(data stored in ACNUC24361 zone)

EMBL: AL833416

ID   AL833416; SV 1; linear; mRNA; STD; HUM; 2381 BP.
XX
AC   AL833416;
XX
DT   10-JUL-2002 (Rel. 72, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Homo sapiens mRNA; cDNA DKFZp313M0722 (from clone DKFZp313M0722)
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2381
RA   Bahr A., Lauber J., Mewes H.W., Weil B., Amid C., Osanger A., Fobo G.,
RA   Han M., Wiemann S.;
RT   ;
RL   Submitted (13-MAY-2003) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; 048f7c2d2638a955fe620a06d8bad459.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
CC   Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by Qiagen (Hilden/Germany) within the cDNA sequencing
CC   consortium of the German Genome Project.
CC   This clone (DKFZp313M0722) is available at the RZPD in Berlin.
CC   Please contact the RZPD: Ressourcenzentrum, Heubnerweg 6,
CC   14059 Berlin-Charlottenburg, GERMANY; Email: clone@rzpd.de
CC   Further information about the clone and the sequencing project
CC   is available at http://mips.gsf.de/proj/cDNA/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2381
FT                   /organism="Homo sapiens"
FT                   /map="6p22.1-22.3"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="313 (synonym: hlcc2). Vector pTriplEx2; host
FT                   DH10B; sites SfiIA + SfiIB"
FT                   /clone="DKFZp313M0722"
FT                   /tissue_type="human adipose"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        162..905
FT                   /codon_start=1
FT                   /gene="DKFZp313M0722"
FT                   /product="hypothetical protein"
FT                   /note="Homo sapiens cDNA FLJ33140 fis and FLJ23407 fis"
FT                   /db_xref="GOA:Q8N3P9"
FT                   /db_xref="H-InvDB:HIT000028328.18"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q8N3P9"
FT                   /protein_id="CAD38641.1"
FT                   /translation="MVTQLRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDS
FT                   RLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTG
FT                   EKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKP
FT                   YECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQC
FT                   SQCSKLFSKRTLLKKHQKIHTGERP"
FT   regulatory      2300..2305
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2323
XX
SQ   Sequence 2381 BP; 787 A; 441 C; 488 G; 665 T; 0 other;
     gtctgagata acgcccggag ttctttgtcc tgcctccaag acgataaagg agcgcagaca        60
     caaaggctcc agaccatgaa catggacatt ctgaagtgct cttggaggat gtggaacatc       120
     tgaaggtcaa gcaggaacca acagacatac agcttcagcc tatggtgaca cagctcagat       180
     atgaatcttt ttgcctccac caatttcaag aacaagatgg tgaaagtata cctgagaacc       240
     aggagttggc atcaaagcaa gaaatcttaa aagaaatgga acatttgggg gatagcagac       300
     tccaaagaga tgtatctttg gattctaagt acagagaaac ttgtaaacga gacagcaagg       360
     cagaaaagca gcaggcacat tccactggag agagacgcca caggtgcaat gaatgtggga       420
     aaagcttcac taagagttca gtactcattg agcaccagag aatccacact ggggagaagc       480
     catatgaatg tgaagaatgt gggaaggcct tcagccggag gtcaagcctg aatgaacatc       540
     ggcggagcca cactggagag aaaccctatc aatgtaagga gtgtgggaaa gccttcagtg       600
     ccagcaatgg cctcactcga cacagaagaa tccacacagg ggaaaaacca tatgaatgca       660
     aagtgtgtgg gaaggctttc ctcctcagct catgccttgt tcagcatcag aggatacaca       720
     ctggagagaa gcgctatcag tgtcgtgagt gtggcaaagc cttcattcag aatgcagggc       780
     ttttccagca tctccgagtc cacactggtg agaaacccta tcagtgcagt cagtgcagta       840
     aactctttag taagcggaca cttcttaaga aacatcagaa aatccacact ggagagagac       900
     cataagggtg atgagtttgg gaaagccttc agtcatcatt gcaaccttat taggcatttt       960
     agaatccata ctgttccagc agaactggac taattctgtg gaccctcaga cccctaaatg      1020
     gggccgtctt ggaaagtaag attttcaagt ggcttattct gttcttataa aatttatttt      1080
     gtattgcatt gaaccacttg tctacaaacc aggtgttggt gtctcctgtg tggatgactg      1140
     tgattgtagg gggttgctgg gtggccttct tattccctag cctttggtcc atttcttatg      1200
     atttccttta aaggcaccaa atcttatctg gaaataaatt gttatggagg ggctgttttt      1260
     gagcaatact gcatattgaa caattctaaa agaccagtat ctatgtatac ttttaaaaaa      1320
     aagatttgct aagatcaaag gatattcaga ggtgcatctt tttctgtaag agtgacattt      1380
     taaacaaatg taaggttttg gggaataaga atcgtccaca ttcccacagg aaatcattgc      1440
     tatggtctcc cctaggaatg tgatagatag cttctataat tatgcagcat tatccatagt      1500
     atgaaacctg tagttttaat ggtttagaaa tctatgtctc atttcatatc taactcatgt      1560
     ttttgatacg aatcaatata tatgttgata tcatgagtta atatgagttt gacatgaatc      1620
     atcaacatag tatatacata tcaacataac tatgttgatg attcatatca aattctcaat      1680
     gcaggtcatt actgtaagtt ttccattttt gttacaaata ataagtaaga tgatacttta      1740
     aaatctctgt tcttcacaag gtacctcttt aattcatagc cttttatgtc agcattattc      1800
     ttcttttggg ggttggtcag caactttgag tgccattgca agcagcatca tttaagtagt      1860
     tttataaaga aaagaagtct gatatcttgg gcagcttgct gcttactggg gagaccagca      1920
     tgcttagaca cttattgcca gggttaaaca tatgctctgg caccaagttc aaatctttcc      1980
     tccccatttg tgagctgtgg gactttaggc aagttatcta aatgctgcta tgctatagtc      2040
     tccccacctg taaaacagag gatgatacca ataccttcct catagggtac ataagattaa      2100
     ataaatacaa acttgtactt aaaatgtagc tctcaataaa tgtgcattat gatttacata      2160
     cgaaataata gcatttaaca aatgtaggta gaattttaag tatcatgtta aaattaggat      2220
     acgaaatgcc tctgctgaca ttcttgttac tcttttctcc acagtcaaaa cctgaatcag      2280
     aatatttcaa aagagaggaa ataaaagttc agcttaaaac tggaaaaaaa aaaaaaaaaa      2340
     aaaaaaaaaa aaaaaaaaaa aatttaaaaa aaaaaaaaaa a                          2381
//

If you have problems or comments...

PBIL Back to PBIL home page