttc    147180
     tatgaatttg attgcataaa atcttaatac aaaaataaca aagttggtgg atttaatgga    147240
     gtttaagcac gaagtagaaa atatctttgc ggatataatt caagaatatc aatttaactt    147300
     aattaaagta aatgaagacg aaatattgtt attacaccct aattatgctc taactatatg    147360
     gaaaagtaga gaaggtattg atgtttatta tctgtttctt catagcttag aaaaagtgaa    147420
     aataaccaat ttcttatttt caaattatga aaaagatttg ttagccaata taactcctgc    147480
     caataatttg accaaccaaa tttctaatag cttacttatt catgcgagag gtttaagcaa    147540
     atatttccct gaattgttat ctggtcaaaa tgactgggta aaggagttta aagagaataa    147600
     gttttataat gagccgagag ctattaacaa agacgagtat tcagcctatc aaactattat    147660
     aaaaaatatc aatggcaaaa aaattgaagg atttcaaaat gaaatatgaa gcagatttta    147720
     taaatagatt caaatcatta atagaagaat tccagttaaa ttataaagtt atatctgaag    147780
     aggagctagc actttttggt tctaattttg cgcatgtttt tttgattcat tttgatgaag    147840
     tttctttgaa ttatgtatgc cgtgataaag ataattcact tgttagttat gatgtatggt    147900
     cttatttttt gcatgtcttt gatgataaag atagggagaa tttgccaaaa tataattctg    147960
     tgcaggaacg ggttgatatt tcgtttttaa tacttgcaag aggtcttccg cgtcattgga    148020
     gtagtgtgct aaatggagat gacaagtggt tggaagatta taagcagtat gaattagccc    148080
     gtgttcctag aaaagtaatg ggggacttga aggattgttt gagtttatat atttaaccaa    148140
     gaaatgttga gaatgtaaca gcaaagagga gttcaaccat gaaaatagac ggtaactcaa    148200
     aagaaataat ccttaaaaaa gtgaatttct actccataat aattttaaat taatagaaat    148260
     aaaaataacg gatgtcacaa cttattaatt agaaaagctc ataaaatctc tttttatttc    148320
     acaaacaata atgtactatg aaaacatggg agattcaaat acgaaaggag aaaagaaaat    148380
     caatcataca caaaagggta aaattgattt cactttcttt gtgtttatgc tttaaaacct    148440
     ttaacaatta aaaaaacatc atgggatttt tgtatttagg acaacaacgt ataaacaata    148500
     gtgtaatcca gcacaataat tttaaaggag cgtaacttta tgaacgaatt tccagttgta    148560
     tatgaaccag agtatatgac aatttattta cttgttatca tcggtgtctt ttctacaaca    148620
     ttggctttat cacttgaaaa atataagttc actttagcgg gaaaagcgtt gattgggatg    148680
     tgttttattt ctctagctgt gttatttata tatgttttag agttagcata tctttcggat    148740
     acagctgatt tgttatttca tacaatcggt gtttgggaag tagtgctttt cacacatcca    148800
     tatattttct taatacttgc aatcttgctc ggtggggaaa agaaaccgcc acatgtgccc    148860
     aaacctaaaa aataaactat ctaagtcggc ggaatgggaa gatggttttc ctctaggatt    148920
     gtgagaacgg tataatcagc tagctgaatc agtggaaaag taagcttgat tcggtattat    148980
     tcaaaaagga atttaaagtc gaaaatcgtt tgataggttt tcggcttttt tattattgat    149040
     gctttgaaaa tattaaagca gattaggagg aataatatga agtcgcagca gacctttatg    149100
     gtagaggtta ccttttattc tagtgcaaga aaaacggttc cggaagcggg gtatcggccg    149160
     cattttgtga tggagttgga tgaggatcgg gaatatttag gagttgaaat ttatgatata    149220
     gaagtggata cgctggattc ggtggggtat gcaatgtgtt cttttttata tgaacaagag    149280
     ggcgttggtt atagtaagat tcagccaaat aggtctttta tggttatgga gggcgcgagt    149340
     gttgttggga gagggaagat agtgtcgttt catttgtaaa tgacagttaa attgatttat    149400
     gcgttttaca cagtataatt aaactataaa cctatcaaac gaaaaatgat gattccctcc    149460
     tatttgaaaa atacatctaa agggggagtc tttattaatc ttgaccgaag aacttgcgta    149520
     aataaaaaat aaataggaag ttgaaaaaaa tgatacttat aaataaacga gcggaaaaac    149580
     aagattacca gacaatttta gcgatttggg aaaagtcagt tattgtaacg catgattttt    149640
     taactgcgga agataggcag ttttacaaag aacaaattcc tttgtttcta gataatgtgg    149700
     aactgttctt atggttcgct ggtgaggagg tcattggttt tagtgggacg agcgagcggg    149760
     aactagatat gttgtttctg gatccggtag ccacgggtaa tggttatggg agtcagattc    149820
     tgggttggct aatagaaaat aagcggataa acctggtgga tgtgaatgaa caaaatgaaa    149880
     atgccacgag attttatttg aagcatggat ttgtggtttc ttccagaagt gacttggacg    149940
     gttttgggaa gccttatcca attcttcaat tgcaactgaa ggagagagtt aatggagtat    150000
     gaacagctgt tacaaagcga acttggtgaa cttgaaataa ttcgggaaga actacaaaac    150060
     aaagaatatc gaggaatgat tgtaaaaacg gctaaagatg gcacaacgat tcggacgcgt    150120
     ttggcgaaaa aaacagataa aaaaacaggg tactttgttg ctttttggga gaaagatgaa    150180
     cttggtaaga attgtccttt tgatgagaat gatagcgctg attttttatg tattgttgtt    150240
     attgatggtg atttgaacgg tttatttgtt tttccaaggc agtgtttaat tgaaaaggga    150300
     attttaacta gtgaagttgg tattggaaaa atggctgcta gattttatcc atcgtggtgc    150360
     caggatttaa ataaaacagc ggaaaaaaca caagcttggc aacaggtgta ttttaaaaat    150420
     tattctataa gaaaagaaga ccattgatct ggtcttcttt ttattgttta gaaactactt    150480
     gctcgcagta atctaggtaa gcatcgtcta ctagaaaata ttttggaacc attaagccaa    150540
     caatattgat gagtagctct gaattagcga tggcaggatt aatcatttga tgcgagacat    150600
     ttttaatggt tttggtttct aggttttctt ttttgatttg tttggtgtaa acatcttttg    150660
     tttctgctga atcgacattt ttatcttttt cagctaagac gaggtagatt tttgctttta    150720
     cttttgaaag gtctagggtg gcatcttggt tcatgttttt gcggataaag ttgtagcgat    150780
     ctggggtcat tttttcttta ccgccatttt ttttgtagct ttcgtaggtt ttgttattag    150840
     aaataagggt gctgtcggtg aggaaatttt gttgtgcttg cttaacttct ttcgttgttt    150900
     taccagcgtc tttcgcttgc cagccagtgt tgtattctcc ttgacgcatc cagttgatag    150960
     caggggcggc aaggattgag aaagcaatct cattatttgc attcattgct tttgggatca    151020
     cccaaccggc ttgactagcg ccccataagc cgattttggt ggtgctgtct gggtatttta    151080
     ttttcatcca ttcgatcact tggttgactt cgtttgcgcg atcatccatg gactgattta    151140
     gccaattgcc tgaggattta ccaacgccta atttatccca tgaaacagat atatatcctt    151200
     gtttggcaaa tcgttccatc agcggtttat agccaccgtt ttgagttgct tcttgtgccc    151260
     cgtcaccatg aacaaatacg ataatgcctt ttggtttctc gtgttttggg gttgtcacga    151320
     ccgcagaaag ttttccacca gtagttggga ttgcgactct tgtttcgttc atttcgaaat    151380
     cgtttccgat gaaaagaatc gctactaata tgacgatgat tgcgcttatt acaatagttg    151440
     tttttttcca acgtttcatt gtatccactc cattttttgc cattctttaa taccggtgag    151500
     tactcccatc aatgtgctat tttctttttg aatcacttgg aagccaatag ttctatacag    151560
     cttgcaagcg ccattattgt tcttggcaac gtataaagtt atctgttcat catgaaaagt    151620
     ttctaggcaa tgagaaatta acgtttttcc aatgccttga ccacgaaaat ttggcgaaac    151680
     ggttataaag tcaatatatc gttcattttg aacaggtttg tgtgatagaa gactgaggaa    151740
     gaaaatcaat ttgaggcact gtgaaaatga taaaaatttt cttaggtttt gatatagctt    151800
     ttgatgagag tcactcttgc tcgttacaaa catgcaaccg caaattagct catcttgtat    151860
     tgcaattagt aggttttcgc cttgttctgt ataaatgtaa tggcaaaaag cgtatataat    151920
     gtcacgtgct tctgtttctt tgaataacgt ttttgtgaac tttgatttga accctgcgaa    151980
     aactaaagat gttacttctt caacgatatt ttctttttca aatgaattga tgcttttaat    152040
     ggaaagtgtc ataacggcac ttccattgtg taaaccattg cgtctggata ggcgagtgaa    152100
     gggtagatgt tttcgtataa tatcatgctt gttgtagggc gttttaattc ttctaaaaac    152160
     agttggattt gcgtttcaat ggttgcttca tctttggcga taaaagattt acaagcatat    152220
     tcgccggctg gaaaagtata atcacttctt ttttttatgc ttttaaggca gattatacca    152280
     gtgtcttgtt tggagaaaat gtaaaaaggt tcctctaaat ccggtagatt gtgttttgcg    152340
     gcttgggcgt agttgatagt gttattatca attatttggt taggaacttt tttaaaataa    152400
     cgatcgtctt tagctacaaa tgtgatttca tttaaacgca tttctttttg cgaatggatg    152460
     attttttgaa tcgttttttg aatttctact aactcttcta ttttttgttg caaatcttgt    152520
     tcagcctgct ctaacatcgg agtcactttt tcactaagca aactttcttt gatttcttga    152580
     atagaaaagc caatttttct aaaaaggata atttgatata aacggtaaat gtcggcttct    152640
     tcaaaataat aatagccatt ttcgggattt cgtttaggaa ctagaatacc ttcatcgata    152700
     taatgacgga ttttatattt agatatttga aaaagttgcg cgatttcgcc agtggaaagg    152760
     gtaagcatct gaaaacctcc ttatgattta gttttagtat aaactatgtg gttaccacgc    152820
     agtcaaataa aaaaacaaat gacaatgaga atcattatca aacgctgatt tttgtgatat    152880
     aataaacaaa gatttattaa tgggggttag cgatcaaatg ggaaaagtag tattgaaaat    152940
     ggctcatact gccaaaaaat caaagaaagt attaaggtat cttgaaacga accttaatgt    153000
     aactcggggg aagtacaatg attgataagc gtttgtttca attggttgaa aagaaatctt    153060
     tagtgttatt aattcttttt cgtgtgctta gtttggggct gatgattggt ctttggctta    153120
     tttttgctca acaattaacg cattatttag agggccaaag tgtcaattgg ttatggctta    153180
     ttggaacggt tgtagtcgtt ttagttggca aagcgatact taccaaatta gccgagaaac    153240
     aaatttacca agcatcggcg gaactgcgtt tatcaatgcg gcgtgctgtg atggaaaaag    153300
     cttttcggtt aggcaacaac gaaggacagc taccggcatc aacattaacg cagctcgcag    153360
     tagatgggat cgaacaatta gaaatttatt attcacgttt tttaccgcaa ttattttatt    153420
     gtctcatcgc ttctttgatg atttttggaa gcttagttgg atttgcgtgg cagccggcga    153480
     ttgtgttatt aatttgtatg ccgatgattc cgattgttat tatggcagtg atgaaaattg    153540
     ctaagcggat tttgagcggc tattggtcgg attatacgaa tttaggaacc aaatttcatg    153600
     aaaatttaag tggtttgagt attttgaagg cttatgacca agataaatat aagcaagagg    153660
     aaattgtttc tgatgcggaa cgtttccgta aagctacgat gagtttatta tcgatgcagc    153720
     tgaattcgat tacgattatg gatattattt cgtatagtgg ggcggcactt ggtattggta    153780
     tgtctttaat tatgttcaca aatggcaata taagtatgac tggcatgttg atgttcttac    153840
     tactaagcgc cgaattcttt attccaatgc gtcaacttgg atctttattc catgtggcga    153900
     tgaatggaat tagtgcatgt agtaaattgt tcgcttattt agagttaaaa gagcaagttt    153960
     atggctcaga agaattagct aaaccgttag aaaaaatgga agttcgtcat ttaacatata    154020
     catatgaaga aggtaaagct aaagcacttc aagatatatc agctcatttc aataaaggaa    154080
     gtttttcagc acttgttgga aagtctggct caggaaaaag tacttttgtg cgagtgttat    154140
     taaaccaatt gcctggttat caaggggaaa ttatttggaa tgatgttccg ttagctagtt    154200
     tgagcgggga agctattcgt aaacaagctg tgttagtaga taatcatggt tatctttatg    154260
     caaatagtat tcgggaaaat ttattaattg gtaattcagc cgctaatgat agcgatttgt    154320
     ggaatgtttt ggagcaagtt agtttggctg attttgttcg gaagttaccg gagcaattaa    154380
     gtgagaattt agaagagaac ggaagtaatt tatctggtgg acaaaggcag cggttgttac    154440
     tagcgagagc attgctgcgt caagctgaag tctttgtttt cgatgaaatt acgtctggtg    154500
     tggatttgga aagtgaaaaa attattcttt tggtgttgca gaagttagct aaagaaaaaa    154560
     tcgtgctctt tatttcgcat cgcttatata atgttttgga cgcggatcag gtactcattt    154620
     ttgacgcggg gaaattggtg gaagtggcga gcccagaacg attgcaacaa gaatccaatt    154680
     acttcaaaaa ttacttttta gaagaagaag cgttgctgaa agggggagca tgatatgtca    154740
     gaatggacga ttattggttg gttattaaag tttgttaagc cgttacgagg aaagatgatt    154800
     ttggcaattt tacttggtat tataagtaat ttatcggtta tcatgatttc tttgatcggt    154860
     acgtatggca ttatcgcggt gattttaaag caacctctga atccgtataa atggctcttt    154920
     gtaatggttg cttgtggtgt ggttcgcggt ttggcacgat attcggaaca atatttaaat    154980
     catgatattg cctttcgttt acttgcgata attcgtgaac gtatttttgc gactttgcga    155040
     aaactgggac cagctcgttt atctgggaag aaaagtggcg atttagttgc cgcgattaca    155100
     acggatgtcg aagctttgga agtgtttttc gcgcatacaa tctcaccagt ttttattgca    155160
     gttggtacga cgattgtaac tgttggcttt ttggcgacct atgatgttgg tttagcgctc    155220
     atacttttgc taggacaaat cttggttggt gtcgttttgc cgatgattag ttataaacga    155280
     aataaaaaaa tcggaactgc ttatcaaaaa gaattcgttg gactcaatca gatggtaatg    155340
     gaaaatattg caagtttaca agatatattc cagtttaaat tgggcgaaga gcgtttagga    155400
     aaactagaag aacaaggtga aaagctcaat aagcagtata aaaaaagaat acgacaagga    155460
     agcgagctcc aaatatttgg tgaatgggtg ctaattggta cggcgacttt aattttagtg    155520
     ctaggtagtc tttggcaatt accgcttgaa acagtattaa ttggaaccgt gcttagtctg    155580
     agttcttttg gatcggtatt ggcattaaac gctttaggaa cagcgctgtt aactactttt    155640
     gctagtggta agcgattata tacattaact gaagaaaaac ctgttgtatt atttaacggt    155700
     cagcttgaac tatcggattt tgaaagtgcg gagttagata aagtgagttt tagtcatgat    155760
     ggaaaacaac cacttttaaa cgaaatttcg ctagcgcttc ctaaggggaa atggctcggc    155820
     atcggtgggg aaagtggcag cgggaaaagt accttagtaa aactactgat gcgttactgg    155880
     gatccagatg gtcagattaa attaaatgat aacgcactcc ctgaaattac agagtcttcg    155940
     cttcataggc tggaaggtgt tatggagcaa agtacgtttt tatttgaaga cacgctcggt    156000
     aataatattc gtttaggaaa aaaagatgct actttggaag aagttaaaga ggctgcccga    156060
     aaagctgcta tcgatacatg gattgagact ttgccagaaa gttatgacac gatcattggc    156120
     gggcaatcac gaaatttatc agacggcgaa cgccagcgga ttggcttagc tagactattt    156180
     ctccatgatg ccccgttatt attattagat gaaccaacaa gcaatttgga ttatattaat    156240
     gaacaagcga ttttaaacac gctccgttta gaaattcaag ataaaacggt gctggtaatt    156300
     tctcaccgag caacaacatt agacttggca gaagaacaat tatttataga aaatggtgca    156360
     ttgaaacgtg cagtaaaata ataaaaacag cttgtatagt ttacaagctg ttttttattt    156420
     ataaatctac tttctctgag ctttcgaaaa attcaaccgt gtcaagttct gctcatctgc    156480
     tgtgcaatat aaataattcg cgttttacag aaccgctcaa aatattttat cgatttgatg    156540
     agagataatg tccaaagtaa atggacgctg gtttttcatc atatttgacg tactatacaa    156600
     aaactttccc aatttgctca aatagaaatt ctcgtccaaa caaaagaatg aaaatcaaga    156660
     agagcatgac gataccaaaa ataaatactc catatacaag atcaagggga tagcgatgat    156720
     catgttcaat aatatcttcg cttaatgaag ctaatttggc atcaaattgg ttaattaact    156780
     caacgaaatt atttcggccg ataaaggcac agtcgatttt ctccattttg ttttctgttt    156840
     gaaagaatag ttccatcgtt tctggaactt gatacttcaa gaacctacga aaaggttgga    156900
     agttataact tattcttttc acatttgcaa gatgaatcgt ttttgttttg ttgcgtgtgt    156960
     gaataataaa agcattcttt gtgacctgga tccattcttt tggcgggagt agaagtttaa    157020
     caattaaata tcctataaaa aatagagtaa taagaccata gtaaaatgat tctggttttt    157080
     ctattgacaa taaagttaat aagccaaaca agaaaataaa agataaagaa gttaaagctg    157140
     ttccgattgt tttaagtttg tctttgtaat atatcatgat gaacacctgc ttgattgaat    157200
     ttatgttgaa tttaatgata acattgtaaa atataatcat caagttcatt agtgaacttt    157260
     taactaccaa gtaaacaagg aggaacttca tggaaatcac attacaacaa cctacaacag    157320
     ctgactttcc tttcattgaa tggttgtggg gagatttagc aacaacagaa gtgctcggcg    157380
     gaccattttc ttttccagaa gaaacgcgaa tggactggct aaaatcaaaa tcacaagcga    157440
     gcaatgctta ttttattata aaaaaaggta cagaatctgt tggtgaagtt agttttcgcg    157500
     attttgaaaa aggaacagct catttaaata ttaaagtggc tgcatgttat aggggccagc    157560
     gaatcgctca aaaagctttg caattattct tagatttttt ccaaactgat tgcggcggga    157620
     tagttttgtt ggatgaagtt agacgggaaa atgaagcagg cattgggttt ctcgtgaaag    157680
     ctggtttcga agttatagaa gaaaaagaat ggacgatggt gctcaaatgg agtgttcaag    157740
     cagaggggag ttttgaatga gtaaacaaag atgtgcatga ggaattataa aaaattagca    157800
     ggtaagttag atttaaaagt ctaacttacc ttttttagta gttaaaaaag ctgatttctt    157860
     atattgattc attttttaga cacattttaa taaagaataa atgggcgtga taagtccagt    157920
     gaaagcaata ttagcaaggc caaatgggaa ttagcttcca aataaagcga aggaaaataa    157980
     tttcctgaaa taagaaaaat tgcctcctta ttctattgat ttgattatat aagcggagta    158040
     ttatgttgat tgacaatcaa ggaggatact atgaaaaaaa cgatcaagat tacaaccagt    158100
     ttacttttga gctttgcttg tgtatttagt gttggggatt ttactaagcc gcatacagtc    158160
     gaagctgaaa cagtctattc acttacaaat ccaaagccga ttaatgaaat tttttctgat    158220
     ccaaagctcg cgcaagttgt ggcggattgg ttaaagcttc catcagcgac tagcgcggtt    158280
     acgcaaagcc aattgaatac agttaaatct ttgcactttg attcaaaagg tgttcaaagt    158340
     cttgaaggag tagagtattt aaaaaatctc acgcaagtat ttggctatgg taaccaagtg    158400
     agtgatctag gaccattaag taatttaacg caactcgaaa tcatccagat gccaagaaac    158460
     caaataagtg atttaacacc catttcgaat ttgacagcat taatgtcact tgattttgaa    158520
     tttaataatt tacaaacgat tgaaccgata aaaaatttaa cgaacatgtt agaactgaat    158580
     gttagcgcaa atcctatttc ggatattagt gccgttaaaa acatgacgca actggaattt    158640
     ttgactataa gagactgtga ggtaagtgat ttatcgccag ttgaaaatct gtctaatatg    158700
     ctgatgtttt gggcagggag aaataatatt agtgatatta cgccgctcaa aaatatgccc    158760
     aaactgcttg gtttaagttt atttgggaat caaatcaagg atgtgagtgt ggttaaaaat    158820
     cttactagcc ttgaagattt cgatttaaaa gcgaatcagg tgagcgatat tagtagctta    158880
     gcaacgtcaa ctacactcga gacattaact cttagtttca accaaataat tgatatttcg    158940
     cccctgaaaa atttgaccaa tttaactagg ttagaacttg agaaccaaac gcgtgtatta    159000
     gatgcggttg aggtagataa tccattgatt ttacccgctc cagtaattga tgaaaatggc    159060
     agcagagtac agccgacaaa agtaagtcat gcgggtattt atgcaaatgg cgagattaca    159120
     tgggaagggt tgcaaagtaa ttatattcta aattacgagt ataatttacc cgtagcaatt    159180
     ggttcgttaa caacaacgta ttctggtaaa attacccagc cactgttgga gaagcctgtt    159240
     gatccgatta ctccggtaga cccagtagac ccggtagatc cagtagaccc ggtagacccg    159300
     gtagacccgg tagacccggt agacccggta gacccggtag acccggtaga cccggtagac    159360
     ccggtagacc caatagatcc agtaaacccg gtagatccaa tcactccagt agacccgtca    159420
     aatcaagtaa attcaactga tccagtgaag tcagttcttc aagcaactga aactttaata    159480
     aaacagacga tatccgttaa tccgattgta gctaaagata atagaaattt accgaaaaca    159540
     ggggatagtg gaatgacttc tagtttagtt ggcggtttaa ttctagctgt ttctagtttg    159600
     gtattattgc gtaaacgaaa ataaaaaaag gaatttggct tttagtcaaa ttccttttta    159660
     tacgattttt gtgccttggt gaaaggtgag tttccacgag ccattttcga aaatccagat    159720
     gttacttcgc attgtatagg agttttcact tagattttta agtttataat atgataagac    159780
     ctttgtttca tctaaaattt ttatatcata attcatgatt tctagagcgc tatcgccaag    159840
     tgtttttagc gatttgtaat aggaaaagtc tttaacaaca ccactttgcg tgatttcaat    159900
     ataagattcg cttaaaatat cgataatttc ggacatggag tgacggtttt cgagcgataa    159960
     atgtatttgg tcaagttttt tgaagttttc tttcgttaat tccattctaa gtcctccgtt    160020
     ttaaagaaat aaaaaggttc acttgatttt gtaagtgaac ctttttgtgt tattttattc    160080
     cgtcacgatt ttgaatgatt tcatttacga tgccgtaatc ttttgcttca tttacagaaa    160140
     gccagaagtt gcggtctgta tctttggaga ttttttcgta cgattgacct gttgcttcgg    160200
     cgatgagacg attaattctt tcgcgcatcc ggataatttc ttttgcttcg atttcaattt    160260
     ctgtgctttg gccttgaaca ccgccagctg gttgatgaat catatagcgc gtgttaggta    160320
     gactataacg attttctttt tcagcggcta ggtaaatagt aataccagcg cttgcaaccc    160380
     agccagttcc aacgatttta acagtaggct taatgaattt aatcatatca tgaattgtgt    160440
     cgcctgcttc aacgtgacca ccttggctat taataaaaat ggtaatcgga tcattgctaa    160500
     tagattcaag tagtaaaagc tgcttagaaa cgtcctcggc taactcctga ttgatttccc    160560
     cgtaaattaa cactgtgcgt gtatcaatca atttttgggt aaggatgttt gtgatatttt    160620
     cattattttt attctctgcc atgaaaaaat tcctccttaa aaagccttag tttatttgta    160680
     atacaggtat cttatcataa tggtcgaaaa tggtcaaaca ttttgaatac aaaaagaaaa    160740
     cgctttagga tagcgttctc ttcttaattt tatacgaatg cgagttgcca agtaatcccg    160800
     aatttatcag taacccaagc cacttttcga agcgcttcaa cttcttcagg tcccatcata    160860
     accgtgcctt ctttagctag tttttcaaaa agggtatcaa attcatcttc tgtgtctgcg    160920
     aaataaaggg ttgttgtggc ccagctaaag tcaggcgagg cgttgttagt catgtccata    160980
     atcataaatg atgctccctt aatttcaaaa gtagcattca acaccttgcc aatatcgccg    161040
     ccttgttctg gttttgtgaa gtaagttaag ccgatttttt tcgcatctgg aaaagtgtct    161100
     aaataaaaat taaaagcttc ctctccatta ccattaaaag tgaaaaatgt ggagattcgt    161160
     tttgcttgat taaacattta ttttacctcc ttttgaatta ttttaactat acccgaaaaa    161220
     tgtttcaatt atgtgttaaa atggagaaaa atgtacgggg gcatgatgat gaaatatccg    161280
     ataatgcttg atattacagg gaaaagggtt gtcataattg gcggcgggaa ggtggcgctt    161340
     cgtaaagtaa aggggctact ccataccgga gctgatattt taattgtcgg attagacgtt    161400
     ttgccagaga ttaaagagct tcaagtgcag gtgaaagaag aagcataccg ggccgaacat    161460
     ctagctggtg cttttctgat atttatttgt acgaataacc cagaagtaaa ccaaatggta    161520
     ctgaaagatt gcttgccaga acaactagtg aatgatacga cagaacaaaa gaattccgat    161580
     tttttcaata tggcaactgt atcaaaaaat gagttgctag tcggtatttc aacgggcggc    161640
     ggtaatcctg gatacgccaa gaaagtaaaa cgtgaagtca gtcagctagt agaaaattta    161700
     gaaacagaag aaatcggaaa tcgtaataaa aaagataaaa cctgctaatt ttagtaggtt    161760
     ttttattcta ttatattgct ctcttttagg ttgcaaaatt ttactataga ttttggaatg    161820
     taaacgctct atcattgaag tatactgaaa aaatattaag agggtgctga gccaaatgtc    161880
     cattttagaa aagattaaag atgccggagt tgttggttgt ggtggagcgg gctttccgac    161940
     ccatgccaaa tttagcggtg aagtggaata cttaattatt aacgcagcgg aatgtgaacc    162000
     gctcctaaaa acagatcatt ttgtcatgag aaaccatgca gtagaaacga ttaaagcaat    162060
     tgaaatggtt aaaaaccaag taggtgcaga gtttgccgtt attgcaacaa aacggtatta    162120
     cacagaagaa attgcggctt tacggtcagc aattacagaa ctaaatgcaa gcgtgacaat    162180
     acatgagatg gataatgtct atccaactgg cgacgagcaa gtgatggtct ttgaagtgac    162240
     tggacgcgtt gtgccaccaa gcggtattcc acttatggtt ggctgtattg tatcgaatgt    162300
     ctcgacaatg tggaacgtct ttcatgcaat tcaagatgac gcgccagtta ttcgtaaaca    162360
     gttgacagta actggagcag ttggagagcc aaaactttta gatgtaccag ttggaacgcc    162420
     atttgaagta tgtttagcag cagctggtgg aactaattta gacgagtatt tatttttaga    162480
     tggtggaccg atgatgggga aattaaatga tcagtccact attgctgaaa aagttgtaac    162540
     gaaaacaact tcgggtttga ttgtggcaga ggatacgggt tatctgcaca agctacatta    162600
     ccaaacagtg gaacaaattt ttaatgaaac aaagtcggct tgtattcagt gttcgctttg    162660
     ttcggattta tgcccgagac aacaattagg tcatgatatt catccgcata aagtcatgcg    162720
     ccattttgcg gttgcagaag atataacgga tattaaacca gatccgatct gggaagaagc    162780
     gatgatttgt tgcgaatgtg gtatttgtga ggtaatcgct tgtccgatgg ggctttcccc    162840
     gcgccaagta aacattcatg tgaaaaaaga gcttttaaaa caaggtgttc gttatcaaac    162900
     tgataaaaaa gaatttacgc ctgacccgat gcgcgattat aaatcgattg ctccaaaaaa    162960
     tattctaatt aaaatgggct tacagcaata tgctgatgtt catttagaaa caatgcatta    163020
     tttagatgtg gatgaagttt ttatcccaac aaaaatgcat attggtgcgc cgtctattcc    163080
     agtagtaagt gaaggggaca tcgtgaaaaa aggcgattta attgcgaaaa ttcctgatac    163140
     tgctcttggg gcaaatatcc atgcaagtat tgacggtcaa attattcgta taaccgaaga    163200
     acaagttcat attaagaggg tgatgtcatg aaaatggata cattaggatt tctcgaatta    163260
     aatagtattt cgaaaggcat cgaggcggtt gacacaatgc taaaagcggc caactcagaa    163320
     ttgatttatg ctaaagcaag ctgtcctggg aagtattata tattaattgc cggtacagtg    163380
     gattctgtag ctcaatcaat tgaagcggga acgaagattg gtgcggcaaa tatcgttggg    163440
     aacttagtca ttcctcgcgt gtccgaccaa gtaatcaaag caattaacaa aacggaagtg    163500
     ccagatgaga tgaatgcagt tggtgttatg gagtattatt cctgttcagg atcaattatt    163560
     gctgcagatg ccgcggtaaa agctgcagat gttcagctga tggatattcg gttggcgacg    163620
     gggattgctg gtaaatcttt cgttgtttta actggtgata cagcagcatg tgaagcggcc    163680
     gtggaagcgg gacttgcagc tgctaaagag gaagcacttt taattaataa agtagttata    163740
     ccaagacctc gtaaagaagt tttcgagagt ttaatctatt aaaaagataa caatatattg    163800
     tcatagagtt tttgagaaag gtacgcactg actgtggttg cgtgcctttt gaacaatctg    163860
     acaaaatagt ggcgcttaaa tatgatagga ttattttgag atagtttgtc tagatgagga    163920
     gtgaagaaaa tgagttttga tgataataaa gaacgcgtaa tacaagaata tgtaccggga    163980
     aaacaggtga cgctggcgca tttaatcgcc aatccgaacc gtgatattta tacaaaatta    164040
     ggattagaag aaggcgcaag tgcgattgga attttaacga ttacgccaag tgaggcttcg    164100
     attattgcca gtgacattgc aactaaatca ggtgacgttc gaattggctt tattgatcgt    164160
     tttagtgggt ctgttgtact tactggtgat gtttcttctg ttgaatcagc tttacaacaa    164220
     gttgtttatt cattacatga gattttggac ttttctattc caaaaatcac taggagctga    164280
     gtcacttgaa gaaaatgatg gtaatgggtt cagttggttg tggtaaaaca acgctgtgcc    164340
     agaaattaca tggatatgat attttatata aaaaaacaca agctgtggag tattttcaag    164400
     aaatgattga taccccaggc gaatttgtac aacatagaca actatacagt gcgctcactg    164460
     tgacttcggc tgatgcatca gtaatcgcga ttttacaaag tgtaacggag aagaagcaga    164520
     cgttttcacc gatgtttgcc agtatttttg ctaaaccggt tattgggatt gttacaaaag    164580
     tggatttagc ggaatcggac aaagacatcg agcgagcaga gcgggaatta cgcatggctg    164640
     gcgcgaagca tattttttat atttcttcgg tagaggaaac tggaatagaa gagcttcggg    164700
     catatttgga agattaattt taactaaatg ggggttattt tatgcctcaa gtgagggatt    164760
     tatctgtaat tgatgtgcct ggtggttgtg ttttgacgag ctgtgatatt agcgctgggt    164820
     ttggtgagaa agtgcatgat ggcttaagag ttgcgcctga agtgacagca aggttgacct    164880
     tgagagttgc tctactagaa atgcttgctt caggtgctgt agttgtggct gtgagtgatg    164940
     ttatcggagc ggaaatggag ccgaccggta aacgtgttat cgcaggtcta aaagacgaac    165000
     tttttaaggc tgatttaggt catattgaat taaatggtag tactgaagaa aatatgaacg    165060
     taacacaaac tagtgtaggc gttcttgtaa ctggttttgc gactaaagct gcacttaagc    165120
     tcataaatgt gcatgaagct gcggtcttat ttgcatttgg cgaaccgatt gttggagcag    165180
     aagttttgca gagaatgatg gaaatgccag attatccttt ggtcaaacag ttagtttctg    165240
     atagtagagt acttgaagtt gtgccggttg ggtcgaaagg aatggcttat gaggccaata    165300
     ctttagcacg gcttaatgat tgtgttttcg aagccagtgg cgtttttaat gaagcgacca    165360
     tgaataaaac tgctgggccg gcttcggtta ttttagtagc agttaaagca agtgaagtaa    165420
     aggcatttga gcagaatttt ccagctgcta aatgtttagg agagttgagg aattaccatg    165480
     gctgaaatga tgcttgtaac tggtggtgct agaagtggta aaagtaattt tgctgaaaaa    165540
     gaagctgcca aatatgatcg tgttttatat gtggcgaccg gaattgcatt tcaaaatgat    165600
     acagagtttc aagctaggat aaaaaaacat caagcaaccc gtccagaaca ctgggatact    165660
     tttgaagcat ttaaagggat tgctacttac ttggagcaac atggaaatca atatgatgta    165720
     ataatgcttg attgcgtaac gatgttagta actaatttat ttttttcgtt gcttggtgag    165780
     cgcgagttga caaatgagat tgctgatgaa gtagaagcgg cgattcaatc ggaagttcgt    165840
     gcaattttaa aagcaggaaa gcaatcctct gccaaactta tttttgttac gaacgaaatt    165900
     gggctagggg ttgtacctga aaacaagtta actcgagtat ttcgagatat tattggtcgt    165960
     attaatcagc aaattgcaac ggaagtagag gaagtttatt ttgtcgtgag cggcattccg    166020
     aaaaggtgga agtaatatga aaacattgat tttattaatt caattcttta cgcgaattcc    166080
     gctaccgatc caaataaata tggacgagat taacttgaaa aaagggagcg cgcttcttcc    166140
     gcttgttggg gttgttatag gtgcttggaa ttggctcgtt ttttctttag tagcgcttgt    166200
     tatgcctttg ccggttgcga ttatcgcggg actttttgca gaaattatta ttacgggcgg    166260
     attccatgtt gatgcgcttg cagatacagc tgacggatta ttttcttcgc gtaaaaaaga    166320
     gcggatgcta gaaattatga aagatagtcg tgttggtgcc aatggtgtaa ttgcgatttg    166380
     cttttatttt cttttttatg gcgctttatt tctttctgtt ccaaatatac agcagattgg    166440
     ctggttgttt ttcgttttac caatcgttgc aaaaggtgtg acaatgctac tttttgcgaa    166500
     aatgagttat gcaggatcga aagaagggct tggttctatt tttctaggtg ttccttggtg    166560
     gccgattatg attgcccaag ggattgttct cattgtttta gcgttgtttt tctcttatat    166620
     tgggctaatt gcttatgctg gcgtgttagt atttacgatt atttaccggt tatttgtata    166680
     taagcgaatt ggtggaatga acggggatac gcttggtgca ggtgggcaaa tgggacaact    166740
     tgtgtgccta ttttgtttag tgttaatttg ggggttgatg taattgcaac ttatttttgt    166800
     caggcacggc gaaactgact gcaatgcact aaaaaaatat tgtggtcaaa tggacgtggc    166860
     tttaaatgaa aatggtataa gacaaatgaa acgactccaa gaaagactta ctgattactc    166920
     atttgactta gtcgttacca gtgatttaat gcgagtaaat caatctgcag cattgttaag    166980
     taacagaaag ccaattcgtt ttcctggatt taatgaaatg aattttggcg attttgaagg    167040
     atatacatac caagaaatta gtactaagtt tcctgtcgcc tgggatgact attgtagtaa    167100
     ctggcaaaca gctccgtttc caaatgggga aagttttccg gttttttatg agcgagtgat    167160
     agctacattt aaggctgaat gggaaaactg gcagaaactc gatacggtgt tatttgtagg    167220
     gcatcttggt gtattacgcg ccattgcact ttttctacaa gatcaaaaaa tagcacaatt    167280
     ttgggatacc gattttaagc aaggttgcta ttcgctctgg gacaataagt ctcaaagctt    167340
     tctcatttct aatcaatagt agatttttgt tgtttcaggt gaaaacgctt tttttgtaaa    167400
     tcgtttgtgg taagatgtag gtagttaaat aggtcttatg ttggtggaat gtgtttgcat    167460
     ttctgaaaga ggaattcggt atgaagccgg aactgccccc gcaactgtaa ggtggacaag    167520
     aattgaaaat aaccactgtg cgtttttgac gtatgggaag gttcaattgt tgaatgaagc    167580
     caagtcagga tactcgccaa ataagacgga agcaactctt tttcggggtc ctaaaaagcg    167640
     tatgcgggta gtatagctta tttgctgtgc ataaactctc attcgataat ggatgaaagt    167700
     ttttttgttt ttcaagcagc aaaaaagtca tattctgaaa taatcatcga atatgacttt    167760
     ggaaagtact tattttaagg tttcgcggta gccttttgga gttacatcaa actcttttcg    167820
     gaagactttg cagaaatagc tcgtttgggt gaatcctaag ttacgagcaa cattatcaat    167880
     cgaccaacgt ggatttttta gcatatcttt tgcgagcgac attttctttt ggtttacata    167940
     attgataaaa ttaacattca tttctttttt gaataattta ctgaagtaat aagagctaag    168000
     gtagacatga cttgcaactt catcaagtgt aattggacga ttgagatttt tttcaatata    168060
     cttaagtgct tttcgaattt ctttattatc ttcatgatgt gttggtttat tgtgatggaa    168120
     gacgattttt tgtttttgtt cttcgcggct tttttccatt tcagatttca agtaatactg    168180
     ggagataatt gtaagcattt cggcagaaga attgattttt ttagagctga aaacagggac    168240
     agagcgaaac gcggaaatta ggtctttatc gtttttccaa tcagtttctt ctgtttgaat    168300
     attaccaact tcactatttt cttcacaaat aacctgaccg ctgagcaaaa atccgcttag    168360
     ttgattttcg acgacgattg gaactgaaaa atcggttagt ccagcgtgac atcgataaat    168420
     taaaggtttt ccggttttag aagcttccaa cccgccaaac atatcacatt tttggcaaag    168480
     cgagcgatat tttgggttag aacgaatgag ttggcaaaaa ggagtaaagt tacataatct    168540
     tgaaacttcg gtaccgtgta tatctacaac aactgaggct agactagtag cggctgagaa    168600
     ctcatccatg actttttcaa gaagcatttc attgcttttg gtttgtagta acatagctat    168660
     tcccctttcg gcaatacttg gcgtgtttct gtcgttctta gtatagcata tttataatgc    168720
     gcttacattt tcttgccatg aagataacaa tatattgcta agactaattt cataagagaa    168780
     agcccaaacc atgctctact ggatggcttt ttgtcgttta tttttttgaa ggcgcaaaat    168840
     tgtgttaaaa cacgattcgc gtcttctttt tttatattgt aagcggcaac tatttatata    168900
     ttagattgca tatactgaga gagtaaaata cttattttga gaaggaggta cacccatgca    168960
     agaagcacta ggtttagttg aaactaaagg gctagtcagc gccattgaag ccgctgacgc    169020
     catggttaaa tcagctaacg taacattaac agggtacgaa aaaatcggat ccgggcttgt    169080
     tactgtgatg gttagagggg atgtaggtgc agttaaagca gcaacagacg ctggggctga    169140
     agcagcaaga aatgtaggta ccgtaatgag tacacatgtt attcctcgtc cgcatactga    169200
     tgtggaagaa attttaccag tgagggtgaa gtcagatgag taagcaaaat aaactgattg    169260
     acgaaattct aaaacaggta atggaaacgg tcaatgatgc cccggaaaaa atagtagagg    169320
     atggaggatc acgtcaaatg agtgaaaaag cagttcaatt aacagagttt gtaggaacag    169380
     cgattggaga tacaatcggc ctagtgattg cgaatgtaga cggacaactt ttagaagcaa    169440
     tgaagcttga gaagtcttac cgttctatag gtattttagg agcccgtact ggtgcaggcc    169500
     cacatattat ggcagcagat gaagctgtaa aagcaacgaa tacagaagta gtaaaaatcg    169560
     aattaccacg tgatacaaaa ggcggtgcag gtcacggttc tttaattatc tttggtggtg    169620
     atgatgtttc tgatgttaaa cgcgcagtgg aagttgcact gaatgaatta gataaaactt    169680
     ttggagatgt atacggtaac gaagcagggc atattgaact ccaatatacc gctcgcgcaa    169740
     gccacgcact taatacagca tttggcgcac cagtaggtaa agcatttgga cttatggttg    169800
     gtgcaccggc tggaattggc gttgttatgg ctgatactgc ggtgaaatct gccaatgtag    169860
     atgtggttgc ttattcttca ccagcagatg gaacaagttt ctccaatgaa gtgattcttt    169920
     gtatttcagg agattctggc gcagttcgtc aagcagttat ttcagcacgt gaaattggta    169980
     aaaaattact tggagcttta ggggatgaac cgaaaaatga tcgtccatcc tacatttaga    170040
     acggagggta acgactgatg aaatcaaaac gctttgaaga attagcaaaa cgcccggtca    170100
     atcaagatgg ttttgtaaaa gaatggattg aagaaggctt aatcgcaatg gaaagtccaa    170160
     atgacccaaa accaagcatt aaaatagaaa atggaaaagt agtcgaaatg gacagcaaaa    170220
     aattagctga ttttgactta attgaccatt ttatcgctaa atatggcgtc gatttatctc    170280
     gtgcagaaga agttatgaaa atggattctg ttaagcttgc aaacatgctt tgcgacccaa    170340
     atgtaccacg ggaaaaaatc gttttactta caacagcaat gacaccggca aaaatagttg    170400
     aagtagtttc acaaatgaac gttgtcgaaa tgatgatgtc catgcaaaaa atgcgctcac    170460
     gtagaacacc gacaacgcaa gctcacgtaa ctaacttacg tgataaccct gttcaaattg    170520
     cagcagatgc agcagaggca gcaattcgtg gttttgacga gcaagaaaca accgttgctg    170580
     tagttcgtta tgcacctttc aacgcactta gcttattggt aggttcgcaa acaggccgtg    170640
     gtggcgtatt aacccaatgt tctcttgaag aagcaacaga attagagctt ggtatgcgcg    170700
     gtttaacttg ttacgctgaa acgatttctg tttatggtac agaacctgta tttacagacg    170760
     gagatgatac gccttggtcc aaaggtattt tggcaagtgc ttatgcgtct cgcggtctaa    170820
     aaatgcgttt cacatctgga actggttctg aggttcaaat gggttatgca gaaggaaaat    170880
     cgatgcttta tctagaatct cgctgtatct tcattacgaa agcggctggt gttcaaggtt    170940
     tacaaaatgg ttcgattagt tgtatcggaa ttccgggagc cgtaccaagt ggtattagag    171000
     cagttcttgc agagaattta attgccgtta tgttagatct agaagtagct tctggtaacg    171060
     accaaacttt ctctcactcg gatattcgcc gtacagctcg tttgctgatg caatttttac    171120
     caggaactga ttacatttca tctggatata gtgcgactcc aaactatgac aatatgtttg    171180
     cgggttccaa ttttgatgca gatgattttg atgattacaa tattttacaa cgtgatttaa    171240
     aagtagatgg tggtttaacg ccagtgacgg aggaagaagt tgtagcggtt agaaataaag    171300
     ctgcacgagt aatccaagtt gtctttgata aattaggtct tcctgctgta acggatgagg    171360
     aagtagaagc agcaacctat gcacgtggaa gtaacgatat gccagaacgt aacatggtag    171420
     aagatattaa agcagcagca gaaatgatgg accgcggcgt aactggtctg gatgttgtaa    171480
     aagcattagc tgctggtgga tttgacgatg ttgccgaaag cgtactaaac atgctgaaac    171540
     aacgcgtatc tggagacttc cttcatacat ctgccatcat tgataaagac tggaatgtca    171600
     ttagttccgt caacgattta aatgattacg caggcccagg aactggttat cgcttagaag    171660
     gcgaacgctg ggaaaaatta aaagatattg ctgttgcagt tgatgcaaac gaattagatt    171720
     aagctacttc ccatttttta taaaggagga ttaagagaca tggttgaaat taacgaaaaa    171780
     gtgcttcgcg gaattatctc agaagtacta gatgaattac agcttaaaga agataaagtt    171840
     tctttccaaa aagaacagcc aagtgttgca gtttcagatg aaagcttttt aacagaagtt    171900
     ggggatgcga aaccaggaag acaaaaagat gaagttgtta ttgcggtcgc accagctttt    171960
     ggtaaatatc aaacgaaaaa cattgttggc gttccacata aacagatttt acgagaagtg    172020
     attgcaggca ttgaagaaga agggttaaaa gcacgcgttg ttcgtgtatt ccgttcttct    172080
     gatgtagctt tcgtcgcagt agaaggcgac aaattaagtg gttcaggcat ttgtatcggc    172140
     attcagtcgc gcggtacagc attaatccat caaaaagatt tacaaccact ttcgaaccta    172200
     gagttattcc cacaagcacc actaatcaca ctagaaactt accgggcaat tggtaaaaac    172260
     gctgcgaaat atgcaaaagg tgaatcacca aatccagtcc caatggtaaa tgatcaaatg    172320
     gctcgtccaa aattccaagc aaaagcagct ttacttcata tcaaagaaac gaaacatgtt    172380
     gttcaaggta aaaacgcagt cgaactacaa gtaaattaat agtgaggtga gaatgatgaa    172440
     tcaagaagca ctagaaaata tggttagaaa tattttacaa gaagtaaata gtggtgcagt    172500
     aacaacaacc acttctcaaa aagcaagcgg agattcactg actgtacgcg actacccact    172560
     cggtacgaaa cgtccagaac ttgtaaaaac agcttcatct aaatctttgg atgatattac    172620
     gctaaaaagt gttctagatg gcacaattaa acctgaagat gttcgtgtaa cagcagagac    172680
     gcttaaaatg caagcgcaag tagcaagaga tgcaggacgt gctacactcg cgaacaactt    172740
     tgaacgtgca gcagaattaa ccgttgttcc agatgagcgt attttagaaa tttacaatgc    172800
     gatgcgtcct taccgttctt caagagaaga attgcttgcg attgcggatg aattagaaaa    172860
     tgtgtatcaa gcaacaattt gttctaatta tgttcgtgaa gcagcacagc tttatcaaga    172920
     gcgtaagaaa ttaaaaggcg ataattaaaa ttcacctttg ctcatgatta tgtaggaaat    172980
     gcggtgaaat gaatgaagta tattgcaggt attgatatcg gaaactcgac aactgaagtg    173040
     gcgcttgcca tcctcgactc ggtaaataat gcggagtttg ttgctagcgc tattacagac    173100
     acaactggta tcaaaggaac aaaacaaaat cttcatggga tttttaaagc gttaaaacta    173160
     gctttagaaa aagtaaatgc aacaactgcg gatttagctg aaattcgtat taatgaagcg    173220
     actcccgtga ttggtgatgt agcaatggaa acaattactg aaacaattat cacagagtct    173280
     accatgattg ggcataatcc taaaacacca ggtgggcttg gaatgggttc aggaattaca    173340
     gtacatttgg atgaagtggc ttctaaatca aaagatactg attatatcgt gattatccca    173400
     aaaacggttg actttgaaga tgccgcacag cagattaatg attataccga acttggctat    173460
     caaataactg ctgcgatcct tcaagcagac gacggggtgc tcgttcataa tcgattaaac    173520
     cataaaattc cgattgtaga tgaagttggt tttattgata aagttccagt tgatatgtta    173580
     gcggctgttg aagtcgcagc tcctggtaaa gtcattgaaa cgatttctaa tccgtatggt    173640
     attgcgacag tcttccgttt gagttctgat gaaacgaaga acatcattcc cgtagctcga    173700
     gcattaattg gtaatcgttc agcagttgtg attaaaacac cagaaggcga cgtaaaagct    173760
     agaacaatac cagccggaca tattgaactt caatcaggaa ctagaacgca gcgtgtaaat    173820
     gtggcggaag gttccgagaa aatcatgcaa gcgattatgt cactgccaaa acttgataat    173880
     gcaagcggcg aaccgggaac aaatatcggc ggcatgctag aaaaagtacg acaaaccatg    173940
     gctggactta ctgataaatt accggcagat atttttattc aagatttgct ggctgtagat    174000
     acgtttgttc cagtagatgt tcaaggtggt ctggcgggtg aattttccat ggagcaagct    174060
     gttggaattg cctcaatggt aaaaagtgat catttacaaa tggctgcgat tgcctcagaa    174120
     atcgaacaag agctaaatgt aacggtcaaa attggtgggg cagaagctga ggcagcgatt    174180
     ctcggggcac ttactacccc aggaaccaat acaccacttg ctattttaga cttaggagca    174240
     ggttcaacag atgcttcaat cataaatgga aaaggcgaaa tcattgctac tcatttagct    174300
     ggagcaggtg atatggtaac gatgattatc cagtcagaaa ttggccttga agatcggtat    174360
     ttagcagaag atataaaaaa atatccactt gctaaagtcg aaagcatttt tcatattcgc    174420
     catgaagatg gtacggttca atttttcgat acgccgcttt ccccaagtgt ttttgcgaaa    174480
     gtagtgattg taaaaccaga tggatttgta ccaattccag gtgacgtttc gattgaaaaa    174540
     attaaattaa ttcgtcgttc ggctaaagag cgcgtttttg taacgaatac gatccgtgca    174600
     ttaaaatatg tcagcccaac tgggaacatt cgtgatattc catttgtcgt tattgtcgga    174660
     ggatcagccc ttgattttga gattccgcaa ttaatcacag atgcactttc tcattattcc    174720
     ttagttgcgg gacggggaaa tattcgcgga caagaagggc caagaaatgc ggttgcaaca    174780
     ggattaattc tgtcgggtgg tgctaatgta tgattccggt tgtaaataaa ccagcaattt    174840
     attttcatgc agaccaaagc gcgaatccag actgtattaa acaagtatta tttggaatag    174900
     aagaagaagg cattccatgt gaattagaaa ttatgccttt aaaagacgaa gtgcaagccg    174960
     catttcgagc ttcagcgagt tcgccacttt tggttggaat tacgctcaaa aatgatcatt    175020
     tagtgattca ttatcgtaat ctgccgccag atcagccgct attttcagaa tatcgttttt    175080
     gcgcagcgac cttggaaaaa caacgaaata tgggaatgaa tgcggcgcga ctcgtcaagg    175140
     gtgtaccttt taaataagga ggtgaaggaa tgcatcaagc aattggaatt attgaaatta    175200
     aaggacttgc ttcagcgatt actgtagcag atacaatggc taaagtagca aatatccaaa    175260
     tcgtggacac agaaaaagca aaaggttttg gctggattac tgtgaaagtg gaaggagacg    175320
     ttgctgccgt caatgccgct cttgaagcag gagaacaaac ggcaatagcc tcagacagct    175380
     ttgttgcgaa aaaagtcatt cctcgaccag gggaagagat ttttacagta tttttgccaa    175440
     aagaagaaat cgtgccagaa gaacctgaat taattgttga aacagaagac gtcgcggaac    175500
     ctgaaacacc ggtagaagcg acctgtaatc tatgtcatga tccactttgt ccacggataa    175560
     aaggtgatcc aagacaagat tgtattcatt ttgaagaaga aaagtaaacc taattttgag    175620
     gaggaaataa taatgaataa cgcactagga atgattgaaa ctaaaggact tgttggcgca    175680
     attgaagcag ctgacgcaat ggtaaaagca gcaaatgtat cgcttgtagg ttatgaaaaa    175740
     atcggttcag gacttgtaac tgttatggtt cgcggtgatg ttggcgcagt aaaagcagca    175800
     acagatgcag gcgcagcagc agctcgtaat gttggagaag tacaatctat ccacgttatc    175860
     ccacgtccac acaatgatgt agaaacgttg ctaccaaaag gtttataagc cgtggaaaga    175920
     gaagaattaa aggcaataat taagaaaatc gtaacagata aatatggtgg tgcggagaca    175980
     gagattccaa tcggagtctc taaccgccac attcatttaa cagaaaaaga ctataaccaa    176040
     ctttttccaa atgaacctat tcaagtgaaa aaatggttaa agcaacctgg cgaatttgct    176100
     gctgaacaaa ctctcaccgt agtttcagaa agaggcgagt taaagcgggt tcggatttta    176160
     ggtccgcttc gaaaattttc gcaagtagag ctttctaaaa cagatgcacg gatgttaggg    176220
     atgaagattc caattcgtgt atctggtgat attgaaggaa caccagggat caaactcgtt    176280
     tctaaacata acgaaatctt cttaccaaaa ggagcaattg ttgcgaaacg ccatatccat    176340
     ttacccgaaa gtgtagcaaa tgaatacggt gtgaaacaag gtgatgaagt ttctgtccta    176400
     gtaggttcgg aaatacgtag tctcgtgtta aaccattgta cgattcgagt gaataatcaa    176460
     tttatcccag aaatgcatat tgatacagat gaagcaaacg cggcagatat tgctggcgat    176520
     agctttgcaa aaataatcaa gtcgtgacct gataaggagg tgtggaaatg gatattttac    176580
     aaacagctaa cgaacggatg gaacagcttg cagcactaat gaataaagat accaaacaaa    176640
     aggtttcagc ggatcaaaaa gtaaaagttg gcgtcgattt agggacttcc tcgattgttt    176700
     tcgttgtgtt ggatgaaaat aatgttccgc tttttggagc gtttgaattt gctgacgctg    176760
     ttcgcgatgg gcttgttgtt aattaccgcg agtccgtaga agttgtcaaa cgacttaaag    176820
     atagagcaga aaaaagcctt ggaataagtt taacgcatgc ttctggagct attccacctg    176880
     gtacaatcgg gaacaacaaa aaagtggttg ctaacgtgat agaaagcgcc ggaatggaag    176940
     cactttatac aattgacgaa ccaacagccg ctgcagcagt actagattta aaagatggtg    177000
     cagttgtaga tgttggtggt ggcacaacag gaattagtgt ttttaaagac ggtgacgtaa    177060
     tttataccgc agatgaacca accggaggaa cgcatatgac acttgttcta gcaggatatt    177120
     acggtgtctc tgtagaagaa gctgaagaaa ataagcgcgc gcaaaaagat tctagcgagc    177180
     atttttctgt catgcgtcca gtagttgaaa aaatggcaga aatcacccgt gttcatctcg    177240
     aaaaatctcc ctcagaaccg ctttatattg ttggtggtgc ttctgcttat agccagttca    177300
     aagatacgtt tgaaagctat ttgaagatgc ctgtttttca acctaattat ccgcagtatg    177360
     tcacgcctct tggtattgcc atgagttcag ggagcggaaa tttatgatag aaaaattagt    177420
     tgaaatcatt gttaaacgct tgaaaattcg tgccgcaaat aaaacagtca tcgctgttag    177480
     caaaatgcct cgcgatccag ttgcgatttt tatggaaagt gggacagttc ggttaaccca    177540
     agtaaacaaa cattttcttg agcggatact aggtggaaac cgagcagaat cacttactat    177600
     ttggcttgaa actgcagcag aatacggggt aacaattgaa cttgaactgt atgataacgg    177660
     cgaaccttgg ctggattata aaatgctcag tcagctagtc tatccagttt ttacaagcgc    177720
     tggtgagagg ctttttcatc caagttctga agtgatttgt tacagtgata gcgcattaat    177780
     cccaagcgga agtactcttt gcaaatttaa aaagcagctt attacaccgc ttgcaaatga    177840
     atatttaact aaaaataata ttgcagtgcg ggaaaggcag tgacgttatg tttatggcga    177900
     aaattactgg aagcgtagtc tcgacaaaaa aagaagattc gcttacaggc aagaaattaa    177960
     tgattgtaca accaattgat gcgaacggag aacatgtgcg ctcagaagaa gtggcatgtg    178020
     actctgttgg cgctggaatc ggggagtatg tgcttgttgc tcgtggaaat gcggctagga    178080
     gcgtatttgc agaaccaaat agtgcgattg attcggcaat tatagcaatt gtcgatagtt    178140
     ttgataagta aggagtgaat aactcgtgag tatttataca aaaaccggcg ataaaggaac    178200
     gactgcacta tttgatggaa atcgtgtgaa aaaatatgat gaccgtgtcg aaacatatgg    178260
     ttcgtttgat gagctaaatg ccgaaattag tgtagcagaa aagttcgtta cctcgcatga    178320
     aaacaagact ttgcttagaa acgttgagcg ccaattgttt tacgtttgtg cagagcttgc    178380
     aacagaagat gaatctgcgc ttgctagtaa aattgtcatt acagaagatg acattaacga    178440
     acttgaaaaa gttattgatg cttatactct gaagttgcca aaagttgata gttttgtgct    178500
     tcctggttca agtaaagccg gcgcgtttct tcatagtgcg cggacgatag ccagacgagc    178560
     ggaacgatta ttagttcgtt tttcagaaca aacagcagtt agaaatgagc tgttgaaatt    178620
     cgtcaatcgt ttatctgatt tcttgtatat tcttgctcga gaagaagact ttagacagat    178680
     gctagataaa gcgactaagc taattgttgc caagtactta gagcaaacag aacaaaagcc    178740
     tagtacgacg agcgatttat ctttttcatt ttgtgaaaaa ctaatgcatc aggtgcaggt    178800
     tgtctcagaa gaagtcggcg ttccagtcac acttgcaata gttgatgcgc acggaaatgc    178860
     aagatttaat taccgaatgg aacacgctct cttagtaagt gcagaactag caacgaaaaa    178920
     agcatattcc gccgtagcga tgaaaacaag tacagaaaaa ttaacagaag cagttcagcc    178980
     aggagcccca ctttatcaat tagaaacact gacaaatggt gacattgtta cctttggcgg    179040
     aggcgttcca atttacggaa aagatggagc gattattggt ggaatgggaa ttagtggcgg    179100
     atcagtggaa gaagatatcc acattgcaaa aaaagcatta tcaatgatag agaaggggta    179160
     attctgtatg gaatcattag aactcgaaca actggtaaaa aaagttctct tagaaaaatt    179220
     agcagaacaa aaagaagtac caacaaaaac aactacacaa ggcgcgaaaa gtggcgtttt    179280
     tgatacagtt gacgaggctg ttcaagcagc agttatagcg cagaattgct ataaagaaaa    179340
     atcacttgaa gaacgccgca atgttgtaaa agcaattcgt gaagcacttt atccagaaat    179400
     tgaaacaatt gcgacaagag cagttgcaga gactggtatg ggaaatgtga cagataaaat    179460
     tttgaaaaac acgttagcaa tcgaaaaaac gccaggggta gaagatttat atacagaagt    179520
     agctacaggt gataacggta tgacactata tgaactctct ccgtatggcg taattggtgc    179580
     agtagcgccg agcacaaacc caacggaaac attgatttgt aattcaatcg gtatgctcgc    179640
     agctggaaat gccgtttttt atagccctca tccaggggca aaaaacattt cactgtggtt    179700
     gattgaaaaa ctaaacacaa ttgttcgcga tagttgtggt atagataatc taattgtcac    179760
     cgtggctaaa ccatccatcc aagcagctca agaaatgatg aaccatccaa aagtaccgct    179820
     acttgttatt acaggtggtc cgggcgttgt tctccaagcg atgcaatcag gtaaaaaagt    179880
     gattggagca ggagcaggga acccgccttc tattgttgac gaaacagcta atatcgaaaa    179940
     agcggctgct gacatcgtag acggagcatc ttttgaccat aatattttat gtattgctga    180000
     aaaaagtgtg gtagctgttg atagcattgc tgatttcttg ttattccaaa tggaaaaaaa    180060
     tggtgccctt catgttacta atccaagtga tattcaaaaa ttagaaaaag tagccgttac    180120
     cgataaaggt gtaactaata aaaaattagt cggaaaaagt gcaactgaaa tcttaaaaga    180180
     agcaggaata gcttgtgatt ttacaccacg tttaatcatt gtggaaacgg agaaatctca    180240
     tccatttgca acagtagagc tattaatgcc aatcgttcca gttgtaaggg tgcctgattt    180300
     tgacgaagcc cttgaagtgg ctattgaact cgaacaaggc ttacatcata cagcaacaat    180360
     gcattcacaa aatatctcga gattaaacaa agctgcaaga gatatgcaaa cttccatctt    180420
     tgtcaaaaat ggtccgtcct ttgcgggatt aggctttaga ggagaaggta gtactacttt    180480
     cactattgca acgcctactg gagaaggaac aactacagca cgtcattttg ctagacgccg    180540
     ccgctgtgtt ttaacagatg gtttttcgat tcgttaagag gaggcaaagt taatgaatag    180600
     ctttcaaatc aagacaaaag tagcttttgg tacgaatagt ttacaagttt taaaagaaat    180660
     taaaaataaa aatgtttgga ttatttgtga tcgttttttg gcggatggag agggacttca    180720
     aggtttagtt gggcagttag atgcatctaa taatgtgcat attttcaccg atgtagttcc    180780
     agatccaccc atttcaaaag tagctagtgg tgttagtgaa gcaggaaaaa ttcagcctca    180840
     agtcatgatc gcttttggcg gtggctcagc aattgatacg gcaaaaggaa tttactactt    180900
     cgcaaaacgc ttagaaaaaa ttaatattag tacttttata gcgattccaa ctacaagtgg    180960
     cactggatct gaagtgacag ctgctaccgt tattactgat ccaacgacaa aaattaagta    181020
     tccacttttc ttagatgaac ttattccgga tatggctatt cttgacgcgc aactcgttgt    181080
     cacagtgccg ccagcgatta cagcgaatac tggaatggat gtattaacac acgcgattga    181140
     agcttatgtt tctaaagctg cgagtgatta tacggacgca ttaggtgaaa aaagtgtgca    181200
     attaacgcta cgctttttaa cgagctgtta tgacgatggt cgtaatttag ctaaccgtga    181260
     aaaaatgcat aatgcgtcga ccatggcagg tatggctttt aactgtgcca accttggttt    181320
     aaatcatagt attgcgcatc aactaggtgc acagttccac gtgccgcacg gtctagctaa    181380
     tgcgatatta cttgatgcgg tcattcgttt taacgccttc aaaaatcgtg atactgaaca    181440
     aaaatatgct gaactggcgc ggatttgcgg aatggcttct agatctgatt ccaatgaaac    181500
     cgctgtccgt ctgcttcgtg aaagaattgt ccaaatgatg gaacacatgc aaatgccacg    181560
     aacattgaca gatgctggcg tagcaaaaga aaaagtctat gcaaaaatgg acgaaattgc    181620
     aacaaatgca ctgaaagacg cttgcttgcc aacaagtccg acgacaccga cacatcaaga    181680
     actaaaagaa attttagaac aaattattta gattttacgt taaaaaggag gataaactat    181740
     gtcagcatat ttggcggaat ttattggaac gatggtactt attatgtttg gtaatgggct    181800
     tttagcaggt ttaacattaa ataaatcatt atcacaagga gcaaactggg tagttgttac    181860
     atttggttgg ggttttgctg taatgattgg tatttatgtc gctggagcat atagcggagc    181920
     gcacttaaat ccagcagtaa ctattgcgct tgcagttgga ggttcattct cttgggcagc    181980
     tgtagttccg tacattatcg cccaaatcgc cggagcattt gtcggagcat cgattattat    182040
     tttacattat tatccgcatt ttaaagccac accacaagaa attgatacac acggtatttt    182100
     ttctactgga ccagcgattc gaaatacacc gttcaactta atcagtgaga ttattgcaac    182160
     gtttgccttc atttttggat tacttatgat cggcgagaat agttttacaa atggtttaaa    182220
     tccgttaatt ctcggtttct tagtagttgc aatcggaatg agctttggac caacgacagg    182280
     ttatgcgatt aacccagctc gtgatttagg accaagactt gcttactttt tactaccagt    182340
     accaaataaa agtggatcag actggcgtta cgcttggatt ccaattgtcg gaccaatcat    182400
     tggcggtctc ttagccattg gactatttaa cattttatta taaaaaatag gatggagtaa    182460
     acaagaagta agttgtttac tcctttaaaa atgagaaagg actgagctat atgcacaaaa    182520
     ttatggcgat aaacgcaggg agttcttcac tgaaattcca aatttttacg atgccaggag    182580
     aagaagtctt agttaagggc ttaattgaaa gaatcggctt accagatgcc atattcaaca    182640
     tgtcctttca aaatgaaaaa atcaaggaaa ctcgcgcgat aaataatcac ggagaagcag    182700
     tggaaattct actggagcaa ttgaagacgc atcaagtaat taatgaccta aatgaaatta    182760
     caggagtggg acatcgggtt gcgcacggcg gagaagcttt tgtttcttca tgtattgtaa    182820
     cggatgatgt tgtaaagggg attgaagatg taacaagtct tgcgccgctt cataatccag    182880
     ccaatatcat cggcattaaa acattccgcg aactattacc aaatgccgtt tcggttgcag    182940
     tgtttgatac ggccttccat caaacgattc cagaagaaaa ctttttatat gcgctccctt    183000
     atgaacttta tgaaaaacat catattcgaa aatacggttt tcatggaaca agccataaat    183060
     atgtggctgg aaaagcagca gaagttctca agaaaccttt agaaaaatta aaaattattt    183120
     cttgtcattt aggaaatggg gcgagtgttt gtgcgattga agcagggaaa tcagtgaata    183180
     cttccatggg ctttacacca aatgctggct tgatgatggg aacacgttct ggtacaattg    183240
     acgcgacaat catcccttat ttagttgacg aattaggcta tagcttggat gaagtgacac    183300
     atatgatgtc tagtgaatct ggcgttcttg gtgtatccgg aatttctagt gattttagag    183360
     acatcgaaat tgctgcgaat gaaggaaatt cgcgtgcatt attaacactt cggatgttta    183420
     ctggccaaat ctgtaattat atcggggctt acgcttctgc catgaatggt tgtgatgcat    183480
     tattatttac ggctggagtt ggtgaaaatt caccattaat tcgtaaaatg gttacagaac    183540
     agctgagtta tcttggtgta acatgtaatg tgacaaaaaa taatgcaggt gatatgataa    183600
     ttagcaatga tgacgaagcg gtcaaagtat gcattattcc aacaaacgaa gaactaatga    183660
     ttgctcgaga tgtagaaaaa tatacaaaac aaacgataag ttaaggagcg atttgatgtg    183720
     aaaataacga cggcaatgca cggtggcaac tataacgaac tagcaaaaca acatggatta    183780
     accaaagaaa tgattctgga ttttagtgcg aatattaatc cacttggcgt tccagctagt    183840
     ttgaaacaaa cgataacagc gaatttggat aaactggtgg aatatccaga accagattac    183900
     ttagcgctcc gtgcgcgtat tgcctcgttt catcaacttg acttagcaaa tgttattcca    183960
     ggaaacggtg ctactgagct gattttcgga atcgcaaaag taaccaaggc gcaaaaagtt    184020
     ctcttacttg cgcctacttt tgcggaatat gaacgggctt tttttgatgc ggaaattatt    184080
     tatgcagaat taacgaaaga aactcatttt gctgcagcgg aaacggtact agaaatgatt    184140
     aaacgcgaaa cagatcttga agcggtttgt ttgtgcaacc cgaataatcc aaccggacaa    184200
     ttaatatcgc agcaagaaat gatccaaatt gcagaattat gtgaagaacg aaacatatat    184260
     ttaatcattg atgaggcgtt tatggatttt ttagaaggca acgaaacaat ttcgatgatt    184320
     aattatttag ggagctttcc acatttagca attatccggg cattcacaaa attttttgca    184380
     attccagggc taagacttgg ttatttgttg accaaaaatg atttgctagc tgaagcatta    184440
     ttacaaatgc gtgaaccttg gtctatcaat acttttgccg atatggctgg tcaagtatta    184500
     ctagatgata cagactacat cactcaaaca tacaactgga tttcagctga acgagatttt    184560
     ttatatcaag agttgtctaa gtttagcgaa ctaaccgtgt atcgcccaag tgtaaactac    184620
     atatttttcc atcttgaaac accgcttgac ttacgaaaag aattattgtt aaaagggatt    184680
     tttatacgga gttgcgccaa ttaccgtgga ctcactgaaa attattaccg agttgcggtg    184740
     aaagctagat gtgataatac caagcttata agagcgctcg aggtgatttt tagtggaaat    184800
     taaagcaact tgtcccgctt catgtggcga acttttgcaa ggatttatta ctggcggcga    184860
     aaaattgatt tcatacccaa tcaactggta ttccgaagta actttatccg ataaatcagg    184920
     gcaaaacagc caaggtcata caaaagcatg gctcgcattc gaggtaactt gcgagtattt    184980
     tggcgtgaca aaaaaagaac gtccacctat atcgttacta gtaaaatcga ctattccggt    185040
     cgccaaaggg atggcaagct ctactgctga tattgccgca acaatagggg ctacagcaaa    185100
     atggttaaat aaaccgataa cagaaaccga aattgccaaa ctttgtttac aactagaacc    185160
     aacagatagc acgattttta aatcactcac actttttgat catttaaaag ggtccgtgat    185220
     tgaaagttct aactggatgc cgaaactggg cgtcgttgtc ctagaaccac ttactgtttt    185280
     ggaaactgca acatatcggc aagaagacca ccatgaacaa ttgctggaaa atgaacaaca    185340
     attagccaaa gctgtgcaat ttttcaacca agcggcagcc caaaaatcaa tcaacttgct    185400
     tggaaaagcc gccacagtta gcgcagcgag caatcaaatc attttaccca aaccgttttg    185460
     gaatgagttg ttagaagtgg tgagttgttt aaatctagta gggatcaatg tgtcgcatag    185520
     tgggacggtc gttggtttac tgtatgagtt aggtaagata gacccgctag aaattttatt    185580
     cgaattagaa cgacgctatg tcaccacttt ttacagcagg tattacttta gggagctcgt    185640
     tcgaggtggg gttcaaataa tttcataaag caaattcttc ttgcaagcgg attaatttat    185700
     gctataataa ctttgataaa cgaattcgtt catacaaaca gttagatact ggaagtctgg    185760
     tgaaaatcca gcacggtccc gccactgtaa ggagttagac actctaagtc aggtctttta    185820
     tctaattgtt ttaactggtt atactgcttc gaggcaaagc atgtataatt cttggttcca    185880
     gtgtagttgt ctcactgggg cttttttatt tgtttttaaa acaaataagc ccactgtaaa    185940
     tggtttggtg ccgagaagct ggacgaagct acgttttatc aagcaccata cgcacaaaga    186000
     tgtgcaccgc ttagttttat ggtgggcaat gatcttttca acgacgaaaa gagtgataca    186060
     aggaacgtat cttcattgcc tatttacaaa aaaagatttg acatttccac gcgtttggtt    186120
     tttaataaag tggacaaata aaatatttta cggtacaaag gcgtactgtt tacttagcaa    186180
     agaagctttg agttggaaga ggaaatttct ctactcaagg cttctttttt tagttttaaa    186240
     aaattaggag gtaatctcat gcaaaaagtt agttttaaaa cagatcttta cattggccaa    186300
     ggagcaacag atcgtttact ggattttaaa gacaaacaaa ttttcatcgt aacagatcca    186360
     tttatggtga gctcaggaat gattaatgct attacggaaa aaattgataa gtcgaataca    186420
     tatactattt ttagcgatat tattcctgac ccgccaattg aaaacgttgt agctggaatt    186480
     gaagttttaa acgaatgtga tgccaacttg atgatcgcta tcggtggtgg ttccgcgatt    186540
     gatgcggcga aagcgatgaa attctttggt caaaaacttg gtacggtgcg cgcaatgcca    186600
     ttcatcgtaa tcccaactac aagtggaact ggttctgaag ttactagttt ttctgtcatt    186660
     acgaataaag aaaaagcaat taaatatcca cttattactg atgctatttt gccggatgaa    186720
     gcgattttag atgcggattt agtgaaatct gtcccacctg caatcacagc agacactggt    186780
     atggatgtac tcacacatgc gctagaagca tacgtttcca caaaagcaaa tgattattcg    186840
     gacgcaatgg ctgaaaaagt aatccaatta gtattcacat acttggagcg cgcttataaa    186900
     gacggaaatg atttagaagc acgcgaaaaa atgcataatg cttcttgttt agcaggtatg    186960
     gcatttaata ttacctcact tggtttaaac catggtatcg ctcacacagc cggtgctaag    187020
     tttaaaattc cacatggtcg tatgaatact ttacttttgc cacatgttat tagttataat    187080
     gctggattaa caagtgattt tggtaacaat ccagataacc gtgctgcaga acgttataca    187140
     gcaattgcca aattactaaa aatgccagct tccaatacaa gacttggcgt tcgtagctta    187200
     attaacgcaa ttaaacaact tcaaaagaaa ctcaatatgc caacaacatt atctgaatgt    187260
     ggcgttagtc gtaccgattt aaacgagcat attgcgcaaa tcgcggaagg tgcgctgaat    187320
     gatggttgta ctgcaactaa tccaagaaca ccgacagaaa cagatgttag tgcgattctc    187380
     gaaaaaatgt tggcttaaaa gttatttatt tcacaactgg aaacaaataa cctattgaca    187440
     tcgttttcat gctactttat aatagaaccg agcacaaaga cgtgtggaat aataaatata    187500
     gcagagcaac ggggctccct caaaaatatt gcacaatatt tttaaggggc tctttctatt    187560
     ttctgggaga attttttctc tagctcttta actctttcgc tcaagtatat gcttctatag    187620
     agtgatttcg tagagctttg ttacgaatca atcaatagca gaagaagagg acgtgacagg    187680
     aatgaatgga agaattgtaa tagccgatga tgaacctatt acaagaatgg atatccgaga    187740
     catattggaa gaagcgaact acaatgttgt aggggaagcg acagatggtt ttgaagcaat    187800
     tgaactttgt aaaagccatc aaccagatct tgttattatg gacattcaaa tgccactctt    187860
     agacggttta aaagcaggga aacggattat ttctgaaggc cttgctggcg gtattatttt    187920
     attaaccgca tttagtgatc ccaaaaacac tgaaaaagca aaaggattcg gagcattagg    187980
     ttatctagta aaaccacttg atgaaaaaag tttaatccca acagttgaaa tgagtattgc    188040
     caaagggcga gaaacaagaa aactagagca gcaattagaa aagctcacaa aaaaattaga    188100
     agaacgaaaa gtgattgaaa aagctaaagg tgtgcttatg attgagaaca acatcacaga    188160
     ggaagaagcc tacaacatga ttcgtaatct gagcatggat aaacgttgtc caatgatgga    188220
     aatcgcagaa acgattgtga tgagcgatga ctaagacgat tcgagaaatg tgtttacgct    188280
     atacggactt ggcagaatat gatattgatg aattaataca tactgcaaaa tcgttaagcg    188340
     agtcttccat gtatcaagat gtagatgttt tcattgatgt ttataacaaa cttactagtg    188400
     aagcacttgt tattcatcat acgccgccaa aatcaaccaa gtcactttat aaaaacaatg    188460
     tagttggaga aactgctctt cggagtaatg aacctggtgt acttagaaca cttgaaacag    188520
     gtatgaactc caacgacttg cttgccaaaa cacaagaaaa cgtattaatt cgtcaaaaag    188580
     tgtatcctat ccgtaacaaa caacgagtca ttgccgtact tattctagaa aatgatatta    188640
     gtgcagaaat taaagctcat tttgaaatcg acaatgaaga aacagcctat agggatgttt    188700
     ctacaacact ttccgcgatg agtaaattaa ccgattctat tactgatcaa ctagatgatg    188760
     caatcttgat ttttgatcgt aacggtattt tacaacaaaa aaactgcgct gctgaccagt    188820
     attatgaacg actcggctac atggaaaata tccaaggaat gcattatgat aatttatctc    188880
     tcgaccagat gatgtttgat gcaattatgt atcaaatcga aacgggaaaa cagccagttc    188940
     aattaaaaaa agaagtggtt attgccggga attactttat tatgaagcaa atttttgtga    189000
     aagaagagga tgaacaagaa tgtcgtttta tccttatctt acatgatgtc acggatatta    189060
     aagtgaaaga agcggaaatc gtttcaaaat cggtggcaat tcgcgaaatt catcatcgtg    189120
     tgaagaataa tctacaatca gttgtttcac tgctgagaat tcaaggcaga cgttctacaa    189180
     gcgtggaagc acagaaggtt ttgaatgaga gtgtcagtcg tatccttgca attgcagcta    189240
     cacatgaact tttatccaag cagatggaag acggcatcaa cttatatatg gtaattgaag    189300
     cagtcgccta taatattgaa agatgttgta acgattgtcc gcaagttgca gttagaatgg    189360
     atattgataa acggatttac ttggatagtg accgaaccgt ggcactagca cttgttatga    189420
     atgaactact acaaaattca tatgatcatg ctttccatcc aaatgaatca ggcgaaattt    189480
     tactacaaat aaaagaagaa aaaaatatta ttcacgcaga agtaagcgat aatggtcatg    189540
     gctttaatgt tcggaaagta tccgaaaaaa gcctaggact ttccattgtc aaaagttaca    189600
     tcaaagataa actgcgcggt aaagtaacaa ttgaatcaaa tgaacatgga actaaaacaa    189660
     tgttcgattt taaatacaat tcaatccatg ctacaaagaa gtagctatga aaaaagcgat    189720
     gaagcttaaa gccaagtaac gatactgtta tttgtcttta agctttttct ttttgctaga    189780
     aaggagtgag ggttttgacg gaaacgattt taagtgtagg gattgacctt ggtacgtcga    189840
     caacacaact cattttatcc gagttagaaa ttcaaaatat ggcatcaagc ttcacagtgc    189900
     cgcgcattgt gatttcagat aagcgaatca tttttagaag cgagattctt tttacaccga    189960
     ttcttgctga taatttaatt gatgtagatg caattcgtga ttttgtaacg aaagaatatg    190020
     cgaatgctgg gattaagaaa gaagaaatcg gcatgggggc agttattatt acaggtgaaa    190080
     cggctcgtaa agataatgcg agtaacgttc tagatgcgat gagcggtttt gcaggagact    190140
     ttgtcgttgc tacagctgga cctgatttag aaagtattat tgctggaaaa ggagcaggtg    190200
     cgcatactta ttctaaagaa aatagtactt gtgttgtgaa tctggatata ggtggcggga    190260
     caacaaattt atcgctattt gatcgcggtg agcttattga tacagcatgc cttgatattg    190320
     gtggtcggtt aatcaaagtg gaccgtgaaa caagaaaaat cacctatatt gccccaaaaa    190380
     ttcaagcttt aatagaaaaa cgtggttatc caatcacgct aggtgagaaa acctcgccag    190440
     aaaatttaca accaattcta ggtgaaatgg tagagttact taaaaacagt gtcggtcttg    190500
     gagctccaaa tgatttttac gaaacaatca tcacaaataa aggcttaaaa ttccttgctg    190560
     aaattgaatg tatttctttt tcaggcggtg tggctgattg tatttcaact ggtgctttaa    190620
     gtgatccgtt tagatacgga gatattggtc ttttactcgg aaagtcaata gctgaatcta    190680
     gcttgatgac cgaaaaaaag tatatcgaat ctgtcgaaac catacgggca actgtggtag    190740
     gagccggttc acacacagca gaaattagtg gtagtacaat cacttatacc gagaaaattt    190800
     tcccagtaaa aaacattcct attttgaaac ttgccaaaca agaagaaaat gaaaatatgg    190860
     cagaagtcat caaggaaaaa ctcaactggt tcaaaataga tgaagatatg gaacggattg    190920
     cacttgcaat tgaaggggag aatagcccca gtttccagca agtaacagaa tatgcaaagg    190980
     ccatttgcga ggggatgaaa gaaccgattt cacttgggca cccactaatt atcattactt    191040
     ggcacgacat ggcaaaagcg ctcggacaaa gtattttcgg gcatttacca gccggctatc    191100
     cactgatttg tttggatagt gtcaaagtcg ataacggtga ttatattgat ataggaaaac    191160
     cagttgctga cgggaaagtg ctaccagtag tagtaaaaac cttagtcttt aactgatcca    191220
     tataaatagc tttaattttg agaggaggat ttatcgaatg attttaaaaa cgaatttatt    191280
     cggccataca taccagttca aatccatcac tgatgtgttg gcaaaagcaa acgaagaaaa    191340
     atcgggcgac cgtttagccg gagttgctgc tgaatctgca gaagaacgtg tagctgccaa    191400
     agtggtgctt tctaaaatga cgcttggaga tttacgtaat aatccggttg tcccatatga    191460
     aacagatgag gtaacccgta ttattcaaga ccaagtaaat gaacgtatcc atgattccat    191520
     taaaaactgg acagtggaag aattacggga atggatttta gaccataaaa caacagatgc    191580
     tgacattaaa cgtgttgcac gcggcctaac atcagaaatt attgctgctg ttacaaaatt    191640
     aatgtccaac ctagatttaa tttatggagc gaaaaaaatt cgtgttatcg cacatgcgaa    191700
     cacaacaatc ggtcttccag gaactttctc cgctagacta caaccaaacc atccaactga    191760
     tgatcctgat ggtatccttg cttctttaat ggaaggatta acttacggta ttggggatgc    191820
     ggtaatcgga cttaacccag tagatgattc tactgatagc gttgttcgtt tacttaataa    191880
     atttgaagaa tttcgtagta aatgggatgt gccaacacaa acttgtgtac tagcgcacgt    191940
     gaagactcaa atggaagcaa tgcgtcgcgg cgctccaact ggtcttgtat tccaatctat    192000
     cgcaggttct gaaaaaggaa atacagcttt cggttttgac ggagcaacga ttgaagaagc    192060
     tagacaatta gctcttcaaa gtggtgctgc aactggacca aacgttatgt attttgaaac    192120
     aggacaaggt tctgaacttt cttctgacgc tcatttcggc gtagaccaag taacaatgga    192180
     agctcgctgt tatggttttg cgaagaaatt tgatccattc ctagtgaata cagtagttgg    192240
     atttatcgga cctgagtatt tatacgattc caaacaagta attcgcgccg gcctagaaga    192300
     tcacttcatg ggtaaattaa ctggtatctc tatgggctgt gacgtatgtt acacaaacca    192360
     tatgaaagcc gaccaaaacg acgtagaaaa cttatccgtg cttctaactg cagcaggatg    192420
     taactttatc atgggtattc ctcatggtga tgacgtaatg cttaactacc aaacaactgg    192480
     ttaccatgaa acagctactt tacgtgaatt atttggtcta aaaccgatta aagaatttga    192540
     tcagtggatg gaaaaaatgg gattcagcga aaatggtaaa ttaactagcc gtgctggaga    192600
     tgcatctatt ttcctaaaat aaggaaggga ggaactaagc gatgaacgaa caagaattaa    192660
     aacaaatgat tgaaggcatt ttaacggaaa tgtccggtgg taaaacaacc gatacagtag    192720
     cagctgcgcc aactaaatct gtagttgaaa cagttgtaac agaaggtagc atcccggata    192780
     ttactgaagt tgacattaaa aaacaattac tagtaccaga accagctgac cgcgaaggct    192840
     atttgaaaat gaaacaaatg accccagcaa gacttggttt atggcgcgct ggtccacgtt    192900
     ataaaacaga aacaattctt cgtttccgtg cggaccatgc tgttgcacaa gattccgtgt    192960
     tctcttatgt ttcagaggat ttagtcaaag aaatgaactt catcccagta aatacgaaat    193020
     gtcatgataa agacgaatac ttaactcgtc cagacttagg tcgtgaattt gatgatgaaa    193080
     tggtggaagt gattcgtgcg aatactacga aaaacgcgaa actacaaatc gttgtcggtg    193140
     acggacttag ttctgcagca attgaagcaa acatcaaaga catattacct tctattaaac    193200
     aaggtttgaa aatgtataac ttagactttg ataatattat ttttgtaaaa cattgtcgtg    193260
     tgccatccat ggatcaaatc ggcgaaatca ctggcgctga cgttgtgtgc ttacttgtag    193320
     gcgaacgtcc aggtcttgta actgctgaat ctatgagtgc ttatattgct tataaaccaa    193380
     cagttggtat gccagaagct cgtcgtactg ttatttctaa cattcatagc ggcggaactc    193440
     caccagttga agcaggcgca tatattgctg aattaattca caatatgctt gagaaaaaat    193500
     gttctggtat tgatttaaaa taaaattgtt agaggaggaa acttcatgaa aaacgataaa    193560
     ttacctgcat ccgttttaag cgtcaaagtt gtatctaatg tagacaatgg tttatttaaa    193620
     caacttgact taaaaccgca tcaaagaagt ctgggtatta ttacatctga ttgtgatgat    193680
     gttacataca cagcacttga tgaagcaaca aaagcagcag aagtagatgt tgtctatgcg    193740
     aaaagtatgt atgctggtgc tggaaatgca tccacaaaac tagctggtga agtaatcggt    193800
     attattgccg gaccaagccc agctgaagta aaaagtggcc tttcagttgc agtagacttc    193860
     atcgaaaatg gcgctagctt tgttagtgca aatgaagatg atagcgtacc ttactttgca    193920
     cattgtgtat caagaacagg ttctttcctt tcaaaagaag caaatgtagc agaaggacaa    193980
     gcgattgctt acttaatcgc accgccactt gaagctatgt atgctctaga tgcagctctt    194040
     aaagcagcag acgtagcaat tggaactttc tacggaccac catccgaaac taacttcggt    194100
     ggagcacttt taacaggtag tcaatctgca tgtaaagctg cttgtgatgc gttcaaaatg    194160
     gcagtagaaa atgtggctga aaatccactt caatattaag gtggtgctaa aaaatgccaa    194220
     atgaagcact tggtttaatt gaagtcactg gtttccttgg tgctgtggtt gccgctgata    194280
     cttgtttaaa agcagcaaat gttgaattaa ttagatgtga agtcattaaa ggtggcttaa    194340
     caacagttga attaacaggc gatgttggtg ctgtaaatgc agcagtggaa gcaggaaaag    194400
     cagctacaga aagcttaggt tgcctcattt ctagtcacgt gatagcaaga atgagtgaag    194460
     aaacgaaatc actctttgta aaagctgagc aagaaataga agaaacaaaa gaagttatcc    194520
     aagaagtcgt agaagtaaaa acaactacag atgaaacgga aaagaaactt cgcgaaatga    194580
     aagttattga tttaaggaaa cttgcttaca cattagataa tgtgcctatc ccaaaaagca    194640
     agattaaata tgcgaacaag gataaacttg ttcacgcact aaaagatatt tatggaagga    194700
     gtgaaaacta gtggcactag aagataaaga tttacgctca atccaagaag ttcgtaacct    194760
     cattgaatca gctaacaaag cacaaaaaga acttgctgca atgagccaac aacaaattga    194820
     tacaattgta aaagcgattg ctgatgccgg ttatgatgcc cgcgaaaaac tcgcaaaaat    194880
     ggcacatgaa gaaactggtt ttggaatttg gcaagacaaa gtaattaaaa acgtcttcgc    194940
     ctccaagcac gtctacaatt acatcaaaga tatgaaaacc attggtatgt taaaagaaga    195000
     taacgaaaag aaagtaatgg aggttgcagt tccactaggt gtagttgcag gattaattcc    195060
     atcaacaaac cctacatcca ctgttattta caaaacacta atttcgatta aagcaggaaa    195120
     tagtatcgta ttttctccac atccaaacgc actaaaagca attcttgaaa cagtaagaat    195180
     cattagtgaa gcagcagaaa aagctggttg tccaaaaggc gctatcagct gtatgactgt    195240
     tccaacaatc caaggaacag atcaactgat gaaacacaaa gatacagcag ttatccttgc    195300
     aacaggtggt tctgctatgg taaaagccgc ttattcatct ggaactccag caattggagt    195360
     tggcccaggt aacggcccag catttatcga acgcagcgct aacatccctc gcgcagtaaa    195420
     acatattctt gattctaaaa cattcgataa cggaacaatt tgcgcatctg agcaatcggt    195480
     cgttgtggaa cgtgtgaata aagaagctgt cattgctgaa tttagaaaac aaggagcaca    195540
     cttcttatca gatgcagaag ctgttcaact tggtaaattc attttacgtc caaatggatc    195600
     catgaaccca gcaatcgtag gtaaaagcgt gcaacatatc gctaaccttg ctggtctaac    195660
     tgttccagct gacgcaagag tacttatcgc tgaagaaaca aaagttggcg ctaaaatccc    195720
     ttattcaaga gaaaaattag caccaatctt ggctttctac acagcggaaa cttggcaaga    195780
     agcttgtgaa cttagcatgg atattcttta tcacgaagga gctggacata ctttaatcat    195840
     ccactctgaa gataaagaaa tcatccgcga attcgcactg aaaaaaccag tttcccgtct    195900
     cttagttaat acaccaggag cacttggcgg aattggcgca acaacaaatc ttgtacctgc    195960
     tttaacactt ggttgtgggg cagttggagg aagttcatca tctgataata tcggacctga    196020
     aaatctattc aacattcgtc gcattgctac tggcgtttta gagttagaag atattcgtaa    196080
     agaagaaaac caagcaacac ctgaactttc ggttgatgca gacgcactca tccaaagttt    196140
     agtagaaaaa gttttagcag aattaaaata aaaaataaaa cactaattgg aggaatttta    196200
     aaatggcaaa cgcaaacgca ttaggtatga tcgaaacaaa aggtttagta ggagcagtag    196260
     aagcagcaga cgcaatggtg aaagcagcta acgtaacact tatgggtaaa gaacaagttg    196320
     gtggcggtct agtaacagtt atggttcgcg gtgatgttgg cgcagttaaa gcagcaacag    196380
     atgcaggcgc agcagcagct gaacgcgttg gtgaattatt atctgtacac gtaattccac    196440
     gtccacacag cgaagtagac gcaattctac caaaaagcgc tgaataagaa aaatttctaa    196500
     cataaatcag gaaaaagcgt gagcgtaggg cataagggtt ccatcagact cggaaaatgc    196560
     ctaaaacttt cgctttttac cagatttaag caagacaaag cttcccatca ttactaacac    196620
     caattgtaaa tgggacaaaa ggatgtggtt ctttggctat tttgacagaa gatgagttac    196680
     gaaaagccta cttacacacc gatttaaaaa caaagaaaaa attagatata aaaaaaggaa    196740
     cgattattac tccatcagct aagagttttt tatctgaaaa gaaaatcgac cttcattata    196800
     ttgatgaaat ttcagaaaca aaagtagtag tggagccagt gaaaaaagaa actgctagag    196860
     caaaattcca aacgatttat ggtggttcag tagatgaaaa gccagaacat atgacgcatt    196920
     tacgcggcaa cttgcttgta tttaaagacc atcctcaaat cgctttccgc ggaaaattag    196980
     atacgcttga agctgaaatc ctggaaaccc agtgttctgt tgctagtgaa tttaaagatc    197040
     ttgcggaaga tttacaagaa atcctcacct ttgtaagaaa tattgtacga tcggaagttt    197100
     taaacgagca aatcgaaacg gttaatttgc ttggaatgga cgaaaaagaa ctgcgggaac    197160
     gtagtcataa tccgaaaaaa tactaccaaa tgacacattt tatgcccgat tatacgatgg    197220
     ggaatgctgt tattcggtta aacaaattaa gaacgatggt tcgtgaaacg gaattaactg    197280
     cttttgcagc atttaaggaa gcggattatt cggtaaaaag accagatatt attcaagcgc    197340
     ttaacaggtt atccagtttg ttttggatac taatgttccg cgtaagaact ggtgaatata    197400
     aaaagtaagg aggcttattc atgaataatg agttaataac aagccttatt gaagaagtca    197460
     ctcgccgtgc attacttgaa actggcgtag aagtagaagc atccggtcgt cacgtccatt    197520
     tagatcgtga gacagttgat gcactttttg gacctgggta tgaacttact catttccgtg    197580
     acctatctca accaggtcaa tatgtttgta aagaaagaat tagcattgtt ggaccaaaaa    197640
     gcgtgattca taacgtagta attcttggac caatccgtaa aaaaacacaa gtagaaatta    197700
     gtgctacaga cggtaccgca cttggtatta aagcacctgt ccgcgaaagt ggagacatag    197760
     ccgggacacc aggaatttta cttttatctg ctaaaaacag tgttcaatta actgaaggac    197820
     ttattgttgc aaaacgccat attcatatga cgccagaaga tgcagcaaaa caacaagtaa    197880
     cacaaagtga aattgttcaa gtgaaaatta atggcgacag accactgatt tttgacgatg    197940
     tggtcgttcg aattagccct gattttgcta catatatgca tattgattac gacgaagcca    198000
     acgcatgcgg ctttaaaaag ggaattcgag gtcaaataat taagaaaaca aaggcaaaat    198060
     gagtatggaa atggaagctc taataaaagc cgtcaccgag gaagtcatga gacgattaca    198120
     acttccagat aaaaaaatga ttatcatggg gcaagattca gaacacactc tcagacagtg    198180
     ttatcaaaaa gaatatcaag tttcgcttta tgatcgttct gaacgtacct gtgacatttt    198240
     attattagaa gaaatggaaa tcgctgaatt agctcgaatc agtttgcttg caccaatgaa    198300
     taaaaaagaa caatttatca cagatcatct tttagaagaa cgtcctactt ggatcatgaa    198360
     aagcggaatt aaagcaaatg cttataaacg ttctgctaaa tatggtatca gacagctcct    198420
     tcaagaatat gaagaaaaac tcgctcgttt tggcgtagaa tatatcgata atccggtgaa    198480
     aaacgtgaaa acgagcaaag taattagcga acaagatgtg attaaactca cgaagaacaa    198540
     aagcgaattc attttgccag agggaagttt cttaacacca cttgcaaaag attatttaca    198600
     ggaaaaccga attagcatta aagaaagtta ggaaggaaga gcggcatgca aattggaaaa    198660
     gttaccggga gtttatgggc gacaagaaaa gatgaaaaac tgaatggttt aaaactacta    198720
     ctagtagaga tttgtaccga tgaagtggaa gataaaagac attccatagt ggcagctgat    198780
     aatgccggag caggaaacgg tgatctcgtg ctcgttacaa ctggtagcgc agcacgagca    198840
     tctactgggg ataatacaat accagtggac gcgtgtatcg tcggcattat cgactcggta    198900
     gaacgttatg gctgaacagt ccttaggtat tcttgaactc aggagcataa gtaaaggtta    198960
     cgaaatggcc gatgtttttt taaaagctgg caatgtaact ttatttactt ttcgtccgac    199020
     atgtcctggt aaatttttga ttattttgca aggtgcttcc ggtgaactta ctagtgcgat    199080
     gcaagatgca aaagaagaag cagggaaatt tcatgtttct tcttatattt tgcatatggc    199140
     gcacgaagaa ttacttgctt ttctaaacaa taaacaccct aaagttgatg ttgatgcagt    199200
     aggaattatc gaaatcagtc aattgggtgc tgggctaaac gcggtgaatg aagcgctaaa    199260
     aaaatcagct attcatttaa aacgaatgac gctcggtgct tcgattggtg ggaaatttgt    199320
     ggctgttttt acaggggaag ttagtgctat tcaagaaggg atgcggattc taatcgaaac    199380
     cgcagaacca aaaaaggtga tacatcatac ggtcattcct tctcctgatg aacttttaaa    199440
     acgctatcta tagaatggag gaacactttt gagcattaat gaaattatta tttatttaat    199500
     ggtaatcttt atgattctag gagccattga caaaattatc ggtaacaaat ttggcttagg    199560
     agcacaattt gaagaaggta ttatggcaat gggatcgcta actctagcta tggtcggtat    199620
     tattacttta gcaccagttt tagcgaaaat tttaagcccg attgttgtac caatttatac    199680
     agcgcttggg gctgacccag caatgtttgc tacaacttta cttgcgaatg atatgggtgg    199740
     ttttgcgcta gctcaagaac ttgcgctaac gcctgatgct ggtctttttg caggagctat    199800
     tttaggctca atgatgggac caacaattgt tttcacgatt ccagtagcac ttggaattat    199860
     taaaaaagaa gaccataaat acctagcgac tggtgtacta tctggtatta ttacgattcc    199920
     aatcggttgt ttaatcggtg gtcttgtagc tggattttca ccaatcatga ttttcaaaaa    199980
     cttagtacca attcttcttg tagctgtact tattatgtta ggtctttggt tcaaaccaga    200040
     aggcatgatt aaaggcttta cgattttcgg aaaaggggta gtaattgttg ctactatcgg    200100
     acttgtggct ggagctattc aacaacttac tggtttaact attattccag gaattgcacc    200160
     aattggcgaa ggtatcgaaa tcgttggtgg tatcgcacta gttctagcag gagctttctg    200220
     tttagttttt gttattacga aagtgttcaa caaaccactt atgaaaatgg gtaaattact    200280
     tggtatgaat gaagttgcag cggctggtat ggttgcgaca cttgcaaata gtatcccaat    200340
     gttccaaatg ctaaaagata tggatgagcg cggtaaaatt attaacgttg cttttgcagt    200400
     atctgcggcc tttgttttag gggatcatct aggtttcaca gctggggttg cccaagatat    200460
     gattttcccg atgattgtcg gaaaacttgt cggaggagta actgcagtag ctgtagctat    200520
     ctacatggct aaccgaatga tgaagaaaaa taaagcaaaa gaacaaacgg cggtgaaaga    200580
     taatggctga tattagtaaa gaattaattg agcagctagt aaaacaagtt gtcctagaaa    200640
     aaatgggtca aagttccaaa cacgttgacc caagtggtat tttatccgtt aaacttccag    200700
     aagtaagagt ttctgaagaa gaccgtttag atactggtaa ccctagtgat gttgtttata    200760
     caaaagattt agtaacatta gaagaaagta aacgtctagg ttttggtcta atggaaatga    200820
     aagatacaac atttgattgg ttcttagatt acgatgaagt agattatatt attgaaggca    200880
     gactagatgt tgtcatcgat ggtagaaatg tttctgcagg accaggcgaa ctgattttca    200940
     ttccaaaagg aagccaaatt aagttctctg taactggaga agcgagattc atttatgtta    201000
     cttatccggc tgattggcag tcacaataat cataaaaaaa cgatttcggc aacatttgct    201060
     gaaatcgttt tttatttaag tgaatcgcga tattctttag gagtcatatc gaactctttc    201120
     ttaaagactt tgcaaaaata actagcacgc gaaaatccta aattctttgc aatcgtgtgg    201180
     acggcccagt cacttttttc tagttgttcc tttgcatata gcattttttg ttcattgacg    201240
     taattaataa aattgatatt caattcgttt ttaaataatt tacttaaata aaaggggctt    201300
     aaataaacat aattggctac ttcttctaga gtgatggaac gatgaatgtt ctttttaatg    201360
     tagcgaatag cttgtttgat ttctttatgt tcaccactcg ttttactgga tgtggcagct    201420
     tcttttttgg gttgtttttg tttttcgtga gcggtgtagt agtcacttaa aacatcaagt    201480
     acttcgactg tttcgagcga atgaagtagg gcagagtgat ctggattttt tttgttgaag    201540
     tcttcttgaa tttgttgggt aaattgattt tctacctgac tattcatcaa aggttgaata    201600
     tttactactt tttctttctc caaaaatctt ccctccttat tttattcttg cactaattat    201660
     accataaaat cgcttaaaat aacgttttat cctgcatttt aaacagaaca ataaattctt    201720
     ttttataaca aaatattgtc atttttgctt tgtgaattag agaaattgag aaaaagttca    201780
     cactggtggc tattttaagt gtatacaatg aaaaaaatac gattttaaaa gcttgcacta    201840
     ttttgctttc tagcctgtta gtgcccttgt accagtgttt taacagggat ataatgagat    201900
     ggaaataacg ctttcacgag agggtgatct tttcaattga agattcaaaa attagtatta    201960
     tgtgcgatgt tgattgcaat gtgtgtaatt ggcgcaaaca taaaattaat gggttctgtt    202020
     gcatttgacg cagccccagc ttttattggg actttgctgc ttggtccgat gtacggtgca    202080
     gtgcttggga ttttcggtca tttaacatca gctttacttg cgggatttcc gctgacacta    202140
     ccgattcatt tgattgttgc tggaatgatg ggcgtaacga tgattgctta tggatttacg    202200
     cgccacaagc tagctgaaaa gaatcaacta gttgctatta gtgcttctag tgttgtcgct    202260
     tttgttttta attgtccgtt atcattactt gcgctttatc cattaatgca tcaagcggta    202320
     tttgtgttat ttccggttct agctattggt tcgatttgca acatttttgt cgcagaagtc    202380
     gtttaccaag tattaccaga acgctggaaa agacgaattg ccgggtacta aacaactaaa    202440
     taggtgaata tattaatccg ggaaagaggt ggaaatcctc tacaggccct agctactgta    202500
     attcggacga aagccaaaca tatgtcactg gaagaaattc cgggaagact ggtgagtagg    202560
     ttgatgataa gtcaggagac cgctagtata ttcgatatcc aaaaacaact tctaagggag    202620
     cgagttgtct ttattaaaca gattttcatg ataagaaagt ttctttgtgc tacatagaat    202680
     tcttattgat gttaaatctc taaaagacgc caaagttctg tttggcgtct ttttttatgg    202740
     ctaaagcgaa aggtgaaaaa agatgaacaa aatcttaatt gcagccgcat caagtggtgc    202800
     aggaaaaaca accgtaaccc tcggaattat gcaagctttg aaaaaaagag gcttcgcggt    202860
     tcagccattt aaagtaggtc cagattatat tgatacgaac tatcatcaag caattacagg    202920
     tgttgcttcc attaatttag atagttttct cattgatgat gacgagatgc tagcgtccct    202980
     ttttcaaaag cacggcgagt ctgctgatat ttcggtcatt gaaggagtga tgggattatt    203040
     tgatgggctt gggactgatc gcgataatgc cagtacttcc tttattgcca aatgcacaaa    203100
     gacaccagtc attttagttg tggatggaaa agctatttcg acttcagcag cggcgattgt    203160
     tgacggattc aatcgttttg atccggaact taaaattgct ggcgtcatta ttaatcgagt    203220
     tgcctcagaa aaccattttt ctttaatcaa aggggcgatt gagcgttata cggatgtacc    203280
     agtgttaggt tacttgccaa aaaatgcggc agtggcactt ccagaacggc atctaggatt    203340
     agtaccacaa gaagaaatga ctgagctcga agcaaaatgg gagctacttt ctgacctcat    203400
     taccacgcat gtggatttag acaaattact cgaaataagc aaatctagtg agaacttatc    203460
     tacttctaaa gcgcaaatga aagtagcaga tttttctggg cttcgtgtcg cttatgcgct    203520
     agatgcagca tttcactttt attatcaaga taacttggat ctgattcgtt tgactggggc    203580
     agagttaatt ccatttagcc cgcttgagga taacgaggtt ccggaagcag atttcatcta    203640
     tattggcggc ggttttccag aaatttttgc caagcagctt aatgacaaca gatctatgcg    203700
     gaagtcaatt ttggctgcgc acgaaaaggg cattccaatt tacgccgaat gtggtgggtt    203760
     gatgtacctt ggttcgagtt tagaaatgga aggaaaacag tatgaaatgg tgggagtttt    203820
     taacggtatt agtaagatga caacaaggct gcggaagttt ggctactgta tcgcggaacc    203880
     tttagaagaa acgttaatcg gcaaaaaagg gatgtcgatt cgcgggcatg aatttcatca    203940
     ttctgttttt gaaacgactg aaacagcttg tatgaaactt tcaaaaaaac gtgacggtga    204000
     aatagttaaa gagtggcgtg gtggttatca aaaaggcaat acttttgcca gttatctcca    204060
     tatccacttc taccaaaatc cggccatttt aatgcagatg tttggagctg gaaagagatg    204120
     agcgtactct tttataccat atcgtttatt ttagatttca tactaggtga cccttacagc    204180
     tggcctcatc ctatcaaggt aattggtaac tttattcaat tattaacgaa cgctttgcgg    204240
     aaaatttttc atggtaaatc actgtatttt gctggaggcc tattattcat tcttacagtt    204300
     ggaatgacgg gaattgtttc gtggctcatc ctttatatta gtgcaaaaat tgctttttgg    204360
     ctttatgcgg cggtgtttat ttacttaggg tatacgacac ttgcgatgac ttgccttgcg    204420
     aaggaggcgc ggaaaattca gcgaacactc gcggatggtg atttagaagc ggctagagta    204480
     caagttggga tgatagttgg tcgggataca gacaagctta cggcagaaca aatcagtaaa    204540
     gccaccattg aaaccgtggc ggaaaacaca gcagatggcg ttatagcacc attattttac    204600
     ttattcattg gaggacctgt gctagccttg atgtataaag ccgtgaacac acttgattcg    204660
     atggtcggtt ataaaaatga aaaatatcgc gccattggtt ttgtttccgc aaaaatggat    204720
     gatttggcca atttcattcc agcaaggcta tcttggtttt tccttgtgat tgcgagtttt    204780
     attttgaagt atgatggacg cactgcatgg cggatagggc ttcgtgaccg gaaaaatcat    204840
     acaagtccca attgcgcata tccagaaggc gcggtagcag gagcgcttgg gataacactt    204900
     ggtggcaccc atgaatattt cggcgagaca gttgttaaac caaccatcgg cagtggaaca    204960
     aaagccgtta cacaaaaaga aatcagtcaa acaattcact tactatacac agcttccatt    205020
     attgcttttc taatttttat cagtatacat ttaatactat tttaaaggag tggcacaatg    205080
     aactacatta aaaatccagc caaaattgaa gagaaaagtt ttgaaatcat tcaacaaatt    205140
     attgacgata ttcgaccaga ttatacattt caaaacaaac tagaggaagc cattatcaaa    205200
     cgtgcgatac atacgacagc agattttgat tacttggata gcctcgtttt tcaacaagat    205260
     gttatccaaa aaattattca tgttcttaaa aataaaggaa ccatttttac agatactaat    205320
     atggcgctta gtggtattaa taaacggctg ttagatgaac ttggctgtag ttatcactgt    205380
     tatgtgagtg atccagaaac gatcgaaatt gccaaacagc atggcatcac gcgctcaatg    205440
     gccggaatta aacttgcttc tttaaaagat ggaccgaaaa tatttgtcct agggaacgcg    205500
     ccaactgcgg tttataaaat tatcgaaatg acggaaagcg ggcaattaca agcagaggcg    205560
     gtcgttgcag tgcctgtcgg atttgtcggg gcagctgaat gtaaagaaga aattcttgaa    205620
     accgacattc cagcaattgt cgctcgtggt agaaaaggcg gtagtaacct tgccgcggca    205680
     atcattaatg caatcttgat tacgatgtaa agaaggcgac gagcagtgga agattttatt    205740
     tattataatg gcaaaaaata tcgtaaaggc tatacaactg gaacgtgtgc agctgccgcg    205800
     gctaaagcgt gtgtcgaaat gatagaaaac caagaagaag taagcgcggt taaagtcaca    205860
     acaacaggtg gaactattct tgaaatcccc gttgcctatc aacagttttc tgaaaaaaag    205920
     gcaactgcag ctgttcaaaa agatggcggg gatgatattg atgccacaca cggcatgtgg    205980
     atttttgttg atgtcgaatt aacagatagt ccggaagtta ctttagatgg aggcgttgga    206040
     attggtcgcg caacacaaaa gggtatttcg gttgaagtgg gtgaagcggc aattaatccg    206100
     gcaccaagga aaaatatttt agctacagta cgcgaatcac ttggcgaaaa tcgtggcgca    206160
     accattttag tatatgctcc tgaaggggaa gaacgcgcga aacgaacaat gaatagcaac    206220
     ctcggtatta tcggcgggat ttccatttta ggaacgacag gtattgtcac accgatgtcg    206280
     gatgaaggct ggaaaaaatc attatcaatg gagctcgaaa tgaaacggaa ccaaggactt    206340
     gaccaaatta ttcttgttcc aggtaattac ggcgatgatt ttgttcaaaa tacgcttggt    206400
     tttgcgagtg ataacatcgt ttccatgagt aatttcgttg gttacatgtt gaaagaaacc    206460
     caacgactcg catttaagaa agtattgatg gttgggcatt ttggcaaatt agtgaaggtt    206520
     tcagctggta tttttacgac ctatagcaag gatgcggatg cgcgggcaga aatcttggtg    206580
     gctaacttgg ctttactcgg cgcaccatta tcacttttac aagaagtaga gaagtgtaat    206640
     acgacagagg ctgcaggcga attaattgaa gcagctggtt ttactcaagt ttatgaggta    206700
     atcgcacaaa aaatcaaagc aaggtcagaa cgcttcttga aattcactaa gccaagtgtg    206760
     gaaattgatg tcgttacatt ttcaactgaa agaggcttac ttgctgcaac gaaagacata    206820
     gaagtattgc gggaggaatg gcgatgatta cagtggttgg aatcggacca ggagatacga    206880
     atttgctaat aaacgcagca agacaagctt tatcttcagc agattcagtg tatggatcga    206940
     aaagacaatt acaagaaata gctgaattaa caactgcaac gtgcctattg ttaccgaaaa    207000
     aattagcaga tttaaaaaat attcctcatc aaaataaaaa cgtcgtgatt ttagcatcag    207060
     gcgatccact gctctacggg attggcaact gggcgatgac gaatttttca gaagatattc    207120
     atattatccc gggaatcagt gcaatccaga tgatgtttca ccaaatcaag ctgccgatga    207180
     atgattgttt tataacgagc agccatggta aaacaccaaa tttcgatttt ttgctccaac    207240
     atgaaaaagt cgcaatggta acagattcca ttattggacc atacgaaata gctgctgaaa    207300
     tctcaaaacg aaatctaaaa aaaatcatgt ttatcggtga aaatttaagt tcaacagaag    207360
     aacgaattca taagctaaga ccagaggaag ttgaaaaaaa atacgatatg aatgttgtgg    207420
     tgattgtcga tgaaagatga cgtatttatt cgcggaaaag ttccgatgac aaaaagcgaa    207480
     gtgagagcaa taagtattga tttactcgga ttagataata caagtaaaaa actgctagat    207540
     gttggcgctg gaactggaag cgttggactt caagtagctt ataattttcc acatatcaaa    207600
     gttactgcaa ttgaacgaaa taaagatgcg gtggacttaa ttaaacaaaa ccaagccaaa    207660
     ttcggcgtag aaaatgttgc agtcatcgaa gcatatgcac caatcgaatt atctcaggaa    207720
     gagaaatttg atgccatttt tattggtggt agtggtggga atttaaccga tattatcgac    207780
     tggtcgttgg ttcatttgaa actaggcggt cgcttggtac ttaattttat tttattagaa    207840
     aatgccttac aagcaatgaa ccatttagaa aaattaccag tgagtgaatt gacaatgaag    207900
     caaattcaag tttcaaattg gcataaactc ggagctggac attattttga accacagaac    207960
     ccaaccgtca ttattggctg taaaaaacta gaggagtgaa gaaaatggca gaagtacatt    208020
     tcgtcggagc aggaccagga gataaagaat taatcacact aaaaggatac caattattaa    208080
     aaaacgccga tgttgttata tacgctggct cacttgtaaa tccggaattg ctagaatact    208140
     gtaaaccgga ctgcgaaatc cataatagtg ccagtatgaa tttaatagaa attattgact    208200
     gtatggaagc gggagtaaca gctggaaaag aagttgttcg tctgcaaaca ggagacttct    208260
     ctatttacgg ctcgatccgt gaacaagtgg aggaaatgaa aaaacgttcg attccattta    208320
     catgtacgcc aggtgtaagt tcatttcttg gcgcggctag cagttttggt gttgaatata    208380
     cggttcccga agttagccag agtgtgatta ttactcgaat ggctggaaga acgccggtac    208440
     cgtcacgtga gtcactcaga tcttacgcag cgcaccaaac gtccatggtt attttcttat    208500
     ctgttcaagg tatcagaaaa gtagtctcag aacttatcaa aggtggctat aaaccagaaa    208560
     ccccagcagc tgttatttat aaagcaactt gggcagaaga gaaaaaagta actggtacgc    208620
     ttcaagacat cgctgaaaaa gtgacagaag caggaattac taaaacggcc ctaataatgg    208680
     ttggtgattt tctcggcgaa gaattttatt attctaaact atatgataag gatttcaaac    208740
     atgaatacag ataaaattgc cattatcgca gttactgaac gagggcgcga tttagcaatt    208800
     tcattaacaa aaacattacc aggaacggtc tttgtcccag aaaagcacca gaatgaacag    208860
     actgcagttt taacgcctaa ttttggtaca gcaatgcgtg aaatgttcac gacgcatcag    208920
     gcattaattt gtattatggc aacaggtatt gcggtgcgga cgcttgctcc agtcattcaa    208980
     gataaactat cggatccggc agtaattgta atggatgaat atggtcagtt tattattagt    209040
     ttactctcag gacatgttgg aggagcaaat gagttaacgg agcaaattgc tgcaattact    209100
     ggtggtgccg cagtaattac aaccgctact gatcgtgcaa atgtggcagc aattgataat    209160
     atcgccaaag aaatcgacgg atatttaccc gattttaaag cgacgactaa acgcattaat    209220
     ggcttgctcg ctgctggaaa agaagtcagt ttgcacgtag atgagccatt tgaagtagat    209280
     tcacgaggtt ttacaaacaa agaaattagt ccacaaattt tcatttcgac caaatacaat    209340
     ttaccagata caaaaataga aagaattcag ctagtaccaa ggaagttcgt gcttggtatt    209400
     ggatgtcgaa aaggcgtttc agcggaaaca atggaggaag ttttcaccca tttttgtgaa    209460
     caagaaaaca tacatccgcg cgcttttcgt gaaatccata gcattacatt gaaagcagaa    209520
     gaaccagcca ttttgcaatt agcgaaaaag tggaacattc attttattgt tcattccgca    209580
     gaagaattac aaacggtagc tgaaaaatat ccaacgtcag aatttgttct aaaaaccgta    209640
     aaagttggaa atgtcgcttt atcatcagca gatattggta gtaatggaaa cgtcattacg    209700
     aaacgatttg ccgaaaatgg cgtgacattc gcagcaggaa aactaattaa aaataatgag    209760
     gtggcaaaat gatttatgta atcggaattg gcccaggaga taaacgatta atgacaggtg    209820
     aagcactaga agcaatagcg gacgcagatg taatcgttgg ctatgtaaca tatatcaaac    209880
     taatcaaaga attaattaaa gataaagaag tagtgaaaac ggggatgcgc cgtgaaatcg    209940
     atcgctgcca ggaagctgta aatatcgcat taacaggaaa aaaagtagcc gtcgtttcaa    210000
     gcggagatgc tggtatatac ggaatggctg gattggtttt agaactagcc gaaaaaagca    210060
     acccagagct agaagttaaa gtaatcccag gaattacagc tagtataggg gcagcagccg    210120
     ttctcggggc gccaattatg cacgattttt gccatattag cttaagtgat ttaatgacac    210180
     catgggaagt aatcgaaaaa cgtttaacac atgctgcgat ggccgatttc gttgtctgtt    210240
     tttacaaccc gagaagtaaa ggtcgcgcca atcatttagc caatgctttt caaaagatga    210300
     tggaacacaa atcaccaaag actgtcgttg gaattgttaa agatgtcggt cgaaaagaag    210360
     aacgaaaaat cattacgaca atggaagata ttgactatga gttagtggat atgacaacga    210420
     tggttattgt cggtaacaaa gaaacatacg taaaaaacgg caaaatgatt acacctagag    210480
     gatactcttt atgatttttg tgcttggagg aacttctgat agcttgttaa ttagtgactg    210540
     gctaacggaa acaaaacgac catttattct ttcagtagca acagattacg gtgaaacttt    210600
     agctaagcaa catgcagaaa aagtattttg cggtcgatta gccaaagaag caatgctcgc    210660
     aaaatggcag ttagagcaaa tcaagcttgt tattgatgcc actcatccct ttgcaaccat    210720
     cgtttctgaa acggccatgg aagcatgcaa agaagcgggc attccataca tccgctttga    210780
     gcgaacaagc gaacaaaccg ataatactta tttagtagat gatattaacg aagcatgtaa    210840
     agttgctgca aaacttggtc aacgaatttt tcttacaaca ggtagtaaaa atttacctga    210900
     atttgtggca gggctgaaac aacaacatat tatcgctcgt attttgccag tgtctgatgt    210960
     gattcgttca gcagaagaac ttgggctcgt tgccgaccaa ataattggca tgaaaggtcc    211020
     gttcactaaa gaagccaacc gcacacagct agaaatgaca caagcggacg tattaattac    211080
     taaagaaagt ggaaaacaag gcggatttca agaaaaactc acggcagcag cagaattaaa    211140
     tattcctgtt atcgttattc gccgaaaaaa attaaattat ccaatcgaaa taaatcattt    211200
     aaccgaacta ccagaaattt taactcaatt ggaggtctac taatgggaaa agtcatgtta    211260
     attggcgcag gtcctggtga tgcacaactt ctaacagtaa aaggattagc cgcacttcaa    211320
     aaagcggatg ttatagtcta tgatcgcctc gttgaaccag cgatgctcca agaacgaaaa    211380
     gctagttgta aactaattta tgtcggaaaa gaaccacttc atcatccaat cccgcaagat    211440
     gaaatcgaac aaattcttgt aagagaagca gcaacaaatg agctagttgt tcgtttaaaa    211500
     gcgggtgatc cgtacgtatt tgggcgcggc ggcgaggaag gcgaaacact tcataaagca    211560
     ggtattcctt ttgaagtcat cccaggaatt acttcagcta ttggcgggct tgcttatgcg    211620
     ggaattccgg tcacgcaccg tgattttgct tctagttttc atgtgattac aggtcacttg    211680
     aaaaaaaggc gcgatccact agattgggaa gcacttgcaa gactcgaagg aacccttgtt    211740
     tttctgatgg gaatgacaaa cttacctaac atttgcgcca atctactagc aaatggacaa    211800
     aaaccggaga caggcgtggc aattgtacag tgggcatcgc gtggtaagca attaaccgtt    211860
     acaggaactt tgcaaacaat cgaacaaaaa gtagcagaat ctggtatttc atctcctgcg    211920
     cttatcgtag ttggtgatgt agtgagctta cgtccacagc ttaacttttt tgaagaaatg    211980
     ccacttttcc atacaaaagt attacttcca agagcacgcg caggtaaaag tatgctcgct    212040
     gaaaaaattc gcgatttagg cggagaagta acgatgtatc caaatattca agtgctggat    212100
     attctgccaa cgaaaacaaa agcagaatta tgtgaaacta gcgaacttct tttcacttca    212160
     aaagaggctg tagagcgctt tttcgattat ctagcaacac ttgagttgga tattcgttcc    212220
     ctaaaaaata cccatcttac cgctatcgga aaacaaacga aagaagcatt tagtgaaaaa    212280
     ggaatcattc cagatagttt tattaaaaga cggagcacag aactaatttt agagcatata    212340
     gctcgttttc aaaaaaatgc tagcaactta attatcggta gtgttgttga tacagcagag    212400
     gttagtgcta tcttatctga agtgaaaaca accgaaatga tgccattgta cgatatgcgt    212460
     ccagtgacag agcgcccatt tgacctcgaa agttttgaac aaatatgctt ttccagttct    212520
     cgttcagtcc aaaatctact cgatgtacta acaaccgaag aaaaagcgat tttacaaacg    212580
     aaaacgattc tctcgatagg aagattcacg agcgcaacct tgcagtcatt tggcattaat    212640
     gaatttgaag aagctgagaa tgctacacca gagagcttaa ttgaactaat tcaaaaaaca    212700
     aaattagaag gagtaccaca atgaaaaaag ccatattagt cgttagtttt ggcactagtt    212760
     atccagaaac cagagaaaaa accattgaag cttgtgaaaa aagagtggcc caagaatttc    212820
     ctgagtacac tgtatttcgt gcttttacat ccaacaaaat tattaaaaaa ctaaaaaccc    212880
     gtgataacat gcacattaac acaccaagtc aggctttaaa ccagctaaaa gaactaggtt    212940
     acaaagaagt ctttattcaa tctctacata ttattaatgg cggtgaattt gaaaaaatta    213000
     cagctcaagt ggaaaaattt aaagcggatt ttgattcaat catcattagt caaccattac    213060
     ttgattcaaa agaagattac gaaaaagcca ttgaagccat tcgccaccaa atgcctcctt    213120
     tgaaagaaaa tgaagcattg attctgatgg gccacggctc caaacaccat gctttcagcg    213180
     catatgcttg cttagaccac atgcttttaa acgaaccgat ttatctttgt gccgtagaaa    213240
     gttatcccgg ccttgatcaa gtgattgaac gattaaaaca ggcaaagatc aaaaaagccc    213300
     atttgatgcc gttcatgctt gttgcaggag atcatgccac aaatgatatg gcttcagatg    213360
     acgaagattc ttggaagagc atattggagc aagctggtat tgaaactgag tgccacttgc    213420
     aagggctagg cgaaaaccca cttattcaag ctcaatttat cgatcatatc aaagtagcaa    213480
     cagaaagggt gaacacgcgt ggctaaattt tacggcattg gcacaggtcc aggtgacagc    213540
     aagctagtta cgatggaagc tgctgataga ctggggaaat tagcgattct ctatactccc    213600
     caatctaaaa aaggtggaga aagtttagca aaaaaaatcg ttaacccata tttaaaaaac    213660
     acgcttatca tcaaagaacg tcattttcca atgagttaca acaaaacaga gaaaatgcaa    213720
     gcttggaaag aaattgctga agaaatcaaa acagatgttc aaaacggaca tgatgttggt    213780
     ttcattaccc ttggcgatcc aatggtctat agcacttata gttatttgct agaactttta    213840
     aaaggtgaaa ttgaaacagt tacactcgca gggatttcat cattttcaaa tatcgcctct    213900
     aaattagaac tgcctcttgt aatggacgag gatagttttg ctgtaatccc tgtaacagca    213960
     ggagctgaaa aaatcgaaca agcgctcaca ttatttgaca ctattgtctt aatgaaagca    214020
     gcaagcaatt taccccttct tacgacatta ctaaaaaaac tgaatttgct tgatgcagct    214080
     gttgtagtaa gtgatgttgc catggcgact gaaaaaatca cttacggcat gggcgagata    214140
     aatccagaag aaaaaatgtc atattttact acgattatcg tgaaaaaaag aagggagcaa    214200
     tataaatgaa aaaattatgg aagtttctac catttgtttt aatcggcgtt atttatttta    214260
     ctttaacgaa cccagaatcc gcacatgcaa tgcatatcat ggagggcttt ttacccgtta    214320
     aatgggcagt cttttggcta attgtcttta tcccattcct tgtacttggt ttaattcgta    214380
     ttcgtaaatt aatcgcttta gataaaaata ataaattact gttggcatta tgtgcagcct    214440
     ttatctttgt tctttctgca cttaaaatcc cgtccgttac aggatcttgt tctcatccga    214500
     caggtgttgg acttgcaacg gttatgttcg gaccgctcgt tgtcagtgtt cttggcgtga    214560
     ttgtcttact tttccaagcg ctacttcttg cacacggcgg tattactact cttggtgcaa    214620
     acgcaatgtc gatggctgtt atcggtccaa tggttggttt tgtcgtctat aaactagctc    214680
     gtaaactaaa ctgtaataaa agtgtttcga ttttcttatg tgcaatgaca gctgacctgg    214740
     caacctactt aaccaccagc gtccagctcg gagtcgtttt cccagatcca gcatcaggca    214800
     tgatggcttc tattctaaaa ttcatggcaa ttttctgtgt cactcaagtt ccaatcgcga    214860
     ttgcagaagg cttactcact gtagttatgt acaatcttat tagcaaaaat ttaccagaaa    214920
     aggtggcaca attacgatga aaaaaatcaa tattaatatc attttaattt tattagtagt    214980
     tttgttaatg gtgagcccgt ttttcttcaa taaaacaggt gagtacgggg gatcagacgg    215040
     agaagctgaa gcagaaatca ctaaaatcga tccaagctat gaaccgtggt ttgaacctct    215100
     ttatgaacca aaaagtggcg aaattgaaag cttattattt accctgcaag gttgcatcgg    215160
     aacaggaatc attgcgtatg tcattggtgt aagtcgtggc aagcggaaag ctgagaacga    215220
     tgttaaccat tgataaatat gcttatcaaa accggtggat agctttttcg ccatcattaa    215280
     aagcattatt ttatgtcgcg attctaatac tcgcgctaac tggccctgtg ctcgtacaag    215340
     cgatactatt tttatgcatg gtgccactga cgctttatgt tgttaaaatc cactttaaac    215400
     aatatttgaa atggctcctt ttaccatttt catttctact atttagtttg ctttcgattc    215460
     ttatttcaat ttcaaaagat ccaagtagtt ttcttgcttc aatctctatt ggaagttttt    215520
     atcttggtat ttctgatgtg acgataacga cagcaactca agtttttttt cggagtattg    215580
     cttgcttagc ggcaacatac tttttcgtct taaccgttcc cgtggtacaa ttaacgaaag    215640
     tgatgaagca aatttttatt ccaaaagtgc ttattgaact aacgatttta atttatcggt    215700
     tcatctttat tttcttagaa gaagcggcgg cgattcgaaa agcgcagagc ctacgtttcg    215760
     gttaccacgg cataaaaaat agctatcgtt catttggaat gctcgtaaat actttattta    215820
     atcgcgtaat gaaaagatat aatgaaatgg ttataacact tgatgtgaag ctatatcaag    215880
     gagaatttca tatctaggag gaagccaatt tgcttaaaac agaacatatt tcattccaat    215940
     acgaagatgg caaacaagcc ttaacggatg tttcaatcga tttagataaa ggcaatatta    216000
     ttggccttat tggtgcgaat ggctccggga aatcgaccct ttttatgcag cttttaggca    216060
     ttaataggcc aacttcaggg acagtttatt ttgaaggaaa accacttgct tacaataaaa    216120
     aagccttatt tgcattgcga aaaaaagtaa gtattgtttt ccaagacccc gaccaacaaa    216180
     ttttctattc caatgtacgt gatgacgtgg cttttgcact tagaaaccta ggtattagtg    216240
     aaaaggaagt ggagtcacga gtaacaaatg tactagaaac agttggtgcg acagaatttc    216300
     aacataaacc tgtccaatac ttaagttatg gtcaaaaaaa acgtgtcgct attgccggag    216360
     cgcttgttct tgatacagat tggttgctgc ttgatgaacc aactgcagga cttgatccga    216420
     ttggtaaaaa aattatgatg gaaattatcg aacgtcttgc aaaacaagga aaaaagattc    216480
     tcatttcaag tcatgacatc gatttgattt atgagatttg cgattatgtc tatatgttaa    216540
     aagacggaac agttttaaca agcggggaga cgagcgaggt tttcttagag aaaagtcata    216600
     tcgaacaagc agggttagta cagccgtggc taatcaaatt acaccaacaa gctggctacc    216660
     cacttttcaa aaaagaagcc gattttttcg cacatacggg gaaggtgatt aattaatggt    216720
     agagcaaata atgattcaag gtaccgcttc cgatgcaggg aaaagtgtaa tagttgcagg    216780
     tttatgccgc ttatttaaaa ataaaggcaa gcgagttgtg ccttttaaat cgcaaaacat    216840
     gtcactcaat tcttttatta ccgcaacagg tgatgaaatg ggacgtgcgc aagttttcca    216900
     agctgaagca gcaggggttt ttccagatgt tcgaatgaat cccgtgttac ttaaaccgac    216960
     caatgatcgt cagtcgcaag taatttttat gggagcgatt ttagataata tggatgctgt    217020
     ttcttatcac gattttaagc aaacacttat cccaaaaatt caggcagttt atcagagttt    217080
     agctgatgaa aatgatatta ttgtattaga aggcgctgga agcccagccg aaatcaattt    217140
     gaatgaccga gatattgtca atatgggtat ggctaaaatg gtcgacgcac ctgtcgtgtt    217200
     agttgctgat attgataaag gcggcgtgtt tgcttcgatt tatggcacga ttatgctttt    217260
     aaaagaagaa gaacgtgcgc ggcttaaagg agtaatcatc aataaatttc gcggtgatgt    217320
     agcactttta caaccaggca ttgagatgat agaagagctg acaaacgttc ctgtcattgg    217380
     cgttatccct tatgctaacc tacaactaga agaagaagat agtgtttcac tcagcgggaa    217440
     aaattacgtt ctagatagtt cggcgttact tgatattgcc attatttgct tgcctcgaat    217500
     ttctaatttt acagactttc atattctaga aattcaacct gacatcagtg tgcgttatat    217560
     acgaaattta gctgattttg gaaatccaga tttagtcatt attcctggca gtaaaaatac    217620
     gctggaagat atggcttttc tcgaacaatc aggcctgaaa aaagcgattc aaaactatgc    217680
     cgaaaatgcc gggaaagtaa ttgggatttg cggtggctac caaatgctcg gtaaaagaat    217740
     gcttgaccca aatcaagtag aaagcgaaaa agtagaaatt gcgggacttg gcttattaga    217800
     tactgaaaca atctttctcg accaaaaacg cactacacaa attactggcg tgacattttc    217860
     ttcggaacca gtcgaaggat acgaaatcca tatgggccaa actaagcgcg gcgagaatac    217920
     tcaaccgttt tgtaaaatta aagcagtcaa cggtaaccaa gaaacacacg aggacggtgc    217980
     catctccgcg aacaaaaaca ttatcggcac atacatccac ggtattttcg ataatgatat    218040
     tttcttaggc aatctattca atgaactgct aacacaaaaa aacaaatcca tttatccaca    218100
     tgaaattatc aaactaaaag aacataaaga aactgaatat gataaactag cggctctttt    218160
     agaagcaaat attcaaatgg atcaactaga aaaaattatg aaaggagaaa aaatatgcgt    218220
     atctacacaa aaaccggcga taaaggaatg acaagaatta tcggggggag caaagtaagt    218280
     aaagataata tacgaattaa tgcatatggt acactcgacg aactcaattc gcttatcggt    218340
     tacaccatta caactcttgg aaatgaaccc gaaattcaag ctgaacttga gcaaatccaa    218400
     caacaattat tcgatgcagg aggcgacctc gcaacagaag aagggaagcg cgattataaa    218460
     ctgacagctg agccagttgc ttggctagaa gaccgcattg atatttatgc cgatgaacca    218520
     cctgaaattg aaaaattcat tttgccagga ggtactcaag cagcttcttt acttcatatg    218580
     gctagaacag tggcaaggag agcagaacga gaaattgttg gtatgctaaa aatcgcctcc    218640
     actaaccaag aagtattaaa atatgtaaat cgcttatctg attacttttt cgctgttgcc    218700
     agagtcgtga attatcgcgc aggcgaaacc gatattttct acaaaaattc cgaattagtt    218760
     tttcgaaata aaaagaaata acaaaaaacc tctccagaca ttccatccgg agaggttttc    218820
     tttattaaaa gcgttgaatt aaaaatacac caataagcat taataaaaca ccaatcattc    218880
     gataacggtt aattggatga ggaataaccc cgaaaaaacc aaaatgatca ataataagtg    218940
     caataatcat ttgcccacaa agtgctaaaa ctactgtcat agcagagcca agtaatggta    219000
     aaagtaaaat gttagaagtt acaaataata ctccaagtgc gccaccagtg aatacccacc    219060
     aaggaattcg accgacccct tttagctgaa aagtcaaacg acgctccaca attaaacaaa    219120
     caagcgtaag tagcgtggtc ccaactaaaa aggaaataaa tgatgctaca aaaggagaac    219180
     cgacagtgag ccgaagttgg ctattaatcg atgtttgaat cggtgaaagt agtccagaaa    219240
     caagtcccat tgccataaat agtaataatg atttggatga tctttttgtc atgatttctc    219300
     ctccttttaa aatcgttgca tcaagtaaat gccgccgaac attaaaataa caccaagcag    219360
     tcgttcgatg ttaatctcat gcatcggaac ttgaaataaa ccaaagttat caattacaat    219420
     agccataatc atttgtccac acaccgtaat cattacaagc aacgcagagc caagtcgtgg    219480
     taaaagtaaa atattagctg ttaagaaaat aacgcctaat gttccaccgc caacccatat    219540
     ataccaagga tttgaggcaa tcatttctga agatattggc catgattttt gtgtaaataa    219600
     acaaacaata agtaaaacag tcgtccctac cataaaagaa acccacgaag ctaaaaacgg    219660
     tgatttcgta tatgtactaa gtcgtgtatt gatggctgtt tgaacgggta ataccatccc    219720
     cgccagtaga cctgatacaa taaataatat aatcaaaaat ttccctccct tttatcacaa    219780
     tgaaataatt ataaaataaa agaggggtaa aaagatagta tttaatttaa agtgaggtgt    219840
     ttttatgaaa atccgaataa tcggatctgt tggaagcggc aaaaccactt tagcaaaaaa    219900
     agtttccaag tggctacaaa tagatttttt tgaaacagac cgaattgtat ggaaaagaga    219960
     agaaacggaa gtgagacgaa gcgattcaga aaaaatagcc gagttaaatg caattctcca    220020
     gaaggataac tggattatcg aaggcgtgca tttagaagcc tggacagaag agagcatttc    220080
     acaagccgac attattattt accttgattt acctaaaaaa caaatccgct ctcagcttat    220140
     aaaacgccaa ttcaaacaat tactacgaat cgaaaaagcg cactacgtag tccgattcag    220200
     catgctaaag aaaatgtttt actgggatga tttatttgat caaaggacta aaccattagt    220260
     gaacgaaaaa ataaatcaac atccagctaa atggttaatt attaaagaaa atctagcgtt    220320
     tcatgaaatt caacaaaaaa tattgcaaat tatatcgagc cgtgatatat tatgagtatc    220380
     aaatacatcg aggtgcgata taattatgga tgaaaaacta cgaaaaacct atcttcccat    220440
     gactgaaact gccttttaca tattactttc gctagttaaa ccgaagcacg gttacgcgat    220500
     aattgaaaat gttgcccaaa tgaccaatga gcggattaaa cttggaccag gaactattta    220560
     cggtagttta tccaaaatga acaaagacaa tttaatccaa atcatccaag aggagagcaa    220620
     ccgaaaaatc tatcaaatca cagaaatcgg tgccgaggtt ttgcagttag aaaaaacacg    220680
     catagaagaa ttgtatagaa attcgaggga ggtttaatca tggagaaaaa agtcttaaag    220740
     ttttttactg tagataatat ggaaaaagaa gaagcctatt taaacgatat ggctcaaaaa    220800
     ggctggttat ttaaagaata taaatctttt aggtaccatt ttgaaaaagg ggaaccgaac    220860
     aaatatcgct atgccattga ttataaagtg aatcaaggcg acgaagcctc gtataaagca    220920
     ctctttgctg atgctggttg ggataatgta ttctgctatc cagtattaaa cggtaattgg    220980
     atgtatttcc gaaaactaca ggccgaagag gcaggaagtg aaacgatatt ctcagatgaa    221040
     gtatcatata ttcatttata tagaagtatt cggaaacgct ggacgatttt tggcatatta    221100
     atgagtattc ttttattgct ggatttattt ttcctaaaca atgctggaag ttatcaagta    221160
     attactattt tcatttttat tctatttatt attctcatcg gtttgtacgg aaagatgttt    221220
     atccaattaa cgaggaaaat aaataaattt gcgaacaaaa atctataaaa cagaatgtaa    221280
     gataattatg atggcgtcaa ctaaactatt ttataataga agaaactcgc atttttttaa    221340
     aatcatccca tttaatcctg aacttatatg actaaatgat ggcaaatgtt acaaaatgaa    221400
     gaacaaatgt tatcaaataa aattaaattg aatctataac taactttttg ccttatcata    221460
     aaatgttaaa gatttcttaa aagacattta gatggattgc aattgtgttc aaattaacgt    221520
     attctaaaag catcaaggga ttcggagaca gaaaggcgtg acgacatctg aagtatagaa    221580
     aattatccaa aaagaaaaaa caaaaaaggc taattgggat agcagggatt ttactgctga    221640
     ttattctagt aggtgtcata gcatctgtag tcagacaaca atatttaatt atgacagcac    221700
     cgaaaccgga cccagcattc cattcaaaag agcagaactt tcttaatgaa ctctctcctc    221760
     gtgcacaaga aattcaagca gaacacggca ttttaacgag tattacttta gcacaagcta    221820
     tccttgaatc taactggggt caaagcgatt tagcgcaaca aggtaataat ttgtttggtg    221880
     taaaaggcaa agctccacaa ccgatggtaa acatgacgac aaaagaattt gtagacggaa    221940
     aatggattga aatcaaagcc aacttccgaa aatacaaaga ttggaatgaa tcattagaag    222000
     cacacgcaga actcttttta aaaggaactt cctggaataa agataaatat aatggcgtga    222060
     tcaaagccga tgattataaa aaagctgcag aagaattaca aacagcaggc tatgcaaccg    222120
     atccaggtta tgcagagaag ttaatcaata ttatcgaaaa atatgactta gctttatatg    222180
     atcgtataga tgataagata tactatgatg caaaatcaac tggttatggc aacgtaaaaa    222240
     aagacgtttc tggagcaatt tggacaaggc cttatggact atctggagca caaaaagtag    222300
     aagaaattaa ctactacaaa cgagaagatt tgaaactttt acgagaagca aagacagata    222360
     gtggcgtttg gtatcaaatt tccgtgaaaa atgatccaat tggttgggta aaacaagaat    222420
     taattgataa aaaataagaa ataaccgaaa aagagctaaa atgacttgtc ttatttatag    222480
     gcaaaaagtc cttttgaagc tctttttctt ttttattttc ataacagcca tctcccgaaa    222540
     aggttactat acaatagcta agggcctttt gtaacataag taatgtaaaa gtaatgtgta    222600
     ttacaaagaa gttttgttag aatgaagtgg ttgttttaaa gaacacacgt ttctggtttt    222660
     gataagccag aaagatattt caaagaagga tgtgcaataa atcattatgt tacaactcgc    222720
     aaagaagcat ttggtgacaa ttggtcttgg aattacaatt acattatgtg cagtaccaat    222780
     acactcccaa gctgctggtc tagaggacgg cttaacttcc aagcaagaga ggtttattaa    222840
     tgaaattgcg ccgcatgctc aaaaagtgca aagagaacat ggtattttag caagtatcac    222900
     tatttcgcaa gctatactag aatccaattg gggagaaagt atgctagcaa aagatggcaa    222960
     taatttattt ggaatcaaag gttcttataa tggagcctct attaaattac caaccaaaga    223020
     acacaacggt cttgtttggg ttggtaccga tgctaatttc cgcgcatacc cgggttggta    223080
     tgaatcgatg aatgaccacg cacttttatt tgtcaatggc ccatcatgga accctcattt    223140
     atacgggggc ttaatcaaag aatataactt tgaaaaagcg gctattgcac ttggaaaaac    223200
     tggctattcg tctgatccag agtatgcagc aaaattaatc gacctaatta aaaaagcaaa    223260
     tttagataaa tatgatacag tttatagcga acgagtatct gataaagcaa ttaaagctgc    223320
     tggtgaagta gctataaaag ataattcctt tatttggtcc gcgccaggtg gaacaaaagg    223380
     agcaaatcca gtcgaaaaaa caaccaaata ttttggacat caagtttcta ttaatagaga    223440
     agttaaagta acggattcca atatttcgtg gtatcacatt catcataatg gcgattctat    223500
     cggttggatt gaaagcacct ctataaaaaa attctatcaa ttagaagatt atgctccaac    223560
     gcgcgacgct ttacttaaaa cagatgatca aaatcgttta gtaattaata tggatattga    223620
     tacatcagaa ctgcacaaac ctacaatagc taaggaagaa acaaagggca aaactgcact    223680
     taatctacct ttattaaacg ttcagtcaat tgcttggtaa gtaaaacgca aaaaaagtcg    223740
     aatagctgtt tcggcttttt ttgcgttttc aaaggaattt tagagagaaa ctgttataat    223800
     gtaaaaggag tttataagga gggttattta tatggatgaa caattaaaga tgttaaaagc    223860
     actaacggat gcaaaaggta ttcccggtaa cgaacgtgcg gttagaaacg tatttcgtga    223920
     atatattgaa ccgttagctg atagttttga aacagacggc ttaggtagcg ccgttgcgaa    223980
     aaaagtgggc gcagaagatg gaccaaaaat catgattgct ggtcatttag atgaagttgg    224040
     ctttatggtg actcaaatcg atgataaagg ttttattaaa tttcaaacag tgggcggttg    224100
     ggtttcgcaa gtaatgcttg cacaaaaagt aacaatcgtg acgcgttctg gcgaagaaat    224160
     caccggtgtt attggctcta aaccaccgca tgtaatgaca gcagcagaac gtcaaaaatc    224220
     ttttgatatt aaagatatgt ttattgacgt tggtgcggtt gataaagcag aagttgaaag    224280
     ttacggcatt cgtcctggtg atatgattgt gccagcattt gattttaccg taatgaaaaa    224340
     cgagaaattc ttacttgcaa aagcttggga taatcgtatt ggccttgcta ttgctatcga    224400
     agtacttaaa aacttacaaa aagaagcaca cccaaatatc gtttacggtg ttggaacagt    224460
     ccaagaagag gttggtttac gtggagccaa aacagcagca catttcgttc aacctgatat    224520
     aggttttgct gttgatgttg gtatcgctgg ggatactcct ggtgtaactg acaaagaagc    224580
     aatgagtaaa atgggggaag gtccacaaat cgttatctat gatgcttcca tggtagcaca    224640
     tgctggcctt cgtgattttg taacggacgt agcagacgaa ctatctatcc cttaccaatt    224700
     tgaagcaatc ccaatgggcg gaacagattc agggtctatt catttaacag gaaacggaat    224760
     cccgtcgtta tccattacaa tcgcaactcg ctatattcat tcccattcgt ccatgctaca    224820
     tcgtgatgat tttgaaaatg cagtaaaact aattactgaa gtagttaaac gtttagataa    224880
     agaaaaagta acagaaattc gcctaggttg agtttcgaga aaagaggaca acttttatgg    224940
     aacagattca atcagtaaaa aacgaccgtg tcaaaacatg gaagaaacta caaacgagaa    225000
     aaggccgcga taaaaccgga acttatttgg tggaaggctt tcatttagtg gaagaagcgt    225060
     tacgtcaaga tggtttagta ctggagctgc ttatttcaag tggtgtttct gttccagaag    225120
     agtggttaaa aggcgactat gatgtatttg aaattagttc cgaaatcagc catctaatta    225180
     gtgacacaat gacagaacaa ggtgtatttg ctgtcgttgc tatttcagag cctgacatga    225240
     tgctattata tggtaagaaa ttgttactcg tagatgcagt acaagatcca ggtaatgtcg    225300
     gcacgttaat tcgaactgct gatgcggctg gatatgattg tgtcgtttta ggcagaggca    225360
     gtgcagacct ttataatcca aaagttattc gtagcacgca ggggagtcac ttccatattc    225420
     ctgtcattca agcagattta tttgagtggg tggcgaattt agaagaagaa ggtgttccag    225480
     tgattggagc agttttagat gaccaagcca aatcactcaa tgatatgcca aagcgtgaaa    225540
     cattagcctt aatggttgga aacgaaggaa acggcatatc agaagaatta caagatcgac    225600
     tttccgaaaa agtatatatt ccaatttacg gtgatagtga atcattaaat gtagctgtag    225660
     cagccggaat tttactttat ggtttaagaa aataataaaa gtggttgata agtcggaatg    225720
     aacttatcaa ccactttttt aaatctcttc ttgtttttcc atttttactt cacgaattgc    225780
     gacgcgtttt aaatcagcta cgacactatg catataatca aacgcagcgc cccagtcaat    225840
     cccagtaaag aagccgttcg aactacctgt tgagataatc gttacttctg tttctccgtg    225900
     gaaattatta atgttaacaa ataatgccgc tcgattagaa gaacggaagt aaaatttttc    225960
     gcaagcaagt gtcgctagtt ctccaaaatc aaatgttcta atttcggaaa atacaatatt    226020
     tgaccctact tgaccagctt tgattatttc gaaggtttct gaaacatctg ttttaacaat    226080
     gtagcgaata gatggcatga gagacgcctc cttcattaat ctatcttact tatattttaa    226140
     gtcagaagga tactttggtc aattatattt caacttacta aatataagca acaaaagatt    226200
     tattagttac tttctgatga tagatatggt acaataacgt tagaggtgag aattatgact    226260
     gatgcacata cagtatgtcc gaagtttgaa tcggcgttcc aactattagg taaacgctgg    226320
     actggactta tcatcaatgt cttactgact ggtccaaaaa ggtttaaaca agttgccgct    226380
     gagatcccac aaatgagtga tcgggtgctt gcagaacgtt tgaaggaact tgaggaaatg    226440
     gatatttgct taagacaagt ttatccagaa actcctgtac gcattgaata tgaactaacc    226500
     gaaaaaggta aagcactcca agaagtaatg cttgaagtcc agtgttgggc ggataaatgg    226560
     gtggaagtac ctaattaaaa agagataatc tctccaacta atatggggag attatttttt    226620
     agcttgaatc tttcgtagaa ccatactata atagaaacta tctaaataag taaagacaat    226680
     gaaagagcca agtagcatag tgagtctgta tagggagaag tggtcataga ctgaaagcca    226740
     ctttacaaac gaatttgcga acatttcacc tctggagtcg ccccccgaga agcacgttat    226800
     gtgtgaaggt ggtccggtta ctaagccgtt atcgaatttt gagtgggaac aaattttgtt    226860
     cttattaggg tggtaccgcg agaagtctcg tccctttgtg gatagagctt ttttattttg    226920
     tctaaaaaga aggagtgaac ggtatgttag agcaattaca aacgctgaaa agtgaagcag    226980
     aaacgcaaat taacgaagca gcagacttaa aaacattgaa cgacttacgg gtaaaatacc    227040
     ttggtaaaaa aggcccgatg accgaaatca tgaaacaaat ggggaaactt tccgcagaag    227100
     aaagaccaaa aatgggttca cttgctaatg aagtaagaac agccttaaca gaagcgattt    227160
     ccagcaaaca agaaattctg gaaacagcag caattaatga aaaattaaaa tcagaaacaa    227220
     tcgatgttac tttaccaggc acagcgccaa gcatcggaac aaaacattta ctaacacaag    227280
     taattgaaga aatggaagat atgttcattg gtatgggtta tgaaatcgca gaaggaccag    227340
     aagtagaact ggattactat aacttcgaag cattaaacct tccaaaagat cacccagctc    227400
     gtgatatgca agatagcttc tatattacag aaaatacttt attacgtact caaacatcac    227460
     ctgtacaagc aagaacgatg gaaaaacatg acttctctaa gggaccaatc aaagttatct    227520
     gtccaggtaa ggtataccgc cgcgacaacg atgatgcaac tcactcccac caatttacgc    227580
     aaatcgaagg gctagttgtt ggtgaaaaca tcacttttgc tgatttaaaa gggacgctga    227640
     ctgttcttgc taaaactatg tttggtgaag aacgcgaaat tcgccttcgt ccatcattct    227700
     tcccattcac tgagccgtct gttgaaatgg atatttcttg tttcaaatgt ggtggtaaag    227760
     gttgccgcgt ttgtaaggga acaggttgga ttgaaatttt aggaagcggt atggtacatc    227820
     caaacgtact agaaatgtcc ggtattgatt ccactcgtta cagcggattt gcttttggct    227880
     taggacctga acgtgttgcg atgttgaaat acgcagtgga tgatattcgc cacttatata    227940
     cgaatgattt acgctttacg aagcaattcc aaagcacaga aacgggggaa atctaatgtt    228000
     agtttcatat aattgggtca aagaattttt ccaagacttc ccgttaacgg cggaagagct    228060
     aggagaagca attacaagaa ccggaattga aattgaaggc gtagaagaat taagcgctag    228120
     tttgaaaaat gtcgtggtag gcgaagtatt atcatgtgaa cgccatccag atgcagaaaa    228180
     attgaacaaa tgccttgtcc aaactgacga agaagagcca gttcaaatta tttgcggagc    228240
     tccaaacgtt gctgcaggtc aaaaagtaat cgtagccaaa gttggtgcaa gacttccagg    228300
     cggacttaaa atcaaacgcg caaaattacg cggcgaagtt tcagaaggaa tgatttgctc    228360
     acttgctgaa cttggctttg aaagtaaagt tgtaccaaaa gcttatgcgg acggcattta    228420
     cgttttacca gagcatgttg aaacaggcgt gagcgcaatt actttacttg gcttagatga    228480
     tgcgattctc gatatggcaa ttacaccaaa ccgcgcagat gctttaagca tgaacggcgt    228540
     agctcatgaa gtaggcgcaa ttatccatca aaaaccagcg caaccaaccg agcccgatgt    228600
     atctgaaaaa ggtaaagcgg acgattttat ttctgtagaa gtagaaaatc caacagaaac    228660
     accttattat gctattaaaa tggttgaaaa catcgaaatt aaagaatcac ctctatggct    228720
     tcaaacaaaa ttaatgaaag caggcatccg tccacataat aacgtagtcg atgtaacaaa    228780
     ctacattaat ttattatacg gacaaccact gcattcgttt gactatgata aaatcggtag    228840
     taaaaaaatc gtcgttcgtt ccgcaaaaga ccaagaagaa attaccacac ttgatggcga    228900
     gaaaagaata ttacaaacag gacacactgt tattactaat ggaactgaac cgatagcaat    228960
     tgctggggtt atgggcggag agttttctga agtaactgaa acgacaacaa ctgtggcact    229020
     ggaaggagct attttcagta gttcatctgt tggaaaagca tctcgcgaat tatatttacg    229080
     tacagaagca agtattcgat atgataaagg ttctgatgct tggaaagtag aaaaagcact    229140
     tgcacacggc ggagcactta tcgctgaact tagcggcgga acgcttgttg gcggcgtagt    229200
     agaagtagat aatcgtgaaa aagcagtaaa taaaatcgaa acaagcttaa cacgtattaa    229260
     ccgtatttta ggaacggaga tttccctttc cgaaatagaa acgatttttg atcgcttagg    229320
     atttgtatta gaagttaaag aagacacatt aattattgaa gtaccgacta gacgttggga    229380
     cattacaatt gaagcggata ttttggaaga agttgcacgt atttatggtt atgatgaaat    229440
     tcctgtcaca cttccagcaa cgagcacaac tggtggatta tctgacagcc aaaaagctcg    229500
     tcgtgtaatg cgcgcttatt tagaaggagc gggacttaac caagcattaa cgtattcctt    229560
     aacatccaaa aaagatgcga ctcgtttagc gttatccgat gaaaaaacag tggcgctttc    229620
     aatgccaatg agtgaagaac atagccattt aagaacaagt atcgtcccac aattaattcg    229680
     tagcgcaagt tataatatcg ctcgtaaaaa tatggacgta gcactttatg aaatgggaac    229740
     cgtgttctac gcaacagaag gtgacaattt accaatcgaa caagagcatt tagctggctt    229800
     aattactgga aattggcaca cagctgattg gcaaaaaaca ccaaaaccag tagacttctt    229860
     tgttttaaaa ggaattgtag aaggtttagt gaacaaactt ggaatcgaag ccgaactgca    229920
     ctggaagcaa atcgaaaaag aagaactgca tccaggaaga acagcaagca tccaattaga    229980
     aggaaaagaa atcggttatc ttggagcgct tcatccagca gtggaagcaa gctacgattt    230040
     aaaagaaacg tatgtatttg aaattaatgt aaaagcgtta cttgatgcaa cgaaagaaaa    230100
     agtagtttat catccaattc cacgctaccc agaaatgaca cgcgacttgg ccttacttgt    230160
     ggataaagat actgaccatg ctacaatctc tcaagtaatc aaagagcacg gcgggaatct    230220
     cttagtcgac attgaacttt ttgatatttt cgaaggagaa agtttaggcg aaaacaaaaa    230280
     atcactcgct tatacgttaa ctttccttga tagcgaaaga acacttgtcg aagaagacgt    230340
     acaaaaagca actaacaaag tagtagaagc attacaagca aaactacatg ctattatccg    230400
     ctagttaact aaaaagaact gaactatttg gaaaacattt tcgagtagtt tggttctttt    230460
     tttgtacagt ggaaatcttg cctgttttaa cacttcacta actaaaataa cacatgttat    230520
     aatggttaaa tatgacaaac aaaagaagga cgaaaaaaat gacctatgta gaaatgaagg    230580
     acgtatctaa attctatcaa atgggcgaaa atgttgttac agctaatgat aaaattaatt    230640
     ttggaattaa aaaaggggaa tttgtagtta ttgttggtcc ttcaggtgct gggaaatcta    230700
     ccgtattaaa tatccttggt ggaatggaca gtgccagtga agggcgtatc atggtagatg    230760
     gccaggatat tgctcaatat aacgcaaaac aattaactaa atatcgccgc acggatgtcg    230820
     gattcgtttt ccaattttac aatttagtgc ctaatttaac tgccaaagaa aatgtggaat    230880
     tagcagcgca aatagcgcca aatgcattag atgcagaaac cgttttaacc caagttggct    230940
     tgagtcatag attagataac ttcccggctc agttatctgg cggtgagcag caacgggttg    231000
     caattgctcg agcattagct aaagcaccca aattgctttt atgcgatgaa ccaactggcg    231060
     cccttgatta tgatacgggt aaatcagtct taaaattatt acaagaaact tgcgaaaaga    231120
     ctggtacaac agttattgtt atcacccaca atacagcgat tacgccaatt gcagaccgaa    231180
     taattgaaat taataatgca aaagttcgga gcatcaaaga aaatacggaa ccaatgtcca    231240
     ttgatgattt agaatggtag aaaggagcaa gcattgaaac gttcagcttt atggaaagat    231300
     atctaccgag aaatatggca ttcaaaaagc cgctttattt caatttttat gctgataatg    231360
     ttaggtgttg cttttttctc cggactaaaa gcaactggac cggatatgct tttaacagca    231420
     gacaattatt ttaataagta tcaactcgcc aatttcaatg tccagtcaac atatggacta    231480
     gatgatacgg ataaagaagc tttagaaggt atttcgggag tcgctcaagt agacttagga    231540
     tatacagcag atactttaat gaaagaaaac aacatcgtta caaaattata ttcaagctct    231600
     gcaagtgata atttaaataa atataaagta gtaagtggtc gtttgccgga aaaatcaggt    231660
     gagattgctc tggataacaa caaagttatt caagacaaca tcaaaatcgg cgacaaagta    231720
     acttttgtta aaaatgatgg aagtgaatta acccatacac ttaaaaaatc aacgtataaa    231780
     gtagttggct ttgttcgatc accagcatac atccaaaaat ccgaacgggg atcaagtact    231840
     gttgggaaag gaaaaacaga cgcttttggt gtgattccag aacaagattt tgatttgcca    231900
     gaatacacta ttgccagtct cacttttaat aatctagcgg ataaagaagc ttttagtgat    231960
     gcttacattc gcacggagaa aaaagataac aaaaaagtgg agcaagcttt agcaggacaa    232020
     ccagaaaaac gactgaataa aattaaaacg agcgaacaaa aaaaattaga tgatgccaca    232080
     gccgaaatca ataaaggaaa agcagaacta caaaaaaatc aagccaaact agatgctgca    232140
     aaagcacaat tggatgaagg cttttccaag tataatgcag caaaagctag ctatgatgcc    232200
     aaaattaaac aaggtgaatc agaaattgct gctggtgaag cggaactagc gaacgccaaa    232260
     aaacaattag atgccgcaaa aatgcagatt aatcaaggcg aagaagccat tttacaagct    232320
     gaaagagaat tagaagaagg cctagctgca tggaatgagg ccaataatct cctcaataca    232380
     gcaaatggat acttaaaaaa tgcgcgatca accttagaaa atgcattaaa acaaccagat    232440
     ttaactgatt ttgacatcga ccgagaaagc ttaactaatg cattcaacat ggcggcttca    232500
     gaacttgata tttcagctga agagctcgcc gaatacgaag aaaccattaa cactttgctc    232560
     gatgattatg aaaatggagc cattagcgat gcacaaatcc gggaagctct gaacgctgca    232620
     cttaaacaag ttgctgaagg tgaaaaagcc tatcaatcgg ctcgaacagt tttagatgaa    232680
     gaaaaacaaa aaatagagca aggcgaaaaa acattagcta gtaaacaaca gcaacttgag    232740
     caagcaaaaa tagcgtatca agcgggatta gcaaaatatc aagccggtca agaaaaaatc    232800
     tccctcgcta aaaagcaatt ggctgatgga aaagagacag gcgccgtaga attacaaaat    232860
     gcactaaaaa aattaaacaa tgggcaagca gaatacaata aaaatctcgc actatttgaa    232920
     aaagagaaaa aggcagctga agccaaatta gctagcgccg aaaaagacgt taaaattggc    232980
     caagaaaaac tcgatgcact taaactaccg aaatactatg tccttgatcg taacgataat    233040
     ccaggttata gcgaatataa agaaaatgcc gatcgtttaa cttctttatc cacggcattt    233100
     ccaatctttt tcttcttaat cgcagcactt gtttgtttaa caacaatgac tcgaatggta    233160
     gaagaacaaa gaacgcaaat tggaacatta aaagcatttg gttattcgaa cggtagcatc    233220
     attttgaaat atcttgttta tggttcgatt gcaagtattg gcggaagtat cgttggaatt    233280
     ataatcggtt tccaattctt cccaaatatt atctttaatg cttataaaac aatgtatgaa    233340
     atgcctgctg tcgacatcgg attttattgg agttacagtt tattatccat ttgtgtagca    233400
     ttattctgta cgactttcac cgcatatgca gcatgtcggg cagaactaag agcgaatgca    233460
     gctacattaa tgcgcccgaa agcaccaaaa atcggcaaac gaattttctt agaacgaatt    233520
     agctttatct ggaaacgaat gaattttacg agcaaagtaa cagcaagaaa tctcttccgc    233580
     tacaaacaac ggatgctaat gacagtactc ggtgttgctg gttgtacagc gctaattctt    233640
     actggctttg gactgcgaaa ttccattagt gatatagcta aaatgcagta cggtcaaata    233700
     atgaaatatg acgcagcagt ttatcaagat atgagcgctc caccaacagc aaaagaaacg    233760
     tacgataacc taatggaaga ttctaatatc aaaagtaaac tagcgatgtc gcaaacaaat    233820
     atagatgcag tcaaatcagg gcaatccgca caagcgagtt ccatcattgt ccctaaaaat    233880
     ttaaacgaat taccagacta tatcgtgttg cgtgaccgtg ctagtcacac aacagaaaag    233940
     ctaacagatg atggagcaat aattagtgaa aaactagcta aattattcga tataaaacca    234000
     ggcgattcga ttactgtaaa aaatgcgaag aatgataagt acaaaatcaa agttagcgct    234060
     attacagaaa actatgcaat gcactatatt tacatgactc caacgtatta tcaacaaata    234120
     tttgacgaaa aacctagtta caatttagat ttattaaagc ttaaagacac ttctgaaaaa    234180
     gtagaaactg agttcgcaga aaaattaaca gatagtaaat ctattttaac gattactttc    234240
     tcaaacaata taagttcgat gctaacggat actctagata gtttaaatat tgtcattgtc    234300
     gtattaatta cttctgcagc actactagcc tttgtcgttt tatacaacct tacaaatatt    234360
     aacgtatcag agcgtatcag ggaactttcc actatcaaag tactcggttt ttatccaaaa    234420
     gaagtgacaa tgtatgttta ccgagagaat atcattttaa ccttgatggg cattgtcgct    234480
     ggatttatcc ttggcttctt cttgcaccga tttattatca cgactgcaga agtcgatcaa    234540
     atgatgttca gccctgcaat tgattggaca agctatctat tctccggcat tcttaccctt    234600
     gtttttgcat ccatcgtcat ggttgtgatg cacattaaac ttaaacgaat tgatatgatt    234660
     gaagcactta aatccgtaga ataaccttga aaagaacttg ctatttaagc aagttctttt    234720
     catttgactt caaaataaat aaagcttaaa cttggaaata gttaaggggg tgaactttat    234780
     ttggaaaagc aaaaagtgaa acaactgata aagagttacc aacaaactta catattcgcg    234840
     atgacacata tacatcaggc tatttctgaa atttcagcta atacagtaga cttatcgatt    234900
     gaacaatttt ttgtattgcg agaaatagct actggtgatg aaataagtgc tacagaactt    234960
     tctgcttgtc taaatgtcaa taaaagcgca attacaccaa agttaaaaaa actagaagaa    235020
     aaaggctaca ttagacgaga acgaaacaag catgataaac gcgccgttgt tttaaccatc    235080
     acagaaaaag ggaatagcgt ttacgaagag tgtgaaaaac aattagagtt actcgtaaat    235140
     gaatggcttg aaattctagg ggaagaagac agcgaacaat tttttgagtt atttcaaaaa    235200
     attaacaagt cagttgtcaa accgaaaaaa taaaaggaga gatttggcat gaaatggatt    235260
     atgaaactcc gctgggccat tttagcattt tggcttgcag cagcagtcgt actaatgttt    235320
     atcgcaccac ccatggcaga tcttgtacgc gaaaaaggcg aattaaagct gcctgatggt    235380
     tatccgtcct cacttgcgac agaaatgcaa aagaaacaca atccggatga caaaggttca    235440
     gcatacattg cggtgtacac agctgaccat aagttaactg gaactgagtt aaacaatatt    235500
     aaaaaatcac ttgattccat tgacaaaaat aaagatgaac ttcacgtaac caacgttgta    235560
     tcaagtttta atcaacccga attaaaggat aaattcttat caaaagacgg taaaacgatg    235620
     gtagcaagtc taactgtaga tgacacagat gcctctgtta aaagcattcg aaacgcttta    235680
     gacaaaaaaa tggatgttaa aggcgttgat acttacttaa caggaaataa attaattcaa    235740
     gaggatgttg ttcagggttc agaagacggt ttacataaga cagaaggcat cacagttgtc    235800
     tttattttag tcgtattatt ccttgtattt agatctgcag tagcgccgtt cattccactt    235860
     ttaactgtag gaataagtta tctcgttgca caaagcacgg tcgctttctt aattgacatc    235920
     tttaattttc ctgtttcgac ctatacgcaa atatttatgg tgtgtattat gtttgggatt    235980
     gggacggact attgtattct cttaatgagt aggtttaaag aagaaatggg agcagggcta    236040
     gatccacgag aatctgttca tgcaacttat cgtacagcgg gtaaaacagt tatttatagt    236100
     ggtgtagctg tactcgttgc cttcacttcg ctttatttcg ttcaatttga tttatatcgt    236160
     tccgcagtcg ctgttggtgt cggtattgtc gtcttactcg cagcacttta tacactcgta    236220
     ccattcttta tgagtacgct cggaacccat ttattctggc cattaaataa aaatattagc    236280
     cacaaagaaa ataaagtgtg gggagctgct gggaaattca catttgcgag accatggatt    236340
     gctttactca tcgttgcagc tatcacattg ccgccaattt tactgcatac aggaacagaa    236400
     tcatttaact cattagatga aattagtgac aaatatcctt ctaaaaaagg atttgaaatc    236460
     gtttcagata gttttggagc aggacaagtc gcgcctacac aagtttttat cgaaaatgac    236520
     gataacatgc gtacaacaga atacattgcg caaatcgaaa aaatttccga tgatttatct    236580
     cacttaaaag gtattgatat ggttatgagc gcgtcacgtc cagcaggaaa acgtgtcgat    236640
     gatatttaca ttaaaaatca agctggacaa gtaaatgacg gcgttggaca agcaactgac    236700
     ggagtaggtg aagtcaaaaa aggcttagat tctgctagct cagaacttaa aaaatcagaa    236760
     ccagctcttg ataaagcagt tgctggagtt ggcgaccttc aaaaaggtac cgtggcaacc    236820
     gagcaaggca tcaatcaact tcaagctgca ctcgcacaaa ttcaaattgg aattgaaagt    236880
     ggcgcaaccg gtgcaggaga cttaaaacaa ggagtagcag aagccaagtc acaactcgct    236940
     tcacttcaaa atggagaagc acaaattcaa gcaggttatg cagaaattca gaaaaacttg    237000
     caaaatgtag cagaacaatt aaaaggcttt ggaaatccca attcaccagc aattgacaca    237060
     tccaagctcg aagcacagtt taagaaaatc ggggaatcgt tccaaacatt cgcagcagca    237120
     catccagaag taagaaacga tcctaaattc caaaaactag cggctgatat acaaggtcta    237180
     caaacagctg gtaatgaatt aaaaacaact gcaggacaac aaatggccgc tcttcaagca    237240
     aaaatgaaag aactaaatca aggtattcaa caattagcaa ccgcaatgaa ccaattaaat    237300
     gaacagtcca aacaaatttc agacggccta agcgcatttg gcactggact tggtcagatt    237360
     gaaactggac tcgatcaatt agaaaacggt ctaaatcaag ccgcagacgg tcaaggtcaa    237420
     gtcgtttcta aaatgcctga aatctctaac gccctatctc aaattgcagc aggacaaggt    237480
     gcactaaaag aaggttttgc cggaattagt ggacaaatgg gtgaactaac aaatggctta    237540
     acttcaggag ctgatggatt aggcaaagta gaaagtggtc taaacacagc gaacggactt    237600
     attgatgatt ggtcgaaagt tccttacgca agttctggaa tttacgtacc agatgcgcta    237660
     ttaaaaaatg ctgatttcca aaaagtacta gaccaataca tttcttctga tggaaaacta    237720
     gctacgatta atgttatttt gacaaaaaat ccatattcga atggagcaat ggattccata    237780
     gatgacatta atgaacaact cgcagctagt atgaaaggca caaaactaga aaatgccaaa    237840
     attggtattg gcggaatgac tagcgctaac tatgatacaa gagatatgtc aacagccgat    237900
     tatcatttag tacttgttat cgttctagct agtgtattcg taacccttgt tatcgtttta    237960
     cgttcacttg taatgccaat ttaccttatc gcatcacttg tattaactta ctttgcggca    238020
     cttggatttg cagaaataat ctttatgcga attctcggct atagtggact aacatgggca    238080
     accccattct tcggatttgt tgtactcgtc gcactcggta tcgattattc gatattcctt    238140
     atgtcacgat ttaatgaata taatgggctt tccgttcgtg atagaatgat aaaagcgatg    238200
     aaaaatatgg gcggcgttat cttcagcgca gtgatcattc tcggtggaac attcgccgcg    238260
     atgatgccag caggagttct ttccttactt gaaatcgcaa cagtagttct gattggctta    238320
     gtgctctacg ccatcgttat cttaccacta ttcgtaccag ttatggttaa actattcggt    238380
     cgtggtaatt ggtggccatt tatcacaaga aaaggcgatc atcaagaaaa cgtaccaccg    238440
     aaaaaataat taacaaaccg cattccttta atcgaggagt gcggttttta gtttaattta    238500
     aaaagttatt ttgctaagat gggtatagag atgaataaag gaggaaggaa gcaaatgata    238560
     aaactcgaaa atgactggga tgagttatta aaagatgagt ttaaccagcc atactattta    238620
     aaacttcgcc agttcctaaa aaatgaatac caaaccaaaa gaatatttcc tgatatgtat    238680
     gatattttta atgctttaaa acacacggct tataaagatg taaaagtagt tatacttggt    238740
     caagatccat accacggacc aggacaagca cacggtcttt ctttttcagt ccaaaaaggt    238800
     gttcaaattc caccatcgtt acaaaatatt tatttagaat tacataacga tctaaattgt    238860
     gagattccaa acaatggcta tttgatacca tgggcggacc aaggagtgct cttgctaaac    238920
     acagttctta ccgttcgcgc cggtcaagct aattcgcacc gtggccaagg ttgggaactg    238980
     ctaacaaacc gcattattga aatgattaac cagaaagaag aacccgttgt ctttttactt    239040
     tggggaaaca atgcaaaaga gaagttacaa ctactcacaa atccaaaaca cattgctttc    239100
     acatccgttc atcctagccc actatcagct tcacgcggct ttatgggatg caaacatttt    239160
     tcaaaaacaa atcacttcct agagcaaaat ggcatcaaac caattgattg gcaaattcct    239220
     tctatataat taaaaacgcc tcgtctttat ttgacggggc gttttatcat ttttttgcaa    239280
     ttttcaaggc tttttctgtg ttagcaaaat gttgtttagt atatttagct aatgtttcta    239340
     gtccaaatcg ttcaataatt tctgctgcaa caacgtccac gtgtggtccg gcaccttttg    239400
     gaagcgggat gccaacttct tttgacatag catcaaaggc ttgcacaaat ttatatcgag    239460
     caataatcga agctgctgcc actgaaagat gaagtccttc tgctttcgtt gcgaaaaata    239520
     catcttctcg aataatactt ggctcttttg ctaaatatcg atagtaagta tttttttcag    239580
     caaattgatc aattaaaatc gcttctggtt ttatgggagc aagttttttt aggacatttt    239640
     caatagcacg gttatgtagt aatgctttca tttggccttg gttcatgcct cttttttgaa    239700
     gttcattgta tttaggatta gggcaaagta gcacactatg tggaacgatt ggcatgattt    239760
     tctctgctat tcggcaaatt tctgggtctt tcatggcttt tgaatctttc acaccaagct    239820
     cttttaaaag cggcatcatt tcagcgtcca cataagctgc acaaactgta attggaccaa    239880
     aaaaatcacc agtaccgact tcatctgaac caataacatt tttggcggca aagttcgctg    239940
     gaagaacgcc tttagaaaca ctcggcgcct tcgtttttgc ttctggaaga gtcgcaaccc    240000
     atttttttgc ttcagcttct ccgttgactc cttggaacat tactttacga gatttgtagc    240060
     cagtaatcga aacaccaggt ttttttgccg caaaaacggc tccaggtggg agttttgggc    240120
     ttgaaaaggg aagataagtt tgtttcattt tttcgagtgt tgattgatcg actatgataa    240180
     ctgtatttgc gataaggcat catcctttca aagttctatt gtaacatact acgacgaaag    240240
     actgaatatc tgttaaacgg gtggttgact cttttctttc cagctttttc gtgataagat    240300
     tatgacaagt agcggcctaa atgaatttgg gcgaggagga atttacgtgg caaatgagag    240360
     aaataaagta gtgacaacaa tttatggtag agaatatacg attgttggcg tagaaacagc    240420
     tgaccactta cgaaaagtag ctcgtcaagt tgatgaaaaa atgcacgaaa ttggctccca    240480
     aaatcatgcg ctagatagtg gtaggctcgc ggtattaaca gctgtgaatg caactcacga    240540
     ttatttaaaa ctagaacaaa aatatctaga gttggaacaa gaactggctc gaattaaagg    240600
     aagagattaa tgattttaaa tgcgattatt ttaattttac ttgtttgcgg ctttttcgca    240660
     ggatttagaa caggcctaat caaacaactt attttattac ttggttatat tttggcattt    240720
     tttatctcgt atacgtatta cgaagattta gcgccacatt taacttttat accttatcca    240780
     ggtagtgata cttcagatgg attatccatt attttacaag aattaagaac agaaacagct    240840
     tattacaatg tacttggctt tgcgattatt ttcattgtgg caatcattgt tgtgcatatg    240900
     ctcgcttccc ttgttggtgg cttgactaaa atcccagtgt tgcgtcaaat caatggatta    240960
     ttagcagctg tttttggtgt tattaagtct tatttaatta tttttattgt tttgttcgtc    241020
     atggcaattt atccggcaaa ttggtctgaa aacctcattg atagctcgac ggttgctcag    241080
     tggatgcttg aaaatacgcc aattttgtcc gaacaatttt atgactggat gacagatatt    241140
     ctgccaaaat aaaagaaaca ttcgatacca gatgtatact cttagccaat tttggatagg    241200
     atttctctgg tattttttaa tgaccaagcg agggaggaat taagatggct acgaataaaa    241260
     aagaaatcat tcgtttactt gaggaaatcg ccacttatat ggaattaaaa ggagaaaata    241320
     gctttaaaat atcggctttc cgaaaagccg cgcaagcaat tgaactagat agcagaagtc    241380
     tggcggaaat tgaagacttt actaagatta gcggtattgg aaaaacgacg ggtgagatta    241440
     ttcaacgcta tttggacagc ggcgaatgcc cagaactcgt ggaactaaaa aaagaagtgc    241500
     cagctggcct cgttccactt ttagatgtac cagggcttgg tggtaaaaaa ttatcacgtc    241560
     tttaccatga attaggcgta gtagataaag atacattact taaagaagct cggaacggtc    241620
     acattgaagc attaaaaggt ttcggtaaaa agtctgcgga aaaaatggca gaagcagtgc    241680
     gcgaaatggg cgaacgacct gatagatacc cactaaatga tgtgttacca atcattcaaa    241740
     aagtagaaga ttatcttgct agcatagaca caattgcaac ctttgctcga gcaggcagtt    241800
     tacgtagatt acgagaaaca gtcaaagatt tggattacgt tattgctact gaaaaaccag    241860
     aagacgttca aaaagcatta ctagaatttc ctctgattac agatgttatt ggggcagggg    241920
     aaaccaaagt atcagctgtt ctagaagata acattacaat ttcagtagat tttcgcttag    241980
     tagaaaagaa agcttttgca acaactttgc accattttac tggttccaaa gatcataata    242040
     tcaaaatgcg ccaattagct aaacaatcga acgaaaaaat cagtgaatat ggtgtggagc    242100
     aagaagatgg aagtatgcgt cactttgaat cagaagaaac gttctttaaa cactttcata    242160
     ttccattttt acctccagaa gtacggcgcg acggtacaga aattgaacgg gtgacaaaag    242220
     atacgaaatt cctcgagtta agtgatattc gcggtgattt acacatgcat acaacttggt    242280
     cggatggagc ttacgcgatt cctgagatga ttgaagcttg tatcgctaaa ggttatgagt    242340
     acatggtaat taccgatcac ggaaaatttt tacgagtagc caatggtctg gatgagaaga    242400
     gattacttga gcaacaggca gaaattaaaa aagtagctgc taattatcca gaaattgacg    242460
     tttattctgg cgttgaaatg gatattttag cagatggctc tctggacttt gatgatgaca    242520
     ctttaaaaca gttagatttc gttatcgcat cgattcattc cagtttccaa caatcagaag    242580
     aagagattat gaaacgacta aaaacagcct gtgaaaatcc atatgtgcgt ctgattgctc    242640
     atccaacagg tagaattgtc gtgaaaagaa aaccatatca tgttaatatg aaagaactaa    242700
     tcaaactagc aaaaaataca ggtactgcgc tagaattaaa tgctaatcca cagcgccttg    242760
     atttaaatcg ggagcattta gaaatggccc atgcagcagg cgtgcctatc gcaattaata    242820
     cggatgcgca cgatacgaaa catcttgatt ttatgtcgat cggagtccgt gctgcaacga    242880
     aagcttggct agataaatct gcaatcttga atacaaaatc agccgcagaa ttcaaacaat    242940
     ttttacagaa taaataactt ttaaaaagaa ggatgactaa tggaaaaaaa agtagaagcc    243000
     attttagaat ttgataaaat aaaaaaacaa cttgctgaat ttgcttcttc ctcactaggg    243060
     gagcaagcga tttatgaact tgctccagct acagattttc aagtcgtaca aaaagcgcaa    243120
     cttgaaacag aagaaggagc caaaattatt cgtttgcggg gaagcgcgcc aattactggt    243180
     ctaacagatg tttttgcaca tttgaaacgt ctagagattg gtggcgattt aaacgggcta    243240
     gaaatctacc aaattggtag taacttgcgt gtaagccgcc aaatgaaaaa ctttatgaac    243300
     gatttactag aaattggggt cgaaatacca ttactcggcg cactttctga tgaactttta    243360
     gtattaaaag atgtagaaga agatattgcc atttcaatag atgaaagcgg gaaaatatta    243420
     gatacagcaa gtgaagcgct tagctcgatt cgtcgtactt tgcgacggac agaagaccgc    243480
     gtgcgtgaaa agctagaatc ttatttacgt gatcgcaacg cttcaaaaat gctaagtgat    243540
     gcggttatta cgattcgaaa tgatcgctat gttatccccg tgaaacaaga atataaagga    243600
     cattacggcg gcatcgttca tgaccagtct gcatccggtc aaacgctctt cattgagcca    243660
     caaagcgtgg ttgatttaaa taacgaacgc aaagcccttc aagcgaaaga aaaacaagaa    243720
     atcgaacgaa tcctagctga aatttctgct tcattagctg gctggattaa tgagattcat    243780
     cataatacct ttattctggg tcgttttgat ttcattctcg caaaagctcg atttgggaaa    243840
     gctctgaaag ccgtaacgcc acatttgagc gatactggaa tcgttcattt aatagcagcc    243900
     agacacccgc ttttagatgc agagaaagtt gttgctaacg atatttattt aggcgaagat    243960
     tttagtacga ttgttattac tggtccaaat acaggtggta aaacaattac attaaaaaca    244020
     ttaggcttac taaccttgat ggcgcaatca ggcttacaaa tcccagcgca agaagattcg    244080
     actatcgctg tttttgaaaa cgtatttgct gatattggcg atgaacaatc cattgaacaa    244140
     agcttaagta ctttctcatc ccatatgaca aacattgttt ccattttaga aaaagtaaat    244200
     cataaatcac ttattttata tgatgagctc ggggctggga cggatccgca agaaggagca    244260
     gcactagcca ttgccattct tgatgcaagt cacaaaaaag gtgcaagtgt tgttgcaacg    244320
     acacactatc ctgaattaaa agcttatgga tataaccgag cacatgcaac caatgcttcc    244380
     gttgaattta atgttgaaac acttagtcca acgtacaaac tactcattgg cgtacccgga    244440
     cgaagcaatg catttgatat ttcacgccgc cttggtttaa gtgaaagtat catcacagaa    244500
     gcaagaagcc tcgttgatac tgaaagtgca gacttaaatg acatgatttc aagtctagaa    244560
     gaaaaacgaa atctagcaga aagagaatat gaagaagcgc gcgaactagc tcgtggtgcc    244620
     gatgctcttt taaaagattt acaaaaagaa atcacgaatt actatcaaca aaaagataaa    244680
     ttactcgaac aagcaaacga aaaagctgct ggaatcgtag aaaaagccga aacagaagcc    244740
     gaagaaatta tccacgaact gcgcacaatg caattaaacg gggcagcggg aatcaaagaa    244800
     catgaactaa tcgatgctaa aacaagactt ggaaaagcta agccaaaaac aattaacaaa    244860
     gctattccaa aagcaccaaa acaaaaacca cacgttttcc aagcaggtga caatgttcgc    244920
     gtcctatctc ttggccaaaa aggtacactt ttaaacaaaa ttagtgataa agaatggaac    244980
     gtccaaatcg gcatcatcaa aatgaaaatc aaaacgaccg atttagaata tatcgagcca    245040
     gaaaaaccga aaaaacaacg cattatcaca tctgttcata gtagtgactc accagcaaaa    245100
     agcgagcttg atctacgcgg cgaacgctac gaagacgcta ttcaaaaagt ggataaatac    245160
     ctcgatgaag cattgctcgc aggatacccg caagtagcaa ttattcatgg taaaggtact    245220
     ggcgcgctta gaacaggcgt cacggaatat ttgaagaatc atcgtatggt taaatccatc    245280
     cgtttcggag ccgcagcaga aggcgggaac ggcgtaacaa tcgttgagtt caagtaaaca    245340
     actgagcaaa aacatggctc caaataggtc taggtgctat actgtgtgta caaaagtcat    245400
     aaggagtgaa ttaaatcatg gtaaaagaaa ttacagatgc aacatttgaa caagaaacta    245460
     gcgaaggctt agtattaaca gatttctggg caacatggtg tggtccttgc cgcatggtgg    245520
     ctccagtttt agaagaaata caagaagaac gaggcgaagc acttaaaatc gtcaaaatgg    245580
     acgtagatga aaacccagaa acacctggaa gctttggtgt tatgagtatt ccaacacttc    245640
     ttattaaaaa agacggcgaa gtagtagaaa caattatcgg ctaccgtcca aaagaagaac    245700
     tggatgaagt catcaacaaa tacgtttaaa attatgctaa aatgaaagaa gcttagaaca    245760
     aacattctag gcttcttttt aaatgtgtaa ctggagttga taaaatgtct tctgaacata    245820
     tccaaaataa attagcgctt ctgccggacc aacctggttg ttatttgatg aaagatagac    245880
     aaggaacaat tatttatgtt gggaaagcaa aagtgttgaa aaatcgcgtg cgttcgtatt    245940
     tttcaggtac gcacgatagt aaaacgcaac gtctagtcca agaaattgtg gactttgaat    246000
     atatcgtaac ttcatccaac gtagaagcat tgctacttga aattaatttg ataaaaaaac    246060
     atgacccacg cttcaatatt cgcttaaaag acgataaaac ttatccgttc attaaaatta    246120
     caaacgaacg acatccgcga ctaattatta cccgccaagt aaagaaagat aaagggaaat    246180
     atttcggtcc gtatccaaat gtctacgctg caaatgaagt gaaacgcatt ctagaccgac    246240
     tgtatccact tcgaaaatgt agtacattac caaataaagt gtgtttgtac tatcatctcg    246300
     gacaatgcct tgccccgtgt gtatttgacg tggaagcaag taagtataaa gaaatgcaag    246360
     acgaaattgt ggcattctta aacggtggct ataaaaccgt taaaaatgat ttaatgaaaa    246420
     aaatgcaaga agccgcagaa aatatggaat tcgaaaaagc tggtgaattc cgcgaccaaa    246480
     tcaacgccat cgaaacaaca atggaaaaac aaaaaatgac gatgaacgat ttcgttgacc    246540
     gcgatgtctt cggttacgcc attgataaag gctggatgtg cgtccaagta ttcttcattc    246600
     gccaaggaaa actcattgag cgcgatgttt cccagtttcc attttacaac gatgctgatg    246660
     aagacttcct cacatttatc ggccagtttt atcaaaaagc aaaccatatc ccacctaaag    246720
     aaatttattt gccagatgat gttgatagcg aagccgttca agccgtcgtt cccgacacaa    246780
     aaatcatcgt accacagcgc ggaaataaaa aagaactcgt gaaacttgct tacaaaaatg    246840
     ccaaaatcgc tctaaacgag aaatttatgc tacttgaacg caacgaagaa cggacagtcg    246900
     gggcagttga acgacttggt gaagcgatgg ggattccaac accatcacgc gtcgaagcat    246960
     ttgataactc gaatattcac ggtacagatc ccgtttctgc aatggtcaca ttcctagacg    247020
     gaaaaccaag taaaaacgat taccgcaaat acaaaatcaa aaccgtggaa ggaccggatg    247080
     attacgcaac gatgcgagaa gttatccgcc gtcgttactg gcgcgtactt aaagaaggcc    247140
     taccaatgcc agatctaata ttaattgatg gtgggaaagg acaaattgat agcgccaaag    247200
     acgtcctaac aaacgaactc ggcttagata ttccagtagc cggactcgca aaagacgata    247260
     agcatcgtac tagccaacta ttattcggtg atcctttaga aatagttcca ctcgaaagaa    247320
     acagccaaga attctattta ctgcaacgaa tgcaagatga agtccaccgt ttcgctatca    247380
     cattccaccg ccaactacgc agcaaaacag ggttccagag cattcttgac ggcattcctg    247440
     gcgtaggacc tggccgcaag aaaaaactac tgaaacattt tggctccatg aagaaattaa    247500
     aagaagcatc agttgaagaa attaaagaag ctggcgttcc acttaatgtg gcagaagaag    247560
     tgcataaaca tataaccgct tttaacgaaa aagccaaaaa taccgaacaa aaatagattt    247620
     taaatatagc taacatacca atgatttttt agttattggc atgttagctt ttttatttca    247680
     gcatctatga ttttcgctag aagtaaaaac aaaagaaact cacccttccc ttcaacacat    247740
     aaatgcgcta aaataaaacc attgataaaa aagcaccaaa aagtcaggag gagcgagatt    247800
     gggactagta gtattaaaat ttggcggaac ctctgttagc accgtagata aaatcggaaa    247860
     aacagcagat caagccattt acgagaaaaa acaagggaat aaagtcattg tcgtcgtttc    247920
     cgcgatgggt aaatcaaccg acaaattagt agcgatggca gaagaaatca gtgaagctcc    247980
     agacaagcga gaaatggata tgttactttc aaccggcgaa caaatcacga ttgctttact    248040
     tgcgatgact ttaaaagaaa aaggacatga tgctatttct tatacaggat ggcaagcagg    248100
     aattgaaaca gaagcagtac atagtaacgc aagaattgct gatattgata gcgcgcgcat    248160
     tgagtcagca cttgaagctg ggcaaattgt tattgttgca gggttccaag gtataactac    248220
     agacggcgaa attactacac tcggcagggg tggctctgat acgaccgcag tagcaatcgc    248280
     atccgcttta aaagcagaaa aatgtgctat ttgtacagat gttgtcggcg tattcacaac    248340
     agatccccgt tacgtaaaaa aagcccaaaa actagaacaa ctaacctatg atgaaatgct    248400
     agaattagcc aatctcggtg ctggagtttt acatccacgc tccgttgaat atgcgaaaaa    248460
     tttccgaatt ccgcttgaag taagagcgag tcatgaacta gaaccaggta caatgattga    248520
     ggaggattta acaatggaaa ataccaaagt agtccgcgga attgcttttg aagatcaaat    248580
     tactcgtgta accattcact ggaaacaaaa agaagcgatg cgcgtttcaa aagtttttac    248640
     taaactagca gaaaataaca ttgatgtaga tattatcatt caaggtatca caggtcttgg    248700
     tcacggcaac ttatccttca ccattaaaac aagcgaacta ttagctactc tagctgtttt    248760
     agaagaaagt aaagaactac ttcaaatcga aaaactagaa tccgagcagg aactagcgaa    248820
     agtatccatt gttggttctg gcatggtaag taaccctgga gtcgctgcaa aaatgtttga    248880
     agctttaact gaaaataata tcccaataaa aatgataagc acttcagaaa tcaaagtttc    248940
     gacggttgtt cctgcccgta aaatggtaga agcagcacaa gttttacatg accaatttga    249000
     attagataaa taaaaataag cttgaattaa cgagctacat cccagttaag aggggtgtag    249060
     gcaagttatt tcaagcttat ctttttagta acgttcttcg ttatcaatcg tttctttacg    249120
     atcccattta acgataatcg tcacttgttt tttacgttta tctatttcat cgtaactttc    249180
     tgtatagagc ttcttctgtg tttgtaattg ctctgcgata aaaccagctt ccaatttaaa    249240
     agttggattt tcttgtgtac ggaaccgcga aacaaccatg tcaccttcta aaagtaaacg    249300
     caactcatct ttcttttcct ttaaaatact aagtgtccca aaagaggctt cttcaaagaa    249360
     ttctcttatc tcttccatgg attcaagtgg gaatttacgc gctaagtctt tcccagccca    249420
     gtacataatg tgaggcgctt catctccaag gatttcagga attaaataat ctcgcagtac    249480
     atctaatcca aaacttggaa cgagtgcttt ttcctcgtaa ttattctgtt cattttctgt    249540
     catttcggat acctcacttt catacaccat tataaccaaa atcaccctaa aatggaaagc    249600
     acaataaata aatttctata aaaaaccttt tttctcaaaa aagacttgcg aaaaaagcga    249660
     aaaaataaga aaatggaagg tatagataaa aaaatttgga aattaataaa gaaattgagg    249720
     cgagactgtg aaacaagcta taggctttat cgattcggga gtaggcggtt tgacagtagt    249780
     gcgtgaagta ctaaagcagc taccccatga acaagtatat tatttaggtg ataccgcacg    249840
     ttgcccttat ggaccacgcg acaaagaaga agtagctcag tttacttggg aaatgaccaa    249900
     ttttctcgta gatcgtggca tcaaaatgct cgttattgca tgtaatactg caacagcggc    249960
     agcactatat gacattcgtg aaaaactgga tattcctgtt attggagtta ttcaacctgg    250020
     ctcaagagca gctcttaaag caacaagaaa caacaaaatt ggcgtattag gaacgctcgg    250080
     tacagtcgaa agcatggctt acccaacagc gcttaaagga ctaaaccgcc gagtagaagt    250140
     agattcactc gcatgtccga aatttgtatc cgtagtagaa tctggcgaat ataaaagcgc    250200
     cattgcaaaa aaagtcgtag ccgagtcact cttaccactg aaaagtacca agattgatac    250260
     ggtgattttg ggttgcacac attacccact tttaaaacca attatcgaaa actttatggg    250320
     agatggcgtt gcggtcatta actccggcga agaaactgct agcgaagtca gtgctttact    250380
     ggattaccat aatttattag atgcgacaga cgacgaaatt gaacatcgtt ttttcaccac    250440
     tggttccaca caaattttca aagatattgc aaaagactgg ttaaatatgc cagatatgac    250500
     agtagaacat ataaaattag gaaaataaga ggtgccacta atgagatttg atggaagaga    250560
     aaagaatgca ttacgagaaa tcgaagtaac acctgattac ttaatgcacc cagaaggttc    250620
     tgttttaatc gcatcaggaa atacaaaagt tatctgttct gcaagtgtag aaacaaaagt    250680
     accaccattt atgcgcgggg aaggtcgtgg ctggatttct gctgaatatt ccatgttacc    250740
     acgggcaacg aatacacgta atatccgcga atcttctaaa ggaaaagtaa ctggaagaac    250800
     aatggaaatt caacgtttaa ttggacgggc tttacgtgcc gtggttgact tagacgcact    250860
     tggtgaacga acaatttggt tagactgtga tgttatccaa gcagacggag gaacacgcac    250920
     agcctctatt actggtgcat ttattgcaat ggtcatggcg attgcaaaac tagatgaaga    250980
     agttccgttc acgaaattcc cagtcaaaga ttttcttgca gctacaagtg ttggcgtttt    251040
     agaagaaggt ggaacagtac ttgaccttaa ctacgtagaa gatagcgcgg cacaagtcga    251100
     tatgaatatc attatgactg gtagcggagc ctttgtagaa ctccaaggaa caggcgaaga    251160
     agctactttt tcagaaaccg aacttgctga actaatcgct ctaggtaaaa aaggaataag    251220
     cgaactaatc gaaatccaaa aagaaacact cggcgacaaa atcacagcgc ggattaaagg    251280
     agaataaaaa atgagtaaaa ttattattgc caccgcaaat aaaggaaaag caaaagaatt    251340
     cgaaaaaatc tttgcgaagt ttaatatcga agttgctacc cttgctgatt ttccagaaat    251400
     tggtgaaatt gaagaaacag gcacgacctt tgctgaaaat gctgctctta aagcagaaac    251460
     ggtcgctagc ttgctaaatc aaacagttat tgctgatgat tcaggtttaa ttgtagacgt    251520
     gcttaacggg gctcctggtg tctattctgc acgctatgct ggggtcgctc atgatgatgc    251580
     aaaaaataat gaaaaactac ttaaaaattt agaaggcgta gaaccagcaa aaagaactgc    251640
     tcgtttccac tgtacacttg ctgtggctac accctctgag aaaacaagtt tttatacagg    251700
     agaggtagaa ggagttatcg cagaacaact atgcggtaca aacggcttcg gttatgatcc    251760
     actatttttc ttaccagaat tcggtcttac aatggcagaa attccagcag agaaaaagaa    251820
     tgaaatcagc caccgagcta atgctattaa acagctagaa aaagatttag cagaagttgt    251880
     agaaaaagtt actaaaaagt gagagaataa gtaacagagc actaggggga ggaaataaaa    251940
     tgaaattatt agtagttagc gacagccact cagaacgtga ctgcttaatc catcttaaag    252000
     aaaaatacga aaatacagtc gatgccatga ttcattgtgg ggattctgaa ttagaagctg    252060
     atgatccagc gattcaagga tttcatactg ttcgaggcaa ctgtgatttt ggcggaggct    252120
     ttccaaatga ttgggtaggg gaagtggatg gctatcgtat cttaaccaca cacggacatc    252180
     tttataacat caaaatgaca cttatgaact tacgctaccg agctcgtgaa ttaaacgctg    252240
     atttcgcatt ttttggtcat tctcatgaac taggcgttga tatgctagat gacaccatca    252300
     ttttaaaccc aggaagcatt tccttaccaa gaggtcgcat tcgcattaaa acatacgcac    252360
     tcatcgactc tacaccagaa ggaatcaaag ttcgcttcat ggatcgtgac gataacgaac    252420
     taactgacct aacacaagtt tttcctttaa caaagcacaa ctaggtcaaa agacacccaa    252480
     aaaagaaaaa atgcaataac ttaaagaaaa ccattgacaa acaagcaatt taaacataaa    252540
     atggtatttg gctgttgaaa aaacagtgcc atttgtcctg atagctcagc tggatagagc    252600
     aacggccttc taagccgtcg gtcgggggtt cgaatccctc tcaggacgtt aaataaagca    252660
     ccataaacgt tggtaataca atgtttatgg tgctttttga tttgcggaag ttcaaataat    252720
     ggtgttcaag cagttgtatc tattaagagg ggaagacaac attgaatgcc tcttagaaat    252780
     aataaatgct actctaatat gtcttttagt aaataatata ggtgaagact gataaaaatc    252840
     atatgaaatt cttgtttgat tttataagtt aattagttaa ataaaaaagg ggatttcatt    252900
     taaaaaaaca acatatattt taaatgaata tgtatttttc gagatattcg agaagagtaa    252960
     agcataaatc gtgtataatg aactatatta cgtgttatct tgtgattaat tacacaatat    253020
     tgcacctatc gtttaagaaa aagtttaagt                                     253050
//

If you have problems or comments...

PBIL Back to PBIL home page