(data stored in ACNUC1104 zone)

EMBL: AL939105

ID   AL939105; SV 1; linear; genomic DNA; STD; PRO; 291000 BP.
XX
AC   AL939105; AL109974; AL117385; AL117387; AL117669; AL121596; AL121600;
AC   AL121719; AL121849; AL121855; AL132662; AL132707;
XX
DT   25-OCT-2002 (Rel. 73, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Streptomyces coelicolor A3(2) complete genome; segment 2/29
XX
KW   .
XX
OS   Streptomyces coelicolor
OC   Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
OC   Streptomyces; Streptomyces albidoflavus group.
XX
RN   [1]
RP   1-291000
RA   Bentley S.D.;
RT   ;
RL   Submitted (09-MAY-2002) to the INSDC.
RL   Submitted on behalf of the Streptomyces sequencing team, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail:
RL   sdb@sanger.ac.uk
XX
RN   [2]
RX   DOI; 10.1038/417141a.
RX   PUBMED; 12000953.
RA   Bentley S.D., Chater K.F., Cerdeno-Tarraga A.M., Challis G.L.,
RA   Thomson N.R., James K.D., Harris D.E., Quail M.A., Kieser H., Harper D.,
RA   Bateman A., Brown S., Chandra G., Chen C.W., Collins M., Cronin A.,
RA   Fraser A., Goble A., Hidalgo J., Hornsby T., Howarth S., Huang C.H.,
RA   Kieser T., Larke L., Murphy L., Oliver K., O'Neil S., Rabbinowitsch E.,
RA   Rajandream M.A., Rutherford K., Rutter S., Seeger K., Saunders D.,
RA   Sharp S., Squares R., Squares S., Taylor K., Warren T., Wietzorrek A.,
RA   Woodward J., Barrell B.G., Parkhill J., Hopwood D.A.;
RT   "Complete genome sequence of the model actinomycete Streptomyces coelicolor
RT   A3(2)";
RL   Nature 417(6885):141-147(2002).
XX
DR   MD5; 3fa89097a776eb3e44e342f4df894798.
DR   ENA-CON; AL645882.
DR   BioSample; SAMEA1705940.
DR   EuropePMC; PMC1070375; 15805504.
DR   StrainInfo; 166217; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..291000
FT                   /organism="Streptomyces coelicolor"
FT                   /strain="A3(2)"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1902"
FT   CDS_pept        213..3092
FT                   /transl_table=11
FT                   /gene="SCO0305"
FT                   /gene_synonym="SC5G9.14"
FT                   /product="conserved hypothetical protein"
FT                   /note="SC5G9.14, hypothetical protein, len: 959 aa; unknown
FT                   function, similar to TR:O54182 (EMBL:AL021411) Streptomyces
FT                   coelicolor hypothetical protein (913 aa), fasta scores;
FT                   opt: 698 z-score: 776.6 E(): 0, 27.0% identity in 972 aa
FT                   overlap. The C-terminus shows very weak similarity to
FT                   eukaryotic beta-transducins e.g. SW:GBB4_MOUSE
FT                   (EMBL:S86124), gnb4, Mus musculus guanine
FT                   nucleotide-binding protein beta subunit 4 (340 aa) (23.0%
FT                   identity in 291 aa overlap). Contains possible hydrophobic
FT                   membrane spanning region"
FT                   /db_xref="GOA:Q9RL12"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL12"
FT                   /protein_id="CAB55662.1"
FT                   /translation="MSDAVEEAEARAVEPVGAKQRDAFISYSQSKNAPLAKQLQRGLER
FT                   LAVSRFRPMRMSVFRDVTSLPANHDLWQSIQRELARSRYFILLASPEAAASPWVAREVD
FT                   YWLRERDTEHLLIAVASGEIVWDDRAGDFDWRKTTSLPRNLAGHFTAAPLWVDLREIGE
FT                   RSHHSMRYPPFRAAVATLASPLHGRPKEELEHDDFRQLRFVKRLSWSGVALLVALLVLA
FT                   VYGFFDASRQREAALSQARTSASQALAARSGQLLGTSPNQAAQYALYAEETRSTPESRR
FT                   ALAQAVTAAPYARRRLRADADSVTDMQGASRPAATDVVLSGDGTTAAYRSVFDDDRAVR
FT                   LYDVPSARQSRVVRAEGTPRALSRDGRVLAMEVYLNRVQLWDTRSGRLLSTMATGHTEN
FT                   LPHVGHGLHALALSPDGRWVAASHYTPEGEAFAVVWRASDGREITRVPVSDARVGLGFS
FT                   ADGSRLTLVDQDRREVREFRTDSARWEAARSLPGMPGSTAEALRYSEVLLFDGARKALT
FT                   RTSERAEVWDLEQRRRIAVRSLGPYEDMTVADDKGIFLLGGQDGTVRLYDAALRPGTTL
FT                   GRLTRPASTIAMSADGTQVVVASYGGELNLFTTGVRRGQQVAFDEKDFTFGDLTPDGRM
FT                   AVHRSEGRTEFWDPATGRRLGVIPYANLSVNLEDTAYTLSGDKRYVGMQSVEGFEDEGR
FT                   FDVWDLRTGRRTDCGTAVGGSSFSPIRRPGLSFLPGDRYVVGEWNGAVELLDTRTCTRS
FT                   TVTEDSGRFALSGDRRTLVLLNDDGVDTWRWDGDHAFARAARTTLPSEAHPVDMSVDHE
FT                   GRQAAFSDRESHVYVVRLDSGERVRATGYLPDKTDAVAFSRDGRLLFQGFMTESTRGVR
FT                   VLDAGSGDQLDIWTTDPPTGSVQPNEGMQVVPGPADDILTLGPDHKVVRRTVGVGAWHD
FT                   LLCGLVSQPLPARERDRYLKDLDVEDPCR"
FT   CDS_pept        complement(3056..3961)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="SCO0306"
FT                   /gene_synonym="SC5G9.15c"
FT                   /product="putative pseudogene"
FT                   /note="SC5G9.15c, possible pseudogene, len: 302 aa; similar
FT                   to hypothetical proteins e.g. SW:YCJY_ECOLI
FT                   (EMBL:AE000230), YcjY, Escherichia coli hypothetical
FT                   protein (310 aa). GC frameplot and codon usage plots
FT                   indicate a coding region which lacks a start codon"
FT   CDS_pept        4084..4971
FT                   /transl_table=11
FT                   /gene="SCO0307"
FT                   /gene_synonym="SC5G9.16"
FT                   /product="putative DNA-binding protein"
FT                   /note="SC5G9.16, possible DNA-binding protein, len: 295 aa;
FT                   probable CDS suggested by GC frameplot and positional base
FT                   preference. Similar to possible DNA-binding proteins from
FT                   S. coelicolor e.g. SCJ9A.15c (cosmid SCJ9A), S. coelicolor
FT                   possible DNA-binding protein (290 aa) (39.3% identity in
FT                   298 aa overlap). Contains probable helix-turn-helix motif
FT                   at residues 35-56 (Score 1197, +3.26 SD)"
FT                   /db_xref="GOA:Q9RL11"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL11"
FT                   /protein_id="CAB55664.1"
FT                   /translation="MSSELGDFLKARRRELSPPTAGLPADGRRRVPGLRREEVAVLASI
FT                   SPGHYTRLEQGRRRASEPVLDALARALRLSADERAYLFELSGKDAGRPLGRPGRQVRPQ
FT                   LRRLLDDLTHTPALVLGRCTDILAWNPPAAALFTDFALLSRDERNFVRLVFRDPAVRAL
FT                   YTDWPYMARACVAQLRMEAARDPHDPRLSALVAELSAQDPDFRTWWKDHRVAVRGAGTK
FT                   DLRHPVIGELTLDWSALTDTADPDQQLIALTAAPGTPSHDGLRALRDLGAVTSGRTGPG
FT                   VPGGGGEIAGASAQ"
FT   CDS_pept        5026..6429
FT                   /transl_table=11
FT                   /gene="SCO0308"
FT                   /gene_synonym="SC5G9.17"
FT                   /product="putative membrane protein"
FT                   /note="SC5G9.17, possible membrane protein, len: 467 aa;
FT                   unknown function, probable CDS suggested by GC frameplot,
FT                   positional base preference and amino acid composition.
FT                   Contains hydrophobic, possible membrane-spanning regions
FT                   near the C-terminus. Contains TTA (leucine) codon; possible
FT                   target for bldA regulation"
FT                   /db_xref="GOA:Q9RL10"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL10"
FT                   /protein_id="CAB55665.1"
FT                   /translation="MPRSDAAVRVRTRLLLMYHLTPQVHVPDDRLRPLSEALGLGRFTA
FT                   HVEAAGLLLPRLVLHERVREITLPPNAARVDGADITLAVTPRQDPLLFVDVEVPDEAGD
FT                   SDTIAETLYATWQDRSAIRVGGVPLTAWLDERLRAYGLTDRTADRPPLAFGRNVHQSVF
FT                   PGAALAGRLLAAHVPGDAVGQDVVTIVLRGTLDSGTGATLGIRRPETLNNAGQTMVAHG
FT                   RGVSLIVGYAPPVENAFGLAAAGILTAVAAVHRIRRQAFAALELDRAAAVETTDAARAL
FT                   VAQLSHRLNDLQLDLSFSVEVYADTILVPELLVESFHASLRDVSSLADALANTSRIVER
FT                   VNAVLATRRVGLETAAQQYAEDRDRVLAAVIAAGSLLALPPALLLAYFGVNSSDVDPSR
FT                   SILDFQHYGVAYAIAWSPFLLLILVGLLARRRISLRLPAPDAATSERRTRRFRRSLRSW
FT                   LGRSRRPGR"
FT   misc_feature    5434..5436
FT                   /note="TTA (leucine) codon; possible target for bldA
FT                   regulation"
FT   CDS_pept        complement(6537..7625)
FT                   /transl_table=11
FT                   /gene="SCO0309"
FT                   /gene_synonym="SC5G9.18c"
FT                   /product="putative amide hydrolase"
FT                   /note="SC5G9.18c, probable amide hydrolase, len: 362 aa;
FT                   similar to 6-aminohexanoate-dimer hydrolases which degrade
FT                   N-(6-aminohexanoyl)-6-aminohexanoate e.g. TR:P75007
FT                   (EMBL:K02336), NylB', Flavobacterium sp. (strain K172)
FT                   6-aminohexanoic acid linear oligomer hydrolase (EII') (392
FT                   aa), fasta scores; opt: 531 z-score: 598.0 E(): 6.1e-26,
FT                   34.1% identity in 323 aa overlap"
FT                   /db_xref="GOA:Q9RL09"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL09"
FT                   /protein_id="CAB55666.1"
FT                   /translation="MPSRRVWRGRGGPGDLPASPPGALDGLGVTGSYGRTLTLDQLLAE
FT                   AETDALLVLHRGRLVHEEYRHGYEAHVPHFNASAAKSYLGLLAATLAHEGHLDRGARVA
FT                   RYVPELSGTAFGDAQVDHLMHMGTRMSYAGRPYDKALEAQRYFAVLAPRLRPYGYSGPA
FT                   TIREHLATARATGEPGTEFRYENGNVEALAEVLRRITGLSTSALMSEMIWSRIGAEEDA
FT                   YYLVDADGAEAACGGFSATARDVARLGELVRCGGAVGDRQVLPEAVTAPARSVPDGCPR
FT                   RVRFPAAPADSPATLSYHDLWWILNDPYGSFMASGIHGQRLFVSPALDLVVVHYASQVV
FT                   SPAVPQVPLVQAFLSIGAHLNA"
FT   CDS_pept        complement(7816..8466)
FT                   /transl_table=11
FT                   /gene="SCO0310"
FT                   /gene_synonym="SC5G9.19c"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SC5G9.19c, possible tetR-family transcriptional
FT                   regulator, len: 141 aa; shows similarity to the N-terminal
FT                   half of TR:O24741 (EMBL:AB001683), FarA, Streptomyces sp.
FT                   strain FRI-5 receptor for an extracellular regulatory
FT                   factor (IM-2) (221 aa), fasta scores; opt: 154 z-score:
FT                   193.4 E(): 0.0021, 36.7% identity in 79 aa overlap and to
FT                   putative transcriptional regulators. Contains Pfam match to
FT                   entry PF00440 tetR, Bacterial regulatory proteins, tetR
FT                   family"
FT                   /db_xref="GOA:Q9RL08"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL08"
FT                   /protein_id="CAB55667.1"
FT                   /translation="MDMKPEDRRVRRTRAALRKALVELVLDKGFQAVTVEEITERADIG
FT                   RATFYAHYRDKEDLLVGIVRDLAQDRERLLPAVRQAHAQGFTGLPVKYIFEHAAQERGV
FT                   YQVILRGEGDGRALREFTELIRSHAEMAFRDRARQLGVEPRIPLGIVARAWTGELISVL
FT                   GWWVENDTGYTAEQITAHLRDLSVYGRVWATGLTPVDAPGAVDLPGGRGAEPV"
FT   misc_feature    complement(8278..8418)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 31.50, E-value
FT                   5.4e-07"
FT   CDS_pept        8575..10131
FT                   /transl_table=11
FT                   /gene="SCO0311"
FT                   /gene_synonym="SC5G9.20"
FT                   /product="putative ligase"
FT                   /note="SC5G9.20, probable ligase, len: 518 aa; similar to
FT                   domains within polyketide synthases e.g. to the N-terminus
FT                   of TR:Q54297 (EMBL:X86780), RapA, Streptomyces
FT                   hygroscopicus polyketide synthase (8563 aa), fasta scores;
FT                   opt: 815 z-score: 894.4 E(): 0, 34.0% identity in 509 aa
FT                   overlap and to SW:DHBE_BACSU (EMBL:U26444), DhbE, EntE,
FT                   Bacillus subtilis 2,3-dihydroxybenzoate-AMP ligase (539 aa)
FT                   (31.3% identity in 520 aa overlap). Also similar to others
FT                   from S. coelicolor e.g. TR:Q9Z5A6 (EMBL:AL035478) S.
FT                   coelicolor probable long-chain-fatty-acid-CoA ligase (541
FT                   aa) (35.9% identity in 537 aa overlap). Contains Pfam match
FT                   to entry PF00501 AMP-binding, AMP-binding enzyme and
FT                   PS00455 Putative AMP-binding domain signature"
FT                   /db_xref="GOA:Q9RL07"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL07"
FT                   /protein_id="CAB55668.1"
FT                   /translation="MNLGRYVRRTAEHHPDAEAVVCGHVRLTYAELDDHSDRLAAALTG
FT                   LGLSRGERVATLAANRAELVVTEVALYKAGLTRAPVNARLGDGEVAHLLRESDARVLLT
FT                   DAAHLDTARRAVPGSGVKAVIGYDGPADLGPGYQELLAATPREAVDVECAEDDIAVLHF
FT                   TSGSTGKLKAAVQTYGNRLALLRKSVMNQATRVGTGDRQILAGPVTHASGMPLMGIFFA
FT                   GGCAVVLPRWDAAEFLATVERERATHAFLVPTMVNTVLALENARDHDLSSLRHLLYGAA
FT                   PMSPARVRAAWDLFGPVLSQGYGCGETTSGVLFLSTEDHRRAVEGDDEELLLSCGRPLA
FT                   EAEVRIVDDGGEPVADGEIGEIAVRGPDVVPGYHNEPELTARSFRDGWFLTGDLARRRR
FT                   DGYVFIVDRKKDMIISGGFNIYAVEVESVLHQHPDVFEAAVVGVPDEQWGEAVKAVVVP
FT                   RAGVTLDATELIAFCAEHLARMKKPRSVDVVAALPHNPNGKIDRRAIRDTYWSGAERRV
FT                   H"
FT   misc_feature    8656..9894
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme, score 140.40, E-value 3.1e-38"
FT   misc_feature    9055..9090
FT                   /note="PS00455 Putative AMP-binding domain signature"
FT   CDS_pept        10147..11316
FT                   /transl_table=11
FT                   /gene="SCO0312"
FT                   /gene_synonym="SC5G9.21"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="SC5G9.21, probable acyl-CoA dehydrogenase, len: 389
FT                   aa; similar to both bacterial and eukaryotic acyl-CoA
FT                   dehydrogenases e.g. SW:ACDS_HUMAN (EMBL:M26393), AcaDS,
FT                   Homo sapiens mitochondrial acyl-CoA dehydrogenase
FT                   short-chain specific precursor (412 aa), fasta scores; opt:
FT                   653 z-score: 771.4 E(): 0, 34.8% identity in 376 aa
FT                   overlap. Also similar to SCI30A.22C (EMBL:AL096811)
FT                   Streptomyces coelicolor probable acyl-CoA dehydrogenase.
FT                   Contains 2 Pfam matches to entry PF00441 Acyl-CoA_dh,
FT                   Acyl-CoA dehydrogenase"
FT                   /db_xref="GOA:Q9RL06"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL06"
FT                   /protein_id="CAB55669.1"
FT                   /translation="MPFTLTPRYDDNPRLEELVGRLRAYLTDELLPYERAHGITPESKL
FT                   DRATLESVWKRSAELGFYGISLPPELGGQGLSFTELCALKEELTSSGAALSHSVLGDMG
FT                   GPLRVGAIVKYATDEQRERYLLPVVRGERACCFSLTEQDAGSDVRRMRTTATPDGDSYV
FT                   LNGHKVFSSAAPFADFAVVVARMADSEETYSAFLVDLDTPGCRVLDGAVPMSGQQMEGD
FT                   LVFEDCRVPVANLLGEIGQGLRIGIGRITLNRLLHCPSLIGAARRAWDLSVDHAKTRVA
FT                   FGQPLLALQAIQHKLADMATDLYAARSMVQATAAKADRGENIAVEANMCKLFTAEACFR
FT                   TADQAVQIHGKDGLTRGHEVEQIFRSLRMFRIVTGTTEIHKNAIVKALV"
FT   misc_feature    10294..10758
FT                   /note="Pfam match to entry PF00441 Acyl-CoA_dh, Acyl-CoA
FT                   dehydrogenase, score 109.50, E-value 2.6e-31"
FT   misc_feature    10813..11304
FT                   /note="Pfam match to entry PF00441 Acyl-CoA_dh, Acyl-CoA
FT                   dehydrogenase, score 155.40, E-value 9.4e-45"
FT   regulatory      11367..11371
FT                   /note="possible RBS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        11378..12727
FT                   /transl_table=11
FT                   /gene="SCO0313"
FT                   /gene_synonym="SC5G9.22"
FT                   /product="putative transmembrane transport protein"
FT                   /note="SC5G9.22, probable transmembrane transport protein,
FT                   len: 449 aa; similar to many transmembrane transporters
FT                   e.g. SW:DGOT_ECOLI (EMBL:L10328), dgoT, Escherichia coli
FT                   D-galactonate transporter (445 aa), fasta scores; opt: 332
FT                   z-score: 376.2 E(): 1.4e-13, 23.7% identity in 438 aa
FT                   overlap. Contains hydrophobic, possible membrane-spanning
FT                   regions. Contains Pfam match to entry PF00083 sugar_tr,
FT                   Sugar (and other) transporter"
FT                   /db_xref="GOA:Q9RL05"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL05"
FT                   /protein_id="CAB55670.1"
FT                   /translation="MAARSSAPPADRSARRPAVRPYDRRRAWLVTAMIVTFMVINFADK
FT                   SVLGLAAVPIMDELNISNSTYGLISSSFYLFFSLSGLVVGFFASRISSRTMLFVMALLW
FT                   AVAQLPVLAVAAVPTLIAGRVLLGVAEGPAASMSMHALYKWFPPERRGLPSALQIGGAA
FT                   IGTLVSAPVLTWLITDFGWRSAYAVLAVVSLLWALVWRQTGHDGPFDESRPPRADAPRP
FT                   GTHLPYRRLLLTGTVLGSIASAFGAAWALALAHAWLPAYLRTQLDMSPHAVATAISAIS
FT                   ALSLVLLLTVSPLVDALKARGVSSRWSSGAVQGASVCVAGCAMAAFPFTDGAVVRLLLI
FT                   AVAFGTVAVAIPLHYVTAAEVVPGARRGAVFGIVAATGTLPGLIAPFVTGRLIDTADTA
FT                   SSGYTTAFLIAAAVMLLAGTAAVIAIRPEHDARRLGLLHPTTDPEKGAHT"
FT   misc_feature    11462..12700
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score -70.60, E-value 0.00025"
FT   CDS_pept        12724..14670
FT                   /transl_table=11
FT                   /gene="SCO0314"
FT                   /gene_synonym="SC5G9.23"
FT                   /product="putative secreted protein"
FT                   /note="SC5G9.23, putative secreted protein, len: 648 aa;
FT                   unknown function, similar to TR:Q52556 (EMBL:M86744), SdsA,
FT                   Pseudomonas sp. alkyl sulfatase which degrades sulfate
FT                   esters of long-chain primary alcohols (SDS) (528 aa), fasta
FT                   scores; opt: 739 z-score: 806.7 E():  0, 29.7% identity in
FT                   528 aa overlap, but having an N-terminal extension of
FT                   approx. 140 aa. Similar to TR:Q48790 (EMBL:X92423), SepA,
FT                   Listeria monocytogenes gene implicated in cell separation
FT                   (391 aa) (42.6% identity in 364 aa overlap). Also similar
FT                   to hypothetical proteins e.g. TR:O69728 (EMBL:AL022121)
FT                   Mycobacterium tuberculosis hypothetical protein (626 aa)
FT                   (52.9% identity in 624 aa overlap). Contains Pfam match to
FT                   entry PF00753 lactamase_B, Metallo-beta-lactamase
FT                   superfamily. Contains possible N-terminal region signal
FT                   sequence peptide"
FT                   /db_xref="GOA:Q9RL04"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL04"
FT                   /protein_id="CAB55671.1"
FT                   /translation="MNPMNRRGFVAAAAGAAAATVPLSAQAAEASPGRGPSGTPTPTHT
FT                   GDLPYDDRTDFADADRGFVAAYTGGLITTPSGGTAWDPDAYRFLTDAAETAPTTVDPSL
FT                   WRQARLLSRQGLYEVTHRIYQVRGLDLANMTVVEGDTGIIVIDPLTSAETAAAALRLYR
FT                   AHRGNRPVRALIYTHPHVDHFGGCRGVLPDGTEDVPVLAPRGFMEHAVSENVYAGPAMS
FT                   RRAGYMYGTNLPTDAAGQVGCGLGLAVSTGTIGLIPPTRYIETTGQEATLDGVRFRFQM
FT                   TPGTECQEEMNVLLPDLRAVCMAENATHTMHNILTLRGAQVRDAHAWAGYLTESIGLCT
FT                   GTADVAFASHHWPTWGNDDIVALLTRQRDLYGYLHDQTVRLINKGLNGTEIAESLRLPP
FT                   QLEQVWANRGYYGSLSHNVKAVYQRYMGWFDANPAHLWEHPPAEEARRWVESLGGQAAV
FT                   RARARHYSERGDLRFAVTLLNHAVFNDPSDTRAKQQLATLYIRLGRAAENAVWRNFFLT
FT                   GAQELVHGAEPAPKPTSGPDLHRALTVGQLIDGLAVRVNGPDAWSLRLALDWHIGDTYW
FT                   HLRLANGVLTWTSDASPDPDAGLTMTMTRAQLLAVLAGKGTDGVTMTGDGTQLVRLLSV
FT                   LDTADHRFPVVTP"
FT   misc_feature    13090..13773
FT                   /note="Pfam match to entry PF00753 lactamase_B,
FT                   Metallo-beta-lactamase superfamily, score 69.40, E-value
FT                   7.3e-17"
FT   CDS_pept        complement(14697..16055)
FT                   /transl_table=11
FT                   /gene="SCO0315"
FT                   /gene_synonym="SC5G9.24c"
FT                   /product="putative decarboxylase"
FT                   /note="SC5G9.24c, probable decarboxylase, len: 452 aa;
FT                   similar to many e.g. SW:DCDA_BACSU (EMBL:L09228), LysA,
FT                   Bacillus subtilis diaminopimelate decarboxylase (441 aa),
FT                   fasta scores; opt: 484 z-score: 542.1 E(): 7.9e-23, 31.6%
FT                   identity in 389 aa overlap. Similar to TR:Q9ZBH5
FT                   (EMBL:AL035206), DcdA, Streptomyces coelicolor
FT                   diaminopimelate decarboxylase (440 aa), fasta scores; opt:
FT                   400 z-score: 384.5 E(): 3.6e-16, 30.2% identity in 427 aa
FT                   overlap. Contains 2 Pfam matches to entry PF00278
FT                   Orn_DAP_Arg_deC, Pyridoxal-dependent decarboxylase, PS00879
FT                   Orn/DAP/Arg decarboxylases family 2 signature 2 and PS00878
FT                   Orn/DAP/Arg decarboxylases family 2 pyridoxal-P attachment
FT                   site"
FT                   /db_xref="GOA:Q9RL03"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL03"
FT                   /protein_id="CAB55672.1"
FT                   /translation="MTSGSLHQRGTAREAALARAVEDGLLGPRTPLVGLLDVDGVLAAV
FT                   DALNEAFEGPAPVQHTFAAKACGLVPVLRLLAEAGMGCEVASPGELEQALAAGFTYDRL
FT                   VFDSPAKTVEELEFALAHGIAINLDNFQEMARVDGLLAGREAAGPIGLRVNPQVGAGAI
FT                   GAMSTATATSKFGVALRDEGAVDAVIEAFARRPWLNRLHAHVGSQGCPLPLIAQGVRTA
FT                   YELAERINRELGRAQITGLDIGGGLPVNFDGEDDRPTYADHVAELRSAAPGLFDGRYAL
FT                   ITEFGRSLLAKSGTIASVVEYTKSAGGRRIAVTHAGAQVATRTVFMPDAWPLRVGVFDA
FT                   AGRPKQGPAEVVDIAGPCCFAGDLTATGRELPAVEPGDVVALYDTGAYYFSSHFSYNSL
FT                   PRPAVYGYRTDSRGQIAFALVREAQSVRAVVEESGLAQADALVALGTDQSAER"
FT   misc_feature    complement(14859..15020)
FT                   /note="Pfam match to entry PF00278 Orn_DAP_Arg_deC,
FT                   Pyridoxal-dependent decarboxylase, score 28.10, E-value
FT                   1.2e-07"
FT   misc_feature    complement(15105..15905)
FT                   /note="Pfam match to entry PF00278 Orn_DAP_Arg_deC,
FT                   Pyridoxal-dependent decarboxylase, score 135.90, E-value
FT                   7.7e-40"
FT   misc_feature    complement(15312..15356)
FT                   /note="PS00879 Orn/DAP/Arg decarboxylases family 2
FT                   signature 2"
FT   misc_feature    complement(15816..15872)
FT                   /note="PS00878 Orn/DAP/Arg decarboxylases family 2
FT                   pyridoxal-P attachment site"
FT   CDS_pept        complement(16254..17921)
FT                   /transl_table=11
FT                   /gene="SCO0316"
FT                   /gene_synonym="SC5G9.25c"
FT                   /product="putative DNA-binding protein"
FT                   /note="SC5G9.25c, hypothetical protein, len: 555 aa;
FT                   similar to hypothetical proteins e.g. TR:O50442
FT                   (EMBL:AL010186) Mycobacterium tuberculosis hypothetical
FT                   protein (538 aa), fasta scores; opt: 485 z-score: 521.2
FT                   E(): 1.2e-21, 32.6% identity in 568 aa overlap and to
FT                   TR:Q9Z561 (EMBL:AL035569) S.coelicolor putative
FT                   transcriptional regulator (415 aa) (28.4% identity in 444
FT                   aa overlap). Contains probable helix-turn-helix motif at aa
FT                   505-526 (Score 1081, +2.87 SD)"
FT                   /db_xref="GOA:Q9RL02"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL02"
FT                   /protein_id="CAB55673.1"
FT                   /translation="MAAREPDRRDGRPSLEQILRLIAPGMLDVVVAPRGTGVPVADAVL
FT                   HDPGEERDDGTWAASGLILLAVGVDAAAPEAIDVLRGAERAGAAAVVLRRGARGPRAAL
FT                   LEAAASGRTALLTRRPGQGWTEVLGQLRTALAHSAPTGGTGVEGLRLGDLPELANTVAA
FT                   LVGGAITIEDPQSRVLAYSRMDHEPDPMRRLTILGQEVPRWRVDELRESGFFQALWNTD
FT                   GVVRLPADDRYAERLAVAVRHGSEILGSLWAAADGRPLAEDAAAALHTAARAAVPHLAH
FT                   HQTWGRAAARARESAVHALLDGSGPAARVAHDAGVAPDRPYTVLVAEAYDSRDLTAVPA
FT                   PATGGAAGQRTLDVLALQAEAYRPGCVTARSGRRLYVLIPAEDGETDPARALTATARSV
FT                   PRGVVFAGVGPVAADLSGLPASREAAELVVRVLRERAARRPAADVVSAVAAFGEVVPEV
FT                   SALRVLDLIAPLWQSLSGPVHAMVEHDRAHGSEYGASVGAYLDAFGDTGTAAQRLNVHP
FT                   NTLRYRLRRARELFGVDLADPTLRLLADVGLRLARRTE"
FT   CDS_pept        complement(17975..19237)
FT                   /transl_table=11
FT                   /gene="SCO0317"
FT                   /gene_synonym="SC5G9.26c"
FT                   /product="putative transmembrane transport protein"
FT                   /note="SC5G9.26c, probable transmembrane transport protein,
FT                   len: 420 aa; shows weak similarity to many efflux pumps
FT                   e.g. SW:CMLR_STRLI (EMBL:X59968), cmlR, Streptomyces
FT                   lividans chloramphenicol resistance protein (392 aa), fasta
FT                   scores; opt: 276 z-score: 292.9 E(): 6e-09, 27.3% identity
FT                   in 407 aa overlap. Contains hydrophobic, possible
FT                   membrane-spanning regions"
FT                   /db_xref="GOA:Q9RL01"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL01"
FT                   /protein_id="CAB55674.1"
FT                   /translation="MSERATESVLRSPGIPHLLTVGAFCFAGLALLLPVSPAWAVAGGA
FT                   DEFGAGLVTAVLMAATVLAQLCVRTALRTIGWPRTLALGALLLGLPALVQSLSDHLVPI
FT                   LVTTALRGAGFGIVTVCGATAAAALAPRGRQGAAIGLYGLAVALPQVILTPAAPWLMGT
FT                   FALPAIVACGVLPVLALPWTRALGRAVEARTDGPPTQDGRTGHPAPAATVLRRILLPLT
FT                   VLLLVTAAGGAVLTFAPQFTSTPALAATGLLALTATAALARWGCGELADRIALRPITAL
FT                   LASTACAGLALIALAVGPDGETVLPLLAGLLLLGTAYGGLQSLTLVQAFDLAGAEDRHM
FT                   TSVAWNIGYDAGTGLGSLALGLAAQAATFSAGFAVMSAVMAAVVLAVLLTPGRPAGRTA
FT                   GDRPRTRSRTRRSPARPRKLP"
FT   CDS_pept        complement(19329..20345)
FT                   /transl_table=11
FT                   /gene="SCO0318"
FT                   /gene_synonym="SC5G9.27c"
FT                   /product="putative oxidoreductase"
FT                   /note="SC5G9.27c, possible oxidoreductase, len: 388 aa;
FT                   shows weak similarity to many eukaryotic and bacterial
FT                   oxidoreductases e.g. TR:Q39617 (EMBL:U36752), LpcR-1,
FT                   Chlamydomonas reinhardtii NADPH:protochlorophyllide
FT                   oxidoreductase (397 aa), fasta scores; opt: 278 z-score:
FT                   296.3 E(): 3.8e-09, 27.4% identity in 343 aa overlap.
FT                   Similar to TR:O53726 (EMBL:AL021932) Mycobacterium
FT                   tuberculosis putative oxidoreductase (311 aa) (41.1%
FT                   identity in 309 aa overlap). Similar to others from S.
FT                   coelicolor e.g. SCJ9A.19c (cosmid SCJ9A), possible
FT                   oxidoreductase (311 aa) (39.6% identity in 303 aa overlap).
FT                   Contains Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase"
FT                   /db_xref="GOA:Q9RL00"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL00"
FT                   /protein_id="CAB55675.1"
FT                   /translation="MGESVLLTSTPPEHKESVIVSSAPQSRPWDVHRLPSAEGRNFLVT
FT                   GGNAGIGYFTAEQLAATGALVVIGSRNPAKADAALASIRSRVPGARVRHLHLDLADLST
FT                   LKSAVDGLALDLGRLDAVVHNAGGALDDPPRRETEDGHELMFGTNHLGHYALTRWLAPL
FT                   LSAAPAGRVVTVGSFAARSERLDLDDLQSTRDYRPKRTYGRSKLAQMCFGFELDRRLRA
FT                   AGSTVLSAVAHPGGALDSLTPPRPPVGAPTPGERLRGLPAALMVQGKDAGAWPVVRAVL
FT                   DSDVQGGQLWGPRVFGLRGQPRREPVPAHMADPAVAARLWAASAELTGTTDPHLGFR"
FT   misc_feature    complement(19626..20228)
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 70.30, E-value 4e-17"
FT   CDS_pept        complement(20499..21008)
FT                   /transl_table=11
FT                   /gene="SCO0319"
FT                   /gene_synonym="SC5G9.28c"
FT                   /product="hypothetical protein SC5G9.28c"
FT                   /note="SC5G9.28c, unknown, len: 169 aa; probable CDS
FT                   suggested by GC frameplot, positional base preference and
FT                   amino acid composition"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RKZ9"
FT                   /protein_id="CAB55676.1"
FT                   /translation="MEAESGHAVVHQCGGRHRGQPSGNRHDLLRTRDDLFGVSGPGSHD
FT                   HTPADPARVHSVTDCQHLARPAATRHVRQRAREEVLTPAAAQQRVQEDDVGRDHTDDDL
FT                   AGAGHGIGQVDQAQHVRSTERGHVDRMHEQHPSLEATSRPASNLKSGRGQGSSVVRGGV
FT                   GPVGKG"
FT   CDS_pept        21110..21583
FT                   /transl_table=11
FT                   /gene="SCO0320"
FT                   /gene_synonym="SC5G9.29"
FT                   /product="hypothetical protein"
FT                   /note="SC5G9.29, hypothetical protein, len: 157 aa; similar
FT                   to the C-terminal half of SW:QOR_PSEAE (EMBL:X85015), qor,
FT                   Pseudomonas aeruginosa quinone oxidoreductase (325 aa),
FT                   fasta scores; opt: 223 z-score: 254.4 E(): 8.3e-07, 34.8%
FT                   identity in 161 aa overlap and the corresponding region of
FT                   many similar hypothetical proteins. Also similar to regions
FT                   of polyketide synthase-type proteins e.g. SW:MCAS_MYCBO
FT                   (EMBL:M95808), mas, Mycobacterium bovis mycocerosic acid
FT                   synthase (2110 aa) (35.8% identity in 159 aa overlap).
FT                   Contains PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9RKZ8"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RKZ8"
FT                   /protein_id="CAB55677.1"
FT                   /translation="MVAAASSDAKLALARDLGAEVVVDYTRADWVERVREATGGGAALV
FT                   YDGAGGALGATSVDALADGGRFVTYGTADGFAAPDRESAARRGIRLLMPLMDGPPDQET
FT                   ARELLGLALESAAEGRLRPAIGATYPLARAADAHRALAARTTVGKSLLLMGGE"
FT   misc_feature    21536..21559
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        21699..23255
FT                   /transl_table=11
FT                   /gene="SCO0321"
FT                   /gene_synonym="SC5G9.30"
FT                   /product="putative carboxylesterase"
FT                   /note="SC5G9.30, probable carboxylesterase, len: 518 aa;
FT                   similar to many eukaryotic and bacterial e.g. SW:PNBA_BACSU
FT                   (EMBL:U06089), PrnbA, Bacillus subtilis 4-nitrobenzyl
FT                   esterase (489 aa), fasta scores; opt: 718 z-score: 774.9
FT                   E(): 0, 36.3% identity in 479 aa overlap. Similar to
FT                   TR:Q9Z545 (EMBL:AL035212) Streptomyces coelicolor probable
FT                   carboxylesterase (502 aa) (41.3% identity in 521 aa
FT                   overlap). Contains 2 Pfam matches to entry PF00135
FT                   COesterase, Carboxylesterases and PS00122 Carboxylesterases
FT                   type-B serine active site"
FT                   /db_xref="GOA:Q9RKZ7"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RKZ7"
FT                   /protein_id="CAB55678.1"
FT                   /translation="MQREAVPVVVFKTRHGSVRGFRASGDVVAVLGVPYAAAPFGVHRF
FT                   REPAPAPAWTGVRDGRSFGPVAPQSARLPGAPVWSPGDEDILTVNLWTPAPDGGPLPVL
FT                   VWIHGGAYTFGSSAQPDFDGTVLARAGLVVVTLNYRIGFEGFGHVPPDGPIAHPDNRGL
FT                   LDQVAALRWVRENIAAFGGEPGNVTVAGQSSGAASVACLMVMDRARGLFHRAIAHSPAS
FT                   PCYPRDIAAATTREVAAAAGCPATSAGLRSTTPQALVAAADQVADGYRRDPASGSRHYD
FT                   PSLYAPVLDDDVLPTDPLTGMAAGAARDVDLLVCHTTEEYWLLDAVGSSAKVTTDAQLA
FT                   RFAEDFGLPDGLVAGYRAALPRAPVLDVYLAVFGDLLFGEYANRLAEVHARAGGRAFLS
FT                   RFDRRRADPGAVVRAWHCADVPFAFGNLDDERLAFLIGGAPTAADQGLARRMVRAWADF
FT                   AATGSPGWPPVRDSSTEATEATEATEAKVWTADPHAARTGDRAAAVRALWAEADFPVLR
FT                   P"
FT   misc_feature    21735..22658
FT                   /note="Pfam match to entry PF00135 COesterase,
FT                   Carboxylesterases, score 250.70, E-value 2.9e-72"
FT   misc_feature    22236..22283
FT                   /note="PS00122 Carboxylesterases type-B serine active site"
FT   misc_feature    22944..23186
FT                   /note="Pfam match to entry PF00135 COesterase,
FT                   Carboxylesterases, score 12.90, E-value 0.0041"
FT   CDS_pept        complement(23244..24938)
FT                   /transl_table=11
FT                   /gene="SCO0322"
FT                   /gene_synonym="SCF12.01c"
FT                   /gene_synonym="SC5G9.31c"
FT                   /product="putative ABC transport ATP-binding subunit"
FT                   /note="SCF12.01c, possible ABC transport ATP-binding
FT                   subunit, len: >230aa; similar to many eg. SW:TLRC_STRFR
FT                   tylosin resistance ATP-binding protein from Streptomyces
FT                   fradiae (548 aa) fasta scores; opt: 1017, z-score: 1131.8,
FT                   E(): 0, (69.0% identity in 232 aa overlap). Contains
FT                   Prosite match to PS00211 ABC transporters family signature
FT                   and Prosite match to PS00017 ATP/GTP-binding site motif A
FT                   (P-loop)."
FT                   /note="SC5G9.31c, probable ABC-transporter ATP-binding
FT                   protein, partial CDS, len: >371 aa; similar ATP-binding
FT                   components from antibiotic resistance export systems e.g.
FT                   SW:TLRC_STRFR (EMBL:M57437), tlrC, Streptomyces fradiae
FT                   tylosin resistance ATP-binding protein (548 aa), fasta
FT                   scores; opt: 1517 z-score: 1597.3 E(): 0, 67.4% identity in
FT                   356 aa overlap. Also similar to many other putative
FT                   ABC-transporter ATP-binding proteins. Contains Pfam match
FT                   to entry PF00005 ABC_tran, ABC transporter, PS00211 ABC
FT                   transporters family signature and PS00017 ATP/GTP-binding
FT                   site motif A (P-loop)"
FT                   /db_xref="GOA:Q8CK61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK61"
FT                   /protein_id="CAD55436.1"
FT                   /translation="MRTSQLTLSHVTKRYAGRTVLDQVSLTLKPGEKAGLIGDNGAGKS
FT                   TLLRIVAGQERPDSGEATVTAAGGIGCLPQSVPLPPTATVQDAVDLSLADLRALEAELR
FT                   RAEQALGAGEDPEALAAYTVLVERYEARDGHDADRRVDIALHHLGLPALRRERRLGTLS
FT                   GGERSRLALAGVLAGRPEVLLLDEPTNDLDDQAVEWLETQLRAHRGTVLAVTHDRVFLE
FT                   RLTSTILEAEGGRVTRYGDGYNGYRTAKAAERRRRLQEHEEWRSELARNERLATGHAAR
FT                   LGAIPRKASLANFGHGGFRARGRAHGAMSRIRNARERVERLTENPVAPPPDALAFTVRM
FT                   ATAAEEASATGAASATLPAVQLSDVRVGDRLHLGSLGLGRRGRLLVTGPNGAGKTTLLK
FT                   VLAGELRPDEGSVRVPGRVGHLRQEETPWPPELTVAEAFGLGRVGAADEHADTLLALGL
FT                   FRPAELRLRMGELSYGQRRRVELARLVSEPVDLLLLDEPTNHLSPALVEELEEALTGFS
FT                   GAIVLVTHDRALRGRFRGRRLTLPAAPGARTGQPVAVAHRPRPGSGA"
FT   misc_feature    complement(23310..23798)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 144.30, E-value 2.1e-39"
FT   misc_feature    complement(23484..23528)
FT                   /note="PS00211 ABC transporters family signature"
FT   misc_feature    complement(23754..23777)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    complement(24411..24455)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(24804..24827)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(25467..26069)
FT                   /transl_table=11
FT                   /gene="SCO0323"
FT                   /gene_synonym="SCF12.02c"
FT                   /product="hypothetical protein"
FT                   /note="SCF12.02c, unknown, len: 200aa;"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK54"
FT                   /protein_id="CAB56128.1"
FT                   /translation="MDAVPRALRVGQYRPRCVAPAHVSVRGAQFLEAGGQLRPTVLGGG
FT                   GKLEVDSVLHRLRVRDADEVDADRGRVRPVEAHGFQVRDARPLARRAPAERLRPEAAER
FT                   RVVPGLEVHPYKLRRHPEPPALPRPRAARPSPRGPGRTGPDRPRRGAQQVRPVYQAPSM
FT                   SELDPIQVTPGTTHRSLLGPQSSISMTMCEPSEVQWL"
FT   CDS_pept        complement(26238..28616)
FT                   /transl_table=11
FT                   /gene="SCO0324"
FT                   /gene_synonym="SCF12.03c"
FT                   /product="putative secreted protein"
FT                   /note="SCF12.03c, possible secreted protein, len: 799 aa;
FT                   similar to TR:CAC45838 (EMBL:AL591786) Rhizobium meliloti
FT                   (Sinorhizobium meliloti) hypothetical transmembrane protein
FT                   (fragment) SMC01907, 729 aa; fasta scores: opt: 492
FT                   Z-score: 517.1 E(): 3.6e-21; 42.318% identity in 742 aa
FT                   overlap. Contains possible cleavable N-terminal signal
FT                   sequence"
FT                   /db_xref="GOA:Q9RK53"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK53"
FT                   /protein_id="CAB56129.1"
FT                   /translation="MSPKSKRTRAALAALVVAAGSLVTAGAARAEQPHHGQRHGGQQAQ
FT                   QAQQAQQGRSSLFERTATYPVFHNRPAGEDAAAGTVAEISSVSEDGRTLVHTDAVARRI
FT                   GFLDISDPGHPRGLGTLSLARLDDAEDEPTSVTVVGQYVLVVVNTSASHARPSGRLDVV
FT                   SLRDRKRVASFDLGGQPDSVAVSKDKRYAAVAVENERDEEATPPGRDEGDLPQAPAGFV
FT                   QIVDLGRGAAPAHWRTRAVPLTRADGRALPVLAEAGIAEPTDPEPEYVSINSRNQLAVT
FT                   LQENNGVVLIDLPTGRIAKAFGAGTASVRGIDTESDGRIDQRGSIEDLRREPDAVGWID
FT                   DRYLATANEGDWRGGTRGWSVFDSRTGKPVWDAGNSFERLAVRHGLHDEGRSGKKGAEP
FT                   EGIAIAEYDGVPYAFVGSERDNFVAVYDVSRPTRPVFRQLLPATNGPEGLLPIPSRGLL
FT                   AVSSEEDDAEAGVRASVSLFRMGRGTGQTPSFPGIVSADDDRGAPIGWGALGALSAAPG
FT                   KPHRLYTVTDAAYSTTRILTVDTARRPAVITRELTVKDADGRPAGYDAEGIHARPQGGF
FT                   WLAVEGGTGAGNKLVRLDARGVTRQVVPLPADVAAGLGKQGFEGVTATTDRRGHEVVWA
FT                   ALQREAAGDPAGVVRLGRYDVTAGTWSWYGYRLESTGTAGDWMGLSEITVVGDRLAVIE
FT                   RDKLNGPAARVKRIYTVDLPKSAVPSGALRILPKRLAHDVLPDLRATNGWTQEKLEGLT
FT                   VGGDGRVYAVTDNDALDDATGETVFLDLGTARQVFGRRG"
FT   CDS_pept        28899..29264
FT                   /transl_table=11
FT                   /gene="SCO0325"
FT                   /gene_synonym="SCF12.04"
FT                   /product="hypothetical protein"
FT                   /note="SCF12.04, unknown, len: 121aa;"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK52"
FT                   /protein_id="CAB56130.1"
FT                   /translation="MRVTGTSAHERDGVDVIVRMSGSAYDSWAGFEEITVRSCFTVRVS
FT                   PASRWREDPDDVDCPEDPALTFAPPVRGNHFDPQDCLLARVVPGATEVRGAAPHPPDAR
FT                   SGRPQVACALDPAAAPH"
FT   CDS_pept        29333..30301
FT                   /transl_table=11
FT                   /gene="SCO0326"
FT                   /gene_synonym="SCF12.05"
FT                   /product="hypothetical protein"
FT                   /note="SCF12.05, hypothetical protein, len: 322 aa; similar
FT                   to TR:O54173 (EMBL:AL021411) hypothetical protein from
FT                   Streptomyces coelicolor (382 aa) fasta scores; E():
FT                   6.7e-12, 34.2% identity in 371 aa overlap."
FT                   /db_xref="InterPro:IPR021889"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK51"
FT                   /protein_id="CAB56131.1"
FT                   /translation="MSGIPSQGVASGMREAARALLAVLEPEQVRELRAGPDRLDTPELR
FT                   EWTYLPGPRPGLSTEGLDGRQREVVDALLTTAHSAAGAELVRGAIEVERHPRARAGHPG
FT                   PDRYWVRLLGDPGGDEPWGWRLNGHHLAVHVLVTAAGVRVTPHFVGAEPARTGNGPRPG
FT                   LRPLGPEEDLARELITSLGGTARASALFAATPPDDILTRADPFADPGLLPEGLRYDRLA
FT                   PGQQRLLERLVGRYLDRAPEAYARECWSDAVRRGLGSLSFAWAGGLAPGDRHYYCVRAP
FT                   DFLIEYDNTQDDGNHAHSVWRHVRHDWGTDLLRGHYTEQHF"
FT   repeat_region   30297..30317
FT                   /note="Part of inverted repeat bounding insertion element
FT                   IS1650."
FT   repeat_region   30297..31194
FT                   /note="Insertion element IS1650. Also present at
FT                   35521-36418bp on Streptomyces coelicolor cosmid SC6G9."
FT   CDS_pept        join(30321..30731,30728..31174)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="SCO0328"
FT                   /gene_synonym="SCF12.07"
FT                   /gene_synonym="SCF12.06"
FT                   /product="insertion element IS1650 transposase"
FT                   /note="SCF12.07, partial CDS, insertion element IS1650
FT                   transposase, len: 148 aa; similar to many transposases.
FT                   Identical to TR:CAB45627 (EMBL:AL079356) insertion element
FT                   IS1650 transposase from Streptomyces coelicolor (136 aa)
FT                   fasta scores; opt: 999, z-score: 1255.4, E(): 0, 99.3%
FT                   identity in 148 aa overlap. Complete protein probably
FT                   translated by ribosomal frameshifting from the upstream
FT                   CDS."
FT                   /note="SCF12.06, partial CDS, insertion element IS1650
FT                   transposase, len: 136 aa; similar to many transposases.
FT                   Identical to TR:CAB45627 (EMBL:AL079356) insertion element
FT                   IS1650 transposase from Streptomyces coelicolor (136 aa)
FT                   fasta scores; opt: 952, z-score: 1212.6 E(): 0, 99.3%
FT                   identity in 136 aa overlap. Contains Pfam match to entry
FT                   PF01511 Transposase_6. Complete protein probably translated
FT                   by ribosomal frameshifting into the downstream CDS."
FT   misc_feature    30441..30701
FT                   /note="Pfam match to entry PF01511 Transposase_6."
FT   repeat_region   complement(31174..31194)
FT                   /note="Part of inverted repeat bounding insertion element
FT                   IS1650."
FT   CDS_pept        31235..32365
FT                   /transl_table=11
FT                   /gene="SCO0329"
FT                   /gene_synonym="SCF12.08"
FT                   /product="putative esterase"
FT                   /note="SCF12.08, possible esterase  len: 376 aa; similar to
FT                   many e.g. TR:O87861 (EMBL:Z15137) esterase A from
FT                   Streptomyces chrysomallus (389 aa) fasta scores; opt: 503,
FT                   z-score: 581.9, E(): 4.6e-25, 34.9% identity in 378 aa
FT                   overlap"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK50"
FT                   /protein_id="CAB56134.1"
FT                   /translation="MGSEPDAVPGPSLQQKVQGVLDELVGTGAERGLQVAVYHHGALVV
FT                   DAVAGVADSRTGRRVAPETPFFGFSAGKVMTSLVAHLLVKSGRIGYDTPVAELWPRFGA
FT                   HGKGTTTLRHVLTHSAGVPAMPRDIGPGDLSDWSRVCTALADAAPRWRPGTRTGYHSYT
FT                   YGFLVGEIARRATDRPMRQLLREWVTEPLGLEGNLYFSVPRTDLARLAHLEDAHLEDVR
FT                   PPAAAATDDEAVLAPWELRPTAELGNNAEVLRADVPSVGTFTARGIAAMNAALLDGRLI
FT                   DPGQLAEVTAVAFEGTDQVFGHHVRLGLGYPLGGVGSRTGEALTTFGWIGGGGSYVCAD
FT                   TAAGIALAVTKTLLTPHFDTARRLTDLITAELGPPV"
FT   CDS_pept        32504..33253
FT                   /transl_table=11
FT                   /gene="SCO0330"
FT                   /gene_synonym="SCF12.09"
FT                   /product="putative short chain oxidoreductase"
FT                   /note="SCF12.09, probable short chain oxidoreductase, len:
FT                   249 aa; similar to many eg. TR:O86853 (EMBL:AJ007731)
FT                   3-ketoacyl-ACP/CoA reductase from Streptomyces coelicolor
FT                   (244 aa) fasta scores; opt: 515, z-score: 576.2, E():
FT                   9.6e-25, (40.2% identity in 244 aa overlap and to
FT                   SW:FABG_BACSU (EMBL:U59433) Bacillus subtilis
FT                   3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
FT                   FabG, 246 aa; fasta scores: opt: 473 Z-score: 524.5 E():
FT                   1.4e-21; 37.500% identity in 248 aa overlap. Contains Pfam
FT                   match to entry PF00106 adh_short, short chain
FT                   dehydrogenase; Pfam match to entry PF00678 adh_short_C2,
FT                   Short chain dehydrogenase/reductase C-terminus and two
FT                   Prosite matches to PS00061 Short-chain
FT                   dehydrogenases/reductases family signature"
FT                   /db_xref="GOA:Q9RK49"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK49"
FT                   /protein_id="CAB56135.1"
FT                   /translation="MSTPESNRVALVTGGSGGIGRVVAERLARDGFAVAVQYAGNRAKA
FT                   EETVAAINAVGGRALAVGGDVADEDAMGTAFDTVRSAFGGIDVVVNTAGIMILAPVETL
FT                   DLADLDRMHRTNIRGTFVVNQQAARTVRSGGAVVNFSTSVVRTQLPTYGAYGAYVASKA
FT                   AVEAMTLVLARELRGRDITVNAVAPGPTATPLFLQGKDEGTVDKFAKATPLERLGRPED
FT                   IAETVAFLAGPARWINGQVLYANGGLA"
FT   misc_feature    32525..33085
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 175.50, E-value 8.5e-49"
FT   misc_feature    32936..33022
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   misc_feature    33146..33235
FT                   /note="Pfam match to entry PF00678 adh_short_C2, Short
FT                   chain dehydrogenase/reductase C-terminus, score 33.90,
FT                   E-value 3.8e-06"
FT   CDS_pept        33311..34210
FT                   /transl_table=11
FT                   /gene="SCO0331"
FT                   /gene_synonym="SCF12.10"
FT                   /product="putative short chain oxidoreductase (putative
FT                   secreted protein)"
FT                   /note="SCF12.10, possible short chain oxidoreductase
FT                   (putative secreted protein), len: 299 aa; similar to many
FT                   e.g. TR:CAB51136 (EMBL:Y18817) short chain oxidoreductase
FT                   from actinorhodin biosynthesis cluster of Streptomyces
FT                   coelicolor (276 aa) fasta scores; opt: 358, z-score: 403.3,
FT                   E(): 4.1e-15, 34.6% identity in 280 aa overlap. Contains
FT                   Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK48"
FT                   /protein_id="CAB56136.1"
FT                   /translation="MSPTGTVVVITGASSGFGALTARALADAGHTVHAGMRHTAGRNAP
FT                   QVQAALDYSREHGVDLRPVELDVNSQASVDAAIAGIEAEHGHIDVLVHNAGHMSTGPAE
FT                   AFTPDQLAALYDVNVLSTQRVNRAALPGMRRRGQGLVLWVSSSSVKGGTPPYLAPYFAA
FT                   KAAMDSLAVSYAAELARWGVETSIVVPGSFTSGTNHFAHSGRPDDAAVEAEYETRYAGL
FT                   MEQVADKLAALAPEGASATLVSEEIARIVALPAGWRPFRVHIDPADDGSQEVSDTADRV
FT                   RSAFLDRIGLADLLGVER"
FT   misc_feature    33326..33898
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 123.30, E-value 4.4e-33"
FT   CDS_pept        34529..35149
FT                   /transl_table=11
FT                   /gene="SCO0332"
FT                   /gene_synonym="SCF12.11"
FT                   /product="putative transcriptional regulator"
FT                   /note="SCF12.11, possible transcriptional regulator, len:
FT                   206 aa; similar to many e.g. TR:AAD31815 (EMBL:AF129856)
FT                   transcriptional repressor from Pseudomonas fluorescens (208
FT                   aa) fasta scores; opt: 275, z-score: 343.1, E(): 9.3e-12,
FT                   30.0% identity in 200 aa overlap. Contains probable
FT                   helix-turn-helix motif (+5.38 SD) 45-66aa."
FT                   /db_xref="GOA:Q9RK47"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:2ZB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK47"
FT                   /protein_id="CAB56137.1"
FT                   /translation="MANDANGRPAPGSRGRGRRPAEEVRAEVLHAVGELLLTEGTAQLT
FT                   FERVARVSGVSKTTLYKWWPSKGALALDGYFHAVEDTLAFPDTGDVRADLLAQLRAFTH
FT                   VMTRTPGGRILTELIGAAQTDADLATAYRQLYSAQRRALAAERLRHARELGQIRPDVDV
FT                   QVLVDQLWGAVYHRLLIPDEPVDDAFVTALVTNLLDGVCPRPA"
FT   CDS_pept        complement(35223..36734)
FT                   /transl_table=11
FT                   /gene="SCO0333"
FT                   /gene_synonym="SCF12.12c"
FT                   /product="putative dioxygenase (putative secreted protein)"
FT                   /note="SCF12.12c, possible dioxygenase (putative secreted
FT                   protein), len: 503 aa; similar to many of undefined
FT                   function and to TR:Q53353 (EMBL:S65040)
FT                   lignostilbene-alpha,beta-dioxygenase from Pseudomonas
FT                   paucimobilis (485 aa) fasta scores; opt: 529, z-score:
FT                   596.3, E(): 7.3e-26, (31.6% identity in 493 aa overlap)"
FT                   /db_xref="GOA:Q9RK46"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK46"
FT                   /protein_id="CAB56138.1"
FT                   /translation="MGSHSRRRILRGAAVAAAGSVVGSGLGPGFFSAAAQATPAAPKGG
FT                   SAPATPFLEGAFAPVTEELTAFDLDVVGRIPADLDGRYLRNGPNALGIEDVRAHHWMIG
FT                   DGMVHGVRLRGGRAEWYRNRWVRSSQVTAKLGETYPGQAPPDDFPCNTHVIPYHGRILA
FT                   LQEGGPLPYELDGELNTLRPYDFRATQKGAFAAHTKYDAVADELHAIAYYPTWDHVRHI
FT                   VVDRTGRARPATRIPVADAPMMHDFALTEKYVVIVDVPITFDGAAAEAGAIVPYVWNDR
FT                   HPMRLGLLPRTGGTTRWFEIDPVYYSHTLNAYDQGDTVVLEYIGFPAPFYAAGRGVGGP
FT                   SATGSPTLDRWTVDLGAARVRSTRLDDRPQEFPRINESLVSRRHRYAYTACAAEMWRAY
FT                   ETVDGVCPDEKFTNYLVKHDMLRGSRQLHRFPRGAAVGEPVFVPRRGARDEDDGYVLSY
FT                   VNDPDRGATDLVILSAQNFGGRPRARVRLPGRVPLGFHGSWVPDA"
FT   CDS_pept        36948..37292
FT                   /transl_table=11
FT                   /gene="SCO0334"
FT                   /gene_synonym="SCF12.13"
FT                   /product="putative secreted protein"
FT                   /note="SCF12.13, putative secreted protein, len: 111 aa;"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK45"
FT                   /protein_id="CAB56139.1"
FT                   /translation="MLQLAGTTAATTAVGPLAGGSPAHGAALPPARAGIGAPAFPFGLG
FT                   RVRPTATLLDQGDGTCTIRDARGKLLPVQNDSPAAGAFVAQEADDGAADNRWRILRRTA
FT                   IDTRVRVVPG"
FT   CDS_pept        37333..40467
FT                   /transl_table=11
FT                   /gene="SCO0335"
FT                   /gene_synonym="SCF12.14"
FT                   /product="putative secreted protein"
FT                   /note="SCF12.14, putative secreted protein, len: 1044 aa"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK44"
FT                   /protein_id="CAB56140.1"
FT                   /translation="MGPVSLPVGRRLLLQLLGATGAAAALQPALGSPSAAAAASGAAPS
FT                   VDPPDDVAATYHRVLLRHTRWSETQWDEAKGAYSDRNFGFAVVLGHAVLLTHGTFDEDA
FT                   AGVDRETLRRRTLATLRHYAASNRLTGGTQWGRTLFFDTTFQSYFVLAAHLLWDELDAA
FT                   TRSAVDTITREQAAYTHSLGTGDDPYSGSWTPNGLAGGYVGDTKLEEMGLYAQTLAPAL
FT                   AWAPDDRRRSEWAADYGTWSRNEGGLPPADLANPARVDGVPVSHNTAHNAYDTFIVENH
FT                   GSFGPHYQEEMWRTSGRNAAHFLAAGQPLPEVLTRQPNAEPLWRTLLGVMSDAGEPLMP
FT                   MVDDREHLYGRDVIPLAFLSRVAGDRAAARAETELAARLEAYQAYPPEYRLAKFSGEPK
FT                   YEPEARAELAISYLLHVWPQAGPRVRPLSREELFAFASGVTDFGTGPGLVSHQSPAAWA
FT                   GTVTKPGFVKFAWQPAHDDWLFRLGGATPMFLPSTAAEVTGRTVRVHTALRDGFDGSAT
FT                   VLRLGEGFAGYATLPTGAVVYACEGPGAAASRLEVHNLTMPGVAGLDGSRTYRFAEGSA
FT                   TVRAQDTTPSAAGRVDELAFPGTTVRHLRMLGVQPDPAYGYSLYAVEARDGAEGPDLAR
FT                   GGTATASSQSAGMGPELAVDGNGASRWAVSREDRRRADSWWAVDLGAERALDRVTLRWE
FT                   AAAGRSYRVQGSPDGERWTDLATGPAPSLRSGGGWLDVDGRAGLVVRGGSEHRLAVYGD
FT                   TIVPAEGAREPLVIEGHCGVSAGDLSALARRAAPTAGDGRVRAARVDGYLSLFNLSAQE
FT                   VETRVAVPQQGGSREVYEGDQTVTREGIDYGARLDAASASLLAPRFTLSALSGRSLPSG
FT                   LRVRVADGATLILSGAHCRLRIEAQGRGTEATVRGGRETRVTLRGAQAFPHHDHALGRN
FT                   TFPTNPLPPGMSGPGAAVDGDPDTAWHPGRDGRMVVDLGTRTGVRWVEARWRTGAAPAA
FT                   RVEFSTDGVRYQQAGTLDGRGRVRRLTRAGSARYVAVTVQGAPHAHEGLVRLSVG"
FT   CDS_pept        complement(40521..41630)
FT                   /transl_table=11
FT                   /gene="SCO0336"
FT                   /gene_synonym="SCF12.15c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCF12.15c, possible integral membrane protein, len:
FT                   369aa; contains possible membrane spanning hydrophobic
FT                   regions."
FT                   /db_xref="GOA:Q9RK43"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK43"
FT                   /protein_id="CAB56141.1"
FT                   /translation="MTETSGTTSGNRTNDEVWIVGATGRVGRGVTGRLAARGLTVVPVG
FT                   RSRERMAAAGAAAGLPADAKTVVADSAERIAEEVLRQRPRAVVNTMGAYATTAPVIARA
FT                   CMSVGGHYVDQANDVVAVEGLLALHEDATRAGSTLVTGAGFGVLATEAVVAKLCEERPA
FT                   PHRVRIDSVASVAVEAGAVGAALATSIVDTLTAGGRRYADGRLVASRLGADPQRLTFPD
FT                   GTSARSAGVASGELVAARAASGAPFVTATSSLAPSTPLLRAVVPALGRLLSVPALRRLA
FT                   VARLGRVTVKAAPRPREHSWGHAVVEWADGTRREGWLRADEGMDFTADVTATVTELLAR
FT                   GAGRPGAWTPAGALGPDVATSAGGTFVLD"
FT   CDS_pept        41752..42318
FT                   /transl_table=11
FT                   /gene="SCO0337"
FT                   /gene_synonym="SCF12.16"
FT                   /product="putative transcriptional regulator"
FT                   /note="SCF12.16, probable transcriptional regulator, len:
FT                   188 aa; similar to many transcriptional regulators from
FT                   Streptomyces spp. e.g. SW:TCMR_STRGA tetracenomycin C
FT                   transcriptional repressor from Streptomyces glaucescens
FT                   (226 aa) fasta scores; opt: 152, z-score: 176.0, E():
FT                   0.019, 28.1% identity in 203 aa overlap. Contains Pfam
FT                   match to entry PF00440 tetR, Bacterial regulatory proteins,
FT                   tetR family and a possible helix-turn-helix motif (+3.98
FT                   SD) 29-50aa."
FT                   /db_xref="GOA:Q9RK42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="PDB:2DG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK42"
FT                   /protein_id="CAB56142.1"
FT                   /translation="MARWDPGAEQRLKRAALELYSEHGYDNVTVTDIAERAGLTRRSYF
FT                   RYFPDKREVLFGGSELLPPAVARAVLAADPGAAPLTAVLDAMSQVGAQLVAQVEGAAQR
FT                   RAVIDASPELQERERTKSAAISRAVQDALVRRQVDADTAELVAQLATVAFGSAFRRWID
FT                   AEGHADFGSCLDTVTDRLRAVLTGT"
FT   misc_feature    41785..41916
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 33.50, E-value
FT                   1.4e-07"
FT   CDS_pept        complement(42370..42909)
FT                   /transl_table=11
FT                   /gene="SCO0338"
FT                   /gene_synonym="SCF12.17c"
FT                   /product="putative dehydrogenase"
FT                   /note="SCF12.17c, possible dehydrogenase, len: 179 aa;
FT                   similar to the C-terminal many proposed glucose-6-phosphate
FT                   dehydrogenase eg. TR:AAD36231 (EMBL:AE001772) from
FT                   Thermotoga maritima (496 aa) fasta scores; opt: 314,
FT                   z-score: 381.8, E(): 6.5e-14, (42.5% identity in 146 aa
FT                   overlap). Contains Pfam match to entry PF00479 G6PD,
FT                   Glucose-6-phosphate dehydrogenase."
FT                   /db_xref="GOA:Q9RK41"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK41"
FT                   /protein_id="CAB56143.1"
FT                   /translation="MRAAASQSATRACWNSTAGAWAGTRFRLRSGKALGTDRKEVAVRF
FT                   RSVPHLPFGQDQDVRPNVLRFGLEPESLSVDLTATGSRPETLTQLSLTARMDTPDLPAY
FT                   GRLLLDVLRGDPALSIRGDEAEEAWRVVEPVLSAWERGLVPLEEYPAGSDGPPPRHATP
FT                   ERRDDLLHEESVMRAE"
FT   misc_feature    complement(42442..42603)
FT                   /note="Pfam match to entry PF00479 G6PD,
FT                   Glucose-6-phosphate dehydrogenase, score 59.80, E-value
FT                   4.1e-19"
FT   misc_feature    42992..43420
FT                   /note="Pfam match to entry PF00389 2-Hacid_DH, D-isomer
FT                   specific 2-hydroxyacid dehydrogenases, score 106.10,
FT                   E-value 4e-43"
FT   CDS_pept        42992..43561
FT                   /transl_table=11
FT                   /gene="SCO0339"
FT                   /gene_synonym="SCF12.18"
FT                   /product="putative dehydrogenase"
FT                   /note="SCF12.18, possible dehydrogenase, len: 189 aa;
FT                   similar to a region from many proposed dehydrogenases e.g.
FT                   SW:SERA_METJA D-3-phosphoglycerate dehydrogenase from
FT                   Methanococcus jannaschii (524 aa) fasta scores; opt: 415,
FT                   z-score: 508.1, E(): 6e-21, 40.8% identity in 179 aa
FT                   overlap. Contains Pfam match to entry PF00389 2-Hacid_DH,
FT                   D-isomer specific 2-hydroxyacid dehydrogenases"
FT                   /db_xref="GOA:Q9RK40"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK40"
FT                   /protein_id="CAB56144.1"
FT                   /translation="MLGLLSFGAIARLVAERARAFGVEVWAHDPFVDESEIRAARVRPV
FT                   SFDDLVEGADHLVVQAPLTPQTHHTFDRATLRRMKPTAVLVNTARGPIVEDAALYEALT
FT                   GGWIAGAALDDIEEEPAKQRDWRPNNPLFELPNVVVTPHAAYYSEEAIGTVRTIAAEEA
FT                   VRVLTGEPARYPVNEPAAGSHRAEGA"
FT   CDS_pept        complement(43578..44165)
FT                   /transl_table=11
FT                   /gene="SCO0340"
FT                   /gene_synonym="SCF12.19c"
FT                   /product="hypothetical protein"
FT                   /note="SCF12.19c, unknown, len: 195aa;"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK39"
FT                   /protein_id="CAB56145.1"
FT                   /translation="MGAMSRTTAALRLRRAITRTRDATRERAPVGRRPEEADDVRGTFA
FT                   TDGALGFDPFPFLRALHDAGSHAVVIGQVAGIMHGSTELTGDLDLLWDGTPAEARALRS
FT                   ALAACGCAEPPDLDRAQAAYEVTGAGGDLCTPALPWGDMDVSPCLARAETTHDPSGFTV
FT                   RYAALDDLIRMRRALGRPKDHRRADELTRLRS"
FT   CDS_pept        complement(44234..46663)
FT                   /transl_table=11
FT                   /gene="SCO0341"
FT                   /gene_synonym="SCF12.20c"
FT                   /product="putative large secreted protein"
FT                   /note="SCF12.20c, possible large secreted protein, len: 809
FT                   aa; similar to TR:CAB36703 (EMBL:AL035521) hypothetical
FT                   protein from Arabidopsis thaliana (thale cress) (847 aa)
FT                   fasta scores; opt: 903, z-score: 959.2, E(): 0, 38.7%
FT                   identity in 775 aa overlap"
FT                   /db_xref="GOA:Q9RK38"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK38"
FT                   /protein_id="CAB56146.1"
FT                   /translation="MPEFSRRNVLAAAGASAAATALSAAPAPAAPQTADTAASAAPGED
FT                   HAAAPMRLWYRAPAQEWLEALPVGNGRLGAMVFGGTDTERLQLNEDSLWAGGPGDYARP
FT                   DAVRHLAEIRRLVVEEKWNRAQRLIDAEFLGSPSEQAAYQVLGDLELTLAGEGEAADYE
FT                   RELDLETAVARTTYTRGGVRHVREVFASAPDQVLVVRLSADTPGAVGFTARFTSPQRSG
FT                   GSAVDAHTIALDGVGGDWYGRPGSVRFRGLARAESEGGRVSTDGGTLTVEGADAATLVI
FT                   SLATSYRNYLDVGADPASRARNHLAPAARKPYAHLRTRHVADHRRLFGRVALDLGPSER
FT                   AELPTDERIPLFADGKDPQLAALYFQYGRYLLASCSRSPGQPANLQGLWNDSLNPAWES
FT                   KYTVNINFEMNYWPAGPGNLAECWDPAVRMVHELAESGTRTAKALYDAPGWVLHHNTDG
FT                   WRGTAPVDAAQYGMWPTGGAWLCVMLWDHYRFTGDTGALSRNYPVMKGAVEFFLDTLQV
FT                   DAETGWLVTNPSQSPEVTHHQDEGESVSICAGPTMDMQLLRDLFDAYRQAAEVLDRDSR
FT                   LVGRVTEVRDRLAPTRVGHLGQIQEWLVDWEEAALVRSRHVSHLYGVFPSAQITPRGTP
FT                   ELAAAAKKSLELRGTAGQGWSLAWKINMWARLLEPARAYQHLADLLTPARTAPNLFDLH
FT                   PPFQIDGNFGGVSGITEMLLQSHAGEIELLPALPEAWPTGSFRGLRARGGFEVDLEWTG
FT                   AGITRAEVRSLLGNPVRIRTPHPVRVEGADADRSEEAVVSFATHRGGRYRLAPVTP"
FT   CDS_pept        complement(46817..48706)
FT                   /transl_table=11
FT                   /gene="SCO0342"
FT                   /gene_synonym="SCF41.01c"
FT                   /gene_synonym="SCF12.21c"
FT                   /product="putative secreted protein"
FT                   /note="SCF41.01c, partial CDS, possible secreted protein,
FT                   len: >350 aa. Contains a possible N-terminal signal
FT                   sequence."
FT                   /note="SCF12.21c, partial CDS, unknown, len: >533aa;"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK60"
FT                   /protein_id="CAD55438.1"
FT                   /translation="MPTTQVRPVRRRTARLPLLLAAGALLVGGATVGTPDASAQPAGCR
FT                   ATELFVSPDGNDKAKGTKDKPFKTIEKARDHIRDKGLNRPGRMRCDIHVNLRAGDYPVN
FT                   RTVELDDRDSGAGGHQVVYRSYDGPGKARVTGAEPVTGWEEYKDGIYRADVGTDNPFYT
FT                   LFEDGTRATTARYPNRKSEEEWAPYLTSTLPEPEKEAVHQWLYSNPGDWDATWDLGNAQ
FT                   AVVWSGGSWSWFTDTVPIRDWNPAKNQMTLKYWTRYALNNSGGGSRYFLQNSLDFLDQA
FT                   GEYYLDFKKGQLYYKPRGDIDDVTVLRPTVKTLFDLAGTAPDRRVQNVTLDGLALQYTD
FT                   FVDWYRNGWISDGDSGEVHKYPEYDRQIEMPRNRFGAVSVTNSKDVTLSRLKISDTGYH
FT                   AVYALAANDHLTVRDSLLENIGADGIKVEGPYPGEGNTSNGHLLTNNYITHYGELNPGD
FT                   ASGIELMNTGHNTVSHSHVKHSARYGISLEVRPEVALKDNYARGNTFEYLRIDEAGLDS
FT                   GDMGAFYTYGVNNVEPYPMDNHVRQMVVGDVIPDESMPDSGTRGIHMDAGGCGFTFEDI
FT                   EVGRTTDQSYQSYQCNDVKNTNWEDGYDASRMEYDKIGVTAGFPYPLPDGDTQ"
FT   regulatory      complement(48712..48716)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      48807..48810
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        48814..49083
FT                   /transl_table=11
FT                   /gene="SCO0343"
FT                   /gene_synonym="SCF41.02"
FT                   /product="hypothetical protein SCF41.02"
FT                   /note="SCF41.02, unknown, len: 113 aa. Contains a PS00197
FT                   2Fe-2S ferredoxins, iron-sulfur binding region signature."
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJW7"
FT                   /protein_id="CAB55705.1"
FT                   /translation="MRKPELEPEPDGSRNRSRCGSRNRRHGSRCRAGPCSGCGGFVPSS
FT                   GGVAPVADAVRSGMGRGPPLRTPAPVEHPHGIAYTISGSLIEQR"
FT   misc_feature    48901..48927
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature"
FT   CDS_pept        49137..50381
FT                   /transl_table=11
FT                   /gene="SCO0344"
FT                   /gene_synonym="SCF41.03"
FT                   /product="putative GntR family DNA-binding regulator"
FT                   /note="SCF41.03, possible GntR family DNA-binding
FT                   regulator, len: 414 aa. C-terminus similar to Streptomyces
FT                   coelicolor TR:Q9ZBS9 (EMBL; AL034446) putative GntR family
FT                   transcriptional regulator SC1A9.23 (273 aa), fasta scores
FT                   opt: 332 z-score: 363.0 E(): 7.2e-13 31.9% identity in 254
FT                   aa overlap. The N-terminus is weakly similar to other
FT                   DNA-binding proteins e.g. Clavibacter michiganensis subsp.
FT                   sepedonicus TR:O86023 (EMBL; AF079817) putative transposase
FT                   (320 aa), fasta scores opt: 158 z-score:0.0 E(): 0.0 30.04%
FT                   identity in 233 aa overlap. Contains a Pfam match to entry
FT                   PF00392 gntR, Bacterial regulatory proteins, gntR family.
FT                   Contains two potential helix- turn-helix motifs: between aa
FT                   135..156 score (+5.36 SD) and residues 69..90 score (+4.14
FT                   SD)."
FT                   /db_xref="GOA:Q9RJW6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJW6"
FT                   /protein_id="CAB55706.1"
FT                   /translation="MTKGATNSRPVSHKFTHPRKRGAMTDPVLPEFPQLSAEDRAALAE
FT                   LARRQQAGLRLRGRIVLACAEGLTNAEVAQRLTVSPTTVAKWRERYLRRGLAGLHDAPR
FT                   SGRPRSSNRQEAEARIAAVVEQARAGAPVPSTRSLSDTLGLSQSTVARIWREQEARLPE
FT                   RPDGRPSRPRGAADGQEGGEASRTRGGPVPGTPRMPRQLLSDHVYALLRDWIVSGRLAP
FT                   GQRLVESEIARGFGTSQAPPREAIKRLAYEGLVISQPHRGTYVAQVSERQAQDIRDIRV
FT                   MFEEYAARRVAGRLDAEHTRLLAEDVTRLRRAAAEDDIGAFRDADMSFHRHVCEAARNA
FT                   ALIRLWRMIESSLWDLHVLGDPRYAGGWGAMAEHHAELLDVLRSGDPDAAGPMFADHAA
FT                   GETARYLTDGSGPAT"
FT   misc_feature    49755..49931
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 54.90, E-value
FT                   2e-15"
FT   CDS_pept        complement(50419..51201)
FT                   /transl_table=11
FT                   /gene="SCO0345"
FT                   /gene_synonym="SCF41.04c"
FT                   /product="probable IclR family regulator (putative secreted
FT                   protein)"
FT                   /note="SCF41.04c, probable IclR family regulator (putative
FT                   secreted protein), len: 260 aa. Similar to many e.g.
FT                   Agrobacterium tumefaciens TR:AAD43987 (EMBL:U59485) AttJ
FT                   (275 aa), fasta scores: opt: 354 z-score: 406.3 E():
FT                   2.8e-15 31.6% identity in 237 aa overlap and Streptomyces
FT                   coelicolor TR:CAB45040 (EMBL:AL078635) putative
FT                   transcriptional regulator (248 aa), fasta scores: opt: 333
FT                   z-score: 383.3 E(): 5.3e-14 32.3% identity in 248 aa
FT                   overlap. Contains a Pfam match to entry PF01614 IclR."
FT                   /db_xref="GOA:Q9RJW5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJW5"
FT                   /protein_id="CAB55707.1"
FT                   /translation="MSTRDGSVWASAAPAPAVLRAGAILDALADARGRALSPAQLAAAA
FT                   GGIPRASVVNICAALREQELVHAVDGGFALGPGLLRLAQSYLDAFDPVRSFREQVSRLG
FT                   DREETLQLATMDGADVVYLAVHEGTVLMRLTSRAGARLPVTCTALGKAMLAGLDDSGVC
FT                   ELLASREPFEARTPWSLTTLDALLAEVREVRTAGHAVDDQEAAEGIVCVAAAVPGPAGG
FT                   GRSFAVSSSLLKSEATPERVAELAALIKGVVRRMGGAA"
FT   misc_feature    complement(50425..50985)
FT                   /note="Pfam match to entry PF01614 IclR, , score 85.60,
FT                   E-value 1e-21"
FT   CDS_pept        51474..52352
FT                   /transl_table=11
FT                   /gene="SCO0346"
FT                   /gene_synonym="SCF41.05"
FT                   /product="putative 2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomerase"
FT                   /note="SCF41.05, possible 2-hydroxyhepta-2,4-diene-1,7-
FT                   dioate isomerase, len: 292 aa. Similar to many e.g.
FT                   Mycobacterium leprae TR:O33119 (EMBL; Z99263) possible
FT                   2-hydroxyhepta-2, 4-diene-1,7- dioate isomerase (242 aa),
FT                   fasta scores opt: 491 z-score: 566.1 E(): 3.5e-24 40.6%
FT                   identity in 212 aa overlap, Streptomyces coelicolor
FT                   TR:O86527 (EMBL; AL031124) hypothetical 28.2 KD protein
FT                   SC1C2.27 (261 aa), fasta scores opt: 465 z-score: 479.6
FT                   E(): 1.9e-21 40.0% identity in 220 aa overlap and to the
FT                   C-terminus of Escherichia coli SW:HPCE_ECOLI (EMBL; X75028)
FT                   homoprotocatechuate catabolism bifunctional
FT                   isomerase/decarboxylase (405 aa), fasta scores opt: 479
FT                   z-score: 549.1 E(): 3.1e-23  42.8% identity in 187 aa
FT                   overlap. Contains a Pfam match to entry PF01557
FT                   FAA_hydrolase."
FT                   /db_xref="GOA:Q9RJW4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJW4"
FT                   /protein_id="CAB55708.1"
FT                   /translation="MKLVRLGDPGRERPAVIDDRGVTRDLSSLTSDIDGAFLAADGIAR
FT                   TRRALADDVLPPLRTEGLRFGPPVARPGAVVCIGQNYAAHAAESGSEPPTRPVIFFKPP
FT                   NTVVGPNDEVEIPRGSARTDWEVELAVVIGRTARYLDSPGQALEHVAGYAVSNDVSERD
FT                   FQLEHSGGQWSKGKSCATFNPLGPFLVPADEVPDVQALRLRSFVNGEPRQDSRTADMIF
FT                   SVAQLVYDLSQYLVLDPGDVINTGTPEGVALSGRFPYLRPGDVMEIEIEGLGRQRQALV
FT                   PARTSSQSSLV"
FT   misc_feature    51738..52241
FT                   /note="Pfam match to entry PF01557 FAA_hydrolase, score
FT                   226.00, E-value 5.6e-64"
FT   CDS_pept        52529..53779
FT                   /transl_table=11
FT                   /gene="SCO0347"
FT                   /gene_synonym="SCF41.06"
FT                   /product="possible racemase"
FT                   /note="SCF41.06, possible racemase, len: 416 aa. Similar to
FT                   Pseudomonas putida SW:MANR_PSEPU (EMBL; M19043) mandelate
FT                   racemase (EC 5.1.2.2) (359 aa), fasta scores opt: 322
FT                   z-score: 326.6 E(): 7.7e-11 27.9% identity in 366 aa
FT                   overlap. Contains a Pfam match to entry PF01188 MR_MLE,
FT                   Mandelate racemase / muconate lactonizing enzyme family.
FT                   This gene is duplicated on this cosmid and shares 74.3%
FT                   identity, in 378 aa overlap, with the downstream gene,
FT                   SCF41.17. Note the predicted protein product of SCF41.06 is
FT                   36 aa longer than that of SCF41.17"
FT                   /db_xref="GOA:Q9RJW3"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJW3"
FT                   /protein_id="CAB55709.1"
FT                   /translation="MKITGFRSLTTVHRWGRPVGDANGFVAQGVTEVPVLLVETDGGLT
FT                   GVGLGAHGDAERVFPALDGQDPRAVTTLYDRMLAHTFKSGHAGTAFGTIGAFDTALWDL
FT                   KAKMAGEPLWRTLGAADRFVPGYASGLDIALDEEELVALYSGWAARGFTGAKLKGGLDT
FT                   ERDIGRLRAVAEVLRPNTRSPALMLDVNESWGRHQAVRLLARIEDRVELAWIEEPVRRW
FT                   DARGHRAVGRAGRTAVASGENLTGLEQFRPLLAADALQVVQAAGVWGITHFLRVATLAH
FT                   GHDLPVSPVGYHANPLAHAAAAVPNHLVTEVQDIGTPAGLTVDQAIEDGGIVLGDAPGL
FT                   GITVDESALAAPRQNAGWARPDGPHVRPRDAGLRLVPEPGPPGPAARVRAGTPSLGVPG
FT                   PVHRPARSEHTERENTP"
FT   repeat_region   52530..53654
FT                   /note="This repeat unit is 76% identical to the repeated
FT                   region complement(15980..17108)."
FT   misc_feature    52589..53530
FT                   /note="Pfam match to entry PF01188 MR_MLE, Mandelate
FT                   racemase / muconate lactonizing enzyme family, score 13.80,
FT                   E-value 3.9e-09"
FT   CDS_pept        53776..54795
FT                   /transl_table=11
FT                   /gene="SCO0348"
FT                   /gene_synonym="SCF41.07"
FT                   /product="possible 2-hydroxyacid-family dehydrogenase"
FT                   /note="SCF41.07, possible 2-hydroxyacid-family
FT                   dehydrogenase, len: 339 aa. Similar to Mycobacterium leprae
FT                   SW:SERA_MYCLE (EMBL; Z99263) D-3-phosphoglycerate
FT                   dehydrogenase (EC 1.1.1.95) (PGDH) MLCB637.25 (528 aa),
FT                   fasta scores opt: 452 z-score: 525.4 E(): 6.5e-22 36.7%
FT                   identity in 286 aa overlap and Pyrococcus abyssi
FT                   TR:CAB49675 (EMBL; AJ248285) SERA-like protein (307 aa),
FT                   fasta scores opt:  437 z-score: 511.6 E(): 3.8e-21 32.0%
FT                   identity in 309 aa overlap. Contains a Pfam match to entry
FT                   PF00389 2-Hacid_DH, D-isomer specific 2-hydroxyacid
FT                   dehydrogenases"
FT                   /db_xref="GOA:Q9RJW2"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJW2"
FT                   /protein_id="CAB55710.1"
FT                   /translation="MTRPRAVLAMNPRLVHAVFDEAALARLRRAADIDTGQVLAELDSA
FT                   RSRDALAGAEILVAGWDAPVVRAEHLPGTERLRAVVYAGGVAATCLEDPAAFAARGVVA
FT                   ANARAANSGPVAEYTLAMILLANKRVLAEERRYRASRTLPDHFGAYAGRGNYRQTVGIV
FT                   GASTVGRAVLGLLRPFDLDVLLYDPTLTAEQAAALGARLVPLDELMAHSRVVSLHQPLT
FT                   PATRGQIDAGRLALMPDGATLVNTARGAVVDQDALLAEVRTGRIDAVLDVTEPEPPDPG
FT                   SELWALDNVVLTPHLAGSLGGELHRIGDAVADEVERFATGRPFAHPEDLAASARTRVW"
FT   misc_feature    54052..54660
FT                   /note="Pfam match to entry PF00389 2-Hacid_DH, D-isomer
FT                   specific 2-hydroxyacid dehydrogenases, score 150.80,
FT                   E-value 1.9e-61"
FT   CDS_pept        54801..55805
FT                   /transl_table=11
FT                   /gene="SCO0349"
FT                   /gene_synonym="SCF41.08"
FT                   /product="possible oxidoreductase (putative secreted
FT                   protein)"
FT                   /note="SCF41.08, possible oxidoreductase (putative secreted
FT                   protein), len: 334 aa. Similar to  Pseudomonas sp.
FT                   TR:Q52472 (EMBL; D32042) L-fucose dehydrogenase (329 aa),
FT                   fasta scores opt: 960 z-score: 1078.8 E(): 0  48.4%
FT                   identity in 318 aa overlap"
FT                   /db_xref="GOA:Q9RJW1"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJW1"
FT                   /protein_id="CAB55711.1"
FT                   /translation="MRSRTLARGPVLTALGLGAAQLGNLARKTSDTDARGAVDAAWDSG
FT                   VRYFDTAPHYGLGLSERRLGAALARRPRAEYTVSTKVGRLLVPSPETAHRQDDGGFAVP
FT                   AAFRRDWDFSRDGILRSLEGSLTRLGLDHVDIVYLHDPDEHWQQASTTGVDTLVGLRDQ
FT                   GVVKAVGVGMNQAAMLAEFVRRSDVDLVMVAGRHTLLDQSAQDELLPLARERGVGVVAA
FT                   AVYNSGLLAADRPPGDATYDYQPASRELIARADALADVCERHGVTLPEAAIAYPLRHPA
FT                   VVSVVLGARDAGQSRTNAARLAAGVPNALWTELADLGLLPEVPGAPSTPGEPS"
FT   CDS_pept        55802..56686
FT                   /transl_table=11
FT                   /gene="SCO0350"
FT                   /gene_synonym="SCF41.09"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCF41.09, unknown, len: 334 aa. Similar to several
FT                   hypotheticals including: Rhizobium sp. SW:Y4MH_RHISN (EMBL;
FT                   AE000085) hypothetical 33.9 KD protein Y4MH (297 aa), fasta
FT                   scores opt: 262 z-score: 309.5 E(): 6.9e-10 23.8% identity
FT                   in 303 aa overlap"
FT                   /db_xref="GOA:Q9RJW0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJW0"
FT                   /protein_id="CAB55712.1"
FT                   /translation="MTVVDAHLHVWDPEQAAYEWLGPAMAPVDRAMRFHDALPALRTAG
FT                   VGAAVLVQAADNDEDTDLMLATAARHPEVVGVVAWVPLDDPGRARARLAALRRDPHVVG
FT                   VRTLLHERSDPDWVLGPDADAGLALLAEAGLPFDYSTTSPAALRHLAELSARHPALRLV
FT                   VDHLGKPPVGGGREDRAEWHRLIAAAAKHPGVHAKLSGLYSASGALDAWTTDEVRPFVE
FT                   DALELFGPERLMYGGDWPISLLAGGYARTWEAMCELLAPLAPDDRAAVLGGTATRFYRL
FT                   DPALLNTAHHAAV"
FT   CDS_pept        56683..58158
FT                   /transl_table=11
FT                   /gene="SCO0351"
FT                   /gene_synonym="SCF41.10"
FT                   /product="hypothetical protein SCF41.10"
FT                   /note="SCF41.10, unknown, len: 491 aa."
FT                   /db_xref="GOA:Q9RJV9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJV9"
FT                   /protein_id="CAB55713.1"
FT                   /translation="MIRSGRNANTMEHQTTTPDTAELAGWLHSWVTDEGAINGFHNHSV
FT                   WGTNPATFLDFTSGHTTFAGPAVGAWARALAARPDERGVALLRRLLRYQCSEVQPDGQY
FT                   AHIGFQVGESATSGLIHNAVGSLGMLLAVRHAGHLLPAEEVAAVLAAVRRNLDACEVYG
FT                   GGRPGEEGTCNQEYARVWVKQLYTELSDDKTYAAEIPEDLAELIRLFHHRGVPDPESTG
FT                   TFRTVRDRAEGGILEPAEYYGLMIVPLVLGHRAQGDPELLAEARRLCRHVARSAWTDES
FT                   GATRYHRYWYVRGERALKTDTPMLIAGMGLTLYGIHEVLAEGPDAELEAFTEACLATYA
FT                   RYQTPAGYFASASGWHNEADIAPSTAWHAHDLLFLMARYGPDEDFWDRVTAPRDRRSVL
FT                   VSDRAYWAESGVHWSVRSPLTAGDLHLYGRKDRAVFAREFFAWTDREPLPEELRHPDVP
FT                   EFFVADDGIYRVDHGEAPTDITAVGPLPYRGRL"
FT   CDS_pept        58209..59477
FT                   /transl_table=11
FT                   /gene="SCO0352"
FT                   /gene_synonym="SCF41.11"
FT                   /product="putative solute-binding protein"
FT                   /note="SCF41.11 possible solute-binding protein, len: 422
FT                   aa. Similar to many including: Streptomyces lividans
FT                   TR:Q9Z492 (EMBL; AF043654) BxlE precursor (434 aa), fasta
FT                   scores opt:  287 z-score: 311.3 E(): 5.5e-10 25.7% identity
FT                   in 354 aa overlap. Contains a PS00013 Prokaryotic membrane
FT                   lipoprotein lipid attachment site and a possible N-terminal
FT                   signal sequence."
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJV8"
FT                   /protein_id="CAB55714.1"
FT                   /translation="MTSTNRGSKARGAALAAVVPLLLVAACSSGSGSAEGEDGEIRMMV
FT                   NLTDNLNQAYWEKLVKPFEDETGLKVKIEGPTGKSVAESFPQQLAAGTAPDVIQSIFPD
FT                   DDTAPELIDLGGEAWAKGTPMFDEYAMGDAHYAVGVGTQTQSLIYYNKTAFEKAGISGP
FT                   PTTWDELTTDLGALEKAGYTPMQTAGDFQTGLQLQQIYHPTLNQLHPKWQTAVADDRLS
FT                   VGDAYKPAFQMYADWIEAGYIGKSDVGLSPSQADGNFTAGKVGLYTNGSWFAASLDKAG
FT                   DLPFEVGVFSPPAADGQAYPGPQGATMANPYMIRKGIGDEDGAKQLVEYLVTDAKAVEA
FT                   QLGSDGVFRKGAESKQSGVDAQIQGILDDAPALVAVGEGQGNVRLPVTGFNPQFTEVAQ
FT                   SLYTGAGPADAAKSIDQWVDENR"
FT   misc_feature    58257..58289
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        59481..60392
FT                   /transl_table=11
FT                   /gene="SCO0353"
FT                   /gene_synonym="SCF41.12"
FT                   /product="putative binding protein dependent transport
FT                   protein"
FT                   /note="SCF41.12, possible binding-protein-dependent
FT                   transport protein, len: 303 aa. Similar to many including:
FT                   Streptomyces coelicolor TR:CAB41203 (EMBL; AL049661)
FT                   putative binding protein dependent transport protein
FT                   SCE134.05c (327 aa), fasta scores  opt:  560 z-score: 661.2
FT                   E(): 1.8e-29 35.5% identity in 301 aa overlap. Contains a
FT                   Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component. Contains multiple potential membrane-spanning
FT                   hydrophobic domains."
FT                   /db_xref="GOA:Q9RJV7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJV7"
FT                   /protein_id="CAB55715.1"
FT                   /translation="MEQTSVSKPRAWRDLGARVSMVVPAVLVYVALLVVPVIYAIYYSF
FT                   TEYNGFPHRVPEFIGLDNYRTMFGSDDITGTMVVTAVVAVVGAVAVNLAALGLALLLQR
FT                   TNRFNTFGRVVMFYPHVLSALVVGFLWQAILGPQGVVNTMLEKAGTDSLPFLSDPDWAL
FT                   WSMILVIVWSLFGVQLILYLAGLQAVPADLLEAARIDGASRWQTFRAVTWPSLASTVTV
FT                   AVITSGISLLKTYDVVVSLTGGGPAGSTKTLAYSILAVSFPQRDIGVASAQAVLLIVAA
FT                   AVLAITVLVLRRRAEDDAESIG"
FT   misc_feature    60033..60266
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 75.90, E-value 8.2e-19"
FT   CDS_pept        60389..61231
FT                   /transl_table=11
FT                   /gene="SCO0354"
FT                   /gene_synonym="SCF41.13"
FT                   /product="putative binding-protein-dependent transport
FT                   protein."
FT                   /note="SCF41.13,  possible binding-protein-dependent
FT                   transport  protein, len: 280 aa, Similar to many e.g.
FT                   Streptomyces coelicolor TR:O50501 (EMBL; AL009199) probable
FT                   transmembrane transport protein SC7b7.04 (302 aa), fasta
FT                   scores opt: 584 z-score: 670.3 E(): 5.5e-30 36.1% identity
FT                   in 274 aa overlap. Contains multiple membrane spanning
FT                   hydrophobic domains, a PS00402 Binding-protein-dependent
FT                   transport systems inner membrane comp sign and a Pfam match
FT                   to entry PF00528 BPD_transp, Binding-protein-dependent
FT                   transport systems inner membrane component."
FT                   /db_xref="GOA:Q9RJV6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJV6"
FT                   /protein_id="CAB55716.1"
FT                   /translation="MKKTLTSAATVRGAFVSLVSLGMLVPMYLLVVNAFKSQQEILANP
FT                   FSPSFGTATFQYLADAWNNPDFSILKGYGVTIALVLCVNALAMAVCAPAAYVLARTPKP
FT                   ISRLLLFFFIAGMFIPTQVILVPVIFVLRGIGLMGTLPGLILFMTATTIPFTLFVFFGY
FT                   IRVLPRSLDEAAAIDGAGRYRTLWRIILPLMRPIVATVFILNSLSVWNDFASPQMILGP
FT                   GSGVYTVTTGVYAAVGQYSTDYTKVFPTLLLAVIPILVIFVVMQRHIMSGLAAGAVKG"
FT   misc_feature    60875..61087
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 71.80, E-value 1.4e-17"
FT   misc_feature    60878..60964
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp sign."
FT   CDS_pept        61305..61646
FT                   /transl_table=11
FT                   /gene="SCO0355"
FT                   /gene_synonym="SCF41.14"
FT                   /product="conserved hypothetical protein SCF41.14"
FT                   /note="SCF41.14, unknown, len: 113 aa. Shares a low level
FT                   of similarity with Bacillus subtilis TR:O05263 (EMBL;
FT                   Z93938) hypothetical 12.6 KD protein (104 aa), fasta scores
FT                   opt:  129 z-score: 179.4 E():  0.012  31.3% identity in 96
FT                   aa overlap."
FT                   /db_xref="GOA:Q9RJV5"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJV5"
FT                   /protein_id="CAB55717.1"
FT                   /translation="MPAPRTPRRVASVIRLRPEHAERYRELHRAVPGPVLDALSRAHVT
FT                   NYSIFLRDHTLFAYFEYTGDDYEADMAAIAADPETQQWWTLTDPCQQPLDSAQPGERWV
FT                   TGAELFPLY"
FT   CDS_pept        61674..62465
FT                   /transl_table=11
FT                   /gene="SCO0356"
FT                   /gene_synonym="SCF41.15"
FT                   /product="probable oxidoreductase"
FT                   /note="SCF41.15, probable oxidoreductase, len: 263 aa.
FT                   Shares a high level of sequence similarity with Comamonas
FT                   testosteroni TR:P94681 (EMBL:U32622) toluenesulfonate
FT                   zinc-independent alcohol dehydrogenase (252 aa), fasta
FT                   scores opt: 506 z-score: 549.4 E(): 3e-23 39.8% identity in
FT                   244 aa overlap and Streptomyces coelicolor TR:O88068
FT                   (EMBL:AL031541) putative dehydrogenase SCI35.33C (260 aa),
FT                   fasta scores opt: 500 z-score: 542.8 E(): 7e-23 36.4%
FT                   identity in 253 aa overlap. Contains a Pfam match to entry
FT                   PF00106 adh_short, short chain dehydrogenase, Pfam match to
FT                   entry PF00678 adh_short_C2, Short chain
FT                   dehydrogenase/reductase C-terminus and a PS00061
FT                   Short-chain dehydrogenases/reductases family signature"
FT                   /db_xref="GOA:Q9RJV4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJV4"
FT                   /protein_id="CAB55718.1"
FT                   /translation="MPHTPTPPSPELAGLAAVVTGGASGIGLATARLLARRGARVAVLD
FT                   LAPDAVPATDLEALLPVGCDVTDDASVRAGLDRAVDLLGGLDILVNNAGVGAQGTVADN
FT                   DDAEWHRVLDVNVLGIVRTTRAALPHLRASRHAAVVNTCSVAATAGLPRRALYSASKGA
FT                   VQSLTLAMAADHIREGIRVNCVNPGTADTPWIDRLLSSADDPAAERTALNARQPTGRLV
FT                   SAEEVAAAIGYLASPAAASVTGTALAVDGGMQGLRLRPDGG"
FT   misc_feature    61716..62252
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 225.30, E-value 8.7e-64"
FT   misc_feature    62103..62189
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature"
FT   misc_feature    62328..62420
FT                   /note="Pfam match to entry PF00678 adh_short_C2, Short
FT                   chain dehydrogenase/reductase C-terminus, score 36.90,
FT                   E-value 4.5e-07"
FT   CDS_pept        complement(62759..63478)
FT                   /transl_table=11
FT                   /gene="SCO0357"
FT                   /gene_synonym="SCF41.16c"
FT                   /product="probable GntR-family regulator (putative secreted
FT                   protein)"
FT                   /note="SCF41.16c, probable GntR-family regulator (putative
FT                   secreted protein), len: 270 aa. Similar to Streptomyces
FT                   coelicolor TR:CAB50881 (EMBL; AL096844) putative
FT                   GntR-family transcriptional regulator SCI28.07 (230 aa),
FT                   fasta scores opt:  292 z-score: 343.8 E(): 8.5e-12 32.7%
FT                   identity in 220 aa overlap and Escherichia coli
FT                   SW:PDHR_ECOLI (EMBL; V01498) pyruvate dehydrogenase complex
FT                   repressor(254 aa), fasta scores opt: 253 z-score: 298.6
FT                   E(): 2.8e-09 30.4% identity in 224 aa overlap. Contains a
FT                   Pfam match to entry PF00392 gntR, Bacterial regulatory
FT                   proteins, gntR family."
FT                   /db_xref="GOA:Q9RJV3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJV3"
FT                   /protein_id="CAB55719.1"
FT                   /translation="MSRPQRRRPPLAAAVVQSLATAIVLGQYPPGTALPSAGELCEEYE
FT                   VSRTVIREATTTLAEKGLVATRQGWGTVVLGQDQWSLLDPLVLDALFQRADRLVYLDNL
FT                   IEIRTTLECAMAARAAGRIDEEQSAALSAKLDELAGLIDDPEAYSRADIEFHEIIHHAS
FT                   RDAFGRAIVSSIQGKAVRSPQYSGDPTREDIELTHQAHARVAAAVLDGDGDAAAEAMRE
FT                   HITSSWARRRPADAPDA"
FT   misc_feature    complement(63257..63436)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 66.90, E-value
FT                   3.9e-19"
FT   CDS_pept        63635..64777
FT                   /transl_table=11
FT                   /gene="SCO0358"
FT                   /gene_synonym="SCF41.17"
FT                   /product="possible racemase"
FT                   /note="SCF41.17, possible racemase, len: 380 aa.
FT                   Duplication of SCF41.06. Similar to Pseudomonas putida
FT                   SW:MANR_PSEPU (EMBL; M19043) mandelate racemase (EC
FT                   5.1.2.2) (359 aa), fasta scores opt:  374 z-score: 431.2
FT                   E(): 1.2e-16 29.8% identity in 362 aa overlap. Contains a
FT                   Pfam match to entry PF01188 MR_MLE, Mandelate racemase /
FT                   muconate lactonizing enzyme family. This gene is duplicated
FT                   on this cosmid and shares 74.3% identity, in 378 aa
FT                   overlap, with the upstream gene, SCF41.06"
FT                   /db_xref="GOA:Q9RJV2"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJV2"
FT                   /protein_id="CAB55720.1"
FT                   /translation="MRITGYRSLATVHEWGRPVGDVNGVVTTGVTEVPVLLLETDEGLT
FT                   GVGLGGHADVERVFPALEGQDPRAVTSLYDRMLAHVFKSGHGGHVFATIGALDMALWDL
FT                   KAKIAQEPLWRTLGAADRFVPGYASGLDYALSDDELVAFHGRWARRGFTGAKVKGGLDV
FT                   DRDVRRLAAVRDVFRVNSERPALMYDVNECWGRHQAVRLARQVEERVELTWIEEPVRRW
FT                   DVAGHRAVATGIRAAVATGENLTGLEHFRPLLAADAVGVVQTGAVWGITHFLRVSTLAF
FT                   GHGLPVSPVGYNANPVAHAAAAVPNHLVTEVQDLAFPVGLRVDQEIADGGIVLGDAPGL
FT                   GIEVDEERIVARAASGGWSLPSGPHVRPADAGLRLAPQAR"
FT   repeat_region   63636..64764
FT                   /note="This repeat unit is 76% identical to the repeated
FT                   region 4874..5998."
FT   misc_feature    63650..64636
FT                   /note="Pfam match to entry PF01188 MR_MLE, Mandelate
FT                   racemase / muconate lactonizing enzyme family, score 39.40,
FT                   E-value 1.4e-10"
FT   CDS_pept        64774..65496
FT                   /transl_table=11
FT                   /gene="SCO0359"
FT                   /gene_synonym="SCF41.18"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCF41.18, hypothetical protein, len: 240 aa; similar
FT                   to TR:Q9KEZ0 (EMBL:AP001509) Bacillus halodurans BH0709
FT                   protein, 242 aa; fasta scores: opt: 515 Z-score: 603.7 E():
FT                   5.4e-26; 36.000% identity in 225 aa overlap"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJV1"
FT                   /protein_id="CAB55721.1"
FT                   /translation="MRPHRGHVERAEGAWREQHMSMRKALVVRGGWEGHDPVGCTESVM
FT                   PALERAGFEVEIAEDLAVYEDPGLLAATDLVVHSWSAGGLTADQEANLVDAVEAGTGFA
FT                   GWHGGVVATNVANPRYLRMVGGRFLWHPDGFKEFTVRIRATPDRDGEIVEGVTDYDVQT
FT                   EHYWVLTDSLNTVLATSVLTPGPADPWDEPVEFPVVWTRRWGAGRVFICTLGHRVADLR
FT                   VPQTAAIVGRGLVWAARG"
FT   CDS_pept        complement(65559..66551)
FT                   /transl_table=11
FT                   /gene="SCO0360"
FT                   /gene_synonym="SCF41.19c"
FT                   /product="probable DNA-binding, LacI family, regulator"
FT                   /note="SCF41.19c, probable DNA-binding, LacI family,
FT                   regulator. len: 330 aa. Similar to Escherichia coli
FT                   SW:GNTR_ECOLI (EMBL:D84362) gluconate utilization system
FT                   GNT-I transcriptional repressor (331 aa), fasta scores opt:
FT                   674 z-score: 767.8 E(): 0 36.9% identity in 320 aa overlap.
FT                   Contains a PS00356 Bacterial regulatory proteins, lacI
FT                   family signature, a PS00237 G-protein coupled receptors
FT                   signature, Pfam match to entry PF00532 Peripla_BP_like,
FT                   Periplasmic binding proteins and LacI family and a Pfam
FT                   match to entry PF00356 lacI, Bacterial regulatory proteins,
FT                   LacI family. Contains a possible helix-turn-helix motif
FT                   between residues 2..23 score (+5.90 SD)."
FT                   /db_xref="GOA:Q9RJV0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJV0"
FT                   /protein_id="CAB55722.1"
FT                   /translation="MTLSDVAAAAGVSAQTVSRVVRDPLSVSDETRARVQAALTATGYV
FT                   PNLAASNLASNRSRTVAALVPQINASVFADTVHAFSTALAAHGYQIFVGTTDYRPEHEE
FT                   EVLRSFLGRRPDGLLMVGTRHTPGTLTLLRAAGVPVVETWGWSRDPVDLLVGFSNAAAA
FT                   AAMVGHLVERGRRRITFAGRHTSGDPRAAERLDGYTGAVRDLLGGEARTVDAGPEPVTM
FT                   DTGVALLDLALERYPDSDALMFSSDVFAAGALQACVRRGIDVPGRLAVAGFGDFELARH
FT                   LVPALTTVAVPSARIGELGAELLLARMRGAAVDVPHRDVGHRVVAREST"
FT   misc_feature    complement(65652..66383)
FT                   /note="Pfam match to entry PF00532 Peripla_BP_like,
FT                   Periplasmic binding proteins and LacI family., score 63.80,
FT                   E-value 3.6e-15"
FT   misc_feature    complement(66369..66419)
FT                   /note="PS00237 G-protein coupled receptors signature"
FT   misc_feature    complement(66474..66557)
FT                   /note="Pfam match to entry PF00356 lacI, Bacterial
FT                   regulatory proteins, lacI family, score 35.10, E-value
FT                   2e-08"
FT   misc_feature    complement(66489..66545)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature"
FT   CDS_pept        complement(66623..67795)
FT                   /transl_table=11
FT                   /gene="SCO0361"
FT                   /gene_synonym="SCF41.20c"
FT                   /product="conserved hypothetical protein SCF41.20c"
FT                   /note="SCF41.20c, unknown, len: 390 aa. Highly similar,
FT                   over available sequence, to Caulobacter crescentus TR:
FT                   Q46022 (EMBL; X98879)  xylX gene (fragment) (>140 aa),
FT                   fasta scores opt:  276 z-score: 326.5 E(): 7.8e-11 50.0%
FT                   identity in 122 aa overlap."
FT                   /db_xref="GOA:Q9RJU9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJU9"
FT                   /protein_id="CAB55723.1"
FT                   /translation="MNQWPDAATTLPADGTGGALVGRVWRPGLGPSVVAVREDGLHDIT
FT                   AAFPTVRDLCETPDPAARLRAARGERIAGLDEVLANTPVDTRDPRRPWLLAPVDLQAVK
FT                   AAGVTFVVSMLERVIEERVRGDAAGAAEARERIRRLVGDDLAALRPGSEEAAALKELLV
FT                   AQGAWSQYLEVGIGPDAEIFTKAPVLAAVGSGADAGVHAASRWNNPEPEVVLAVSSTGA
FT                   VVGATLGNDVNLRDVEGRSALLLPQAKDNNASAALGPFLRLFEPGFRMDDVRRATVTLT
FT                   VEGADGYRLDAESSMAAISRDPLDLVAQLLGPHHQYPDGAVLYLGTMFAPVEDRDVPGQ
FT                   GFTHHDGDLVAVATPKLGTLANRIRPSDVCVPWTFGIADLMRALVARGAL"
FT   regulatory      67926..67930
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        67935..69146
FT                   /transl_table=11
FT                   /gene="SCO0362"
FT                   /gene_synonym="SCF41.21"
FT                   /product="putative racemase"
FT                   /note="SCF41.21, possible racemase, len: 403 aa. Weakly
FT                   similar to Eukaryotic and Prokaryotic racemases e.g. Homo
FT                   sapiens (Human) TR:O43673 (EMBL; AF047020)
FT                   alpha-methylacyl-CoA racemase (EC 5.1.99.4) (382 aa), fasta
FT                   scores opt: 466 z-score: 544.7 E(): 5.5e-23 31.1% identity
FT                   in 392 aa overlap and Streptomyces coelicolor TR:CAB40680
FT                   (EMBL; AL049587) putative racemase SC5F2A.13 (398 aa),
FT                   fasta scores opt: 508 z-score: 593.2 E(): 1.1e-25  34.5%
FT                   identity in 383 aa overlap"
FT                   /db_xref="GOA:Q9RJU8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJU8"
FT                   /protein_id="CAB55724.1"
FT                   /translation="MASRDKPGVLAGYRVLDCSIAMAGPFAAQRLGDLGADVVKVEPVT
FT                   GEWQRHAAAGGAGGNRINVSFLSLNRNKRSLAVDLKDPAGKEVLRRLVTTADVFLQNYR
FT                   PGVADRLGVDYASLAAINPSLVYVSISGYGEDGPYARRPGQDLLLQAMSGAMLSSGRAG
FT                   EAPRAAGQYLVDAVTASTAFEGVLAALLHRERTGEGQLVTVNMLDAVTTLQMQELSVHT
FT                   VGGLPQTRSAEPHAHVYIRSPYGAFQTSDGYLVLAFPPLKRLGEILGEDTFLAMEDEEH
FT                   GWTHRDEIFARTAARLLTRPSRHWLDAFAAAGIWAGPVYGYADLVQDPQIRHNGTFVTY
FT                   EHPTEGSVTVPGFPYKFSATPPRIDRGAPLVGEHTREVLSEAGLTEGEIEELLAAGAVT
FT                   ETAS"
FT   CDS_pept        69143..70252
FT                   /transl_table=11
FT                   /gene="SCO0363"
FT                   /gene_synonym="SCF41.22"
FT                   /product="putative integral membrane protein"
FT                   /note="SCF41.22, possible integral membrane protein, len:
FT                   369 aa. Contains possible membrane spanning hydrophobic
FT                   domains."
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJU7"
FT                   /protein_id="CAB55725.1"
FT                   /translation="MTHIGAPYRGLTWDHPRGYDALAACAGGLVHWDVQPLEGFESHPV
FT                   DELCARYDLVVLDHPHLGEAVVTGCLRPLDDLFTPAELARWGAGSIGPTMRSYAMDGRQ
FT                   WALPLDAATQVAATRTDLVGEPPGTWDEVRRLARRAPVALSLAGPHAFLTFASVALAVG
FT                   EEPAADPDQLIGDGTGLAVLDLLADLDALAPPGTRELNPIGLLELMAGTDRLAHCPLVY
FT                   GYVTYADRLTFTDAPAVTAGGRPGSTLGGAGIALSARCVPSPELLAHMRWLMSPEAQGD
FT                   FLPRHSGQPSARTAWTSPKTVAADFYRRTAATCEQAWVRPRHAGYIGFQTAASAAVRAA
FT                   LAGETGHREALDRMRALYRTSRTAKEPQT"
FT   regulatory      70236..70239
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        70249..71055
FT                   /transl_table=11
FT                   /gene="SCO0364"
FT                   /gene_synonym="SCF41.23"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /note="SCF41.23, possible enoyl-CoA hydratase, len: 268 aa.
FT                   Shares a high level of similarity with Mycobacterium
FT                   tuberculosis TR:O53418 (EMBL; AL021897) enoyl-CoA hydratase
FT                   MTV017.23C (EMBL; AL021897), fasta scores  opt: 554
FT                   z-score: 635.0 E(): 5.1e-28 40.9% identity in 257 aa
FT                   overlap. Contains a Pfam match to entry PF00378 ECH,
FT                   Enoyl-CoA hydratase/isomerase family"
FT                   /db_xref="GOA:Q9RJU6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJU6"
FT                   /protein_id="CAB55726.1"
FT                   /translation="MSDTGHLPPPDLGTDLVLLDVTDRVAILTLNRPAKLNAVTPGMSR
FT                   ALVRAIEWCDTTDEVRALVVTGAGERSFSVGSDIGALDQYATPWDFRNRVDYCDAIRAA
FT                   RTPTVAAVGGYALGGGLETALSCDIRLAADTASFGAPEITLGWIGGGGMTAFLSRAAGP
FT                   GNAALMLLTGERIDAERALAWHLVSEVVPRAGLLDRARALAAVIASRAPVAAETAKINL
FT                   RAAGNLPEDQALAYERDLQTICFATEDAAEGRRAFAEKRSPVFHKR"
FT   misc_feature    70324..70824
FT                   /note="Pfam match to entry PF00378 ECH, Enoyl-CoA
FT                   hydratase/isomerase family, score 166.20, E-value 5.6e-46"
FT   CDS_pept        71066..71812
FT                   /transl_table=11
FT                   /gene="SCO0365"
FT                   /gene_synonym="SCF41.24"
FT                   /product="probable oxidoreductase (putative secreted
FT                   protein)"
FT                   /note="SCF41.24, probable oxidoreductase (putative secreted
FT                   protein), len: 248 aa. Similar to  Rhizobium sp. (strain
FT                   NGR234) SW:Y4LA_RHISN (EMBL; AE000082) putative short-chain
FT                   type dehydrogenase/reductase Y4LA (EC 1.-.-.-), fasta
FT                   scores opt: 487 z-score: 537.0 E(): 1.5e-22  38.8% identity
FT                   in 245 aa overlap. Contains a Pfam match to entry PF00106
FT                   adh_short, short chain dehydrogenase, Pfam match to entry
FT                   PF00678 adh_short_C2, Short chain dehydrogenase/reductase
FT                   C-terminus and a PS00061 Short-chain
FT                   dehydrogenases/reductases family signature"
FT                   /db_xref="GOA:Q9RJU5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJU5"
FT                   /protein_id="CAB55727.1"
FT                   /translation="MKQPRAALVTGAGGALGRATAVRLAADGHDVAVLDRDAESLEHTA
FT                   ALVEKAGARVLALGTDLRDAPAVAAAVERTVTDLGPLRVLVNNAAVYPSRAFLDVPLAE
FT                   YEEVVAVNQRAYWVAAQAAARHMTGTGGGAIVNVASITLHGGWDSLAAYVSTKGAAVAL
FT                   TRALARELGPAEIRVNCVSPGAFPTAAEEIHEDPDAYRRHVLDHQALKRRGRPEELASV
FT                   VSFLTGPDASFVTGQCVEVNGGWVMA"
FT   misc_feature    71078..71632
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 184.00, E-value 2.4e-51"
FT   misc_feature    71483..71569
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature"
FT   misc_feature    71696..71788
FT                   /note="Pfam match to entry PF00678 adh_short_C2, Short
FT                   chain dehydrogenase/reductase C-terminus, score 43.80,
FT                   E-value 3.9e-09"
FT   CDS_pept        71809..72876
FT                   /transl_table=11
FT                   /gene="SCO0366"
FT                   /gene_synonym="SCF41.25"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCF41.25, hypothetical protein, len: 355 aa; similar
FT                   to the plasmid borne TR:Q9R6D3 (EMBL:AB016260)
FT                   Agrobacterium radiobacter TIORF127 protein, 361 aa; fasta
FT                   scores: opt: 520 Z-score: 612.2 E(): 1.8e-26; 34.295%
FT                   identity in 312 aa overlap"
FT                   /db_xref="GOA:Q9RJU4"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJU4"
FT                   /protein_id="CAB55728.1"
FT                   /translation="MKLYGRSHDRQSLARHAGDLSAAGGVRAVVLDDGSERGIRTLEFR
FT                   TGGGLSFDVLVDRAMDLGGAEFEGRGFGWRSATGFRHPGLHEYRDDDGLSMMRSFSGLL
FT                   LTAGLDHTLFGAEVDASQYRYPPRGTAVHALHGRVANLPARLTGYGERWQEDGRCVLWA
FT                   EGEVRQAAIFGEHLRLTRRIEADLGGSEIRLTDRVRNAGFDPTPHMYLYHVNVGWPFLD
FT                   EGARYELPPHRTLWRSDSVAEQGVSHTAMPAPLPGFVEQVYEHELEPDAAGLARPRLVN
FT                   ERLGVYFELEFDTVRFPSFFQWLHLREGAYAVGFEPSTHHVQGEAAAREDGSMTFLAPG
FT                   EEREYTTAFRVGHLD"
FT   stem_loop       72896..72953
FT   CDS_pept        complement(72921..73478)
FT                   /transl_table=11
FT                   /gene="SCO0367"
FT                   /gene_synonym="SCF41.26"
FT                   /product="putative membrane protein"
FT                   /note="SCF41.26, putative membrane protein, len: 185 aa. A
FT                   low level of similarity to Streptomyces coelicolor
FT                   TR:O54175 (EMBL; AL021411) hypothetical 24.6 KD protein
FT                   SC7H1.16 (257 aa), fasta scores opt: 190 z-score: 226.1
FT                   E(): 3.1e-05 35.1% identity in 188 aa overlap. Contains
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9RJU3"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJU3"
FT                   /protein_id="CAB55729.1"
FT                   /translation="MVTANSALTGVGLGGADPRLGALAAVAVVCYVLGAAGAGWAAGHA
FT                   QRGGRLRPADFLLLELVLLWAVVAWWLAAGGDPTGGERTAMLGILAAAMGCQNAGVRVA
FT                   MGAQVPTAYLTGLLTGAVTDAVTSGRVQWPALVTTALLILGAAAAALLERLLPGAAPLL
FT                   PALLVTAAWLTGRARTGTRRAS"
FT   misc_feature    73932..73974
FT                   /note="22/27 bp inverted repeat bounding insertion element
FT                   IS1649."
FT   misc_feature    73932..75001
FT                   /note="Insertion element IS1649."
FT   regulatory      74034..74039
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        74045..75001
FT                   /transl_table=11
FT                   /gene="SCO0368"
FT                   /gene_synonym="SCF41.27"
FT                   /product="transposase"
FT                   /note="SCF41.27, transposase, len: 318 aa. Almost identical
FT                   to several Streptomyces coelicolor transposases: TR:O86758
FT                   (EMBL; AL031035) transposase SC6A9.26 (318 aa), fasta
FT                   scores opt: 2214 z-score: 2579.1 E(): 0 99.7% identity in
FT                   318 aa overlap and TR:CAB52905 (EMBL; AL109949) putative
FT                   insertion element transposase SCJ11.20 (318 aa), fasta
FT                   scores  opt: 2214 z-score: 2571.8 E():0 99.7% identity in
FT                   318 aa overlap. Contains a possible helix-turn-helix motif
FT                   between residues 26..47 scores (+3.19 SD)."
FT                   /db_xref="GOA:Q9RJU2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJU2"
FT                   /protein_id="CAB55730.1"
FT                   /translation="MVHRNAPLTETGRLRLARCVVEDGWPVRRAAERFQVSHTTASRWA
FT                   RRYRQLGVTGMSDRSSRPHHQPRRTAAAVEEHVLRLRREHRIGPLRLAVRCGIAASTAH
FT                   RILVRHGLPPLAALDRATGEPVRRYERARPGELVHIDVKKLGRIPDGGGHKTLGRAEGH
FT                   RSRTNGAGWAYLHTALDDHSRIAYTEDLPDETAPTCAAFLVRATAYFASLGIRIERVLT
FT                   DNAWAYSKNTWRNTCRDLDISPRWTRPWRPQTNGKVERFHRTLLDEWAYQKPYTSDHER
FT                   REAFTHWLHWYNYHRPHTGIGGHTPASRGTNLSEQHT"
FT   misc_feature    complement(74959..75001)
FT                   /note="22/27 bp inverted repeat bounding insertion element
FT                   IS1649."
FT   CDS_pept        complement(74998..78255)
FT                   /transl_table=11
FT                   /gene="SCO0369"
FT                   /gene_synonym="SCF41.28c"
FT                   /product="putative secreted protein"
FT                   /note="SCF41.28c, putative secreted protein, len: 1085 aa.
FT                   Contains a possible N-terminal signal peptide sequence"
FT                   /db_xref="GOA:Q9RJU1"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJU1"
FT                   /protein_id="CAB55731.1"
FT                   /translation="MPRTNPPVRHRTAAALAGVTAFVTLLAGAVTADAATTGTITPTAL
FT                   RTQHLTEALGIDDTTPDLSWQTTAGAPNTRQAAYRVQAATSLQRLRASRPDLWDSGKVE
FT                   SSVPGTTYAGKDPGSRAKVYWRVMLWSGKGKRHSGWSTTAVFETGLTRQSDWDAQWITH
FT                   PDWRLSDRTVEPVVVHLPRTTARYVRLDVTRLGLPLAESFPGRTWRLQVGEIDVRDSTT
FT                   ATTGLARGAAVTASESNTVRKSWEPALAVDGLPNSALQTAAGYASAAHTGPDVSDAPIT
FT                   LTLDLKSVKTFDEVALYPRADVLTDDGRIPGLPVDYTVSAADSADGPATRLAAVTGQRQ
FT                   PTPYLPAGLPLLTDDFTLPKRVRSARLYIAGLGVYDATVNGEPVGDAVLEPANTDFAER
FT                   VQYATYDVTDRLRTGANTLGVALGNGMSNVVSTADRYRKLYGNLSDPKLIARLEVTLAD
FT                   GRVRTITSGDDWRTTLGPTTASNWYGGEDYDARREIPRWDEPAGDRRGWRHAVAVAGPG
FT                   TADRPALLSARETEPIRVVETLKGKEVDGAEGSRVFDLGRNIAGWPEITVRAPEGTAIR
FT                   VYPAESLKDGHAFQSISNVGAPLWDSYTTAGGWHAESWHPRFSYHGFRYLELRGVPENA
FT                   TVSVRGHVLRTDNASAGDFTSSDPLINGIHSLIRRSIEGNMMSVLTDCPSREKLGWLEQ
FT                   NQLVFPALAGNYDMRAYLRKIVRDMADAQTPDGLVPSTVPEYTSLPGAYRNDSNWGGAF
FT                   VLVPWQLYLTYGDRQTLETYYPDMRRYAAFLEAQAADGILDYGLGDWFTPDRTFPRAVA
FT                   GTYGYWRVVDTLGRIASLLGDTAAADEYRRKAAASVEALTAKYYDATTGTFGGGGHGAE
FT                   ALALDMGAYPQGERDRLLSHFTDAIKDAGNHLVLGEISLPAAFRVLSAADRDDVVHAIA
FT                   TQTTSPSYGYQVLAGNTTLGESWDGGPGQSQNHFMLGAIDSWFTTRVAGISQTEDSVGY
FT                   AKLLVDPAVEGDMTSAAGSYRTPYGVARTDWERSDDRFRLTVDVPAGSTAEVHVPVAGE
FT                   HAEAPGSARLLRLTGGEAVYEVGSGHWTFRSTMERGR"
FT   CDS_pept        complement(78286..81690)
FT                   /transl_table=11
FT                   /gene="SCO0370"
FT                   /gene_synonym="SCF41.29c"
FT                   /product="possible DNA-binding protein (putative secreted
FT                   protein)"
FT                   /note="SCF41.29c, possible DNA-binding protein (putative
FT                   secreted protein), len: 1134 aa. Contains a possible
FT                   N-terminal signal peptide sequence and a possible
FT                   helix-turn-helix motif between residues 51..72 scores
FT                   (+3.60 SD)"
FT                   /db_xref="GOA:Q9RJU0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033400"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJU0"
FT                   /protein_id="CAB55732.1"
FT                   /translation="MPEHPLSRRRFVAAAGATGALVAVGLPDAAHASGRPAGPAGPAGQ
FT                   ERHAWSARHFADPRHDSRPTVYWYWNGPVTPELVDRQLADLRSKGMYEVILFSFDNAEM
FT                   TPVFFTEEWFDIVGHVLRTAERTGMRVWLFNDDHFPSGRAGEFIVKGGQVGTRTYAPRP
FT                   DLRLKALARSTTVVCGPASIDLRRSTGVGVDAGRLVADAAVLDGAAVLRDSAEWGDCTV
FT                   TGSAKAEHGAAGLLVRGSADGRTGYAVSFDQTGVVTVERLTDGAEPAELLRSPRTDGFN
FT                   KTKFHTLRITLGDGGLSVTLDGRDKGTVADLAEEAGGAGVRAVGDQRAVWESLTVEAAD
FT                   GTTLYTGAFDRSAAAGDFPERALSTAGFTLAAAAARPTAATAATDVVDLTDRLTGGHTW
FT                   HVPAGEWQVDLFGGVLLADDSQGYSRSYVDLLDDEPVELFLDIVPGEYHRRFGHYFGTV
FT                   VPGFWDDEPFFASAEAHFKRLPWSPALDRALRTVGATPGTAYAAAFDDLGRSGRIARGN
FT                   YWRAVSDRFATAFRKQAQWYEKRGVALITNPLYDETAPAKRIPSTGDLHKVNQWAQVPG
FT                   GDIITAEYVAGEPTMIPRNPVSVAHQMGRERALLEMFGNMGWQVTPGFVHATVGAQAAR
FT                   GVNLTVLHALWTDESRVYFPPPFGPRAPWWWAMRPLAEWIGRVMEAGRGTSAARTALLQ
FT                   PQRAAEQWTGTDRQQDVDGPLSEAAYALERAQVDFDLLHEGALTRDPALLAHAEVRKGR
FT                   LVVGAAAYDLVVIPRTPVLDADGVRVLREFVRTGGTVIAVGALDTEEADGGDRTLAHGL
FT                   ADLFGNRTPARRPLGRGHAVRVADTGALGAVAVEAGTAAAVLEPPQDAVRVLRVRRGPD
FT                   TVFLINNESGARVRTAAALPATGVPEIWDPATGTGGTAPVYRATKNGVRVPLDLEPFRT
FT                   AVVVVRGGHRDRPHLTEATLPVLSVTRHGNALRATVEATAAGTHRLVGADGGHRYHGTV
FT                   RIDDTLTPVPVDGDWTLTFEREGAEPVTAPLGSWTEHDALFSGSGTYTTDIDVDADRLR
FT                   GRRVVLDLGDVRDVAEVSVNGTALPPLLWAPFAADVTGHVRAGRNTLRVRVANTLSNER
FT                   KKPLPSGLLGPVTLRFRSRTTVELRRS"
FT   CDS_pept        complement(81751..84360)
FT                   /transl_table=11
FT                   /gene="SCO0371"
FT                   /gene_synonym="SCF41.30c"
FT                   /product="putative secreted protein"
FT                   /note="SCF41.30c, possible secreted protein, len: 900 aa.
FT                   Shares a low level of similarity, over the available
FT                   sequence, with Bacteroides ovatus TR:Q45327 (EMBL; U15179)
FT                   arabinosidase (ASDII) (fragment) (>436 aa), fasta scores
FT                   opt:  323 z-score: 317.9 E(): 2.4e-10 30.6% identity in 304
FT                   aa overlap. Contains a possible N-terminal signal
FT                   sequence."
FT                   /db_xref="GOA:Q9RJT9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJT9"
FT                   /protein_id="CAB55733.1"
FT                   /translation="MPAPHSRPAPSRRQVLFTASAATAAAATPAAAAAAAPAGSAAATP
FT                   PAHAGATPSPTNGAHRPGPLLEPFPLSAVRLLDSPFLANMRRTCAYLRFVDPDRLLHTF
FT                   RLNVGLPSAAEPCGGWEAPDVQLRGHTTGHLLSALAQAHAGTGETAYADKARLLVSALA
FT                   ECQRAAPAAGFHRGYLSAFPESVFDQLEAGGKPWAPYYTLHKIMAGLLDQYRLSGNREA
FT                   FDVLLEMAAWTEARTAPLSRERMQSVLKVEFGGMNDVLARLHLETGDPVHLRTARRFDH
FT                   DELYAPLAAGRDELAGRHANTEIAKVVGAVPAYEATGDRRYLDIADTFWTTVVRHHSYA
FT                   IGGNSNQELFGPPDEIASRLSEVTCENCNSYNMLKLGRDLFRHDPERTEYLDHYEWTLY
FT                   NQMLAEQDPDSAHGFVTYYTGLWAGSRREPKGGLGSAPGSYSGDYDNFSCDHGTGLETH
FT                   TKFADTVYFRTPGTRRPALHVNLFVPSEVCWDDLGVTLRQDTDMPTGDRTRLTVTGGEA
FT                   RFALRIRVAGWLAAGDGRAGLTVNGRRTGGRLEPGTYTTVTRHWRTGDRVELVLPRVPV
FT                   WRPAPDNPQVKAVSYGPLVLAGAYGDTPLTTLPAVRPDTLRRTPGEPTRFTAVADGRRI
FT                   PLRPFHEIHHQRYNVYWSVTPPSPTAGDVARYPLDEGHGTSVADRTGTFGDGSLAGGAT
FT                   WSTGDDGTAVTLDGRDGHVVLPAGLPSGLAELTVSVRVRVDTLAPSVRVFDLGYSKDTY
FT                   LFLTATTGAGRARAALKIAGMEAEDFVDATGPLPLGRWTHVALTLGAGTGVLYVDGVEA
FT                   GRNTAMVSGPLLLGRTSRNYLGRSQNSTHPYLHGAVRDFRLHNRVLTADQVRRLAQG"
FT   CDS_pept        complement(84578..87592)
FT                   /transl_table=11
FT                   /gene="SCO0372"
FT                   /gene_synonym="SCF41.31c"
FT                   /product="putative secreted protein"
FT                   /note="SCF41.31c, possible secreted protein, len: 1024 aa.
FT                   Contains a possible N-terminal signal sequence."
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR033400"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJT8"
FT                   /protein_id="CAB55734.1"
FT                   /translation="MHELVSQRGGMSRRAVLAAAVTAGVTATAVTASPGVAALPAGPAA
FT                   DRAAGPARWFADPARSVRPKFRWWWPDGLVDPDEVAREIDQIADAGFGGAEIAAVHHSI
FT                   RDKSLLDTAHHGWGSRPWRDGVEAALRRAVRRGLTVDLTLGPSWPVAVPGVTPDDEAAA
FT                   QELAHGRTSLAAGATYRGPVPAPVHEAASGVRAQRLLAVQAARVDPANSTRKETGLDPD
FT                   SVRDLTDTVTDGGLTWTAPADGEWMLISYWQRGSGQQPESGPHSAPGAFVVDHLSPAGT
FT                   TAVTDYWERHVLTGSLRRLLKAAGGSFFEDSVELESEGLVWTARLPEVFEQRTGRPLLP
FT                   WLPVLVLDDSNQVFAFGAQLTRQIRHDFWATVSDLFNRHHVGALKDWAHSLGMTLRAQP
FT                   YGLQTDAVATAAILDIAEGESLGFKNLDDYRCLAGGRDMAGHTVLSCEAGAYNGSAYST
FT                   TWDRVLRTMGGAYAAGVNQTVMHGFSYASAPEAEWPGFAAFSPYNGTPGYGESWGPRQP
FT                   TWRHAEDIAGYLGRVHAVLQSGTARADVAVFRQTGYTATGIGASWFTSTGVPLGWTHQF
FT                   LSGPLLDLPNATVLGGRLAPGGPAYKALFVEGDFFHGSTPTLALADARRILAFAEAGLP
FT                   VVLLGGFDQALTPGVPEAGETERLRDVLTRLLALPGVVRVTEKTAVGDALAALGVTPDV
FT                   RHSVPSTLLNAHRVTADADYYYLVNGKHAETVKPPVAAIDHDVTLRRTRGRDAVPYLLD
FT                   PWTGRAARVGRYTLDGQDVTFRVALRPGQTLVVALGRPGLFGDRHGNRPHALSSDADEV
FT                   LFTARGLTVRARAAGTYRTRLSQGRTVTTTLPAVPGPIEPGRWHVEVEDWRPGDRPTRT
FT                   ERVRRTLTLDTLLPWSSIAELEDCAGIGRYRTTVTLPGDWGPTHGALLELGRVSDTFRV
FT                   SVNGRDAEPADRLDPVVDVGPLLRRGTNTIEIEVATPLVNRLRVSRPEVFGGLARQEYG
FT                   LVGPVRLVPYAQKTV"
FT   CDS_pept        complement(87761..88360)
FT                   /transl_table=11
FT                   /gene="SCO0373"
FT                   /gene_synonym="SCF41.32c"
FT                   /product="putative secreted protein"
FT                   /note="SCF41.32c, possible secreted protein, len: 199 aa.
FT                   Contains a possible N-terminal signal sequence."
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJT7"
FT                   /protein_id="CAB55735.1"
FT                   /translation="MRRTTGATGGPIVSRPLLFLDVDGPLNPYAAKPQRRPAGYITLRV
FT                   PRDGQTPDGHRSALVRRRPLRVWLHPRHGAELLRLDYELCWATTWMAEANRWIAPVIGL
FT                   PELPFVDFGDVLLQDRPDGVHWKTAPLVEYANGRPFAWVDDEQGGLDQAYVTAHHRAPG
FT                   LLHHVNPRIGLRDDDFRTLAEFARACTVPQRDRDGG"
FT   CDS_pept        88750..90519
FT                   /transl_table=11
FT                   /gene="SCO0374"
FT                   /gene_synonym="SCF41.33"
FT                   /product="putative ABC transport protein"
FT                   /note="SCF41.33, putative ABC transport protein, len: 589
FT                   aa. Similar to many e.g. Streptomyces coelicolor TR:Q9ZNB0
FT                   (EMBL; AB019513)  ABC transporter (584 aa), fasta scores
FT                   opt:  597 z-score: 649.7 E(): 7.7e-29 30.9% identity in 572
FT                   aa overlap. Contains a Pfam match to entry PF00005
FT                   ABC_tran, ABC transporter and a PS00017 ATP/GTP-binding
FT                   site motif A (P-loop). Contains membrane-spanning
FT                   hydrophobic domains."
FT                   /db_xref="GOA:Q9RJT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJT6"
FT                   /protein_id="CAB55736.1"
FT                   /translation="MCAQIPAVLGRIARLSWRTDRRAVQLLLGCQVLTGLAAAVLLTAT
FT                   AHAMNPVLGDGSAADRLHGALPALSVVALAAALGRGAAAVATYAERRITPRLTTETDSA
FT                   LVEAVCRVEASAYAQEGFSDRHEAAEMGVVRTQVMVTDAQRFLSALIRMVTAGGVLSAL
FT                   NPLMLPLLLLAVLPAGAGAVLTARVDYEVHYANIADRNVRGMMRWWATTSKYGDEVRAN
FT                   SMTDYLVHWYRSLSDRCDRRTLSAAPRTLRIAVLSAAAGGVFLVATWGALAWLAVSGRI
FT                   ELAVAATAVIAVQTTLAALSQVVVNGAAVFHTSLYLSDMQAFLDDAAARVPKRGPGKHR
FT                   APTERIRLEEVVYQYPGKDRPAVDGVSLTLERGQILAIVGANGSGKSTLTRLLTGIYLP
FT                   DKGRVTWNGTDLADMEPATVWAHIGLVPQIFAQWPMPVRENVTLGQPRGYDDTPVWEAV
FT                   EAVGLREAVDNLPAGLDTLLSRDVFGGTELSGGQWQRVACARALYRRPGLLILDEPTSQ
FT                   MDPRGEHQIFEQIKAIAAERITIVVTHRLENTRIADHIVVMEHGRITEQGRYDDLVHAG
FT                   GTFAELLALSQDR"
FT   misc_feature    89866..90432
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 218.80, E-value 8.2e-62"
FT   misc_feature    89887..89910
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(90531..92123)
FT                   /transl_table=11
FT                   /gene="SCO0375"
FT                   /gene_synonym="SCF62.01c"
FT                   /gene_synonym="SCF41.34c"
FT                   /product="putative integral membrane transport protein"
FT                   /note="SCF62.01c, possible integral membrane transport
FT                   protein, partial CDS, len: > 406 aa. Similar to many
FT                   members of the drug resistance translocase family e.g.
FT                   Staphylococcus aureus  SW:QACA_STAAU (EMBL; X56628)
FT                   antiseptic resistance protein (514 aa), fasta scores opt:
FT                   750 z-score: 750.4 E():0 30.0% identity in 493 aa overlap,
FT                   as well as many other Streptomyces coelicolor membrane
FT                   transport proteins e.g. TR:O54186 (EMBL; AL021411) SC7H1.27
FT                   (533 aa), fasta scores opt:  972 z-score: 970.2 E(): 0
FT                   35.0% identity in 543 aa overlap. Overlaps with and extends
FT                   into SCF41.34c. Contains multiple possible membrane
FT                   spanning hydrophobic domains and a Pfam match to entry
FT                   PF00083 sugar_tr, Sugar (and other) transporter."
FT                   /note="SCF41.34c, possible transport protein, partial CDS,
FT                   len: >157 aa. Similar to Streptomyces coelicolor putative
FT                   transport protein TR:O54186 (EMBL; AL021411)  putative
FT                   transport protein SC7H1.27 (533 aa), fasta scores  opt: 263
FT                   z-score: 281.1 E(): 2.6e-08 36.1% identity in 166 aa
FT                   overlap."
FT                   /db_xref="GOA:Q8CK59"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK59"
FT                   /protein_id="CAD55439.1"
FT                   /translation="MSTSPPVRAPEAGGGSTPDARQLRTILIAVSVALMAVVASVSGLN
FT                   VAQTHMAVEFGASQSTVLWIINIYTLALAALLLPLGAVGDRLGRRPMLVAGLGVFGAAS
FT                   VLAGLAPSAEVMLAARVAGGAGAAMIMPVTLAVITSTFPEEQRGKAIGVWTGVAGGGGI
FT                   LGMFLSALLVDVADWRLLFVLPVVLVLVALAMALKSVPDSRETAAHRFDTVGALISTVA
FT                   VTGLIFVLQEGPERGWTDPVTLTGLVAGITAAVGFVAWELRRRDAALLDVRLFRERGLA
FT                   GGSITLLVVFGVQAGIAVVLFPYFQAVLGWSGLLSTVALMPMAVMMMATSGLAPMLAAR
FT                   VGSRATMAAGIALAGVGLALMALFVSVDDGYLTILPGMLAMGTGMGLSMTPSTEAITGS
FT                   LPRGKQGVASALNDVTREFGTALGVALLGALLAGGYRAAIDGRLDGIPQGPADEARQGV
FT                   ANAVEAAGGAGPHGPDLLHAAQQSFVDGWQQAMWAGVAVMGVLFVYVALRGPGRTAPAD
FT                   ADEPEAAEALTAR"
FT   misc_feature    complement(90924..92030)
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score -87.50, E-value 0.00097"
FT   regulatory      complement(92128..92133)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      92222..92225
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        92232..92834
FT                   /transl_table=11
FT                   /gene="SCO0376"
FT                   /gene_synonym="SCF62.02"
FT                   /product="putative transcriptional regulator"
FT                   /note="SCF62.02, possible transcriptional regulator, len:
FT                   200 aa. Similar to several proteins of undefined function
FT                   from Streptomyces sp. e.g. Streptomyces coelicolor
FT                   TR:CAB51134 (EMBL; Y18817) hypothetical 20.6 KD protein
FT                   (190 aa), fasta scores opt: 352 z-score: 424.9 E(): 2.6e-16
FT                   37.0% identity in 189 aa overlap. Contains a Pfam match to
FT                   entry PF01381 HTH_3, Helix-turn-helix between residues
FT                   29..50 (+5.17 SD)."
FT                   /db_xref="GOA:Q9RJL2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJL2"
FT                   /protein_id="CAB58317.1"
FT                   /translation="MLLMTQEDGDLDSLVRKRIRALRVAQGWSLEELAGRARLSQSSLS
FT                   RIENGRRRLALDQLVTLARALDTTLDQLVETADEDVITSPMIDSAHGLMRWPVKGDPGM
FT                   TVVRQRMTQPPPENPARMRAHPGREWLVVLSGTAVLMLGHRRFRVETHQAAEFPTMMPH
FT                   AIGTAGGPCEILGIFDRDARRGHQREGGEPEARDRAE"
FT   misc_feature    92286..92450
FT                   /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix,
FT                   score 64.30, E-value 2.5e-15"
FT   CDS_pept        complement(92950..93483)
FT                   /transl_table=11
FT                   /gene="SCO0377"
FT                   /gene_synonym="SCF62.03c"
FT                   /product="putative membrane protein"
FT                   /note="SCF62.03c, possible integral membrane protein, len:
FT                   177 aa. Contains multiple possible membrane spanning
FT                   hydrophobic domains."
FT                   /db_xref="GOA:Q9RJL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJL1"
FT                   /protein_id="CAB58318.1"
FT                   /translation="MPEGAGRGSAGGVAPRGILRRRPERWLFKGIYGLVLASALVAALD
FT                   VPGEAANPGQDALWVLLTALTSGAAHGYAHVIAQRASGDGTAGPSRLRAVLAEWPLAVA
FT                   VLPTVMMLLAAEAGWWAEETAADTALVLNTVLLFALGTSAARTAGLGRLSSCRAGALDM
FT                   LIGLVIIAADALIE"
FT   CDS_pept        complement(93484..94218)
FT                   /transl_table=11
FT                   /gene="SCO0378"
FT                   /gene_synonym="SCF62.04c"
FT                   /product="putative conserved secreted protein"
FT                   /note="SCF62.04c, possible secreted protein, len: 244 aa.
FT                   Highly similar to Streptomyces coelicolor TR:CAB52958
FT                   (EMBL; AL109950) hypothetical 25.2 KD protein SCJ4.24C (242
FT                   aa), fasta scores opt: 1283 z-score: 1457.6 E(): 0 83.1%
FT                   identity in 242 aa overlap. Contains a possible N-terminal
FT                   signal sequence."
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJL0"
FT                   /protein_id="CAB58319.1"
FT                   /translation="MRMKIAVIGGTGLIGSQVVKDLNAAGHQAVPHSRSTGVDVVGGGG
FT                   VDDAVEGAEVVVNLTNSPTFDDASPAFFRASMDTLLAAARRAGTGHFVILSIVGVDRVP
FT                   ALDYYRAKVLQEEILRDGPVPYSIVRATQFMEFMEAVLSWTASDDSVRLPATPIQPIAA
FT                   KDVAAAVADVAVGAPLNGIRNIGGPEVFPLDELGRLTLAHKGDARTVVTDPGAGMFGAV
FT                   EGDVLTDLDAHLAPTRYADWLS"
FT   regulatory      complement(94227..94231)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      94487..94491
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        94498..95961
FT                   /transl_table=11
FT                   /gene="SCO0379"
FT                   /gene_synonym="katA"
FT                   /product="catalase (EC 1.11.1.6)"
FT                   /note="SCF62.05, katA, catalase (EC 1.11.1.6) len: 487 aa.
FT                   Has been previously sequenced and characterised from
FT                   Streptomyces coelicolor strain ATCC10147 TR:P77948 (EMBL;
FT                   X96981) catalase (EC 1.11.1.6) (488 aa), fasta scores opt:
FT                   3300 z-score: 3768.6 E():0  98.2% identity in 488 aa
FT                   overlap. Also similar to another proposed Streptomyces
FT                   coelicolor catalase (EC 1.11.1.6) TR:Q9Z598 (EMBL;
FT                   AL035478) SC2G5.25C (487 aa), fasta scores opt: 1704
FT                   z-score: 1896.1 E():0 53.8% identity in 483 aa overlap.
FT                   Contains Prosite hits to PS00437 Catalase proximal
FT                   heme-ligand signature and to PS00438 Catalase proximal
FT                   active site signature. Also contains a Pfam match to entry
FT                   PF00199 catalase, Catalase."
FT                   /db_xref="GOA:Q9RJK9"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJK9"
FT                   /protein_id="CAB58320.1"
FT                   /translation="MPENNQKPLTTVAGAPVPDNQNSLTSGPRGPMLLQDVWFLEKLAH
FT                   FDREVIPERRMHAKGSGAFGTFTVTHDITRYTSAKIFSEIGKKTPLFTRFSTVAGERGA
FT                   ADAERDIRGFAVKFYTDEGNWDLVGNNTPVFFFRDPLKFPDLNHAVKRDPRTNLRNAEN
FT                   NWDFWTNLPEALHQVTIVMSDRGIPASYRHMHGFGSHTYSLINAEGERFWVKFHHRTQQ
FT                   GIKNLTDAEAEALVGKDRESHQRDLFDAIEDGDFPKWKLFIQVMPEADAENYRFHPFDL
FT                   TKVWSKKDYPLIEVGEWELNRNPDNYFADVEQAAFSPANVVPGISFSPDRMLQGRLFSY
FT                   GDAQRYRLGVNHHQIPVNAPKNPVNSYHRDGAMRVDGNQGATPGVEPNSYGRWQEQPAY
FT                   RDPAQAVGAVADRFNYREDDDNYFEQPGNLFRQMSPEQQQVLFENTARAIDGASAQTIE
FT                   RHIGNCTQADPAYGAGVRKAIEALAAGNL"
FT   misc_feature    94525..95937
FT                   /note="Pfam match to entry PF00199 catalase, Catalase,
FT                   score 1129.70, E-value 0"
FT   misc_feature    94633..94683
FT                   /note="PS00438 Catalase proximal active site signature"
FT   misc_feature    95503..95529
FT                   /note="PS00437 Catalase proximal heme-ligand signature"
FT   stem_loop       95997..96039
FT                   /note="Inverted repeat 21/21 (100%) with 1 base loop."
FT   regulatory      96052..96055
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        96065..96460
FT                   /transl_table=11
FT                   /gene="SCO0380"
FT                   /gene_synonym="SCF62.06"
FT                   /product="conserved hypothetical protein SCF62.06"
FT                   /note="SCF62.06, unknown, len: 131 aa. Weakly similar to
FT                   several Prokaryotic Ank-like proteins e.g. Pseudomonas
FT                   syringae TR:P95546 (EMBL; AF001355) AnkF precursor (183
FT                   aa), fasta scores opt:  255 z-score: 318.0 E(): 2.3e-10
FT                   38.4% identity in 125 aa overlap. Contains 2x Pfam match to
FT                   entry PF00023 ank, Ank repeat."
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJK8"
FT                   /protein_id="CAB58321.1"
FT                   /translation="MDMHDSGGLTPEQTERVVAIAMDLAREGGTEQLVEFVQHGLPVDV
FT                   RDPAGNSLLMLAAYHGHADTVRTLIRHGADPDLRNDRDQSPIAGALFKGADDVVAVLRQ
FT                   AGADLDSGTPTARAAAAMFGREHLLAT"
FT   misc_feature    96209..96307
FT                   /note="Pfam match to entry PF00023 ank, Ank repeat, score
FT                   38.10, E-value 2e-07"
FT   misc_feature    96308..96406
FT                   /note="Pfam match to entry PF00023 ank, Ank repeat, score
FT                   6.10, E-value 13"
FT   CDS_pept        96939..98414
FT                   /transl_table=11
FT                   /gene="SCO0381"
FT                   /gene_synonym="SCF62.07"
FT                   /product="putative glycosyl transferase"
FT                   /note="SCF62.07, possible glycosyl transferase, len: 491
FT                   aa. Similar to many other glycosyl transferases e.g.
FT                   Erwinia amylovora SW: AMSG_ERWAM (EMBL; X77921)
FT                   UDP-galactose-lipid carrier transferase (EC 2.-.-.-) (477
FT                   aa), fasta scores opt: 599 z-score: 695.6 E(): 2.2e-31
FT                   33.0% identity in 403 aa overlap. Contains multiple
FT                   possible membrane spanning hydrophobic domains"
FT                   /db_xref="GOA:Q9RJK7"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJK7"
FT                   /protein_id="CAB58322.1"
FT                   /translation="MRQGGLVSAFPSARGQLADGATSRLTSDWEQRYRRTVITSDTVTT
FT                   AVVVAGIGNFFGVRDAANWHEKWGILAFGTWLLVLGALAVSRSWSPAVLGQGAEEFRRL
FT                   GRSLFMATVVLALGGIALTSRNIKLWIFVAVPAIAIFIMVARYALRVRLHRQRKQGRCL
FT                   RPVLAAGSPATVRDLIARTRRFPHLGWRVDAVCTTDDGLEGGQLDGVPVVGPLEHVAHH
FT                   VRRDGYRVVAVTPDPHWSPHRLQRLAWNLEGSDAEMVVAPVLMEVAGPRLHVDAVLGIP
FT                   LLRVSMPTFTGGRRAVKAVVDRLGAAVLLTLFAPLMLFVALLVLVDSRGGAFYRQRRVG
FT                   KDGREFTILKFRTMVAGADGARAALADRNEGAGLLFKLRRDPRVTRVGAVLRRYSVDEL
FT                   PQLLNVLAGSMSLVGPRPPLPEESAAYGPDIRRRLLVKPGLTGLWQISGRSDLPWEEAV
FT                   RLDLRYVEDWSLALDTVILWKTLRAVVHGQGAY"
FT   regulatory      98472..98476
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    98485..99747
FT                   /note="Pfam match to entry PF00984 UDPG_MGDP_dh,
FT                   UDP-glucose/GDP-mannose dehydrogenase family, score 401.50,
FT                   E-value 8.1e-117"
FT   CDS_pept        98485..99810
FT                   /transl_table=11
FT                   /gene="SCO0382"
FT                   /gene_synonym="SCF62.08"
FT                   /product="UDP-glucose/GDP-mannose family dehydrogenase
FT                   (putative secreted protein)"
FT                   /note="SCF62.08, probable UDP-glucose/GDP-mannose family
FT                   dehydrogenase (putative secreted protein), len: 441 aa.
FT                   Highly similar to many e.g. Pseudomonas syringae (pv.
FT                   phaseolicola) SW: ALGD_PSESH (EMBL; AF001555) GDP-mannose
FT                   6-dehydrogenase (EC 1.1.1.132) (438 aa), fasta scores opt:
FT                   1453 z-score: 1666.9 E(): 0 49.2% identity in 445 aa
FT                   overlap. Contains a Pfam match to entry PF00984
FT                   UDPG_MGDP_dh, UDP-glucose/GDP-mannose dehydrogenase
FT                   family."
FT                   /db_xref="GOA:Q9RJK6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028358"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJK6"
FT                   /protein_id="CAB58323.1"
FT                   /translation="MRVSVFGLGYVGCVSAACLAGMGHQVVGVDVNQAKVDLVNDGKAP
FT                   VVEERIGELIAEVVGSGALRATGDVREAIMESEISLVCVGTPSEPNGSLCTTYLERVTE
FT                   EIGTALAERGGGGGRHTVVFRSTMLPGTCANLLVPILEKYVGGTAGVDFGVAVNPEFLR
FT                   EGTSVRDFFDPPKTVIGELDAAGGDAVLALYDSLPGEVFRVPVATAEAIKYADNAFHGL
FT                   KIGFANELGAVCHALGVDSHQVMDVFLADRKLNISPAYLRPGFAFGGSCLPKDLRSLVH
FT                   AAQRADVSVPILSHVLPSNSAHLERAVELVERTGKRRVGMFGLSFKPGTDDLRESPLVE
FT                   LAERLFGKGYDLRIHDANVSLSRLLGANREYVETRLPHLAQLLADSVDEVLDHAEVCLV
FT                   GTRDPAVLSALPHGAGPLLIDLIHLPDADTRRTEPGYMGLAW"
FT   CDS_pept        99881..101104
FT                   /transl_table=11
FT                   /gene="SCO0383"
FT                   /gene_synonym="SCF62.09"
FT                   /product="hypothetical protein SCF62.09"
FT                   /note="SCF62.09, unknown, len: 407 aa. Weakly similar to a
FT                   number of glycosyl transferases e.g. Streptomyces
FT                   coelicolor TR:CAB39859 (EMBL; AL049497) putative glycosyl
FT                   transferase SC6G10.05C (412 aa), fasta scores  opt:  236
FT                   z-score: 280.6 E(): 2.8e-08  26.4% identity in 386 aa
FT                   overlap and Escherichia coli TR:Q47594 (EMBL; D43637)
FT                   mannosyltransferase B (381 aa), fasta scores opt:  187
FT                   z-score: 223.4 E(): 4.3e-05 23.3% identity in 288 aa
FT                   overlap. Contains a TTA leucine codon, possible target for
FT                   bldA regulation."
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJK5"
FT                   /protein_id="CAB58324.1"
FT                   /translation="MENLSVPFDRRVWQEATTLRDAGWDVHVICPRGSKRDTEPEAVVD
FT                   RVHIHRYPLRAATGGPAGYLREYGAALWHTARLARRVGPVDVVHACNPPDLLFLPALWL
FT                   KRRGARFVFDQHDLIPELYLSRFGRGKDLLYRAVCALERWTYRAADVVLATNESYKDVA
FT                   IRRGGRRPDDVFVVRSAPATDRFQPVPPEPELKRGKPHLLCYLGVMGPQDGVDYALRAL
FT                   AKLRDEVGRTDWHAVFVGSGDAFDAMVELSRSLGLDEQVRFTGRIPDADLVRHLSTADV
FT                   CLSPDPRNPLNDVSTMNKVLEYMAMGRPIVSFDLREARVSAGEAALYAPANDEAAFARL
FT                   VARLLDDPDERARMGKIGQERVTGRLSWRNSQAALLAAYAAACRDHTPVSAGAPVRTGF
FT                   KAGKRPRS"
FT   misc_feature    100910..100912
FT                   /note="TTA/leucine codon, possible target for bldA
FT                   regulation"
FT   CDS_pept        101179..102468
FT                   /transl_table=11
FT                   /gene="SCO0384"
FT                   /gene_synonym="SCF62.10"
FT                   /product="putative membrane protein"
FT                   /note="SCF62.10, possible membrane protein, len: 429 aa.
FT                   Contains a possible membrane spanning hydrophobic domain
FT                   and a probable coiled-coil from 146 to 176 (31 residues)."
FT                   /db_xref="GOA:Q9RJK4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJK4"
FT                   /protein_id="CAB58325.1"
FT                   /translation="MVGALAGYGVSVLFPPRYTASASVLLPGQWEQRELVTQVEIATSS
FT                   AVVDRAADELRWNGVGRSELRDRVSAETADGNIVKISGTAATPERAQRLSDEVAQQFVT
FT                   YAARIASGTTGADEAAGPEALREQVTRTNRRITDLANAADPGQTVESVQARTELEKLRS
FT                   ALQDAMQKLEEADPANNRAGMVVMGPAARPAGEAPPTRLQLIGGGALLFFVLAVIAHLT
FT                   AARVNRRPRSESEIAAALGTALLGTVDVPGDRRAHRPKARGAQARFRRLLGVDVRWDLP
FT                   TPRSSGDEAGRRLRYRRVRARLRERVPTARRLLVVVPDDDEVARRAAGRLAADAEDDPR
FT                   LRVVEVSVARPIVPDRDTESGALVVLSAGARTAEELAGVAEACADGGHEVVGVVVAGAV
FT                   RARPTASADEPRGDAAAGAAVHDHATGGVA"
FT   regulatory      102453..102460
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        102465..104030
FT                   /transl_table=11
FT                   /gene="SCO0385"
FT                   /gene_synonym="SCF62.11"
FT                   /product="putative membrane protein"
FT                   /note="SCF62.11, possible membrane protein, len: 521 aa.
FT                   Contains possible membrane spanning hydrophobic domains and
FT                   two possible coiled-coils from  144 to 182 (39 residues)
FT                   and  from 190 to 221 (32 residues)."
FT                   /db_xref="GOA:Q9RJK3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJK3"
FT                   /protein_id="CAB58326.1"
FT                   /translation="MTTTDTASQPSASAPLLDLQALVVAVRRRRRLWGSLALLGLLLGA
FT                   AVAVLLPPRPTAVTKVLVAHKDDQPNDTGTLIRTDVELLDTTRIAAAALRTLGSRENPE
FT                   DFMRDYRGTGLTNNLLRIDVTADSDAEAVARAKALADTFVADHVRRMREAAEAESKSLL
FT                   DQRDRMRKELAEVNSAIGDRSPDDEPKASASIESLFARRAELDSRIAEFDQRAAEALTG
FT                   TPEVVAGTQIVDAPHAVEHSLPRAVGTDAAIGLALGLVLGLALSAVGAVVADRPVLRRE
FT                   IAANLGASVLAELRRRPRRSARSWRRRRTRAARERLTTTLTRLVRGSAEPVSMLELGCA
FT                   RGTGLIALDVAGALEADGPVVVVDGLPGTRLAGAHRGPGGPTVLSGERATAEGHQGRRL
FT                   GVGSVAPGTAWTDLRYLGSRTVLVVRAGHGSTAWLHTVARQLADQRIAVIGVVLIDPDP
FT                   RDRTDGTLWDGPHLARRVPGERPKRHNGGGTPHAVQAVGEGRLRAERPSMPAATVPDSD
FT                   QEAR"
FT   regulatory      104017..104022
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        104034..105968
FT                   /transl_table=11
FT                   /gene="SCO0386"
FT                   /gene_synonym="SCF62.12"
FT                   /product="putative asparagine synthetase"
FT                   /note="SCF62.12, putative asparagine synthetase, len: 644
FT                   aa. Highly similar to many e.g. Mycobacterium tuberculosis
FT                   SW:ASNH_MYCTU (EMBL; Z70283) putative asparagine synthetase
FT                   (glutamine-hydrolysing) (EC 6.3.5.4) (652 aa), fasta scores
FT                   opt:  752 z-score: 874.8 E():0 32.8% identity in 655 aa
FT                   overlap. Contains a Pfam match to entry PF00310 GATase_2,
FT                   Glutamine amidotransferases class-II."
FT                   /db_xref="GOA:Q9RJK2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJK2"
FT                   /protein_id="CAB58327.1"
FT                   /translation="MCGIAGTYHWPDGKAVTDRLTDVLAHRGPDGAGRYSHPAGEGEVH
FT                   LGHRRLAVVDLSTTGAQPMVSEGLALSYNGELYNAPELRTELESAGVRFRGTSDTEVVL
FT                   EAWRRWGTDCLPQLRGMFAFAVFDERTGELVLARDQLGIKPLFLLRRGAGLVFASELKA
FT                   LATATGGKLEVDHAALVASLLYYWVPDSRCALREAEKLPPGSWLRCRPDGRVERGRFWN
FT                   LRDVAAEGRERARSGERPDLAAVVEESTRRHLLSDVPVATFLSGGLDSSYLTALAARDR
FT                   PGISAYTIGFRAEDARFEAMPDDLRYARQVAERFGVDLHEIEIAPNVLDLLPRMTYHLD
FT                   EPIGDPAAINTFLICSAAREAGVKVMLSGMGADELFAGYRKHLANVLALRYQRVPRPLR
FT                   RGVSAAVGRLPVASSRRGYRSVRFAKRFLSFADLPQETAFRRSYTMYDRQELLDLIDPD
FT                   LAGTVEDVLTEHADVYEDNDLDDFVNRMCLADARMFLPGLNLAYTDRSSMAASTEVRVP
FT                   YVDVEVVKAAFAVPGDRKIVGRQGKAVLKEAATSVLPREIVYRPKGLFSAPLRAWMSRD
FT                   LAPLVREVVNDGELVRSGFLRRDALRRLVAEDAAGQRDFSKHLWHVLTLEYWYRGATSG
FT                   SGDHSSSTA"
FT   misc_feature    104037..104480
FT                   /note="Pfam match to entry PF00310 GATase_2, Glutamine
FT                   amidotransferases class-II, score 87.90, E-value 2.4e-29"
FT   regulatory      106048..106051
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        106070..108250
FT                   /transl_table=11
FT                   /gene="SCO0387"
FT                   /gene_synonym="SCF62.13"
FT                   /product="putative bi-domain oxidoreductase"
FT                   /note="SCF62.13. possible bi-domain oxidoreductase, len:
FT                   726 aa. The N-terminus is similar to many Zinc-binding
FT                   dehydrogenases e.g. Sinorhizobium meliloti TR:O31186 (EMBL;
FT                   AF031940) alcohol dehydrogenase (340 aa), fasta scores pt:
FT                   224 z-score: 241.8 E(): 4.1e-06 25.5% identity in 333 aa
FT                   overlap. The C-terminus is similar to other oxidoreductases
FT                   e.g. Zymomonas mobilis SW:GFO_ZYMMO (EMBL; M97379)
FT                   glucose-fructose oxidoreductase precursor (EC 1.1.99.28)
FT                   (439 aa), fasta scores  opt:  243 z-score: 260.3 E():
FT                   3.8e-07 26.1% identity in 272 aa overlap. Note this CDS is
FT                   also weakly similar to the C-terminus of the Eukaryotic:
FT                   Cochliobolus heterostrophus TR:Q92217 (EMBL; U68040)
FT                   polyketide synthase (2530 aa), fasta scores opt: 164
FT                   z-score:0.0 E(): 0.0  25.52% identity in 576 aa overlap.
FT                   Contains a Pfam match to entry PF00107 adh_zinc,
FT                   Zinc-binding dehydrogenases and a Pfam match to entry
FT                   PF01408 GFO_IDH_MocA, Oxidoreductase family. Also contains
FT                   possible membrane spanning hydrophobic domains"
FT                   /db_xref="GOA:Q9RJK1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJK1"
FT                   /protein_id="CAB58328.1"
FT                   /translation="MQNYKSGELALLDVPVPGCKPGGVLVRTAYSLISTGTELMKVSEA
FT                   GMSMLGKARSRPDQVAKVVQSVATNGVPATYRKVMGKLDSYTPLGYSLCGVVEQVGEGI
FT                   DDVKAGDLVACAGNEHALHAELNWVPRNLYAPVPDGLAARDAAFGTVGSIALQGVRQGE
FT                   SRLGETALVIGLGLIGQLVVQLLVASGVRVVGADPDAERCELAERLGAAACGDPASPAV
FT                   ESAVVELTDGHGVDQVYLAAGGGSNQPVELAARLCRDRGRVVDIGKCRLDLPWNAYYEK
FT                   ELDVRFSRSYGPGRYDPEYELEGRDYPIGYVRWTERRNLACFLDLVARGRVDVAPLITR
FT                   TADFDDAVETYRSLQDGALKAVAVLFRYPGQPDAEAPAGAPAVTVPGVRRGAGAAAPAR
FT                   AARTPVRLAFVGAGNYATSMLLPHLARREGVELSTVVTTTALSAANAQRKFGFGEATTD
FT                   LDAVLGDASVDAVFVVTRHSSHAELTRKALLAGKAVFVEKPLALTGEELTGVLAAVEES
FT                   GNDRVQVGFNRRFAPLLQEARKRFGARTGPASLRYLVNAGRLDHGSWYLQQGTEGSRFA
FT                   GEGGHFVDTASWLLGADPVSVYALAPSSNEDLQVVLGYPDGSTATLSYVTTGAAGFPKE
FT                   TLDLVADGKVLQLDDFVRSSVYDGRKRWVSSRLPKARDKGQSAELAAFVRAVRTGGPMP
FT                   VPLESLVATTAATLAVRTALAAGAPVGLAEAR"
FT   misc_feature    106076..107167
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenases, score -34.50, E-value 6.5e-08"
FT   misc_feature    107282..107995
FT                   /note="Pfam match to entry PF01408 GFO_IDH_MocA,
FT                   Oxidoreductase family, score 121.00, E-value 2.2e-32"
FT   regulatory      108238..108242
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        108253..110214
FT                   /transl_table=11
FT                   /gene="SCO0388"
FT                   /gene_synonym="SCF62.14"
FT                   /product="hypothetical protein SCF62.14"
FT                   /note="SCF62.14, unknown, len: 653 aa. Weakly similar to
FT                   Cytophaga heparina TR: Q59289 (EMBL; U27586) heparinase III
FT                   protein precursor (EC 4.2.2.8) (659 aa), fasta scores opt:
FT                   202 z-score: 229.2 E(): 2.1e-05 22.8% identity in 421 aa
FT                   overlap."
FT                   /db_xref="GOA:Q9RJK0"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJK0"
FT                   /protein_id="CAB58329.1"
FT                   /translation="MTPGSAGWYLRRLSRMGPREVAGRVGDTVRRRRWRSVRPDAPGVS
FT                   GARFTAVLPAGTIAAVPPDAAKRLVAEADRLLAGHVEYFGVRRDDLVEPDWCFDPKTGR
FT                   RAPWGYAFDVPYRDEDAVGDIKQIWEPSRHQYLTVLAAAYAVTGDERYAERVAEHLRSW
FT                   WAANAPLRGVHWVSGIELGIRLLSWVWIRRLLDGWPGAAALFEDNPAALEQIWHHQRWL
FT                   AAFPSRGSSANNHVVAEAAGQLAAACAFGWFPESARWRDDALRSLERHLRGNTFLSGLN
FT                   RELATEYHGLVLELGLAAVAEADAAGVPVPATVRLVLLRMTDALAAVVDDRLRPPRQGD
FT                   ADDGHGLVVDGAGTDRWGSLLATGDAVFGSLPWWPTVTGTDVRTPLLAALVRPYGGDGA
FT                   GRAVTRPARRPAHFADAGLTVLRGPGGIWCRCDGGPHGFLSIAAHAHADALSVEVRHDG
FT                   VDVLADPGTYCYHGQPVWRGYFRSTLGHNTLELDGADQSVSGGPFLWTRHARTRVLAVD
FT                   TSDEKVSRWCAEHDGYGDSVHRRRVELTAASRELRVVDEVRGPRRSVRLAFHLGPAVAA
FT                   DLAGSRAALTWTRDGEERSAVLDLPGALSWRAHRGETDPPLGWYSPGFGRKEPATTLVG
FT                   TGVTDGAQEFTTVLGFRG"
FT   regulatory      110221..110227
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        110237..111772
FT                   /transl_table=11
FT                   /gene="SCO0389"
FT                   /gene_synonym="SCF62.15"
FT                   /product="putative lipoprotein"
FT                   /note="SCF62.15, possible lipoprotein, len: 511 aa.
FT                   Contains a possible N-terminal signal sequence and an
FT                   appropriately positioned Prosite hit to PS00013 Prokaryotic
FT                   membrane lipoprotein lipid attachment site."
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJJ9"
FT                   /protein_id="CAB58330.1"
FT                   /translation="MGSRRRGGTWSAAASLALALLAAGCTGTPDAKAPEPTAPSSPSGA
FT                   RKVARVCEKPAAGPAKAPAGAVTVDPAVVGDLADKTRNSPANTTFWLRPGKHRLASDRY
FT                   SQVVPKEGNRYLGAPGAVLDGRKTNQYAFGGTARDVTIGHLTVQGFVAPHDEGVVNHDS
FT                   ADGWVIEHATIRRNSGAGLMAGDRQQVRASCLRDNGQYGINAYKGDGVINDLVLEGNEI
FT                   TGNNTGDWERRRPGCGCTGGVKFWAVQGADVRGNWVHHNRGTGLWADTNNNDFLIEDNV
FT                   LEGNDGAALIYETSYNAVVRENTIRRNNWVEGRENTDGGDDFPYATVYISESGGEPRVE
FT                   ARTDKIEIYRNVLEDNWSGITLWENADRFCNSPANTSSGDCTLLVEDVDRCARPAIASA
FT                   PLYADCRWKTQRVDVHDNRFTLDKSVVECTDGCDRMALLANYGTYPDWSPYRGERVAEA
FT                   VTLRQHNRWHDNVYVGPWKFVAHDPSRVLDFGQWRGAPYRQDADSTLRPGGGD"
FT   misc_feature    110279..110311
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        111774..113006
FT                   /transl_table=11
FT                   /gene="SCO0390"
FT                   /gene_synonym="SCF62.16"
FT                   /product="putative membrane protein"
FT                   /note="SCF62.16, possible membrane protein, len: 410 aa.
FT                   Contains a possible N-terminal signal sequence and multiple
FT                   possible membrane spanning hydrophobic domains."
FT                   /db_xref="GOA:Q9RJJ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJJ8"
FT                   /protein_id="CAB58331.1"
FT                   /translation="METGRTPKLVGTVWGLLILNTLGSTGAETVVPLPRSLIQMVTMGA
FT                   LAVAFSLALALNLRLRVRASAFLFLLTLLLVPSVISSADLESGFGALFRCARLGLFVGT
FT                   LWLLSRWWDGSPTFVRHHIRMYFAVLCTVAAGALVSPGAAMPDLYGGRLVGALWPLTPP
FT                   QIGQYAAVIIGLALLLVLSRQTDRRSAALVIVPSLLLLVLTHTRTATLGLLVGLTLAIG
FT                   SLALTSAAARRFFSWAVLCAAVAAVAFASALHAWFLRGQSEENFSNLTGRAKVWDALLA
FT                   APRTVGEKVFGIGLGDKSFDGLPIDNSWLAVYHEQGLIGIALVATVFVVLGGVALLRPP
FT                   SPARACAIFLISYCALASYTEAGLGDASPYLLHLAVAASLLASPAAATPRVTPEPPRRR
FT                   VPRWARTPEVT"
FT   regulatory      112994..113001
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        113009..114250
FT                   /transl_table=11
FT                   /gene="SCO0391"
FT                   /gene_synonym="SCF62.17"
FT                   /product="putative transferase"
FT                   /note="SCF62.17, possible transferase, len: 413 aa. Similar
FT                   to many including Streptomyces coelicolor TR:Q9Z5B7
FT                   (EMBL:AL035478) putative transferase SC2G5.06 (406 aa),
FT                   fasta scores opt: 263 z-score: 301.1 E(): 2.1e-09 31.9%
FT                   identity in 385 aa overlap and Erwinia amylovora
FT                   SW:AMSK_ERWAM (EMBL:X77921) amylovoran biosynthesis protein
FT                   AmsK (407 aa), fasta scores opt: 224 z-score: 257.0 E():
FT                   5.8e-07 28.4% identity in 232 aa overlap. Contains a Pfam
FT                   match to entry PF00534 Glycos_transf_1, Glycosyl
FT                   transferases group 1"
FT                   /db_xref="GOA:Q9RJJ7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJJ7"
FT                   /protein_id="CAB58332.1"
FT                   /translation="MHVLVVHNRYNSAQPSGENNVVDQEVALLRAAGHRVGLFERRSDD
FT                   IASRSLLGKVAVPLLVPWNPAVRRELADRLRTERPDVVHVHNVFPLLSPAVLAACADAG
FT                   VPAVATLHNYTQVCPPGTLQRDGRPCTECVGAAPLPAVRHGCYRNSRLATVPLAVGLSV
FT                   NRRRWWSGVERFFCISAAQREVLVGAGLPAERLAVKHNFVPDPEARRAGPGEHLLYLGR
FT                   LAEAKGVRLLMEAWDELAADGGVGVPLVVAGTGPLEREVTAWAAGRDDVRYVGLYDPEQ
FT                   CRRALARSVAVVAPSTWLEAFGLVVVEAMAAGVPAVAAGHGAFAELVDDGVTGLLHRPG
FT                   EAASLASRIRRIAAEPEGNQEMGRAARRRYEQGFSPAVGLERLLEGYRTAIAGRSALAR
FT                   DGDVRAGRGDGGSR"
FT   misc_feature    113657..114115
FT                   /note="Pfam match to entry PF00534 Glycos_transf_1,
FT                   Glycosyl transferases group 1, score 71.40, E-value
FT                   2.6e-19"
FT   CDS_pept        114247..115497
FT                   /transl_table=11
FT                   /gene="SCO0392"
FT                   /gene_synonym="SCF62.18"
FT                   /product="putative methyltransferase"
FT                   /note="SCF62.18, possible methyltransferase, len: 416 aa.
FT                   Similar to several including: Streptomyces peucetius
FT                   TR:O68501 (EMBL; AF048833) daunorubicin/doxorubicin
FT                   biosynthesis enzyme DnrX (403 aa), fasta scores opt: 801
FT                   z-score: 923.6 E(): 0; 36.7% identity in 403 aa overlap and
FT                   Streptomyces fradiae TR:AAD41823 (EMBL:AF147704) NDP-hexose
FT                   3-C-methyltransferase TYLCIII (418 aa), fasta scores opt:
FT                   688 z-score: 793.6 E(): 0; 34.1% identity in 425 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9RJJ6"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJJ6"
FT                   /protein_id="CAB58333.1"
FT                   /translation="MTRCRLCGSAAMESVVDLGATPPCESFLAADQLDRPEPAYPLHLR
FT                   VCTDCWLAQIPALITPEETFTQYAYFSSYSSSWVEHARTFVTGAVERLGLGPGSFVVEV
FT                   ASNDGYLLRHMVDRGIRCLGVEPSVNVGAAAREAGVPTLTEFLSPDTGAAVSAEHGPAD
FT                   LVVANNVYAHIPDVVGFTQGLRALVADDGWVSIEVQHLLTLIEENQYDTIYHEHFQYYT
FT                   VASAIRALASGGLALVDVELLPTHGGSIRLWARPAEVAGEPSRRVSDVLDREKAAGLRE
FT                   LSGYTEFSSRVAKVRRDLLRFLIDAAERGDTVVGYGAPGKGNTLLNHCGVRPDLLAYTV
FT                   DRNPYKHGRFTPGTRIPILSPERIAADRPDYVLVLPWNLREELVEQLSFVHEWGGRLVF
FT                   PIPELSVVEAASEKGTA"
FT   CDS_pept        115494..116303
FT                   /transl_table=11
FT                   /gene="SCO0393"
FT                   /gene_synonym="SCF62.19"
FT                   /product="putative transferase"
FT                   /note="SCF62.19, possible transferase, len: 269 aa. Similar
FT                   to many transferases e.g. Streptomyces glaucescens
FT                   TR:Q54266 (EMBL:X82177) alpha-D-glucose-1-phosphate
FT                   cytidylyl-transferase StrQ (fragment) (299 aa), fasta
FT                   scores opt: 554 z-score: 687.3 E(): 6.3e-31 35.0% identity
FT                   in 280 aa overlap."
FT                   /db_xref="GOA:Q9RJJ5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJJ5"
FT                   /protein_id="CAB58334.1"
FT                   /translation="MKVVLFCGGYGMRMREGALDDVPKPMAMVGPRPLIWHVMRYYAHF
FT                   GHKEFILCLGYGAHHIKDFFLNYEETTSNDFVLRGGRTELLSADIADWTITFAQTGIES
FT                   PIGERLRRVRHHLDGDEMFLANYADVLTDAPLPEMIDSFARRDAGASMMVVPPQSSFHC
FT                   VDLGEDGLVGGITAVSDLPLWENGGYFVLRQEVFDHIPENGDLVADGCTQLAKRGRLVA
FT                   HQHRGFWKPTDTVKERAALDAAYARGERPWAVWERDGAMSGAGVRTA"
FT   regulatory      116291..116294
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        116300..116947
FT                   /transl_table=11
FT                   /gene="SCO0394"
FT                   /gene_synonym="SCF62.20"
FT                   /product="hypothetical protein SCF62.20"
FT                   /note="SCF62.20, unknown, len: 215 aa"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJJ4"
FT                   /protein_id="CAB58335.1"
FT                   /translation="MIRLGAGSPERIVAVGAHCDDIAIGAGGTLLTVCLARPGVRVDAL
FT                   VLSGGGGEREREERAALAAFCPGADLRLTVLKLPDGRMPAHWEEAKAAVEELRERTEPE
FT                   LVLSPRTDDAHQDHRGLAKLMTTAFRDHLVLRYEIVKWDGDLGRPTAYQPLSEDVAEEK
FT                   VRLLQEHYPSQRHRPWYDREAFLGLARIRGIECHARYAEAFDVAKLTLNLGG"
FT   CDS_pept        116951..117976
FT                   /transl_table=11
FT                   /gene="SCO0395"
FT                   /gene_synonym="SCF62.21"
FT                   /product="putative epimerase/dehydratase"
FT                   /note="SCF62.21, possible epimerase/dehydratase, len: 314
FT                   aa. Highly similar to Streptomyces glaucescens TR:Q54262
FT                   (EMBL:X78974) putative protein involved in biosynthesis of
FT                   5'-hydroxystreptomycin StrP (358 aa), fasta scores opt:
FT                   1446 z-score: 1656.6 E(): 0 68.4% identity in 342 aa
FT                   overlap. Also similar to Streptomyces griseus SW:STRE_STRGR
FT                   (EMBL:X62567) DTDP-glucose 4,6-dehydratase (EC 4.2.1.46)
FT                   (328 aa), fasta scores opt: 260 z-score: 303.2 E(): 1.6e-09
FT                   28.4% identity in 317 aa overlap. Contains a Pfam match to
FT                   entry PF01370 Epimerase, NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="GOA:Q9RJJ3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJJ3"
FT                   /protein_id="CAB58336.1"
FT                   /translation="MRVLLTGHQGYLGTVMAPVLTAAGHEVVGLDSGLFADCVLGPAPD
FT                   DPPGQRVDLRDLTAEHVAGVDAVIHLAALSNDPLGSLAPELTYDINHHASVRLARLARD
FT                   AGVQRFLYASTCSVYGAAGGGDLVTEDAPLRPVTPYAESKVRVEDDLHALSDGDFSPVY
FT                   MRNATAFGFSPRLRADIVLNNLVGHALLSGEVLVLSDGTPWRPLVHAADIARAFAAALV
FT                   APREAVHDRAFNIGSEVNNVTVAEIAEEVAAAVSGSKVVITGETGADPRSYRVDFSRFR
FT                   AAIPGFDCEWTVKQGALELAEAYRKHGLTREDFEQRFTRLAVLRAAAGTGSVDDTLRWR
FT                   R"
FT   misc_feature    116957..117874
FT                   /note="Pfam match to entry PF01370 Epimerase, NAD dependent
FT                   epimerase/dehydratase family, score 2.10, E-value 2.2e-12"
FT   CDS_pept        117973..119247
FT                   /transl_table=11
FT                   /gene="SCO0396"
FT                   /gene_synonym="SCF62.22"
FT                   /product="hypothetical protein SCF62.22"
FT                   /note="SCF62.22, unknown, len: 424 aa"
FT                   /db_xref="GOA:Q9RJJ2"
FT                   /db_xref="InterPro:IPR012353"
FT                   /db_xref="InterPro:IPR032589"
FT                   /db_xref="InterPro:IPR032610"
FT                   /db_xref="InterPro:IPR032622"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJJ2"
FT                   /protein_id="CAB58337.1"
FT                   /translation="MTQAGGEMYALVERLYPLCRSITGDGVRATLDIVDEYIPLHMHEV
FT                   PTGTQVLDWTVPQEWNIRDAYVADATGRRVVDFAASSLHVLGYSVPVSATMPLAELRPH
FT                   LHTLPDHPAWVPYRTSYYRPQWGFCLAQETLDALPEGDYEVRIDSTLADGHLTYAEHVV
FT                   QGQVSDEVIVSCHVCHPSLANDNLAGIAVATFLARELAERNPYYTYRFVFAPGTIGAIT
FT                   WLARNRERVERVKHGLVLACAGDPGQVTYKQSRRGDAEIDRVLRHVLTDSERPHRVVEF
FT                   TPYGYDERQYCSPGFDLGVGSLTRTPYAGYPEYHTSADNLDFVSPAAMADTLAVCREAF
FT                   SVLDRNRRYVNLSPYGEPQLGRRGLYDSLGGRSDAKQAQMAMLWVLSLSDGEHSLLDVA
FT                   EQSGLPFETVVEAADALHGAGLVKA"
FT   CDS_pept        119253..120542
FT                   /transl_table=11
FT                   /gene="SCO0397"
FT                   /gene_synonym="SCF62.23"
FT                   /product="putative integral membrane protein"
FT                   /note="SCF62.23, possible integral membrane protein,
FT                   len:429 aa. Weakly similar to several proteins of undefined
FT                   function e.g. Synechocystis sp. (strain PCC 6803) TR:P72591
FT                   (EMBL; D90899) iron(III) dicitrate transport system
FT                   permease protein FecD (349 aa), fasta scores opt: 154
FT                   z-score: 170.4 E(): 0.039 25.4% identity in 334 aa overlap.
FT                   Contains multiple possible membrane spanning hydrophobic
FT                   domains."
FT                   /db_xref="GOA:Q9RJJ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJJ1"
FT                   /protein_id="CAB58338.1"
FT                   /translation="MTVEGEKTTTPAEPARRGVVGRLSWGLADQAASSLSNFVVGIYVA
FT                   RSLGLTAFGVFSLAWVTYGVVLNVSRGLATDPLVVRFSGVPESSWRGAVARASGAALLV
FT                   GAGIGTVSLVAGLAIGGQVGAAFAALGVVLPGLLLQDAWRYSFFAAGVGRKAFVNDVVW
FT                   AVALVPAMVVAARAGSVPAFLLAWGGSAAVAGVYGWFQSGIRPRPAGAREWHRDHRDLG
FT                   YRYLVENVGVSGAGQIRAYGLGAIVGVGAVGVIRGAELLLGPFLAVLMGLSLVTVAEAA
FT                   RVLRQAPRRLGKFCFLLGAGQTVAALLWGAALLLVPDRLGELVLGDVWSGASELIVPVT
FT                   LSVAGAGLGTGAAAGLRALAAARRSLRCQLFASACYVAGGLGGAVAGGTVGSAWGAAAA
FT                   SVCGSVVWWLQLRAALRERDHHSIPEVRTT"
FT   regulatory      120531..120534
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        120539..121486
FT                   /transl_table=11
FT                   /gene="SCO0398"
FT                   /gene_synonym="SCF62.24"
FT                   /product="putative glycosyl transferase"
FT                   /note="SCF62.24, possible glycosyl transferase, len: 315
FT                   aa. Similar to several e.g. Rickettsia prowazekii TR:Q9ZD96
FT                   (EMBL:AJ235271) glycosyl transferase (280 aa), fasta scores
FT                   opt: 272 z-score: 326.2 E(): 8.1e-11 29.9% identity in 214
FT                   aa overlap and Neisseria gonorrhoeae TR:Q50949
FT                   (EMBL:U14554) glycosyl transferase (337 aa), fasta scores
FT                   opt: 234 z-score: 280.4 E(): 2.9e-08 27.8% identity in 248
FT                   aa overlap. Contains a Pfam match to entry PF00535
FT                   Glycos_transf_2, Glycosyl transferases"
FT                   /db_xref="GOA:Q9RJJ0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJJ0"
FT                   /protein_id="CAB58339.1"
FT                   /translation="MTPHPRLSIGLPVYNGEEYLAESLDALLGQTYENFELVISDNAST
FT                   DGTRDICRRYAAQDSRIRYIRLPRNIGAAPNHNYVFTECRGELFKWASHDDLYARDLLR
FT                   SCVAALDERPEVVLAHAGQAVIDGDGKVKVPYEYGLATDSPRAPERFRSLLFEPGGDDF
FT                   YGVMRSAMLRRVKPHDSYHHADRTFVAEITLHGPFHQVPELLYFRRDHPTRAERANPSK
FT                   RSRCVNLDPRRAGPLHPTPRLLAEYVWGFASAIGRAPLSSADRRACHRHLAAWLTSRVR
FT                   PGVGERVEDRAPVDPDRLTVSVDDLVAGREGRQA"
FT   misc_feature    120560..121084
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferases, score 57.20, E-value 3.5e-13"
FT   CDS_pept        121492..122715
FT                   /transl_table=11
FT                   /gene="SCO0399"
FT                   /gene_synonym="SCF62.25"
FT                   /product="putative membrane protein"
FT                   /note="SCF62.25, possible membrane protein, len: 407 aa.
FT                   Weakly similar to a several e.g. Erwinia amylovora SW:
FT                   AMSJ_ERWAM (EMBL; X77921) amylovoran biosynthesis protein
FT                   AmsJ (415 aa), fasta scores opt: 107 z-score: 129.1 E():
FT                   7.8 21.3% identity in 423 aa overlap and Escherichia coli
FT                   SW:WCAK_ECOLI (EMBL; U38473) colanic acid biosynthesis
FT                   protein WcaK (426 aa), fasta scores  opt:  111 z-score:
FT                   133.6 E():4.3 20.1% identity in 398 aa overlap. Contains a
FT                   possible N-terminal signal sequence and a membrane spanning
FT                   hydrophobic domain. Also contains a TTA leucine codon,
FT                   possible target for bldA regulation and a Prosite hit to
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJI9"
FT                   /protein_id="CAB58340.1"
FT                   /translation="MREKPLRIGVFGLFGAGNSGNDGSLEAVLDHLRAAHPDAVVDAMC
FT                   GGPETVATRYGVPATRLNWYRGEYRTASRASAIAAKALGKLVDVFRTAAWVRRHDAVIV
FT                   PGTGVLETTLPLRPWGFPYSLFLLCLTGRLFGTRVALVSVGAGAIGVRPTRVLTRWSTR
FT                   LAAYRSYRDDQSRDAMRAMGVNTARDEVYADLVFALPGPSASEPVETRGPVCVGVMDFH
FT                   GSNDERDVAEEIHRRYLDGTTRFVRALVEEGRPVRLLTGDELDRPVAAAIVDAVGSPLV
FT                   TVAEAASLADLMKETASADTVVATRYHNLVCALKVGTPTLALSYSGKSDALMAEMGMGA
FT                   YCHPAREADADRLLEQFRELERRSGPVRRTLCERNLVVARRVEDQFAALTTALFPATDH
FT                   AHALREAP"
FT   misc_feature    121507..121509
FT                   /note="TTA/leucine codon, possible target for bldA
FT                   regulation"
FT   misc_feature    122455..122478
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   regulatory      122703..122707
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        122712..123263
FT                   /transl_table=11
FT                   /gene="SCO0400"
FT                   /gene_synonym="SCF62.26"
FT                   /product="putative epimerase"
FT                   /note="SCF62.26, possible epimerase, len: 178 aa. Similar
FT                   to many including: Streptomyces griseus SW:STRM_STRGR
FT                   (EMBL; X62567) dTDP-4-dehydrorhamnose 3,5-epimerase (EC
FT                   5.1.3.13) (DTDP-4-keto-6-deoxyglucose 3,5-epimerase)
FT                   (DTDP-l-rhamnose synthetase) (200 aa), fasta scores opt:
FT                   340 z-score:0.0 E(): 0.0  37.78% identity in 180 aa overlap
FT                   and Leptospira borgpetersenii TR:Q9ZGK0 (EMBL; AF078135)
FT                   RmlC (186 aa), fasta scores pt:  432 z-score: 524.9 E():
FT                   7.2e-22 42.3% identity in 175 aa overlap. Contains a Pfam
FT                   match to entry PF00908 dTDP_sugar_isom,
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase."
FT                   /db_xref="GOA:Q9RJI8"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJI8"
FT                   /protein_id="CAB58341.1"
FT                   /translation="MKATEVPEISGAYLFRPTPHADARGFFCRTFDADVVRSVGLDPAA
FT                   FVQDSVSRSVRGVLRGLHLRSGAGEAKLVRCSNGRIFDAVVDLRADSPTYLGRAFFELS
FT                   GETQTTLYIPAGCAHGFQSLTETSDVSYRIDRAHDPAEDVTIAFDDPDLAIDWPLPVAS
FT                   VSPRDREAPSLADFLKHREG"
FT   misc_feature    122733..123242
FT                   /note="Pfam match to entry PF00908 dTDP_sugar_isom,
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase, score 207.70, E-value
FT                   1.8e-58"
FT   regulatory      123254..123258
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        123271..124596
FT                   /transl_table=11
FT                   /gene="SCO0401"
FT                   /gene_synonym="SCF62.27"
FT                   /product="putative aminotransferase"
FT                   /note="SCF62.27, possible aminotransferase, len: 441 aa.
FT                   Similar to many including Pseudomonas aeruginosa
FT                   SW:GSA_PSEAE (EMBL:X82072) glutamate-1-semialdehyde
FT                   2,1-aminomutase (EC 5.4.3.8) (glutamate-1-semialdehyde
FT                   aminotransferase) (427 aa), fasta scores opt: 475 z-score:
FT                   540.8 E(): 9.5e-23 34.8% identity in 434 aa overlap and
FT                   Streptomyces coelicolor TR:CAB39702 (EMBL: AL049485)
FT                   probable aminotransferase SC6A5.18 (461 aa), fasta scores
FT                   opt: 464 z-score: 527.9 E(): 4.9e-22 32.4% identity in 407
FT                   aa overlap. Contains 2x Pfam matches to entry PF00202
FT                   aminotran_3, Aminotransferases class-III
FT                   pyridoxal-phosphate"
FT                   /db_xref="GOA:Q9RJI7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJI7"
FT                   /protein_id="CAB59810.1"
FT                   /translation="MNAEELGLPRSRQANERLHALVPGGAHTYAKGDDQYPENLAPVIS
FT                   HGRGAHVWDVDGNRYVEYGSGLRSVSLGHAHPRVTEAVRRELDRGSNFVRPSIVEVDAA
FT                   ERFLATVPTAEMVKFAKNGSDATTAAVRLARAATGRPRVAVCADHPFFSVDDWFIGTTP
FT                   MSAGIPAATNELTVAFPYGDLAATEDLLARHEGEVACLILEPATHTEPPPGYLAGLREL
FT                   ADRHGCVLVFDEMITGFRWSEAGAQGLYGVVPDLSTFGKALGNGFAVAALAGRRELMEL
FT                   GGLRHSGDRVFLLSTTHGAETHALAAAMAVQGTYVEEGVTARLHALGDRLAAGVREAAA
FT                   SMGVGDHVVVRGRASNLVFATLDENGQPSQRYRTLFLRQLLAGGVLAPSFVVSSALGDA
FT                   DLDHTVDVVAEACAVYRKALDAADPTPWMAGRPVKPVFRRLV"
FT   regulatory      123355..123369
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    123415..123714
FT                   /note="Pfam match to entry PF00202 aminotran_3,
FT                   Aminotransferases class-III pyridoxal-phosphate, score
FT                   61.30, E-value 9.5e-21"
FT   misc_feature    123808..124290
FT                   /note="Pfam match to entry PF00202 aminotran_3,
FT                   Aminotransferases class-III pyridoxal-phosphate, score
FT                   80.10, E-value 2.8e-27"
FT   CDS_pept        complement(124654..125406)
FT                   /transl_table=11
FT                   /gene="SCO0402"
FT                   /gene_synonym="SCF51.01c"
FT                   /gene_synonym="SCF62.28c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCF51.01c, unknown, len: >48 aa"
FT                   /note="SCF62.28c, possible integral membrane protein,
FT                   partial CDS, len: >248 aa. Weakly similar in parts to
FT                   Streptomyces coelicolor TR:O86624 (EMBL: AL031155) putative
FT                   integral membrane protein SC3A7.23C (272 aa), fasta scores
FT                   opt: 189 z-score: 228.1 E(): 2.5e-05  31.6% identity in 190
FT                   aa overlap. Contains multiple possible membrane spanning
FT                   hydrophobic domains."
FT                   /db_xref="GOA:Q8CK58"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK58"
FT                   /protein_id="CAD55440.1"
FT                   /translation="MTGRPGPAVLPSWLRVWFVLMACLAAPVVLVLGAVYADESEPREW
FT                   DMRIFAAVDGVGPPWRHVAVVTDFLGEPAGAVLLVAAVVTGCLLLRHPRAAVFVVTGAG
FT                   LTVGTTTLLKPVVGRTIHGDNLSYPSGHTAFLTAIALMVSLLAAGRLGLGRAAGTAFVF
FT                   AAGLVAGAAMGWAQVALGSHYATDTLGGWCTALAVLPVTAWLVDRTADRLTDRWAGLPA
FT                   HPPDEWTAGPPCDRRAERRADAGRQQGS"
FT   CDS_pept        complement(125609..126226)
FT                   /transl_table=11
FT                   /gene="SCO0403"
FT                   /gene_synonym="SCF51.02c"
FT                   /product="hypothetical protein"
FT                   /note="SCF51.02c, hypothetical protein, len: 187 aa;
FT                   similar to various hypothetical proteins, e.g. TR:CAB56690
FT                   (EMBL:AL121596) Streptomyces coelicolor SCF51A.38
FT                   hypothetical 18.5 KD protein, 169 aa; fasta scores: opt:
FT                   176 z-score: 225.6 E(): 3.4e-05; 32.9% identity in 173 aa
FT                   overlap"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJT3"
FT                   /protein_id="CAB59700.1"
FT                   /translation="MTTGPTLPILAVTGQDGDVDFAFVSGNPALDLTGTVLSRRDEPVD
FT                   LLAVPADLGRWVAACEGLPDRVTATPSAFDAALNLREAVYRLALDRVLDRRFHIPSLEV
FT                   VNAAAAGPLPTVRLGDAGVRMSGGLPAVLTHVARSGIAVLADPGARLKECGRTDCTRVY
FT                   LDRSRGARRAWCGMEECGNRVKAAAYRARRRTSAAPSGRAER"
FT   regulatory      126232..126235
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        126243..126983
FT                   /transl_table=11
FT                   /gene="SCO0404"
FT                   /gene_synonym="SCF51.03"
FT                   /product="putative 2-haloalkanoic acid dehalogenase"
FT                   /note="SCF51.03, possible 2-haloalkanoic acid dehalogenase,
FT                   len: 246 aa; similar to SW:HAD2_PSEPU (EMBL:D17523)
FT                   Pseudomonas putida 2-haloalkanoic acid dehalogenase H-109
FT                   (EC 3.8.1.2) (L-2-haloacid dehalogenase H-109)
FT                   (halocarboxylic acid halidohydrolase H-109) DehH109, 224
FT                   aa: fasta scores: opt: 275 z-score: 328.4 E(): 6.4e-11;
FT                   32.2% identity in 202 aa overlap. Contains a Pfam match to
FT                   entry PF00702 hydrolase, haloacid dehalogenase-like
FT                   hydrolase"
FT                   /db_xref="GOA:Q9RJT2"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJT2"
FT                   /protein_id="CAB59701.1"
FT                   /translation="MVASGRESAEEGVRAGMAGGILGIEVVVFDVLGTLVDEPGGLRAG
FT                   IREAVPAADDAFVDELLALWQGHVEREQRRVVRGRRAYADSGIIDAEAARLVADRAGVG
FT                   DPAAVDRLAGAGRRLPPWSDSAAGLDRLTRRLVVLGLSNASHTAVPRIAAYAGLRWHGA
FT                   LSGETVRAYKPAPEVYRLAVDTAGCPPDRVLMVAAHAWDLRGARAGGMRTAYVRRPGGD
FT                   PPTGSDDFDGRFEALDELADALRL"
FT   misc_feature    126312..126899
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 27.80, E-value 2.7e-05"
FT   CDS_pept        complement(127015..127833)
FT                   /transl_table=11
FT                   /gene="SCO0405"
FT                   /gene_synonym="SCF51.04c"
FT                   /product="conserved hypothetical protein SCF51.04"
FT                   /note="SCF51.04, conserved hypothetical protein, len: 272
FT                   aa; similar to TR:O86540 (EMBL:AL031350) Streptomyces
FT                   coelicolor hypothetical 32.8 kD protein, 300 aa; fasta
FT                   scores: opt: 656 z-score: 793.0 E(): 0; 43.1% identity in
FT                   246 aa overlap"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJT1"
FT                   /protein_id="CAB59702.1"
FT                   /translation="MTGESSSIDSTRPTIARVYDYLLGGKDNYAADREIGDVFKRDLPG
FT                   SVAIAFANRAALTRAVGEIVTRTGVRQFIDLGSGLPTADNVHQVAQRRAPETRVVYVDT
FT                   DPQVLVHGRALLEENDRTRFVPVDVRDPEGIRSHPDTRQLIDFDRPVAVMFSAILHHVN
FT                   DDEDPAAIVRYWRGQVPSGSLFFVSHFRSGNNPETVEAEKVLQETFGRGRWRTDAEIEA
FT                   LLDGLEILEPGIVPASLWRPGTTAGTYDDGGERELTVWERLIAAGMARKP"
FT   regulatory      complement(127843..127847)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        127893..128606
FT                   /transl_table=11
FT                   /gene="SCO0406"
FT                   /gene_synonym="SCF51.05"
FT                   /product="hypothetical protein SCF51.05"
FT                   /note="SCF51.05, unknown, len: 237 aa"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJT0"
FT                   /protein_id="CAB59703.1"
FT                   /translation="MTRSSLAAQEVVPMTMTRQDTDALGAFESLADPSASVRLRAALAV
FT                   GTAPHPRFVEGLVERSAVEPEFFVRDMLTWALTRHPVAATLPPLVREVGSKLPQARSQA
FT                   LHTLSKIGDRRAWPAVTGAALSDADDEVARSAWRAAVVLVPEGEEQALARALAPQLGRG
FT                   DRETQLSLSRALVALGESAGAVLEAAATTAPAPHVRAHALATRRLLRDPDSGFEAAIEE
FT                   AKRVVALGGSGHEGP"
FT   misc_feature    128610..128675
FT                   /note="Helix-turn-helix from SCF51.06 score 1170"
FT   CDS_pept        128610..129614
FT                   /transl_table=11
FT                   /gene="SCO0407"
FT                   /gene_synonym="SCF51.06"
FT                   /product="putative transcriptional regulator"
FT                   /note="SCF51.06, possible transcriptional regulator, len:
FT                   334 aa; similar to SW:TIPA_STRLI (EMBL:S64314) Streptomyces
FT                   lividans transcriptional activator TipA, 253 aa; fasta
FT                   scores: opt: 215 z-score: 237.9 E(): 7e-06; 37.9% identity
FT                   in 103 aa overlap and to TR:O54191 (EMBL:AL021411)
FT                   Streptomyces coelicolor putative transcriptional regulator
FT                   SC7H1.32c, len: 196 aa; fasta scores: opt: 264 z-score:
FT                   290.9 E(): 7.8e-09; 37.4% identity in 139 aa overlap.
FT                   Contains a Pfam match to entry PF00376 merR, Bacterial
FT                   regulatory proteins, merR family and a prosite match to
FT                   entry PS00552 Bacterial regulatory proteins, merR family
FT                   signature. Contains possible helix-turn-helix motif between
FT                   residues 3351..3416, score 1170 (+3.17 SD)"
FT                   /db_xref="GOA:Q9RJS9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJS9"
FT                   /protein_id="CAB59704.1"
FT                   /translation="MLIGEVARRSGVSARMLRHYESLGLVRPSGRTGSGYREYSRADIR
FT                   RIFHIESLRSLGLSLREIGRALDEPGFAPAALVDDLIRRTRERIAAETELLTRLRRIDA
FT                   AGPAGWEDVLQAVALLQALGSKSADARQRAALSSVQDASVPVEALVDAVLSETDTNVAG
FT                   ALRWALARSGDDAAALLARGLDSPVAEVRARAVRALAELSGVEATARLRHALDGPDAVV
FT                   RGYAALALGSRGAGEAVPTLVDMIVAGRNDTDAADALSVLASDPATADRIAAGLVGRLC
FT                   DGTTDAAARGRLTQALAGIPGTRASSALAELSRDEERAVALTATYLLRLREEP"
FT   misc_feature    128619..128687
FT                   /note="PS00552 Bacterial regulatory proteins, merR family
FT                   signature"
FT   misc_feature    128619..128726
FT                   /note="Pfam match to entry PF00376 merR, Bacterial
FT                   regulatory proteins, merR family, score 44.50, E-value
FT                   2.3e-09"
FT   CDS_pept        129615..130403
FT                   /transl_table=11
FT                   /gene="SCO0408"
FT                   /gene_synonym="SCF51.07"
FT                   /product="probable methyltransferase"
FT                   /note="SCF51.07, probable methyltransferase, len: 262 aa;
FT                   some similarity to TR:Q9ZGH6 (EMBL:AF079762) Streptomyces
FT                   venezuelae N,N-dimethyltransferase DesVI 273 aa; fasta
FT                   scores: opt: 165 z-score: 205.9 E(): 0.00043; 28.3%
FT                   identity in 237 aa overlap and to TR:CAB49808
FT                   (EMBL:AJ248285) Pyrococcus abyssi menaquinone biosynthesis
FT                   methyltransferase, 248 aa; fasta scores: opt: 165 z-score:
FT                   205.6 E(): 0.00044; 27.3% identity in 183 aa overlap"
FT                   /db_xref="GOA:Q9RJS8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJS8"
FT                   /protein_id="CAB59705.1"
FT                   /translation="MLRQFASRRATWPTVTSSQLWTRETADRYDAEEAESGMGSAAVLG
FT                   PTVDFLAELAGEGRALEFAIGTGRVGVPLRERGVPVAGIELSEHMAAVLRRKAAEETLP
FT                   VTLGDMATTVVPGEFTLVYLVYNTITNLLTQDEQVECFRNAARHLGPGGRFVIELGVPP
FT                   LRFLPPGQVAVPFDVSERHLGFDTFDLVEQILVSNHFTRDPGDGSYRRDNSRHRYAWPA
FT                   ELDLMARIAGLELERRVADWDGAPFTADSAKHISVWRKPA"
FT   CDS_pept        complement(130492..130956)
FT                   /transl_table=11
FT                   /gene="SCO0409"
FT                   /gene_synonym="sapA"
FT                   /gene_synonym="SCF51.08c"
FT                   /product="spore-associated protein precursor"
FT                   /note="SCF51.08c, sapA spore-associated protein precursor,
FT                   len: 154 aa; N-terminal region identical to SW:SAPA_STRCO
FT                   (EMBL:M20145) Streptomyces coelicolor spore-associated
FT                   protein precursor (fragment) SapA, 120 aa"
FT                   /db_xref="GOA:P12690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12690"
FT                   /protein_id="CAB59706.1"
FT                   /translation="MQAVGATLTAVGAIGAGLLVTAPAAGAATAGATASYNGVCGSGYK
FT                   VVNSMPIGSTGTVYLTYNSATGKNCTVTIRNTTGTPTYMVAYVRNIESGADQYDEGDYR
FT                   SYAGPVYVSARGACVEWGGVIGNLQAWNYGSNCGALAAKAPQKDWFAGQR"
FT   regulatory      complement(130973..130976)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(131071..132321)
FT                   /transl_table=11
FT                   /gene="SCO0410"
FT                   /gene_synonym="SCF51.09c"
FT                   /product="hypothetical protein"
FT                   /note="SCF51.09c, hypothetical protein, len: 416 aa;
FT                   similar to TR:Q49897 (EMBL:U00021) Mycobacterium leprae
FT                   hypothetical protein MLC1351.13c, 311 aa; fasta scores:
FT                   opt: 288 z-score: 317.7 E(): 2.5e-10; 34.4% identity in 326
FT                   aa overlap. Contains Pfam match to entry PF01513 DUF15,
FT                   domain of unknown function and prosite PS00339
FT                   aminoacyl-transfer RNA synthetases class-II signature 2"
FT                   /db_xref="GOA:Q9RJS6"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RJS6"
FT                   /protein_id="CAB59707.1"
FT                   /translation="MMAYRHGTYSVPDARLAGRKREARHVAARPAAGVGEDSVDRGCGS
FT                   TARRQEAVVTIERVGLVVHGGREGAAEAAREVREWCDENAVACTDIDVWSDTGRHSARE
FT                   EVDAAGDPDLVVTLGGDGTFLRGARLAAENDALILGVDLGRVGFLTEVPAPAVRSALDA
FT                   VRDGGLEPESRMLLTLRASRLLEIPAEMEALLRYGRGPLLPPPRVRTDCESGDEWGIAL
FT                   NVTALNDVVLEKLSRDRQISVGVYIAGRLLASYSADALLVATPTGSTAYSFAAGGPVVS
FT                   PRAEALVFTAVAPHMTFDRSVVTAPDEPVGLRILERSGRAAVSIDGQLRGVLDPGDWLG
FT                   VYAAPRRLRAVRLGPMDFYGRLRERMRLTDAPAAVADGTPAPLWPVSTPPPGDLAHLAL
FT                   PVPGAEGASGDLLREQS"
FT   misc_feature    complement(131239..132159)
FT                   /note="Pfam match to entry PF01513 DUF15, Domain of unknown
FT                   function, score 150.90, E-value 2.2e-41"
FT   misc_feature    complement(132136..132165)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2"
FT   CDS_pept        132327..132551
FT                   /transl_table=11
FT                   /gene="SCO0411"
FT                   /gene_synonym="SCF51.10"
FT                   /product="hypothetical protein SCF51.10"
FT                   /note="SCF51.10, unknown, len: 74 aa. Contains a prosite
FT                   match to entry PS00017 ATP/GTP-binding site motif A
FT                   (P-loop)"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJS5"
FT                   /protein_id="CAB59708.1"
FT                   /translation="MTFTEEEMEGVRAAAAAEGKSLKQYMHDLGVREMQRKRFVAGAVS
FT                   WADRLRAEFDEAFPDEIPPSQRGEGVTAA"
FT   misc_feature    132366..132389
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        132551..132934
FT                   /transl_table=11
FT                   /gene="SCO0412"
FT                   /gene_synonym="SCF51.11"
FT                   /product="hypothetical protein SCF51.11"
FT                   /note="SCF51.11, unknown, len: 127 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJS4"
FT                   /protein_id="CAB59709.1"
FT                   /translation="MSEPLYIDVPWLLDVQDAALDNEDVSVTDYSALVAAVARHKTRMP
FT                   TLAASNPDSAWRAAALLHTVVRLEPLPHRNSLFAAFVTGQYMDQSGEGIDPPYGALSDL
FT                   IRKVRETRLSIYDIADVLRSWRI"
FT   CDS_pept        complement(132962..133564)
FT                   /transl_table=11
FT                   /gene="SCO0413"
FT                   /gene_synonym="SCF51.12c"
FT                   /product="hypothetical protein SCF51.12c"
FT                   /note="SCF51.12c, unknown, len: 200 aa."
FT                   /db_xref="GOA:Q9RJS3"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJS3"
FT                   /protein_id="CAB59710.1"
FT                   /translation="MTTAHDLTIVSLEVPSDYPVERGDLSLALAGAELIDLMEAGTVEL
FT                   DGDLLRPVSRAASGDRLLDEAASLLGGDPAESVTDWLWRRGDGLAARYLAAAGADEGGR
FT                   RRPRRNARGGTGRPAPADPAAHRRATDRWSGADPVLAGFAAAVGVRHESADQVADPEDD
FT                   GVATVLAAVNDVVVELAAIRQRRSIEEAAFDNIWRGM"
FT   regulatory      complement(133570..133574)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(133617..134513)
FT                   /transl_table=11
FT                   /gene="SCO0414"
FT                   /gene_synonym="SCF51.13c"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /note="SCF51.13c, possible RNA polymerase sigma factor,
FT                   len: 298 aa; similar to TR:CAB42013 (EMBL:AL049754)
FT                   Streptomyces coelicolor putative RNA polymerase sigma
FT                   factor SCH10.4c, 294aa; fasta scores: opt: 614 z-score:
FT                   721.0 E(): 8.7e-33; 41.4% identity in 285 aa overlap and to
FT                   TR:O86856 (EMBL:AJ007313) Streptomyces coelicolor sigma
FT                   factor, SigT, 236aa; fasta scores: opt: 160 z-score: 194.6
FT                   E(): 0.0018; 31.0% identity in 158 aa overlap"
FT                   /db_xref="GOA:Q9RJS2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJS2"
FT                   /protein_id="CAB59711.1"
FT                   /translation="MGTAGTSTDATVGERRQLINVAYRLLGSLAEAEDAVQEAYARWYA
FT                   LPRSRQEEIVSPGAWLTTVTGRVCLDALGSARARRERYVGAWLPDPLPAHAERGPGHGA
FT                   DPADQMVLDESVTMAFLVVLESMTPAERVAFVLHDVFRYPFADIAGILRRTPAACKQLA
FT                   ASARRRVRGARAPQTPAAVRADVVRQVKEAWQTKDIAALVDLLDPAAVMTADGGGMVGT
FT                   ALRPIEGGARIAQYMAAVADKAPGLELLERSVNGVPGLVARRDGAVMTVAAFDVADGRV
FT                   TRIWVVRNPEKLGPWVG"
FT   regulatory      complement(134526..134529)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        134615..134977
FT                   /transl_table=11
FT                   /gene="SCO0415"
FT                   /gene_synonym="SCF51.14"
FT                   /product="putative membrane protei"
FT                   /note="SCF51.14, possible integral membrane protein, len:
FT                   120 aa. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q9RJS1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJS1"
FT                   /protein_id="CAB59712.1"
FT                   /translation="MATQATAQHRLSFLRIAIALQTLTIFLQAVSAGLLLTASYGETLH
FT                   SVGARVMYGASMLYVLAAVLAWKPGGGPLRPVRHACGFLVLASVQVVLGIAHVPSVHLP
FT                   LGVLMFGLSVLALARR"
FT   CDS_pept        complement(134984..135589)
FT                   /transl_table=11
FT                   /gene="SCO0416"
FT                   /gene_synonym="SCF51.15c"
FT                   /product="probable integral membrane protein"
FT                   /note="SCF51.15c, probable integral membrane protein, len:
FT                   201 aa; similarity to SW:CMLR_STRLI (EMBL:X59968)
FT                   Streptomyces lividans chloramphenicol resistance protein,
FT                   392aa; fasta scores: opt: 123 z-score: 149.4 E(): 0.6;
FT                   30.5% identity in 177 aa overlap"
FT                   /db_xref="GOA:Q9RJS0"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJS0"
FT                   /protein_id="CAB59713.1"
FT                   /translation="MRFVPRWVLLSSGCAPVLLIAGWTGAAYAEGASYDPVSQTISVLG
FT                   AYGAAGFWVMTAAFLALGVCHLLTAWGLRPAATAGRVALGGGGLAALVLVALPAPSSGG
FT                   SLRHGAVVVVGFTLLAVWPVLAVNGGPAGPWALRLAPSIAVTTLMAAGGVWFLIEMRQH
FT                   GDAGVAERVVTSLQSLWPFVVAASCLRHARRPGTAPEG"
FT   CDS_pept        complement(135651..136397)
FT                   /transl_table=11
FT                   /gene="SCO0417"
FT                   /gene_synonym="SCF51.16c"
FT                   /product="conserved hypothetical protein SCF51.16c"
FT                   /note="SCF51.16c, hypothetical protein, len: 248 aa;
FT                   similar to TR:P74164 (EMBL:D90912) Synechocystis sp.
FT                   (strain PCC 6803) hypothetical 33.9 KD protein, 300 aa;
FT                   fasta scores: opt: 361 z-score: 423.5 E(): 3.2e-16; 35.9%
FT                   identity in 259 aa overlap"
FT                   /db_xref="InterPro:IPR014990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJR9"
FT                   /protein_id="CAB59714.1"
FT                   /translation="MTTPAQSLRSLARTRASLDGEEVTYWWSGSVFAWAPDEPYERLFG
FT                   FEGVNVARLVHDAEDGPDSYRLLTREAAFYLDPVTGDILETWRDQPVVHVWNDPANQKW
FT                   RPFPVPTTDLGDQVCFSLEIPLAYPSPLPTAQYPRHSAGDMYRALELFQFFARREDLAG
FT                   PDPSVPATMSWTRMSPWVPWMARGGRPGGLTYHCRGRKLGSYTEVPERTRAHIAGHHPR
FT                   FARAPERWSEPNETSWTYFRALNPPV"
FT   CDS_pept        136456..137103
FT                   /transl_table=11
FT                   /gene="SCO0418"
FT                   /gene_synonym="SCF51.17"
FT                   /product="DNA-binding protein"
FT                   /note="SCF51.17, DNA-binding protein, len: 215 aa; similar
FT                   to TR:CAB44405 (EMBL:AL078610) Streptomyces coelicolor
FT                   putative DNA-binding protein, SCH35.22c 215 aa; fasta
FT                   scores: opt: 206 z-score: 233.8 E(): 1.2e-05; 30.9%
FT                   identity in 220 aa overlap and to TR:CAB45035
FT                   (EMBL:AL078635) Amycolatopsis orientalis hypothetical
FT                   protein CZA382.14c, 202 aa; fasta scores: opt: 305 z-score:
FT                   340.6 E(): 1.3e-11; 34.0% identity in 212 aa overlap"
FT                   /db_xref="GOA:Q9RJR8"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJR8"
FT                   /protein_id="CAB59715.1"
FT                   /translation="MNPGGGPGLPCMTRIIADISISLDGCVTGPDPGPGNGLGTGGEAL
FT                   HTWAFSDDPEERRIVRETTARSGAVVLGRRLFDLVDGPGGWDDTVGYGAAEVGRPPFVV
FT                   VTASPPESVRLTGLDWTFVTTGLPDAVAAARERAEAASADLGRDLDVVLMGGGALIGSA
FT                   LDAGLVEVLSLHLAPVVLGSGTPLFTGGTPHTLVRRSANATPNATHLLYEVL"
FT   regulatory      137215..137218
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        137235..138224
FT                   /transl_table=11
FT                   /gene="SCO0419"
FT                   /gene_synonym="SCF51.18"
FT                   /product="putative zinc-binding oxidoreductase"
FT                   /note="SCF51.18, possible zinc-binding oxidoreductase, len:
FT                   329 aa; similar to SW:QOR_PSEAE (EMBL:X85015) Pseudomonas
FT                   aeruginosa quinone oxidoreductase (EC 1.6.5.5)
FT                   (NADPH:quinone reductase) qor, 325 aa; fasta scores: opt:
FT                   420 z-score: 452.5 E(): 7.8e-18; 32.8% identity in 332 aa
FT                   overlap and to TR:CAB45348 (EMBL:AL079345) Streptomyces
FT                   coelicolor putative dehydrogenase SCE68.12c, 318 aa; fasta
FT                   scores: opt: 535 z-score: 574.1 E(): 1.3e-24; 38.6%
FT                   identity in 332 aa overlap. Contains Pfam match to entry
FT                   PF00107 adh_zinc, Zinc-binding dehydrogenases"
FT                   /db_xref="GOA:Q9RJR7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJR7"
FT                   /protein_id="CAB59716.1"
FT                   /translation="MKAVVQERFGPPDSLRLRDVDRPHAGAGQVLVRVHAAAVNPYDWH
FT                   MLRGDPYVARMLGGMGLTRPKCPVAGLDAAGVVERVGADVRGFGPGDRVLGFCPGAFAE
FT                   YACTTAPMLVPVPEGLTFEQAAALPMAAVTALRGIRTVGRVRSGQRVLVNGAGGGVGTF
FT                   AVQIAAVLDAEVTGVCSAANTDLVRSLGAAHVLDYAREDFTDGRGRYDVVLDNVGNHPL
FT                   RRLRRALTPAGVLVANGGGSPGRVFGAVGAMLRLAAANAVTRQRLRPILPATPDGPVHE
FT                   DLSAVTALVDAGQVTPVVGRTFALADTARALRHVEEGHARGKTVVTVA"
FT   misc_feature    137253..138215
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenases, score -9.20, E-value 2.9e-09"
FT   CDS_pept        complement(138253..139287)
FT                   /transl_table=11
FT                   /gene="SCO0420"
FT                   /gene_synonym="SCF51.19c"
FT                   /product="putative homoserine dehydrogenase"
FT                   /note="SCF51.19c, possible homoserine dehydrogenase, len:
FT                   344 aa; similar to SW:DHOM_SYNY3 (EMBL:D64001)
FT                   Synechocystis sp. (strain PCC 6803) homoserine
FT                   dehydrogenase (EC 1.1.1.3) (HDH), 433 aa; fasta scores:
FT                   opt: 284 z-score: 307.6 E(): 9.2e-10; 29.0% identity in 335
FT                   aa overlap and to TR:O26517 (EMBL:AE000826)
FT                   Methanobacterium thermoautotrophicum homoserine
FT                   dehydrogenase homologue MTH417, 340 aa; fasta scores: opt:
FT                   332 z-score: 359.9 E(): 1.1e-12; 30.1% identity in 335 aa
FT                   overlap. Contains Prosite match to entry PS01042 Homoserine
FT                   dehydrogenase signature"
FT                   /db_xref="GOA:Q9RJR6"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJR6"
FT                   /protein_id="CAB59717.1"
FT                   /translation="MNELTGATETTGATTTAVVLAGYGPVGQAFVDRLARDGEALARRH
FT                   GVRPRVAAVRASAAQCRPDAGGSVPPRSRWDPARPLDETFDRTGARVFVQAVPSSPGLR
FT                   ERAAEEALAALRRGIHVVTATKSHLLTHWRDLDAAARAGGSMIRISGATGAALPAGDLS
FT                   RTSLRGLDCRTIRACPNGTATFVLDRLAEGDTLGDAIRAAQLRGIAEADPSADLSGDDA
FT                   ATKVRLLAALAWGWDPAEVRVRAEPVDGTTARRALAAAARSRRLRAVAGAAVAEPGVVR
FT                   VRLEETEAGDPLHALTGPEKAAVFGCPDAGDVTVSGGRSSPVGAALALVKDTVEVTAAR
FT                   TGFH"
FT   misc_feature    complement(138613..138681)
FT                   /note="PS01042 Homoserine dehydrogenase signature"
FT   regulatory      complement(139299..139303)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(139329..139988)
FT                   /transl_table=11
FT                   /gene="SCO0421"
FT                   /gene_synonym="SCF51.20c"
FT                   /product="putative two-component response regulator"
FT                   /note="SCF51.20c, possible two-component response
FT                   regulator, len: 219 aa; similar to TR:CAB51249
FT                   (EMBL:AL096872) Streptomyces coelicolor putative
FT                   two-component response regulator, SC5F7.36c, 227 aa; fasta
FT                   scores: opt: 815 z-score: 952.9 E(): 0; 61.8% identity in
FT                   220 aa overlap and to TR:Q53894 (EMBL:U51332) Streptomyces
FT                   coelicolor absA2, 222 aa; fasta scores: opt: 543 z-score:
FT                   638.7 E(): 3.3e-28; 43.8% identity in 217 aa overlap.
FT                   Contains two Pfam matches to entries PF00196 GerE,
FT                   Bacterial regulatory proteins, luxR family and PF00072
FT                   response_reg, Response regulator receiver domain and
FT                   Prosite match to entry PS00017 ATP/GTP-binding site motif A
FT                   (P-loop). Contains possible helix-turn-helix motif between
FT                   residues 14157..14222, score 1198 (+3.27 SD)"
FT                   /db_xref="GOA:Q9RJR5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJR5"
FT                   /protein_id="CAB59718.1"
FT                   /translation="MLLADDQALLRATFRILIDSSEDMDVVAEAADGRDAVELTRTHRP
FT                   DIVLMDIRMPGTDGLAATAEICADPALRGTRVLILTTFETDEHVARALRIGASGFLGKD
FT                   VTAEELLDGIRTVAAGDALLSAAATRSLITRFLDSPDPRASPVPPEDLAALTAREREVT
FT                   ALVADGKSDKEIAAELFLSPLTVRTHVQRAKTKLGARDRAQLVAHAYRSGLARPPR"
FT   misc_feature    complement(139338..139535)
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 82.90, E-value
FT                   6.4e-21"
FT   misc_feature    complement(139416..139481)
FT                   /note="Helix-turn-helix from SCF51.20c score 1198"
FT   misc_feature    complement(139476..139499)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    complement(139647..139988)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 107.80, E-value 2.1e-28"
FT   CDS_pept        complement(139997..141190)
FT                   /transl_table=11
FT                   /gene="SCO0422"
FT                   /gene_synonym="SCF51.21c"
FT                   /product="putative two-component sensor kinase"
FT                   /note="SCF51.21c, possible two-component sensor kinase,
FT                   len: 397 aa; similar to TR:CAB51250 (EMBL:AL096872)
FT                   Streptomyces coelicolor putative two-component sensor
FT                   kinase, SC5F7.35c, 416 aa; fasta scores: opt: 841 z-score:
FT                   875.2 E(): 0; 43.5% identity in 393 aa overlap and to
FT                   TR:Q53893 (EMBL:U51332) Streptomyces coelicolor AbsA1,571
FT                   aa; fasta scores: opt: 369 z-score: 385.9 E(): 4e-14; 30.5%
FT                   identity in 394 aa overlap. Contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9RJR4"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJR4"
FT                   /protein_id="CAB59719.1"
FT                   /translation="MLSSWRRYADSHPHLVETAFLLLVLAVTSRQYVHQGPGWWQGQPL
FT                   ALVATAGLLPRRGHPRAAVLVTAACAAASVALGYLISPLLLLPVLIALYELAVRTPQRT
FT                   AYACYGATVALVVPAALLSARDGRPWMDESVGPVFWILLPVLAGTAVRNRRAHLDAVHT
FT                   RAEHAERTREEEARHRVAEERIRIARELHDVVAHHMALANAQASTAAHLARTHPEQAHE
FT                   ILTHLTGTTASALRELKATVGLLRSPDDTGDTGGPDDLRPPPGLGRLPELVSAFGSAGL
FT                   HVTVTVRGTRRPLPPGVDLTAFRIVQEALTNVTKHTDAGTADVHLAYAHDRLTLTVTDD
FT                   GGASPRPPGPGGGFGLVGMRERAETSGGRLSAGTLADGGFAVTAELPAPPPAREQPS"
FT   regulatory      complement(141197..141201)
FT                   /regulatory_class="ribosome_binding_site"
FT   stem_loop       141227..141280
FT   CDS_pept        complement(141282..143579)
FT                   /transl_table=11
FT                   /gene="SCO0423"
FT                   /gene_synonym="SCF51A.01c"
FT                   /product="putative membrane transport protein"
FT                   /note="SCF51A.01c, putative membrane transport protein,
FT                   len: 765 aa. Similar to many Streptomyces coelicolor
FT                   integral membrane proteins including:TR:Q53902 (EMBL;
FT                   M64683) ORF1-4 (ACTII) (711 aa),fasta scores opt: 291
FT                   z-score: 295.3 E(): 4.3e-09 27.7% identity in 779 aa
FT                   overlap, TR:Q9Z577 (EMBL; AL035569) SC8D9.14 (748 aa),
FT                   fasta scores opt: 1021 z-score: 1028.4 E(): 0 40.6%
FT                   identity in 773 aa overlap and TR:O88022 (EMBL; AL031107)
FT                   SC5A7.16C (705 aa), fasta scores opt: 639 z-score: 645.0
FT                   E(): 1.4e-28 37.2% identity in 764 aa overlap. Contains
FT                   multiple possible transmembrane hydrophobic domains."
FT                   /db_xref="GOA:Q9RL63"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL63"
FT                   /protein_id="CAB56653.1"
FT                   /translation="MATLLYRLGRGAFRRRRWVTLAWAAVVLGVVLGAMSAGEAGDDSD
FT                   SMPGIESQHAFDLINERFPGAEAEGADARIVLVAPDGRQVTASEYRAAIDTLVAEVADG
FT                   PQVAAVSDPLDAATVSQDGSTAYATVTYEVTEDNVTDAGRADLTAAVERARTSGLTVEA
FT                   GGGAVAGEPPAGIGEFLGIGVAAVVLLITFGSLAAAGLPLITAVVGVALTLASIVALGS
FT                   ALGMSTASGDLAMMIGIAVGVDYALLVVSRYREERAEGHDAREAAGLAVGTAGSAVVFA
FT                   GLTVVIALAGLSVIGVPSLTKMGLAAAGAVVIAVLITLTLVPALCGFWPDALLARRVRK
FT                   GRSAPPARRFRKGRSTPPARRLRGGPGRGAARRTREAGAWSVRWARFVQRRPVPVLLGS
FT                   AVLLGALAVPALDLRLGMPGDEAKPTSTTERRAYDALADGFGPGFNGPLTVVVDARQAD
FT                   DPRSAVAAVSDRLAATAGVVSVAPPRFNAAKDTAVIQAVPATAPTSERTEELVHTIRDE
FT                   RHATESATGATFEVTGTTALNIDVARKMTDALIPYLLVVVGLAFLLLLVVFRSVLVPLK
FT                   AALGFLLSVGASFGALVTIFQNGHGAGLLGVEETGPVMSTMPLMLVGIVFGLAMDYQVF
FT                   LVSRMREAVVHGERPAEAVVTGFRHSGRVVTAAAVIMTSVFAGFMTGGETLLKMVGFGL
FT                   AVAVLFDAFVVRMAFVPAVLVLLGERAWWLPRRLDRLLPRVDVEGEALGRRTPAPALAA
FT                   VPDTDRQDTVRA"
FT   regulatory      143692..143697
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        143700..144191
FT                   /transl_table=11
FT                   /gene="SCO0424"
FT                   /gene_synonym="SCF51A.02"
FT                   /product="hypothetical protein SCF51A.02."
FT                   /note="SCF51A.02, unknown, len: 168 aa."
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL62"
FT                   /protein_id="CAB56654.1"
FT                   /translation="MPGWTAGLPHLPKRPRGHGAGRGDPDGPRVSAVPAAQCVEWGPGR
FT                   RRGGPRTAVATARGPTVRPGPHQFGGGPLEHRQRLGIAVLGGRAEFEEAPGRQVAAARA
FT                   TRACPASGRSAGTRIASVQVPGPARRSRRPGAVVGAAVPGRPHRAAAGRDDVALAARQA
FT                   "
FT   CDS_pept        complement(144293..145243)
FT                   /transl_table=11
FT                   /gene="SCO0425"
FT                   /gene_synonym="SCF51A.03c"
FT                   /product="hypothetical protein SCF51A.03c"
FT                   /note="SCF51A.03c, unknown, len: 316 aa. Similar to
FT                   Streptomyces coelicolor TR:CAB46385 (EMBL; AL096743)
FT                   hypothetical 30.5 KD protein SCI7.02C (281 aa), fasta
FT                   scores opt:  424 z-score: 490.6 E(): 5.7e-20 36.6% identity
FT                   in 292 aa overlap."
FT                   /db_xref="InterPro:IPR029475"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL61"
FT                   /protein_id="CAB56655.1"
FT                   /translation="MTLSLTHVHGDRVTVAHGAAGTELFSYVYRPEAAWEAPKPYLHPV
FT                   RTLSGAVVTDYRPNDHRWHKGLQLTASHLSGQNLWGGNTYVHGEGYRALPERVGSMAHV
FT                   SFEEIGAEADHAVIAERLTWHPHGGELWAEEERRIEVRDVDPDTGSWTLTWTSAVTNRR
FT                   AEPLRFGSPTTHGRPAAGYTGLFWRGPRAFRGGRVFTAQSAASAESGEPADAGPMGSSA
FT                   RWLAYVGEHDGRDGHATLVFEHAPSNDHSGEKGTHPAHWFVRSDPFAAVAPSWAFHEEL
FT                   VLPPGETLARAYRVVVADGAWDRARVAAHLAGLAW"
FT   regulatory      complement(145248..145253)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      145428..145430
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145441..145671
FT                   /transl_table=11
FT                   /gene="SCO0426"
FT                   /gene_synonym="SCF51A.04"
FT                   /product="hypothetical protein SCF51A.04."
FT                   /note="SCF51A.04, unknown, len: 76 aa."
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL60"
FT                   /protein_id="CAB56656.1"
FT                   /translation="MEIPRHLIELRRAVEAADNRYRSNRGENATVALAVWSDATAALAR
FT                   GIAAYADETGVPHREVELAVQRATGRHTPAR"
FT   regulatory      145744..145747
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145752..146588
FT                   /transl_table=11
FT                   /gene="SCO0427"
FT                   /gene_synonym="SCF51A.05"
FT                   /product="putative hydrolase"
FT                   /note="SCF51A.05, possible hydrolase, len: 278 aa. Similar
FT                   to many e.g. Pseudomonas fluorescens SW:PRXC_PSEFL
FT                   (EMBL:AF031153) non-heme chloroperoxidase (EC 1.11.1.10)
FT                   (chloride peroxidase), fasta scores opt: 243 z-score: 282.1
FT                   E(): 2.4e-08 28.4% identity in 275 aa overlap and many
FT                   putative hydrolases: Streptomyces coelicolor TR:CAB44393
FT                   (EMBL; AL078610) putative hydrolase SCH35.34C (269 aa),
FT                   fasta scores opt: 259 z-score: 300.1 E(): 2.3e-09 29.7%
FT                   identity in 269 aa overlap. Contains a Pfam match to entry
FT                   PF00561 abhydrolase, alpha/beta hydrolase fold"
FT                   /db_xref="GOA:Q9RL59"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL59"
FT                   /protein_id="CAB56657.1"
FT                   /translation="MTERLAVDGGTIAYEVTGSGPLIVLAHGMGDSRAAYRTVVPQLVA
FT                   AGHRVAAVDLRGCGESSVDWPQWSRTAIAGDLIALIRHLGGPAVVVGHSVSGGAATIAA
FT                   AREPSLVTAVVELAPFTRKQSVRLGDLRVKRFRRGMLRLLGAGAFGSLPLWRSYLDVAY
FT                   PGVKPAHWSERLGRIESLLREPGRMKAMQAMGRSAPTDAGAQLGNVRCPVLVVMGTLDP
FT                   DWADPHAEGSAVVADLPSGLGRLEMIEGAGHYPHDQFPDEVAALVLAFLRSDAARA"
FT   misc_feature    145893..146564
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 74.40, E-value 2.4e-18"
FT   regulatory      146604..146608
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    146611..146721
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 17.50, E-value
FT                   0.0041"
FT   CDS_pept        146611..147144
FT                   /transl_table=11
FT                   /gene="SCO0428"
FT                   /gene_synonym="SCF51A.06"
FT                   /product="putative tetR family transcriptional regulator"
FT                   /note="SCF51A.06, possible tetR family transcriptional
FT                   regulator, len: 177 aa. Similar to many putative regulators
FT                   e.g. Streptomyces coelicolor TR:Q9ZBU4 (EMBL; AL034446)
FT                   putative transcriptional regulator SC1A9.08C (189 aa),
FT                   fasta scores opt: 402 z-score: 476.9 E(): 3.3e-19 45.5%
FT                   identity in 165 aa overlap. Contains a Pfam match to entry
FT                   PF00440 tetR, Bacterial regulatory proteins, tetR family
FT                   and a possible helix-turn-helix motif between residues
FT                   18..39 (+2.91 SD)."
FT                   /db_xref="GOA:Q9RL58"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL58"
FT                   /protein_id="CAB56658.1"
FT                   /translation="MVAAGAALADEVGFANLTMGLLAERVGVRTPSLYKHVGGQDDLTR
FT                   RIAVRALNEAADAVGGAVQGYAGRDALAAAARAFRAFVLEHPGRYAATIGQEPSGPDDP
FT                   LAAAGQRLLGAFTAVLRGYDIEDRDVNHALRLLRSLFHGFATLQASDGFQWSTDVDDSF
FT                   EWLIAFTDRGLRTL"
FT   CDS_pept        complement(147214..148161)
FT                   /transl_table=11
FT                   /gene="SCO0429"
FT                   /gene_synonym="SCF51A.07c"
FT                   /product="putative oxidoreductase"
FT                   /note="SCF51A.07c, possible oxidoreductase, len: 315 aa.
FT                   Weakly similar to many eukaryotic oxidoreductases e.g.
FT                   Hordeum vulgare (Barley) TR:Q42837 (EMBL; Z48360) aldose
FT                   reductase (EC 1.1.1.21) (aldehyde reductase) (320 aa),
FT                   fasta scores opt: 236 z-score: 263.3 E(): 2.6e-07 27.0%
FT                   identity in 296 aa overlap and many other putative
FT                   oxidoreductases e.g. Streptomyces coelicolor TR:CAB42953
FT                   (EMBL:AL049863) putative oxidoreductase SC5H1.28C (305 aa),
FT                   fasta scores opt:  563 z-score: 617.0 E(): 5.2e-27 39.7%
FT                   identity in 305 aa overlap"
FT                   /db_xref="GOA:Q9RL57"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL57"
FT                   /protein_id="CAB56659.1"
FT                   /translation="MTSTGTPSSSRATHGGTPRPGGAGVLAGRTVSRIGYGAMQLERLH
FT                   ADRAAAVALVRRAVERGVDHLDTAQFYGDGFVNEVIRAALRPADDVVVVSKVGAAPDPG
FT                   GPLPLRPAQRPEELRASVEDNLRSLGTDRIPVVNLRRLDTGPGLRAEGDQRVDLDDQLA
FT                   VMTALRDEGKIGAIGLSSVTPDGLRRALPAGIVCVQNAYSVVSRDDEDMLALCSAEGVA
FT                   WVPYFPLGGAFPAMPKVADEPAVHTVANRLGVTPAQVGLAWLLHHAPNVLLIPGTADAG
FT                   HLDANLAVGEIALDASSLAALDAVRSRSADVPLG"
FT   regulatory      complement(148172..148176)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        148185..148868
FT                   /transl_table=11
FT                   /gene="SCO0430"
FT                   /gene_synonym="SCF51A.08"
FT                   /product="putative tetR family transcriptional regulator"
FT                   /note="SCF51A.08, possible tetR family transcriptional
FT                   regulator, len: 227 aa. Similar to several putative
FT                   regulators e.g. Streptomyces coelicolor TR:CAB46405 (EMBL;
FT                   AL096743) putative transcriptional regulator SCI7.22c (202
FT                   aa), fasta scores opt: 428 z-score: 495.6 E(): 3e-20 41.1%
FT                   identity in 202 aa overlap. Contains a Pfam match to entry
FT                   PF00440 tetR, Bacterial regulatory proteins, tetR family
FT                   and a possible helix-turn-helix motif between residues
FT                   71..92 (+3.86 SD)."
FT                   /db_xref="GOA:Q9RL56"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL56"
FT                   /protein_id="CAB56660.1"
FT                   /translation="MTVAEDPPLYDCNTTGGSSALSPDQETSADPGRPDRPAGAERPLR
FT                   AHARRNREKLVAAARAAFTAADDTVPLDGIARAAGVGIGTLYRHFPTREALVEAVYAAE
FT                   LDDVTASASALLDTLPPERALRAWLERYAAFVATKRSILNTLHSGWASGRLVMPATRER
FT                   ITAAIGTMLAQGARAGSLRGDVAPDDVTAMLLGVFLSTAADDEPERTERLLDLVVDALR
FT                   PPGSS"
FT   misc_feature    148347..148484
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 29.80, E-value
FT                   1.5e-06"
FT   CDS_pept        complement(148890..150218)
FT                   /transl_table=11
FT                   /gene="SCO0431"
FT                   /gene_synonym="SCF51A.09c"
FT                   /product="putative secreted protein"
FT                   /note="SCF51A.09c, possible secreted protein, len: 442 aa;
FT                   similar to TR:Q9KZR1 (EMBL:AL353832) Streptomyces
FT                   coelicolor putative secreted protein SCE6.29, 454 aa; fasta
FT                   scores: opt: 614 Z-score: 655.9 E(): 6.7e-29; 31.278%
FT                   identity in 454 aa overlap. Contains a possible N-terminal
FT                   signal sequence"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL55"
FT                   /protein_id="CAB56661.1"
FT                   /translation="MRRLLARVPDPARAPLARGVATALALTLASSVLAASTSTAAAPAG
FT                   TERDGRPGGNAWFTSWAASQQNVAPTPLRDQSMRMITHLSQGGDAVRIRVQNTFGDSPL
FT                   TVDAATVAHSDGKDAATEGRPRPVTFDGRPRVVVPPGGEVWSDSTGLRTAAQDDIAVSL
FT                   SVSGTVAPGRHDSAFRTNYLTPPGSGDHTADPDGTAFTGTTGSTLLVSAVDVRNPRLRG
FT                   SLVAYGSSVVDGTGSTNCGPDCSRPGADLRWTDDLARRITSELPPNRQFAVANAGIGGT
FT                   TSAATCPGTGDSVRGLDAAARLERDVLSLHGVTGVLYYYGTNDLPAGCDAARIEASYRE
FT                   VFQRLRAAGIKVYVTPITPRPGYTDQHNRDRHAVGTFVSKWNSCGGTCDGILPFDQVLE
FT                   DPVRPNSINPPYDTGDGVHANIAGQQALADIVSLPMLAASARR"
FT   regulatory      150501..150504
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        150515..154252
FT                   /transl_table=11
FT                   /gene="SCO0432"
FT                   /gene_synonym="SCF51A.10"
FT                   /product="probable secreted peptidase"
FT                   /note="SCF51A.10, probable secreted peptidase, len: 1245
FT                   aa. Highly similar to  Streptomyces albogriseolus TR:P95684
FT                   (EMBL; D83672) subtilisin-like protease (1102 aa), fasta
FT                   scores opt: 1572 z-score: 1550.1 E(): 0 34.4% identity in
FT                   1259 aa overlap. Also similar to the much smaller
FT                   subtilisins e.g. Bacillus sp. (strain TA39) SW:SUBT_BACS9
FT                   (EMBL; X62369) subtilisin precursor (EC 3.4.21.62) (420
FT                   aa), fasta scores opt:  485 z-score: 483.5 E(): 1.4e-19
FT                   38.2% identity in 304 aa overlap. Contains a Pfam match to
FT                   entry PF00082 Peptidase_S8, Subtilase family and a possible
FT                   N-terminal signal sequence."
FT                   /db_xref="GOA:Q9RL54"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017296"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL54"
FT                   /protein_id="CAB56662.1"
FT                   /translation="MRRIRLLAAISAGLALAAGAVAPVPALASTPRPDAAAPSADHGTA
FT                   TDHGTATVKLITGDSVTVTRAGDGRQAASVTPGPGRRGVLFRTLEQDGHVTVLPSDADA
FT                   LVAAGRLDRDLFDVTALLAQRYDTAHTDALPLIVERAEGVAASSVNALTDLARDASVRE
FT                   LDSIDARAVRVDEAELGRFWKRLVPAGGQRAKAAAATPRVWLDGRVGASLDRSTAQIGA
FT                   PDVWSAGYRGDGVKVAVLDTGADQSHPDLAGRVAAAKDFSGSSGTNDVFGHGTHVASIV
FT                   GGSGAASGGSRQGVAPAARLLVGKVLGDDGFGSESQVIAGMEWAADQGADVVNMSLGSS
FT                   GATDGTDPMSQALNDLSRRTGTLFVVAAGNEGEQGPRTVGSPGAADAALTVGAVDRDDS
FT                   LAPFSSRGPRLGDDAVKPDVTAPGVGIVAARAAGSAMGDPVDEHYTAASGTSMATPHVA
FT                   GAAALLAQRHPDWTGAQLKDALISTAVTVDGQKVTEQGGGRIDVRAAGLGAVTATGTLV
FT                   MGPFTSRDTEPVTSRVRYTNSSDEDVTLSLAVELATEGGKAPAEGSARLGSDSVRVPAG
FT                   SSAEVPLTVDPARAGQGKFYGYVTATTADGSVAAHTTLSLVVHGPTHRITVRTIDKDGE
FT                   QVADLPTIWGAEGFVGYSDPAAAVAEVEEGVYQLNTSWTTSAEDGEELRHVVLPEVKVT
FT                   KDMTVTLDARKTVPVEIRTPRPAEQRGILSYQTYREIGGRSLTQGTMYFDIAKRLYISP
FT                   TAKVTEGTFEFASRWQLVAPLVEAKVSRTGFDLGAYYMPASPLLPERGATLTAVDAGVA
FT                   ADADFSRARGRVAVVDNPTGAGERALVERAAAAGVSAVILVHFNDTGWTRWRPTGDRNA
FT                   LPTLRIGKGTGAELLARIARGSTSVRFSGTARSPYLYDVMQVSEQQVPRKVVHSVSARN
FT                   SAVVRTTYADNGVTGWASEQRFGWRPYQNTAWLQYTRFVPLGFERTEYVSAGDTAWQHR
FT                   VHHTTTFDVDQPLIAGMRDDPRTYRAGVRPRETWQGAVVRPSIPAGTTTPTVRDGNVLR
FT                   LRVAEFTDSQAGHWSPPSGGDTASAVLYRDGERVDGVGSAWQNVTVPAERARYRLDMET
FT                   SRDSEAWTRGVATSTSWSFESGRTDAAAPLSLLQLDYDVPVDVRNSVRGTRSHHVEVRV
FT                   RTQEGLPVPRGVSVRVEASYDDGRTWSSARTHAHGRNAFRASLTPPARGESWVTLRVTA
FT                   RDAAGDSVRQTVQRAYAVRR"
FT   misc_feature    151166..152035
FT                   /note="Pfam match to entry PF00082 Peptidase_S8, Subtilase
FT                   family, score 187.70, E-value 1.8e-52"
FT   regulatory      154359..154363
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        154370..155374
FT                   /transl_table=11
FT                   /gene="SCO0433"
FT                   /gene_synonym="SCF51A.11"
FT                   /product="putative transcriptional regulator"
FT                   /note="SCF51A.11, possible transcriptional regulator, len:
FT                   334 aa. Similar to Streptomyces coelicolor TR:Q9ZBT5 (EMBL;
FT                   AL034446) putative regulatory protein SC1A9.17C (327 aa),
FT                   fasta scores opt: 494 z-score: 573.8 E(): 1.3e-24 36.9%
FT                   identity in 333 aa overlap. Contains a possible
FT                   helix-turn-helix motif between residues 290..311 (+2.71
FT                   SD)."
FT                   /db_xref="GOA:Q9RL53"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL53"
FT                   /protein_id="CAB56663.1"
FT                   /translation="MVLEIAGLSPDEESVYALLVTFGRAGAADLAERDGMPVERMDRVL
FT                   ESLTAKGLASPTDGVPRLYQAAPPDVALLPRLKRSAEALDLAQHEAARLIESYRDTMRR
FT                   RDAGQLLEVITGAEALRQHLRQIQTSVREEMLWFCKAQYVAMPSGSNTEEFEALARGVR
FT                   YRVLYEKAFFDDEGAVDNVVAGVRAGEVARAVPQLPLRLAIADRAVAVFPLVAGGPHGS
FT                   PEEPTTALVRDSNLLAALIALFERYWEDAVPLDVDDSGELSGTDGPAAPDALAPTDRRL
FT                   LSLLVAGVADKAIASQMQLSRRTVQRRIQGMMERANAATRMQLAWQAARRGWL"
FT   CDS_pept        155546..157195
FT                   /transl_table=11
FT                   /gene="SCO0434"
FT                   /gene_synonym="malX"
FT                   /product="sugar phosphotransferase"
FT                   /note="SCF51A.12, malX, sugar phosphotransferase, len: 549
FT                   aa. Highly similar to Escherichia coli SW:PTOA_ECOLI (EMBL;
FT                   M60722) PTS system, maltose and glucose-specific II ABC
FT                   component (maltose and glucose-permease II ABC component)
FT                   (phosphotransferase enzyme II, ABC component) (EC 2.7.1.69)
FT                   (523 aa), fasta scores opt: 1852 z-score: 2064.1 E():0
FT                   59.5% identity in 543 aa overlap. Contains a Pfam match to
FT                   entry PF00367 PTS_EIIB, phosphotransferase system, EIIB and
FT                   a Prosite hit to PS01035 PTS EIIB domains cysteine
FT                   phosphorylation site signature. Contains multiple possible
FT                   membrane spanning hydrophobic domains"
FT                   /db_xref="GOA:Q9RL52"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011301"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL52"
FT                   /protein_id="CAB56664.1"
FT                   /translation="MQKTKAALWEFLQGLGKTFMLPVALLAFCGIMLGIGSSLSSDAVT
FT                   DNVAFLKGEGFHLVFTWMANTGLVAFTFLPVLFAMAIPLGLAREDKGVAAFSGFVGFVA
FT                   MNLAVNFYLTAKGVDFEDEKAIEHYGIADVLGVQSIDTGLLGAVAVGIVVSLLHRRFRT
FT                   QRMPDALAFFGGLRFVPIVSALVLSVLGLLIPLVWPTFNGWISAVGRGIGHTGVFGPFF
FT                   FGMGEVLLRPIGLHHILVAMFRFTDVGGSGTVCGDHVSGALNLFYAQLDCSAAPGSAVT
FT                   DATHFLSQGKMAAYLGGLPGAALAMYHCARRRMRPEIKALLVSGVVACVVGGITEPLEF
FT                   LFLFVAPWLYLVHAVLVGLGFLTAAVLGVFIGNTDGNVIDWLVFGVLQGSTTKWYLVPV
FT                   IAAVWFAAYYFLFRWAITRFDLKTPGREDPPADDDHDEHDEHDGAHDAEHAEEQVRAAP
FT                   EPARELVAGKYDAAAMLDAIGGAGNIRSLDNCITRLRMTVADAEAVDEARLKKLGAVGV
FT                   VKLDGHNVQVVIGPQVQSVKDAIATMVPAGRP"
FT   misc_feature    156956..157060
FT                   /note="Pfam match to entry PF00367 PTS_EIIB,
FT                   phosphotransferase system, EIIB, score 51.00, E-value
FT                   3.7e-13"
FT   misc_feature    156992..157045
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT   CDS_pept        157192..158397
FT                   /transl_table=11
FT                   /gene="SCO0435"
FT                   /gene_synonym="malY"
FT                   /product="aminotransferase"
FT                   /note="SCF51A.13, malY, aminotransferase, len: 401 aa.
FT                   Highly similar to Escherichia coli SW:MALY_ECOLI (EMBL;
FT                   M60722) MalY protein (EC 2.6.1.-) (390 aa), fasta scores
FT                   opt: 1577 z-score: 1814.7 E():0 58.5% identity in 386 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9RL51"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL51"
FT                   /protein_id="CAB56665.1"
FT                   /translation="MTAHSAPAAPGPASAPYDFDTPVDRRGTWCTQWDYVQDRFGVPDL
FT                   LPFTISDMDFETAPEVLAALRGRLEHGVLGYSRWRQDDFLSAIVHWYAARHGTAVDPGS
FT                   VVYAPSVVYQVSRLLHLWSRPGDGVVAHTPMYDAFPRTVAASGRRLLECPLDDWPELER
FT                   LLALPDTAVLLLCSPHNPTGRVWSAAELDRMARLCARHGVAVVSDEIHSDLAHAPHLHR
FT                   PWVRHAGDGRWAVVTSASKSFNIPALTGSYGIIGDPASRDAYLRQLKDADGLSSPAVLS
FT                   LVGHIAAYREGAPWLDALRTYLAGNLAMVADRLRAAFPGLDWRPPQAGYLAWIDLRPLG
FT                   VDDEELQRELVEVEKVAVMPGAAYGSPGRVRLNVGCPRSKAEAGVEALVRALGRLTGTQ
FT                   RR"
FT   regulatory      158469..158476
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        158484..158654
FT                   /transl_table=11
FT                   /gene="SCO0436"
FT                   /gene_synonym="SCF51A.14"
FT                   /product="probable 50S ribosomal protein"
FT                   /note="SCF51A.14, possible 50S ribosomal protein L32, len:
FT                   56 aa. Similar to many including: Helicobacter pylori J99
FT                   SW:RL32_HELPY (EMBL; AE000540) 50S ribosomal protein L32
FT                   (48 aa), fasta scores  opt: 85 z-score: 146.1 E(): 0.89
FT                   30.2% identity in 43 aa overlap and highly similar to the
FT                   N-terminus of Streptomyces coelicolor TR:Q9ZBQ8 (EMBL;
FT                   AL034447) 50S ribosomal protein L32 SC7A1.15 (57 aa), fasta
FT                   scores opt: 165 z-score: 258.9 E(): 4.6e-07 82.1% identity
FT                   in 28 aa overlap."
FT                   /db_xref="GOA:Q9RL50"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RL50"
FT                   /protein_id="CAB56666.1"
FT                   /translation="MAVPKRRMSRSNTRHRRAQWKASTPNLVPVTVDGVTLRVPRHLVP
FT                   AYRRGLLRPEI"
FT   CDS_pept        complement(158670..159695)
FT                   /transl_table=11
FT                   /gene="SCO0437"
FT                   /gene_synonym="SCF51A.15c"
FT                   /product="conserved hypothetical protein SCF51A.15c"
FT                   /note="SCF51A.15c, hypothetical protein, len: 341 aa;
FT                   similar to TR:Q9A8Z7 (EMBL:AE005797) Caulobacter crescentus
FT                   hypothetical protein CC1198, 331 aa; fasta scores: opt: 855
FT                   Z-score: 977.0 E(): 8.7e-47; 45.181% identity in 332 aa
FT                   overlap"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL49"
FT                   /protein_id="CAB56667.1"
FT                   /translation="MPLSTHAARFAQLALANITREYPNFPAHLITSADERPEPRSLHPA
FT                   FYGAYDWHSSVHMHWLLVRLLRRHGGTSALPGTEEAVAALDRHLTPGNLATEAAYLRER
FT                   PSFERPYGWAWLLALAAECRALGGPEGQRWAGALEPAVDAVDALLADWLPKATYPVRHG
FT                   NHPNSAFALGLALDSGELPAGTERAVRERLLSWFADDHDAPAHWEPSGQDFLSPALTEA
FT                   DAMRRVLAPDRLARWLDRFLPGLGTGARCALLEVPVVSDHADPQIGHLLGLTLSRAAAL
FT                   RALADALPDGPVRARLDKAAGAHLTAGLPAVERGDFTTDHWLATFAALALDPVAPPAPR
FT                   H"
FT   CDS_pept        complement(159695..160345)
FT                   /transl_table=11
FT                   /gene="SCO0438"
FT                   /gene_synonym="pcp"
FT                   /product="pyrrolidone-carboxylate peptidase (EC 3.4.19.3)"
FT                   /note="SCF51A.16c, pcp, pyrrolidone-carboxylate peptidase
FT                   (EC 3.4.19.3), len: 216 aa. Highly similar to many e.g.
FT                   Bacillus subtilis SW:PCP_BACSU (EMBL; X66034)
FT                   pyrrolidone-carboxylate peptidase (EC 3.4.19.3)
FT                   (5-oxoprolyl-peptidase) (pyroglutamyl-peptidase I) (PGP-I)
FT                   (pyrase)(215 aa), fasta scores opt:  741 z-score: 820.9
FT                   E(): 0 52.3% identity in 214 aa overlap. Contains a Pfam
FT                   match to entry PF01470 Peptidase_C15, Pyroglutamyl
FT                   peptidase and a Prosite hit to PS01334
FT                   Pyrrolidone-carboxylate peptidase cysteine active site"
FT                   /db_xref="GOA:Q9RL48"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RL48"
FT                   /protein_id="CAB56668.1"
FT                   /translation="MTRVLITGFAPFGGERVNPSWQAASLVAAEPPAGLAVTAAELPCV
FT                   FGESLDALRDAIRADNPDLVLCLGQAGGRPGVTVERVGINVDDARIPDNAGGQPIDEPV
FT                   VPDGPAAYFSTLPVKACVAAMREAGVPAAVSNTAGTFVCNHVAYGLGHLIATEFPHLRG
FT                   GFAHVPWAPEQVPDGTAPALPPATVAHGLRALLAAAARTPAEQDLKVTEGATH"
FT   regulatory      complement(159706..159711)
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(159737..160342)
FT                   /note="Pfam match to entry PF01470 Peptidase_C15,
FT                   Pyroglutamyl peptidase, score 333.00, E-value 3.3e-96"
FT   misc_feature    complement(159914..159961)
FT                   /note="PS01334 Pyrrolidone-carboxylate peptidase cysteine
FT                   active site"
FT   regulatory      complement(160352..160356)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(160393..161367)
FT                   /transl_table=11
FT                   /gene="SCO0439"
FT                   /gene_synonym="SCF51A.17c"
FT                   /product="putative membrane protein"
FT                   /note="SCF51A.17c, possible membrane protein, len: 324 aa.
FT                   Contains a possible N-terminal signal sequence and multiple
FT                   possible membrane spanning hydrophobic domains."
FT                   /db_xref="GOA:Q9RL47"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL47"
FT                   /protein_id="CAB56669.1"
FT                   /translation="MIKVEWLYWLIGLVFVVMAVQMAMDRSNPKRWTSAAFWGLLGLTF
FT                   PYGTGVANATAGNGGWTLPAEPLGVAVLALIVLAGFNFLGKGVPVTTTGEQREAAAARL
FT                   GNKIFVPALTIPLVAIVCASVLDESGLFETGKATLLGLGLGCVAALVVGMLVTGEKKLS
FT                   VPIHSGRSMLEAMGSALLLPQLLAVLGSIFAAAGVGDQVGDIMNKVLPDDSKYFAVLAY
FT                   CVGMFLFTVIMGNAFAAFPVMTAAIGWPVLIQQMHGNEPAVLAIGMLAGFAGTLCTPMA
FT                   ANFNIVPATLLELKDQYGPIKAQLPTGIALLGCCTVIMALFAF"
FT   CDS_pept        complement(161364..162083)
FT                   /transl_table=11
FT                   /gene="SCO0440"
FT                   /gene_synonym="SCF51A.18c"
FT                   /product="possible integral membrane protein"
FT                   /note="SCF51A.18c, possible integral membrane protein, len:
FT                   239 aa. Contains multiple possible membrane spanning
FT                   hydrophobic domains."
FT                   /db_xref="GOA:Q9RL46"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL46"
FT                   /protein_id="CAB56670.1"
FT                   /translation="MIVLLGVVVVILGFVTRRNPVLVVGVAGIVTGLLGKMNPLEVLAA
FT                   FGRSFADSRSVTVYAIVLPVIGLLERYGLREQARHLIGRLGKLSAGRFLTVYLLVRQVT
FT                   AAFGLNSIGGPAQTVRPLVAPMAEAAAERSTGAKLPDKLREKVRSYSASADTVGVFFGE
FT                   DCFIAIGSILLITGFVNSTYHQDIEPTQLALWAIPLAVCAFLIHGARLLLMDKQLEREM
FT                   AQAAAEHDLPLPEGAEK"
FT   CDS_pept        162350..163102
FT                   /transl_table=11
FT                   /gene="SCO0441"
FT                   /gene_synonym="SCF51A.19"
FT                   /product="conserved hypothetical protein SCF51A.19"
FT                   /note="SCF51A.19, unknown, len: 250 aa. Similar to
FT                   hypothetical proteins e.g. Bordetella pertussis TR:O30444
FT                   (EMBL; AF006000) hypothetical 26.3 KD protein (252 aa),
FT                   fasta scores opt:  742 z-score: 794.0 E(): 0 47.4% identity
FT                   in 247 aa overlap."
FT                   /db_xref="GOA:Q9RL45"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RL45"
FT                   /protein_id="CAB56671.1"
FT                   /translation="MIDLNADLGEGFGRWTLTDDDALLSVVTSANVACGFHAGDPSVMR
FT                   RVCDLAAERGVRIGAQVSYRDLAGFGRRAMDVPSDELAAEVAYQIGALRVFAEAAGAPV
FT                   AYVKPHGALYNRTVHDEGQARAVVAGVRLAGGALPVLGLPGSRLLTAAAEAGLTGVPEA
FT                   FADRAYTAEGSLVPRSEAGSVVTDEDAVVRRALAFAVEGSVEAVDGTAVAVAARSLCVH
FT                   GDTPNAARIAARVREALETAGVGIGAFA"
FT   CDS_pept        163099..163857
FT                   /transl_table=11
FT                   /gene="SCO0442"
FT                   /gene_synonym="SCF51A.20"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCF51A.20, unknown, len: 252 aa. Similar to a number
FT                   of hypothetical proteins e.g. Escherichia coli
FT                   SW:YBGJ_ECOLI (EMBL; AE000174) hypothetical 23.9 KD protein
FT                   in phrB-nei intergenic region (218 aa), fasta scores: opt:
FT                   477 z-score: 492.1 E(): 4.7e-20  43.5% identity in 214 aa
FT                   overlap"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL44"
FT                   /protein_id="CAB56672.1"
FT                   /translation="MTDGRPLTARPAGRHALLVELRDAEHTAAFHAEVLRRRAAGALPP
FT                   VTEVVPGARTVLLDGVPDPDALARRVADWQVPPVADDTGAVVEIPVRYDGPDLADVAAL
FT                   WGVGPDEVGALHRSHAYRVAFCGFAPGFGYLTGLPPRLHVPRRSTPRTRVPAGAVALAG
FT                   PYSAVYPRATPGGWQLIGTMPDPRPLWDPARERAALLTPGTRVRFVTADGTCAGPGTGT
FT                   GTGTETGTGTGTETGSGDDPTAGTSPEAGA"
FT   regulatory      163842..163846
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        163854..164711
FT                   /transl_table=11
FT                   /gene="SCO0443"
FT                   /gene_synonym="SCF51A.21"
FT                   /product="conserved hypothetical protein SCF51A.21"
FT                   /note="SCF51A.21, unknown, len: 285 aa. Similar to a number
FT                   of hypothetical proteins e.g. Mycobacterium tuberculosis
FT                   TR:P95220 (EMBL; Z86089) hypothetical 32.2 KD protein (300
FT                   aa), fasta scores opt: 714 z-score: 663.0 E(): 1.4e-29
FT                   45.3% identity in 289 aa overlap. Also similar in parts to
FT                   Pseudomonas fluorescens TR:CAB48407 (EMBL; AJ243652) urea
FT                   amidolyase homologue (1213 aa), fasta scores opt: 423
FT                   z-score: 390.1 E(): 2.3e-14 37.7% identity in 289 aa
FT                   overlap"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL43"
FT                   /protein_id="CAB56673.1"
FT                   /translation="MTTRLTTVRAGALTTVQDAGRPGHAHLGVPRSGALDAPAMRLANR
FT                   LLGNDPDTAVLETTLTGCALRPDRDVAAVVGGAPCAVTVDGRPAAWGAPVRVPAGSVLD
FT                   VGTATGGVRSYVAVAGGIAAEPVLGSRSTDLLSGLGPTPLRDGDVLAVGAPARPAPPPV
FT                   AAPWPGPPAELVLPVRPGPRADWFTPAALRTLTSAAYRVSPHSNRIGLRTEGPPLQRLS
FT                   TGELPSEGMVLGAVQVPPDGRPVIFLHDHPTTGGYPVVAVVPEPALAAAAQAVAGTPVR
FT                   FTLA"
FT   CDS_pept        complement(164698..165099)
FT                   /transl_table=11
FT                   /gene="SCO0444"
FT                   /gene_synonym="SCF51A.22c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCF51A.22c, possible integral membrane protein, len:
FT                   133 aa. Contains possible membrane spanning hydrophobic
FT                   domains."
FT                   /db_xref="GOA:Q9RL42"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL42"
FT                   /protein_id="CAB56674.1"
FT                   /translation="MVSSSRARVAARDDPGRTRSAAAVSAVLVVGAGLALRALAAGEVA
FT                   KYGGDALYTLLLFALVFAAAPRTAPAKAAALALAVSWGVEFLQLSDVPAHLARQSTAAR
FT                   LVLGSTFNAPDLFWYAVGAATGWLAVRRA"
FT   CDS_pept        complement(165207..166502)
FT                   /transl_table=11
FT                   /gene="SCO0445"
FT                   /gene_synonym="SCF51A.23c"
FT                   /product="putative secreted protein"
FT                   /note="SCF51A.23c, possible secreted protein, len: 405 aa.
FT                   Contains a possible N-terminal signal sequence."
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL41"
FT                   /protein_id="CAB56675.1"
FT                   /translation="MLTPSSRRRGSAPRRRPRTARALTGTVCLLALSGTTLAAAPAPAA
FT                   DPVPPAPVSWRADLSRTGTDDVNVRYDAGALRVRDGSLSPASLGRDRGYASAVLDPHHV
FT                   GRPVDRVTVDLDATVPDAAGVEVDVRGRAADGAWTEWRRAAPGAPAELPREVVDVQARL
FT                   TLWNARGGPTAAVRALTLTADDAGTAPAEPAPATRAAAFSARVYATREGLVGHTTANGH
FT                   VIGANDHFVALPSRRALSPNGSGQYSVQVCGPARCETAPVWDVGPWNTHDDHWNPSAQR
FT                   EQWKDLPQGLPQAQAAYEDGYNGGRDEFGRQVANPAGIDLADGTFYNVGLNDNGWVTVT
FT                   YLWTEGGGDTTSFPTWGTDVSVRQRATTDSTRVASLPGPTTVRVRCQVHGQLVDYDGYS
FT                   NDAWSYLPDYGGYVSNIFIDVADSWLPGVPTC"
FT   CDS_pept        complement(166496..166861)
FT                   /transl_table=11
FT                   /gene="SCO0446"
FT                   /gene_synonym="SCF51A.24c"
FT                   /product="hypothetical protein SCF51A.24c"
FT                   /note="SCF51A.24c, unknown, len: 121 aa; similar to
FT                   C-terminal of SCF51A.23C TR:Q9RL41 (EMBL:AL121596) putative
FT                   secreted protein from Streptomyces coelicolor (431 aa)
FT                   fasta scores; opt: 408,  Z-score: 470.3, E(): 1.4e-18,
FT                   70.115% identity (70.115% ungapped) in 87 aa overlap."
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL40"
FT                   /protein_id="CAB56676.1"
FT                   /translation="MTTGVRTTPAIRGRLRRTPRPGPGLGLLHGLARGDDGVTATPFVT
FT                   RETDVSVRQQPTTDSARVARPPGPTSVRVACQVHGGLVEYDGYSNDAWSHLPDHGGYVS
FT                   SIFIDVDDARPPGAPTC"
FT   regulatory      complement(166510..166514)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(166869..166874)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      166984..166988
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        166990..167436
FT                   /transl_table=11
FT                   /gene="SCO0447"
FT                   /gene_synonym="SCF51A.25"
FT                   /product="putative MarR-family regulatory protein"
FT                   /note="SCF51A.25, possible MarR-family regulatory protein,
FT                   len: 148 aa. Similar to many hypothetical proteins with
FT                   similarity to the MarR family of transcriptional regulators
FT                   e.g. Mycobacterium tuberculosis SW: YZ08_MYCTU (EMBL;
FT                   Z73101) hypothetical 15.6 KD protein CY31.08 (143 aa),
FT                   fasta scores opt:  256 z-score: 328.8 E(): 5.9e-11 34.1%
FT                   identity in 135 aa overlap. Contains a Pfam match to entry
FT                   PF01047 MarR, MarR family"
FT                   /db_xref="GOA:Q9RL39"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL39"
FT                   /protein_id="CAB56677.1"
FT                   /translation="MSENESPSPSAVQASREVRAVISRLRRRILKASEVEDLTLGQSSV
FT                   LARLSDRGSITASELAAIEGVRHQSMTATVTALASMGLVERRPDPDDGRRLLITLTPEG
FT                   VRRVEEGRQVRTEWLAERLQDRCTEEERRTVIAAMAVLERLNRD"
FT   misc_feature    167101..167415
FT                   /note="Pfam match to entry PF01047 MarR, MarR family, score
FT                   95.90, E-value 8.2e-25"
FT   CDS_pept        167504..168909
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="SCO0448"
FT                   /gene_synonym="SCF51A.26"
FT                   /product="putative transmembrane efflux protein
FT                   (pseudogene)"
FT                   /note="SCF51A.26, putative transmembrane efflux protein
FT                   pseudogene, len: 86 aa. Similar to Streptomyces coelicolor
FT                   TR:CAB42035 (EMBL; AL049754) putative transmembrane efflux
FT                   protein (484 aa). Sequence contains a likely frame shift,
FT                   within a well sequenced region, between bases
FT                   26483..26492."
FT   CDS_pept        169153..170232
FT                   /transl_table=11
FT                   /gene="SCO0449"
FT                   /gene_synonym="SCF51A.27"
FT                   /product="possible secreted solute-binding lipoprotein"
FT                   /note="SCF51A.27, possible secreted solute-binding
FT                   lipoprotein , len: 359 aa. Weakly similar to many
FT                   solute-binding proteins e.g. Streptomyces coelicolor
FT                   TR:O69944 (EMBL; AL023862) putative secreted solute binding
FT                   protein SC3F9.04 (348 aa), fasta scores opt:  231 z-score:
FT                   259.4 E(): 4.3e-07 23.2% identity in 366 aa overlap.
FT                   Contains a possible N-terminal signal sequence and an
FT                   appropriately positioned Prosite hit to, PS00013, a
FT                   prokaryotic membrane lipoprotein lipid attachment site."
FT                   /db_xref="GOA:Q9RL38"
FT                   /db_xref="InterPro:IPR013459"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL38"
FT                   /protein_id="CAB56679.1"
FT                   /translation="MHKTPARRASVLVAAVSSLSLLTAGCGDGDGPVDDDTAANAKNAE
FT                   ASPNAPTKTGLTVGFLPKQVNTPYFAVADRGGERAVESLGSTFKEVGTDQGADASGQVS
FT                   HINGLTEQKADAIAVSALDPDALCDALKKAMAKGVKVVTYDSDTKPECRYAFVSPASAE
FT                   DIAVRQLELLGEQTGYQGDIAILSAAQTATNQNAWISSIKRELEGPRYKEMRLVDVVYG
FT                   DDEAEKSYQKAEELLREHGKLKGIISPTTNGIKAAAKYLSQSEYKGEVKLTGLGAPNDM
FT                   RPYIKDGTVEAFLLWDPAKLGELAGHAAVALASGQITGREGQMFLAGDMGWFQLTGNGV
FT                   ITLGEPTVFDAGNIDDYDF"
FT   misc_feature    169198..169230
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        complement(170315..171304)
FT                   /transl_table=11
FT                   /gene="SCO0450"
FT                   /gene_synonym="SCF51A.28c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCF51A.28c, possible integral membrane protein, len:
FT                   326 aa. Weakly similar to a number of sensory transduction
FT                   histidine kinases e.g. Synechocystis sp. (strain PCC 6803)
FT                   TR:P72791 (EMBL; D90900) (834 aa), fasta scores opt:  172
FT                   z-score: 187.7 E(): 0.0042 23.7% identity in 317 aa
FT                   overlap. Contains multiple possible membrane spanning
FT                   hydrophobic domains."
FT                   /db_xref="GOA:Q9RL37"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL37"
FT                   /protein_id="CAB56680.1"
FT                   /translation="MAAVVGIRAWPRPVVLTCATLLLAGCYYAAGRLGLSQQLTADGSV
FT                   VTPIWPPTGLAVACLLLFGPWCVPGIALGALLVIVSLGAPGPEAAGIVVGNTAAPVCAW
FT                   LLLRAVGFRLSLSRLRDGLALVFLGALAAMLISSCTGIGMLLLSGKLPTDHLGIVWLAW
FT                   WVGDAMGVVLVTPLLLLLYRARLPPPSARWPEAAGLTAVVCVLVPLIMYSSVSVLFLAY
FT                   PILIWSALRFQLAGGIPCALFVSVTATVVARQEAGSFGKLTDIETMMKLQAFNGTLGLT
FT                   ALLLSAVISEQLNTRRSVERACHELVEALQHLNAGGSGAPGPPGGDGR"
FT   CDS_pept        complement(171355..172209)
FT                   /transl_table=11
FT                   /gene="SCO0451"
FT                   /gene_synonym="SCF51A.29c"
FT                   /product="conserved hypothetical protein SCF51A.29c"
FT                   /note="SCF51A.29c, unknown, len: 284 aa. Similar to the
FT                   C-terminus of many hypothetical proteins e.g. Mycobacterium
FT                   tuberculosis SW:Y07S_MYCTU (EMBL; Z75555) hypothetical 69.5
FT                   KD protein CY02B10.28C (653 aa), fasta scores opt:  390
FT                   z-score: 451.1 E(): 9.1e-18 33.5% identity in 263 aa
FT                   overlap. In addition to Bacillus subtilis SW:RSBU_BACSU
FT                   (EMBL; L35574) sigma factor SibG regulation protein RsbU
FT                   (335 aa), fasta scores opt: 206 z-score: 243.6 E(): 3.3e-06
FT                   24.3% identity in 185 aa overlap."
FT                   /db_xref="GOA:Q9RL36"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL36"
FT                   /protein_id="CAB56681.1"
FT                   /translation="MFRKRPAPDGEELLARLASLTTRAKELAELRRSQVELAIALQRDM
FT                   LPADLPAVPGIHLAACYSPAYAGLNVGGDWYDAFALPDGRIGLSVGDVQGHAIDAAAFM
FT                   GQVRVGLRALASVTSEPGDLLACTNELLLSLNKDLFATCTFMRYDPATGLLESARAGHI
FT                   PCVRATADGRAEVCRDEGGPPLGVLEGTEYPVTRYRLATGGVFVLVTDGVVEGPSLSVD
FT                   EGLDRVVRLASLAAAVGMEADALAAAVLKNAELIGHEDDAAVLVVGHDGRGATRGLARG
FT                   VTP"
FT   regulatory      complement(172216..172219)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        172415..173314
FT                   /transl_table=11
FT                   /gene="SCO0452"
FT                   /gene_synonym="SCF51A.30"
FT                   /product="putative SIR2-like regulatory protein"
FT                   /note="SCF51A.30, possible SIR2-like regulatory protein,
FT                   len: 299 aa. Similar to several Eukaryotic proteins e.g.
FT                   Homo sapiens TR:AAD40852 (EMBL; AF083109) sirtuin type 4
FT                   (314 aa), fasta scores  opt:  736 z-score: 829.3 E(): 0
FT                   46.3% identity in 255 aa overlap. Also similar to several
FT                   Prokaryotic proteins e.g. Archaeoglobus fulgidus TR:O30124
FT                   (EMBL; AE001098) transcriptional regulatory protein, SIR2
FT                   family (253 aa), fasta scores opt: 319 z-score: 364.7 E():
FT                   5.9e-13 31.9% identity in 257 aa overlap."
FT                   /db_xref="GOA:Q9RL35"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RL35"
FT                   /protein_id="CAB56682.1"
FT                   /translation="MRMRPTLSWTPGADLPPGTTDLAPVADALRAGGVLVLSGAGISTE
FT                   SGIPDYRGEGGSLSRHTPMTYQDFTAHPEARRRYWARSHLGWRTFGRARPNAGHRSVAA
FT                   FGRHGLLTGVITQNVDGLHQAAGSEGVVELHGSLDRVVCLSCGVLSPRRELARRLEEAN
FT                   AGFSPVAAGINPDGDADLTDEQVGDFRVVPCAVCGGVLKPDVVFFGENVPPRRVEHCRE
FT                   LVRGASSLLVLGSSLTVMSGLRFVRQAAEAGKPVLIVNRDATRGDRLAVTRVALPLGPA
FT                   LTTVADRLGLRVGDAATA"
FT   regulatory      173445..173448
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        173458..174747
FT                   /transl_table=11
FT                   /gene="SCO0453"
FT                   /gene_synonym="SCF51A.31"
FT                   /product="probable secreted solute-binding lipoprotein."
FT                   /note="SCF51A.31, probable secreted solute-binding
FT                   lipoprotein, len: 429 aa. Weakly similar to many putative
FT                   solute-binding proteins e.g. Bacillus subtilis
FT                   SW:YURO_BACSU (EMBL; Z99120) hypothetical ABC transporter
FT                   extracellular binding protein YurO (422 aa), fasta scores
FT                   opt:  235 z-score: 270.1 E(): 1.1e-07 19.9% identity in 422
FT                   aa overlap. Contains a Pfam match to entry PF01547
FT                   SBP_bacterial_1, an appropriately positioned Prosite hit to
FT                   PS00013, a prokaryotic membrane lipoprotein lipid
FT                   attachment site and also contains a possible N-terminal
FT                   signal sequence."
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="PDB:3I3V"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL34"
FT                   /protein_id="CAB56683.1"
FT                   /translation="MRSSLTRRELLAAGSGLAAAAALPALSGCSSLASADSDPDTLVVH
FT                   TQLGTTAPGSPTYLAAVDRFREENPGVKIKNLVNGDDLAQVYETSRLARKEADVVMVNL
FT                   YDKTLAWTDVGATVDVKPYLDDWGLRGRVLPAALADWTDDEGRVRAFPYFATNWPVAYN
FT                   RALLDRAGVDAIPTTGDQLIAAARKLRAKGIAPVTVGGNDWTGQKLLAQIIQTFLSQDE
FT                   ARHVYSTGDFGVRGARLGIEYFAHLRDAGVFADKAQGLTSDSMTTQFNTEEAAVQSAMS
FT                   SALAKVPEKVAGHTEVGGWPLADGAAHDGPTVIRAYTLIGFWISPNGVRKIEQVEKFLR
FT                   FMYRPDVVARFVTESGRDMALRTDAVSTGFPLVGAAQRLGSEVSQVLLPDVYVPPAAAQ
FT                   PLITATSTSFTRGTSPARVRAALESAYRSV"
FT   misc_feature    173512..173544
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   misc_feature    173890..174729
FT                   /note="Pfam match to entry PF01547 SBP_bacterial_1, , score
FT                   33.50, E-value 4.7e-06"
FT   regulatory      174837..174840
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        174848..175789
FT                   /transl_table=11
FT                   /gene="SCO0454"
FT                   /gene_synonym="SCF51A.32"
FT                   /product="binding-protein dependent transport protein"
FT                   /note="SCF51A.32, probable binding-protein dependent
FT                   transport protein, len: 313 aa. Similar to many including:
FT                   Streptomyces coelicolor TR:CAB41203 (EMBL; AL049661)
FT                   putative  protein SCE134.05C (327 aa), fasta scores opt:
FT                   479 z-score: 546.7 E(): 4.3e-23 31.4% identity in 315 aa
FT                   overlap. Contains a Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component and a Prosite hit to PS00402
FT                   Binding-protein-dependent transport systems inner membrane
FT                   comp sign. Contains multiple possible membrane spanning
FT                   hydrophobic domains."
FT                   /db_xref="GOA:Q9RL33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL33"
FT                   /protein_id="CAB56684.1"
FT                   /translation="MTTLTTTPDGSAARRSVPPPSPAPAAGRRRQGGTVLAVPALVWYL
FT                   VFMVGPLLAIFVIAALHWPGMLQPVSFAGLDNARVVLDDPVFWDAVRNTAVQLAVAVPV
FT                   MIVCAFMLGYYVAQRPPGHRVIRYLLFIPGLISTPAKAMVFYAALSPDGLLNGGLESVG
FT                   LGSLADAWLASPSTALACLIALDIWAGIGFTAVLFAARLGSVPDELGEAAQLDGAGHWR
FT                   TMWSVHFPVIRDYVGVVTMLQFLWTLFGSAQHVLLLTQGGPGTSSTTLSFLVYQKAFIA
FT                   ADLGYSQTVGVLLFLAGLVGLLTIRRVFRQNY"
FT   misc_feature    175448..175684
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 40.90, E-value 2.8e-08"
FT   misc_feature    175451..175537
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp sign."
FT   CDS_pept        175804..176631
FT                   /transl_table=11
FT                   /gene="SCO0455"
FT                   /gene_synonym="SCF51A.33"
FT                   /product="putative binding-protein dependent transport
FT                   protein"
FT                   /note="SCF51A.33, putative binding-protein dependent
FT                   transport protein, len: 274 aa. Similar to many e.g.
FT                   Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides)
FT                   TR:O30833 (EMBL; AF018073) sorbitol/mannitol transport
FT                   inner membrane protein (276 aa), fasta scores opt:  452
FT                   z-score: 556.9 E(): 1.2e-23 32.0% identity in 272 aa
FT                   overlap. Contains a Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component. Contains multiple possible membrane spanning
FT                   hydrophobic domains."
FT                   /db_xref="GOA:Q9RL32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL32"
FT                   /protein_id="CAB56685.1"
FT                   /translation="MKLGKRWLPAHILVWTYAVLLVVPLYYFLASAFKSNDEIFAHPFA
FT                   PPSSLGLGNFRTAFESADLGLAVVNSALVTVFSLALTLLLAIPASFALARSTGRLAGVV
FT                   EKVFSLGFLIPTFAALFPTFLLAAATGLFHTRIFMVLFLPATALPLSVVILVQFMRTIP
FT                   PEMEEAARLDGASTFAVLRHVYTPMCLPGIATVLLLNFLTFWNEYLYSLVIIGPDPAQR
FT                   TVQVALPTLKSITGTDYGVLTAGTVLTLVPVWLVYTLLQKRMQQALVSGAVKM"
FT   misc_feature    176275..176502
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 49.80, E-value 6e-11"
FT   CDS_pept        176628..177671
FT                   /transl_table=11
FT                   /gene="SCO0456"
FT                   /gene_synonym="SCF51A.34"
FT                   /product="putative LacI family transcriptional regulator"
FT                   /note="SCF51A.34, possible LacI family transcriptional
FT                   regulator, len: 347 aa. Highly similar to several
FT                   including: Escherichia coli SW:CYTR_ECOLI (EMBL; X03683)
FT                   transcriptional repressor CytR (341 aa), fasta scores opt:
FT                   504 z-score: 574.2 E(): 1.3e-24 31.6% identity in 339 aa
FT                   overlap and Streptomyces coelicolor TR:O86598 (EMBL;
FT                   AL031514) putative transcriptional regulator SC2H4.15 (342
FT                   aa), fasta scores opt: 807 z-score: 915.3 E(): 0 44.4%
FT                   identity in 333 aa overlap. Contains a Pfam match to entry
FT                   PF00356 lacI, Bacterial regulatory proteins, lacI family, a
FT                   Pfam match to entry PF00532 Peripla_BP_like, Periplasmic
FT                   binding proteins and LacI family and a possible
FT                   helix-turn-helix motif between residues 13..34 (+5.95 SD)."
FT                   /db_xref="GOA:Q9RL31"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL31"
FT                   /protein_id="CAB56686.1"
FT                   /translation="MSISTERAGRRPTIKAVAAAAGVSTAAVSQAFNNKGRLSEATRRR
FT                   ILDAALELGWSPSASAAALRNARTRSLALVVRRPTDVLGSDPHFSELITGIEGELAPRG
FT                   YGLLLHLVSGHREENALYERLAAEGRVDGAVLTDARDDDARPALLARLGLPAVLLGSPD
FT                   DTAVVPRVGLRDQGAGIAEAVAHLLGLGHRRVAYVSGPPELQHTRVRRAAFEGALREAG
FT                   LRPFAVLPTDFSERRAVGATEALLDSADGPTAIVYANDSMAVCGIGTAQRAGLAVPRDV
FT                   SVVGYDNLPLGSWLHPRLTTVDQQVQRVGAAAARMLLALCGEEVEDTALAERPRLVVRE
FT                   STGPAPT"
FT   misc_feature    176655..176738
FT                   /note="Pfam match to entry PF00356 lacI, Bacterial
FT                   regulatory proteins, lacI family, score 34.10, E-value
FT                   3.9e-08"
FT   misc_feature    176829..177566
FT                   /note="Pfam match to entry PF00532 Peripla_BP_like,
FT                   Periplasmic binding proteins and LacI family., score 85.50,
FT                   E-value 1.1e-21"
FT   regulatory      177731..177735
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        177738..179672
FT                   /transl_table=11
FT                   /gene="SCO0457"
FT                   /gene_synonym="SCF51A.35"
FT                   /product="conserved hypothetical protein SCF51A.35"
FT                   /note="SCF51A.35, unknown, len: 644 aa; "
FT                   /db_xref="GOA:Q9RL30"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL30"
FT                   /protein_id="CAB56687.1"
FT                   /translation="MRRHSAQLIHQPDVLPWLGANFWSRTGGPLMWRNYDPAVVREELR
FT                   VLAGHGLNTTRSFFYWPDFHPEPDRVDDELCAWFEDFLDAHVETGMGTIPTFIVGHMSG
FT                   ENWDPVWRGDRDLYEDVWMVGRQAWFVSRMARRFKDHPAVTGWLITNEMPGYGRIYQVD
FT                   PPSTDVVTAWAQAMCNAVRATGATQPVSLGDGAWGIEVTGRDNGFSLRETAEYVDFVGP
FT                   HVYRSDTDRPRQHYRAAFECELASVTGQPVVLEEFGLSTDTVSAANAGIFYRQTLHNSL
FT                   LGGATGWLAWNNTDYDDLWDRSPYDHHPFEMHFGITDSTGAPKEPLRELAAFAGVLKAV
FT                   DFPRCSRTDADAALVVPAFLERGYPYSRPADRPLIFTSLHQGYVTARAADLPVALTREA
FT                   DGMPGEASLYLLPATRQLTTRTRRELARRAAEGATVYLSFCSGEHPVTRGPWFDDLDGL
FT                   FGVELQLSYGVAEPIEDDVLELTFTEDFGDLRAGEVLRFPVAGNEDSRAYLPVEPRAGR
FT                   VVAVDAHGRPALVVHETGAGRTVLSTYPLEHMAARTARVNPDVTQRLYGALAQLAGVRR
FT                   PVTVADPHVSADVLVHADGRRFVWLVSQSPDPLVVRPAAEGKLHDLADGAPVQDVALDA
FT                   YGVAVLELR"
FT   CDS_pept        179669..181957
FT                   /transl_table=11
FT                   /gene="SCO0458"
FT                   /gene_synonym="SCF51A.36"
FT                   /product="Beta-glucosidase (EC 3.2.1.21)"
FT                   /note="SCF51A.36, probable Beta-glucosidase (EC 3.2.1.21),
FT                   len: 762 aa. Highly similar to many e.g. Escherichia coli
FT                   SW:BGLX_ECOLI (EMBL; U15049) periplasmic Beta-glucosidase
FT                   precursor (EC 3.2.1.21) (765 aa), fasta scores   opt:  851
FT                   z-score: 896.9 E(): 0 32.2% identity in 773 aa overlap.
FT                   Contains 2x Pfam matches to entry PF00933 Glyco_hydro_3,
FT                   Glycosyl hydrolase family 3."
FT                   /db_xref="GOA:Q9RL29"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL29"
FT                   /protein_id="CAB56688.1"
FT                   /translation="MTLPLYRDPAAPVPDRVRDLLGRMTLAEKVGQVNQRMYGWDAYER
FT                   AGDGHRLTDAFRAEVAAFDGMGALYGLQRADAWSGVGFADGLDARDGARTAAAVQRYVM
FT                   DHTRLGIPVLLVEEMPHGHQALDGTVLPVNLAVGATWDPDLYADAVAGAAAELRARGAH
FT                   IALVSALDLVRDPRWGRSEECFSEDPYLAARMTEALVEGARRAGVAVVLKHFAGQGATV
FT                   GGRNSAATELGPRELHEVHLAAARAGVAAGAAGVMAAYNEFDGLPCVANRYLLTDLLRT
FT                   EWGFEGVVMADGTAVDRLVRLTGDPVSAGALALDAGCDLSLWDASFTRLGEAVERGLVS
FT                   ESALDAAVARVLTLKFRLGLFEQPLPPARSETVELPDPAELGERIARASVTLLAHEGGV
FT                   LPLSRAVRRIAVLGPNADSVAQQIGDYTAPQRPGGGITVLEGIRAAVAAGTEVVHDRGC
FT                   ALVGDDVSGVPAAVALAAGSDVAVLVLGGSSARSPDTVFDANGAAVTGTGTPSGMTCGE
FT                   GVDLADLALPPGQRALLTAVSATGTPVVVVLVQGRPHALTELDAPAAAVLSAWYPGPRG
FT                   GRAVAEVLFGDAEPRGRLPVSVPRSAAQLPVYYNGKDHRYRGYADQSAGPLHAFGHGLS
FT                   YTSVVYGAPRLSQARVGTRAPRLTCRVTVRNTGSRPAEETVQLYVRRLSGGSSWPRVRE
FT                   LRGFVRLTIAPGEEAEAVFEVDRDTLASVGRDLRLAVEPGLVELETGPASDRTTGVRLE
FT                   ITDSESNAT"
FT   misc_feature    179981..181045
FT                   /note="Pfam match to entry PF00933 Glyco_hydro_3, Glycosyl
FT                   hydrolase family 3, score 274.20, E-value 6.7e-83"
FT   misc_feature    181214..181906
FT                   /note="Pfam match to entry PF00933 Glyco_hydro_3, Glycosyl
FT                   hydrolase family 3, score 199.10, E-value 4.5e-60"
FT   CDS_pept        182012..182791
FT                   /transl_table=11
FT                   /gene="SCO0459"
FT                   /gene_synonym="SCF51A.37"
FT                   /product="hypothetical protein SCF51A.37"
FT                   /note="SCF51A.37, unknown, len: 259 aa. Similar to
FT                   Mycobacterium tuberculosis SW:YX26_MYCTU (EMBL; Z74024)
FT                   hypothetical 30.6 KD protein  CY274.26C (283 aa), fasta
FT                   scores opt:  268 z-score: 318.2 E(): 2.3e-10 28.9% identity
FT                   in 263 aa overlap."
FT                   /db_xref="GOA:Q9RL28"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL28"
FT                   /protein_id="CAB56689.1"
FT                   /translation="MFRARVVRTRRVSPSMQRVTVTGPGLGGFPWLGYDHWFRLFLQLP
FT                   HQRDLRLPEFTGSQWWQPYLAIPEDERPHCANYSVADYRRAAAELDIDFVVHRGPTGEV
FT                   EGRAAIWACGARPGDALALLDQGVLFDCPRDASEVTVVADETGLPATASIMRSLPEGTV
FT                   GRLIQEIPTDADRRELNAPAGVTVSWVVRRDGTSVPGAAALRELRRLTRADASGYAFVV
FT                   GESTLATEGRRHLHRLGLPKERITFSGFWKHEAMAAA"
FT   CDS_pept        complement(182810..183319)
FT                   /transl_table=11
FT                   /gene="SCO0460"
FT                   /gene_synonym="SCF51A.38"
FT                   /product="hypothetical protein SCF51A.38"
FT                   /note="SCF51A.38, unknown, len: 169 aa."
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RL27"
FT                   /protein_id="CAB56690.1"
FT                   /translation="MTDRAAEDVLLELLNTTPVVRGSVSDALGTPAEGRAWARGHGGTG
FT                   SDEEAAHLVAVRDALQDVVRGRRDPACLGGFLHGVSRLPVIEDGGLRWVLQVPDAHRLA
FT                   VELVLTWAHVEEARPGRLKPCGNPECRRFLLDRSKPNSARWCSMAECGNRMKARRHYQR
FT                   AKGPQA"
FT   CDS_pept        183456..184325
FT                   /transl_table=11
FT                   /gene="SCO0461"
FT                   /gene_synonym="SCF76.01"
FT                   /gene_synonym="SCF51A.39"
FT                   /product="putative hydrolase"
FT                   /note="SCF76.01, possible hydrolase, partial CDS, len: >228
FT                   aa. Similar to several hypothetical proteins e.g. from
FT                   Saccharomyces cerevisiae SW:YN93_YEAST (EMBLL:Z71679) (290
FT                   aa), fasta scores opt:  609 z-score: 749.0 E():0 42.4%
FT                   identity in 229 aa overlap. Also weakly similar to
FT                   Xanthobacter autotrophicus SW:HALO_XANAU (EMBL:M26950)
FT                   haloalkane dehalogenase (EC 3.8.1.5) (310 aa), fasta scores
FT                   opt:  151 z-score: 190.4 E():0.003 22.9% identity in 231 aa
FT                   overlap. Contains a Pfam match to entry PF00561
FT                   abhydrolase, alpha/beta hydrolase fold"
FT                   /note="SCF51A.39, possible hydrolase, partial CDS, len:
FT                   >113 aa. Highly similar to Saccharomyces cerevisiae (Bakers
FT                   yeast) SW:YN93_YEAST (EMBL; Z71679) hypothetical 32.8 KD
FT                   protein in BIO3-HXT17 intergenic region. In addition to
FT                   being similar to many dehalogenases e.g. Mycobacterium
FT                   tuberculosis SW:YU14_MYCTU (EMBL; Z77163) putative
FT                   haloalkane dehalogenase (EC 3.8.1.5) (300 aa), fasta scores
FT                   opt:  222 z-score: 292.5 E(): 6.2e-09 37.0% identity in 100
FT                   aa overlap"
FT                   /db_xref="GOA:Q8CK57"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK57"
FT                   /protein_id="CAD55442.1"
FT                   /translation="MSVAVHHRTATVDGLDVFYREAGDPRAPAVVLLHGFPTSSHMFRG
FT                   LIPKLADTYHVIAPDMIGFGYSAMPTVDAFDYSFDSLTDVTVGLLDQLGVERFAVYVQD
FT                   YGAPVAWRIATRTPHRVTAIVTQNGNGYTDGFVKDFWDGLFAYTDDPTPETEAPARAAL
FT                   SPGMVRWQYLNGVRDRSLVSPDTWSLDLALLDRPGNDAVQLTLFRDYPTNVGLYPRLQQ
FT                   YFRDTRVPLLAVWGANDEIFGPDGARAFRRDLPDAEIHLLDTGHFALETHLEEITGHMR
FT                   DFLARAGK"
FT   misc_feature    183639..184307
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 56.90, E-value 4.4e-13"
FT   CDS_pept        complement(184338..185267)
FT                   /transl_table=11
FT                   /gene="SCO0462"
FT                   /gene_synonym="SCF76.02c"
FT                   /product="putative oxidoreductase"
FT                   /note="SCF76.02c, possible oxidoreductase, len: 305 aa.
FT                   Similar to many hypothetical proteins e.g. Pyrococcus
FT                   horikoshii SW:APBA_PYRHO (EMBL; AP000006) probable
FT                   2-dehydropantoate 2-reductase (EC 1.1.1.169) (ketopantoate
FT                   reductase) (KPA reductase) (301 aa), fasta scores opt: 359
FT                   z-score: 419.9 E(): 4.9e-16 26.5% identity in 291 aa
FT                   overlap and Streptomyces coelicolor TR:Q9ZBV6
FT                   (EMBL:AL034443) putative oxidoreductase SC4B5.12C (323 aa),
FT                   fasta scores opt: 233 z-score: 274.7 E(): 6.1e-08 32.0%
FT                   identity in 322 aa overlap."
FT                   /db_xref="GOA:Q9RJH2"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJH2"
FT                   /protein_id="CAB56722.1"
FT                   /translation="MRIAVIGAGGVGGYFGARLAAAGNEVTFVARGGHLAAIRRSGLVV
FT                   HSPLGELRTSPDSVVASISELGPTDLVLVAVKLWDTQAVAEELRTSPAHGAPVLSLQNG
FT                   VHKDDVLRGRLTDEQVLGGVCFISAFIEEPGVVRHNGPLQKVVLGPYRSGSTATVRAVL
FT                   AAFRDAGIDAEGSDDIERAIWEKFVFLVGLSATTATVRQPVGVVRANERSRRLLYEVMA
FT                   ETVAVAQASGVRLDSGFAEDRLAFCDTLPAAMTSSMHNDLEKGNRLELPWLSGGVVDLA
FT                   DRLDVPVPRNRTVADILAPYVLGRPAGS"
FT   CDS_pept        185318..185932
FT                   /transl_table=11
FT                   /gene="SCO0463"
FT                   /gene_synonym="SCF76.03"
FT                   /product="conserved hypothetical protein SCF76.03"
FT                   /note="SCF76.03, unknown, len: 204 aa; similar to TR:Q9L1U0
FT                   (EMBL:AL138851) SCE59.14C hypothetical protein from
FT                   Streptomyces coelicolor (196 aa) fasta scores; opt: 357,
FT                   Z-score: 418.9, E(): 1.1e-15, 37.433% identity (40.230%
FT                   ungapped) in 187 aa overlap."
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJH1"
FT                   /protein_id="CAB56723.1"
FT                   /translation="MDAVQHQPPRTRVTAQLRALRFDAGTLCLNLVATVGRRPGVPVER
FT                   MGDAERLEAWCRGVGLTLADGYDPRDVLSSLHALRAAAHDIASGALDAHRPRQESVDLV
FT                   NLLARPAPPAPRLEVTADGAWVAEGRRALSKEALLSLVARDLIDLMTDEARRSRLAACA
FT                   SEVCRMLCLDSGGGRPRKWCSMRRCGNRAKAAGRRLRESAP"
FT   CDS_pept        complement(185973..187670)
FT                   /transl_table=11
FT                   /gene="SCO0464"
FT                   /gene_synonym="SCF76.04c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCF76.04c, possible integral membrane protein, len:
FT                   565 aa. Similar in parts to many hypothetical proteins e.g.
FT                   Streptomyces lividans TR:O86875 (EMBL; U22894) hypothetical
FT                   57.9 KD protein (547 aa), fasta scores  opt: 689 z-score:
FT                   806.6 E(): 0 41.7% identity in 439 aa overlap and
FT                   Streptomyces coelicolor TR:O86807 (EMBL; AL031031) putative
FT                   regulatory protein (916 aa), fasta scores opt: 329 z-score:
FT                   381.2 E(): 7.1e-14 26.5% identity in 582 aa overlap.
FT                   Contains a Pfam match to entry PF01590 GAF, GAF domain and
FT                   possible membrane spanning hydrophobic domains."
FT                   /db_xref="GOA:Q9RJH0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJH0"
FT                   /protein_id="CAB56724.1"
FT                   /translation="MSGIPEGEAGAALRALLTDSVVGLAVWDTGLRCVWVNDALERYDG
FT                   IARERRLGRRPRESLTGDTGELEALVRRVLATGRCVTGREYRVPTAPDSRRDRAFSASF
FT                   VRLHDDGGHILGVCMLMLVVTDRRWAGDRLAVVSEAGTRVGTTLDVMRTAQELADFTVP
FT                   LIADYVTVDLTEAVRLGEEPLDRLGRSQGRVPKFRRAGRASVHAGSPESLWLNGEVVYV
FT                   PETSPFMQVLSSGRPLLHPVLDPSHEAWLADDPARAAKIREFGMHSLLILPIHARGVLL
FT                   GVAVFVRTSNPTPFDDNDRLLAEELVARAALSLDNARRYTREHNTALALQRSLLPRRVH
FT                   GGTAMEVAARYLPADAEEGVGGDWFDVIGLPGGRLALVVGDVVGHGVNAAATMGRLGMA
FT                   IRTLADLDLPPGEVLTRLDRTFIRLTEDEEEGGGEVATMSATCVYAVYDPATRTCALAL
FT                   AGHPPPAVVHRGGDCSFPDLPHGLPLGVGLLPFPTAELELPAGSLLALFTDGLVEERDQ
FT                   DIEVGLRRVGRALTRGASSLEDLGTAVIGTLPATPPPDDVTLLLARGL"
FT   misc_feature    complement(186714..187388)
FT                   /note="Pfam match to entry PF01590 GAF, GAF domain, score
FT                   38.80, E-value 1.3e-07"
FT   CDS_pept        complement(187684..188514)
FT                   /transl_table=11
FT                   /gene="SCO0465"
FT                   /gene_synonym="SCF76.05c"
FT                   /product="non-heme chloroperoxidase (chloride peroxidase)"
FT                   /note="SCF76.05c, non-heme chloroperoxidase (chloride
FT                   peroxidase), len: 276 aa. Identical to Streptomyces
FT                   lividans SW:PRXC_STRLI (EMBL; U02635) non-heme
FT                   chloroperoxidase (EC 1.11.1.10) (chloride
FT                   peroxidase)(CPO-L) (chloroperoxidase L) (275 aa), fasta
FT                   scores opt: 1866 z-score: 2162.6 E():0 99.3% identity in
FT                   275 aa overlap. Contains a Pfam match to entry PF00561
FT                   abhydrolase, alpha/beta hydrolase fold."
FT                   /db_xref="GOA:Q9RJG9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJG9"
FT                   /protein_id="CAB56725.1"
FT                   /translation="MGTVTTSDGTNIFYKDWGPRDGLPVVFHHGWPLSADDWDNQMLFF
FT                   LSHGYRVIAHDRRGHGRSDQPSTGHDMDTYAADVAALTEALDLRGAVHIGHSTGGGEVA
FT                   RYVARAEPGRVAKAVLVSAVPPVMVKSDTNPDGLPLEVFDGFRAALAANRAQFYIDVPS
FT                   GPFYGFNREGATVSQGLIDHWWLQGMMGAANAHYECIAAFSETDFTDDLKRIDVPVLVA
FT                   HGTDDQVVPYADAAPKSAELLTNATLKSYEGLPHGMLSTHPEVLNPDLLAFVKS"
FT   misc_feature    complement(187693..188367)
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 124.80, E-value 1.6e-33"
FT   CDS_pept        188618..189601
FT                   /transl_table=11
FT                   /gene="SCO0466"
FT                   /gene_synonym="SCF76.06"
FT                   /product="araC family transcriptional regulator"
FT                   /note="SCF76.06, probable araC family transcriptional
FT                   regulator, len: 327 aa. Highly similar to many including
FT                   the Streptomyces coelicolor hypothetical regulators:
FT                   TR:CAB40696 (EMBL; AL049587) SC5F2A.29 (325 aa), fasta
FT                   scores opt: 857 z-score: 962.2 E():0 45.8% identity in 323
FT                   aa overlap and TR:CAB46927 (EMBL; AL096822) SCGD3.05 (334
FT                   aa), fasta scores opt:  617 z-score: 694.7 E(): 2.4e-31
FT                   38.6% identity in 332 aa overlap. In addition to
FT                   Streptomyces lividans SW:YCP1_STRLI (EMBL; U02635)
FT                   hypothetical protein in CPOL 5'region (ORF1) (fragment)
FT                   (141 aa), fasta scores opt:  908 z-score: 1024.0 E():0
FT                   99.3% identity in 141 aa overlap. Contains a Pfam match to
FT                   entry PF00165 HTH_2, Bacterial regulatory helix-turn-helix
FT                   proteins, araC family. There are two possible
FT                   helix-turn-helix motifs located between residues 237..258
FT                   (+3.99 SD) and 301..322 (+2.58 SD). Note that the
FT                   translational start site may be 'M' residue 6."
FT                   /db_xref="GOA:Q9RJG8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJG8"
FT                   /protein_id="CAB56726.1"
FT                   /translation="MAEEAMTAGPHRVVVLVFDGMKLLDLSGPAEVFSEANRFGADYRL
FT                   SIVSADGSPVRSSIGMLVPADTDARAAAAHDTLVVVGGDALPGSPVDPVLGAAAKELAE
FT                   RAGRVASVCTGAFVLGAAGLLEGRRATTHWQHTATLARRCPSTRVEADALFVKDGSTYT
FT                   SAGVTAGIDLALALLEEDHGPGLARQVARSLVVYMQRAGGQSQFSASLQGPAPRTPVLR
FT                   LVQEAVQGDPTADHGLEALAARVRVSPRHLTRMFRAELDTTPMKYVELIRFDMAKALLD
FT                   AGHNATEAATRSGFSSYESLRRAFARHLGLSPIRYQQRFATTSRES"
FT   misc_feature    189320..189577
FT                   /note="Pfam match to entry PF00165 HTH_2, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   50.60, E-value 3.5e-11"
FT   CDS_pept        189614..190357
FT                   /transl_table=11
FT                   /gene="SCO0467"
FT                   /gene_synonym="SCF76.07"
FT                   /product="conserved hypothetical protein SCF76.07"
FT                   /note="SCF76.07, unknown, len: 247 aa; similar to TR:Q98LL0
FT                   (EMBL:AP002996) MLR0982 protein from Rhizobium loti
FT                   (Mesorhizobium loti) (215 aa) fasta scores; opt: 410,
FT                   Z-score: 484.9, E(): 2.2e-19, 33.178% identity (33.649%
FT                   ungapped) in 214 aa overlap."
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJG7"
FT                   /protein_id="CAB56727.1"
FT                   /translation="MTGSEGFVAIGQRTRSGRPAQGGTDTTGNRPGRTTMTETIAGIGI
FT                   PDSSLAREATELVRDTTPPLIFHHSRRVYLFGSLQAAALGLRPDPELLYVAALFHDTGL
FT                   VPPYRGDDQRFEMDGADQARAFLLAHGVPEADADTVWTAVALHTTPEVPYKLAPEIAAT
FT                   TAGVETDVLGLHLARITRAEIDAVTAAHPRPDFKKQILQAFTDGFGHRPQTTFGTVNAD
FT                   VLEHFLPGFRRTDFVEVIENSAWPE"
FT   CDS_pept        complement(190373..191350)
FT                   /transl_table=11
FT                   /gene="SCO0468"
FT                   /gene_synonym="SCF76.08c"
FT                   /product="conserved hypothetical protein SCF76.08c"
FT                   /note="SCF76.08c, unknown, len: 325 aa. The N-terminus is
FT                   highly similar to several PIRIN proteins e.g. Alcaligenes
FT                   eutrophus TR: AAD21775 (EMBL; J05278) PIRIN (187 aa), fasta
FT                   scores opt:  446 z-score: 495.3 E(): 3.1e-20 49.7% identity
FT                   in 149 aa overlap. Also similar to several hypothetical
FT                   proteins e.g. Mycobacterium tuberculosis TR:O07425 (EMBL;
FT                   Z97050) hypothetical 26.3 KD protein (244 aa), fasta scores
FT                   opt:  269 z-score: 301.6 E(): 1.9e-09 32.7% identity in 217
FT                   aa overlap."
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJG6"
FT                   /protein_id="CAB56728.1"
FT                   /translation="MSNTETHPAEVRCGAGEEGAPAAGVEILTARDVPLGGPRAMTVRR
FT                   TLPQRARTLIGAWCFADHYGPDEVSRSGGMDVAPHPHIGLQTVSWLFSGEIEHRDSVGS
FT                   HALVRPGEVNLMTGGHGISHSEVSTPDTTVLHGVQLWVALPSEHRDTAPAFQHHVPAPV
FT                   ALDGGEARVFLGSLAGDTSPVGTFTPLLGAEVTLAPGATVTLDVDPGFEHGVLVDSGDV
FT                   RLDGTVVRPAELAYAAPGRRTLALTNAASGAARLVVLGGPPFPEEIVMWWNFVGRTHDE
FT                   IAAARADWENEAERFGRVEGYPGDRLPAPALPNATLSPRRNPRP"
FT   regulatory      191437..191441
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        191451..191972
FT                   /transl_table=11
FT                   /gene="SCO0469"
FT                   /gene_synonym="SCF76.09"
FT                   /product="hypothetical protein SCF76.09"
FT                   /note="SCF76.09, unknown, len: 173 aa. Weakly similar in
FT                   parts to Bacillus subtilis TR:P96684 (EMBL; AB001488) YDFG
FT                   protein (147 aa), fasta scores opt:  260 z-score: 329.6
FT                   E(): 5.3e-11 35.1% identity in 111 aa overlap."
FT                   /db_xref="GOA:Q9RJG5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJG5"
FT                   /protein_id="CAB56729.1"
FT                   /translation="MTQTPVRADAGAPGSTGSTGERRVFVDKQSPEAYAALRATAEAVR
FT                   GVAEAAGLDRILVELVNIRVSQLNACAYCLNAHTRAALRGGETTQRLGVLPAWRDTELF
FT                   SPRERAALALAEATTHPADAGAQSTAYAEARGVLSDDEISAVIWVAISINAFNRVSVLS
FT                   KHPVRGAPRA"
FT   CDS_pept        191983..192891
FT                   /transl_table=11
FT                   /gene="SCO0470"
FT                   /gene_synonym="SCF76.10"
FT                   /product="putative hydrolase"
FT                   /note="SCF76.10, possible hydrolase, len: 302 aa. Weakly
FT                   similar to hydrolases e.g. the N-terminal, domain of
FT                   Streptomyces coelicolor TR:O86608 (EMBL:AL031155)
FT                   3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone
FT                   decarboxylase (449 aa), fasta scores opt: 387 z-score:
FT                   428.9 E(): 1.6e-16 33.7% identity in 258 aa overlap.
FT                   Contains a Pfam match to entry PF00561 abhydrolase,
FT                   alpha/beta hydrolase fold."
FT                   /db_xref="GOA:Q9RJG4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJG4"
FT                   /protein_id="CAB56730.1"
FT                   /translation="MRPEPLERGHSYKTRVRHRAHPCGMSQYDARFPHGMHVVDDGPPQ
FT                   APPVLLIHGSGASGASWNRVVPALAEQRRVLRVDLPGCGKSPPTPSYDVPLQAGRLAAL
FT                   LDDLGLRSVTVAGHSSGGYVATALAERRPDLVGALALVSTGPNPDALLPQPMILRLLLA
FT                   PPFGPLLWPRRTDAMLRKAIAATAAGPVEVPAEMVDDVRGISYRSFRTVARGNTAYLAE
FT                   RGVPERLAALTVPVLVLFGAADPRWDPSSAHRYEAVPNARLELLPGVGHLPPLEAPGPT
FT                   GELLLGLTARGADLPAAGPET"
FT   misc_feature    192199..192849
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 77.30, E-value 3.1e-19"
FT   CDS_pept        192901..193881
FT                   /transl_table=11
FT                   /gene="SCO0471"
FT                   /gene_synonym="SCF76.11"
FT                   /product="putative araC family transcriptional regulator"
FT                   /note="SCF76.11, possible araC family transcriptional
FT                   regulator, len: 326 aa. Weakly similar to the DNA-binding
FT                   domains of other transcriptional regulators e.g.
FT                   Escherichia coli SW:ARAC_ECOLI (EMBL; V00256) arabinose
FT                   operon regulatory protein (292 aa), fasta scores opt:  130
FT                   z-score: 151.4 E(): 0.45 28.2% identity in 163 aa overlap.
FT                   Contains a Pfam match to entry PF00165 HTH_2, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family. The
FT                   putative helix-turn-helix motif is located between residues
FT                   197..218 (+2.74 SD). Also contains a possible membrane
FT                   spanning hydrophobic domain."
FT                   /db_xref="GOA:Q9RJG3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJG3"
FT                   /protein_id="CAB56731.1"
FT                   /translation="MLSTETPTDPSAPAPAVAPTGAPPDWSIVDVAVPRPSVRLAGVAM
FT                   AGFSQHVSAFVDMAMVAHPSVTLLIDLSDGDGILYSARDRHGHGSFVVGLAPGDLRAAG
FT                   RVGTCLQIRLEPAVAAAVLGPSAGLGGRVESFEDVWGREAGRVQDELRTAGSWDERFAV
FT                   AADVLRRRTADRPPVDPEVAHTWRTTLAGRGRVRVEGLAEEVGWSRKRLSARFHAQLGI
FT                   TPKRAARLVRFDHAAHLLAAGLAPASVAFESGYADQSHLHREVKAFTGLTPTAVAGAPW
FT                   LAIDDVAWPGSSPARSVSAAGSAPRRMARPGRAWNRGRTAWTDAH"
FT   misc_feature    193483..193740
FT                   /note="Pfam match to entry PF00165 HTH_2, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   46.50, E-value 5.7e-10"
FT   CDS_pept        complement(194055..195263)
FT                   /transl_table=11
FT                   /gene="SCO0472"
FT                   /gene_synonym="SCF76.12c"
FT                   /product="putative secreted protein"
FT                   /note="SCF76.12c, possible secreted protein, len: 384 aa.
FT                   Contains a possible N-terminal signal sequence."
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJG2"
FT                   /protein_id="CAB56732.1"
FT                   /translation="MNTSIRNRAVTGTALALAVSAVLTACGGDTSSSDATSKGGGSTPS
FT                   ATPAASVQDPLVATFDGGLYILDGKSLELTRTIDLPGFNRVNPAGDKDHVVVSTDRGFR
FT                   LLNATRQALTDIEYKGAKPGHVVRHAGKTVLFTDGTGEVNVFAPGDLGTGEKPDGRTYR
FT                   SAEAHHGVAIELSDGRLLTTLGDEEKRTGALVVDKDGKEIARSENCPGVHGEAAARGEA
FT                   IALGCEDGVLIYKDGRFTKVDAPDDYGRTGNQAGSDASPVLLGDYKSDPDAELERPTRI
FT                   SLIDTGTAKLRLVELGTSYSFRSLARGPHGEALVLGTDGAIHVIDPDKGTVEKKIPAVG
FT                   QWQEPLDWQQARPTLFVRGHTAYVSEPGKKAVHAIDLESGRKRTSVTLPQGTNELSGTV
FT                   AGH"
FT   CDS_pept        complement(195260..196249)
FT                   /transl_table=11
FT                   /gene="SCO0473"
FT                   /gene_synonym="SCF76.13c"
FT                   /product="putative solute-binding lipoprotein"
FT                   /note="SCF76.13c, possible solute-binding lipoprotein, len:
FT                   329 aa. Similar to many e.g. Streptococcus parasanguis
FT                   SW:ADHS_STRPA (EMBL; M26130) adhesin B precursor
FT                   (saliva-binding protein) (309 aa), fasta scores opt:  354
FT                   z-score: 399.1 E(): 7.2e-15 23.7% identity in 317 aa
FT                   overlap. Contains an appropriately positioned Prosite hit
FT                   to PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site, a Pfam match to entry PF01297
FT                   Lipoprotein_4, Adhesion lipoprotein and a possible
FT                   N-terminal signal sequence."
FT                   /db_xref="GOA:Q9RJG1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJG1"
FT                   /protein_id="CAB56733.1"
FT                   /translation="MRGTVRTRIRVARLRRLLVGLLALVTAATATACSATDEQPRIVVT
FT                   TNILGDITRQVVGDQAEVTVLMKPNADPHSFGLSAVQAAQLERADLVVFNGLGLEENVL
FT                   RHVDAAREAGVATFEVGRAVDPLTFHSGDDGGPEGESGRPDPHFWTDPDRVRTAAGLIT
FT                   DRVSEHVTGVDHDAIRANAAEYDEQLADLTAFMEKSFDRVPEDRRNLVTNHHVFGYLAD
FT                   RFGFRVIGAVIPSGTTLASPSSSDLRSLTRAMERAGVRTVFADSSRPKRLAEVLSTELG
FT                   DGVRVVELYSESLTAENEGAATYLQMMRANTTALTDGLTVGSPKGTHS"
FT   regulatory      complement(195272..195277)
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(195290..196189)
FT                   /note="Pfam match to entry PF01297 Lipoprotein_4, Adhesion
FT                   lipoprotein, score 134.20, E-value 2.4e-36"
FT   misc_feature    complement(196151..196183)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        complement(196246..197493)
FT                   /transl_table=11
FT                   /gene="SCO0474"
FT                   /gene_synonym="SCF76.14c"
FT                   /product="putative lipoprotein"
FT                   /note="SCF76.14c, possible lipoprotein, len: 415 aa.
FT                   Contains an appropriately positioned Prosite hit to PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site and
FT                   a possible N-terminal signal sequence."
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJG0"
FT                   /protein_id="CAB56734.1"
FT                   /translation="MEPTVRTHPTRRLPTALVLTAALLATGCSEQSDDGREPAATESSG
FT                   TPHGYVEGAREAAEEQSRLILGDPGTGASRVLDLVTGKVHESEPVTGADGLSTDGRFGF
FT                   FHTDRGTHVVDGGAWTVDHGDHVHYYRAAIRHVGDLPGGRGAEIRSDAAVTAATDPEGR
FT                   TTLYDRTALEKGEVGPARTLDGVHAGAVVPYEEHLVALAGDDESAEVAVYDRSGRRVAS
FT                   PDATCERPAGDAVTRRGVVLGCADGALLVSAEDGTFTAERIPYGQDVPEKERATAFRHR
FT                   AGSDTLTAPAGERAVWVLDVTDRDWTRVRTTGPVLAANTAGEGSPLLVLESDGALHGYD
FT                   IATGRHTARTEPLLTRTAKTPAGAAAPVVEVDRSRAYVNDRTGKRVYEIDYNDALRVAR
FT                   SFDLDIAPGLMAETGR"
FT   misc_feature    complement(197410..197442)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        complement(197508..198359)
FT                   /transl_table=11
FT                   /gene="SCO0475"
FT                   /gene_synonym="SCF76.15c"
FT                   /product="ABC transporter protein, integral membrane
FT                   subunit"
FT                   /note="SCF76.15c, probable ABC transporter protein,
FT                   integral membrane subunit, len: 283 aa. Similar to many
FT                   e.g. Escherichia coli SW:ZNUB_ECOLI (EMBL; AE000280)
FT                   high-affinity zinc uptake system membrane protein ZnuB (261
FT                   aa), fasta scores  opt:  442 z-score: 483.2 E(): 1.5e-19
FT                   32.5% identity in 246 aa overlap. Contains a Pfam match to
FT                   entry PF00950 ABC-3, ABC 3 transport family and multiple
FT                   possible membrane spanning hydrophobic domains."
FT                   /db_xref="GOA:Q9RJF9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJF9"
FT                   /protein_id="CAB56735.1"
FT                   /translation="MDWLTAPFEVTFVQRALWGGILVSAICALAGTWVVLRGMAFLGDA
FT                   MSHGLLPGVALAALLGGNLLLGAVASAAVMAAGVTALGRTPRLSQDTGIGLLFVGMLSI
FT                   GVIIVSRSQSFAVDLTGILFGDVLAVREQDLLVLGGALLVALLVSVLGHRAFLALAFDP
FT                   RKAHTLGLRPRLAHAVLLVLLGLAIVASFHIVGTLLVLGLLIAPPAAALPWARGVRGVM
FT                   ALAALLGVTATFGGLLLSWHLSTAAGATVSAVAVALFFLSHTASGLRHLRTRPATPHPT
FT                   VD"
FT   misc_feature    complement(197562..198335)
FT                   /note="Pfam match to entry PF00950 ABC-3, ABC 3 transport
FT                   family, score 238.20, E-value 1.2e-67"
FT   regulatory      198362..198366
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        198375..199133
FT                   /transl_table=11
FT                   /gene="SCO0476"
FT                   /gene_synonym="SCF76.16"
FT                   /product="ABC transport protein, ATP-binding subunit"
FT                   /note="SCF76.16, ABC transport protein, ATP-binding
FT                   subunit, len: 252 aa. Similar to many e.g. Haemophilus
FT                   influenzae SW:FECE_HAEIN (EMBL; U32720) iron(III) dicitrate
FT                   transport ATP-binding protein FecE homolog (306 aa), fasta
FT                   scores opt:  375 z-score: 413.4 E(): 1.2e-15 37.3% identity
FT                   in 185 aa overlap. Contains a Prosite hit to PS00211 ABC
FT                   transporters family signature and PS00017 ATP/GTP-binding
FT                   site motif A (P-loop)."
FT                   /db_xref="GOA:Q9RJF8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJF8"
FT                   /protein_id="CAB56736.1"
FT                   /translation="MKIMFNKSRPSPPAVPGRASGVRLTELCAGYPGRPVLRQLTCEIP
FT                   ALAVTALVGPNGSGKSTLLGVLAGVIRPTSGDLHRDGERPPAFVPQRGAVADALPLTVR
FT                   QTVEMGRWAERGPWRRLNRRDRLIVDSALDRLGIADLAPRQLGELSGGQRQRALVAQGL
FT                   AQQSDLLLLDEPTTGLDPEARQRITALLTDLVADGVTVVHATHDLEAARSAEACLLLRA
FT                   GTLAGQGRPGRVLTASALAEVWAVAGHAGP"
FT   misc_feature    198534..198557
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    198819..198863
FT                   /note="PS00211 ABC transporters family signature"
FT   regulatory      199226..199229
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        199238..199630
FT                   /transl_table=11
FT                   /gene="SCO0477"
FT                   /gene_synonym="SCF76.17"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCF76.17, conserved hypothetical protein, len: 130
FT                   aa. Highly similar to several including: Bacillus subtilis
FT                   TR:O32161 (EMBL; Z99120) YurT protein (127 aa), fasta
FT                   scores opt: 494 z-score: 605.8 E(): 2.2e-26 58.6% identity
FT                   in 128 aa overlap, Streptomyces coelicolor TR:CAB42950
FT                   (EMBL; AL049863) hypothetical 14.4 KD protein SC5H1.25C
FT                   (131 aa), fasta scores opt: 221 z-score: 280.0 E(): 3.1e-08
FT                   37.2% identity in 129 aa overlap and also weakly similar to
FT                   some lyases e.g. Salmonella typhimurium SW:LGUL_SALTY
FT                   (EMBL; U57364) lactoylglutathione lyase (EC 4.4.1.5) (135
FT                   aa), fasta scores opt: 101 z-score: 136.7 E(): 2.9 23.1%
FT                   identity in 134 aa overlap"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJF7"
FT                   /protein_id="CAB56737.1"
FT                   /translation="MKINLTSVFVDDQAHALRFYTETLGFLKKHDVPVGAGGDRWLTVV
FT                   SPEAPDGTELLLEPSGHPAVAPYRTALAQDGIPAASFAVDDVRAEHDRLRSLGVHFTQE
FT                   PMEMGAVTTAVLDDTCGNLIQIMQVR"
FT   CDS_pept        complement(199683..200807)
FT                   /transl_table=11
FT                   /gene="SCO0478"
FT                   /gene_synonym="SCF76.18c"
FT                   /product="putative membrane protein"
FT                   /note="SCF76.18c, possible membrane protein, len: 374 aa.
FT                   Contains a possible membrane spanning hydrophobic domain."
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJF6"
FT                   /protein_id="CAB56738.1"
FT                   /translation="MREEASETGAPFGRRTFMASAVVAAAASVPAAAPALAAGLPEAAA
FT                   PGCRSVAHLLAVPESGRGVDWLREALQVAVALELATIPPYLCGWWSVGDRTSHVARLIR
FT                   RIIGDEMYHMGVVCNLLVAVGGRPRITDAALAYPGPLPGGVREEVNVYLSGLNRPFVRD
FT                   VMMAIEAPEVPLARGANNSPGIGHFYDGLLRAFRATAPPLSAGGQLSQRIGSDVLEPVT
FT                   DLDGVERAVEIIKEQGEGTASSPEDAFGDDYPAHYYAFGEIYHGRQLRREDDGWRFTGA
FT                   PVPFPDARPMARVPAGGWPGPSQRVGDLLDRFDTAYAKVLGTLEAAWAHGDARTLGSAV
FT                   RTMRALEGPAVELMETGIPGGRGTYGPQFRPPGA"
FT   CDS_pept        complement(200952..201776)
FT                   /transl_table=11
FT                   /gene="SCO0479"
FT                   /gene_synonym="SCF76.19c"
FT                   /product="putative phosphatase SCF76.19c"
FT                   /note="SCF76.19c, putative phosphatase, len: 274 aa. Almost
FT                   identical to Streptomyces lividans TR:O70034 (EMBL;
FT                   AJ223365) Sbl1 gene (274 aa), fasta scores opt: 1764
FT                   z-score: 2005.4 E():0 97.1% identity in 274 aa overlap.
FT                   Also weakly similar to many inositol monophosphatases e.g.
FT                   Mycobacterium smegmatis TR:O51845 (EMBL; AF005905) inositol
FT                   monophosphate phosphatase (276 aa), fasta scores opt:  299
FT                   z-score: 346.7 E(): 6e-12 33.1% identity in 269 aa overlap
FT                   and Escherichia coli SW: SUHB_ECOLI (EMBL; M34828)
FT                   extragenic suppressor protein SuhB (267 aa), fasta scores
FT                   opt:  269 z-score: 313.0 E(): 4.6e-10 30.8% identity in 263
FT                   aa overlap."
FT                   /db_xref="GOA:Q9RJF5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJF5"
FT                   /protein_id="CAB56739.1"
FT                   /translation="MINLPVPHDETGARHDDTEVAIAAARAGAETVRARYGRRLTRFDK
FT                   GGGDFATDADVAAEEAILGVIRAARPHDAICGEEGGRRGAADAARQWLVDPLCGTLNYA
FT                   AGTMAVAVNVALRGGPAAVADPFGGEVLFTDGETARVRRDGHDTPLAPSAATRLVDVNL
FT                   DPPFPGAPAFRAVDLIAHPGFVRRLRPRVLSTTLALAWVAAGKRAAYVTDGTGLTESVH
FT                   FAAGIALCRAAGCVVTGVDGEPVGPVGRGLVAAADAGTHALLLSLIREGRPR"
FT   CDS_pept        201780..202412
FT                   /transl_table=11
FT                   /gene="SCO0480"
FT                   /gene_synonym="SCF80.01"
FT                   /gene_synonym="SCF76.20"
FT                   /product="hypothetical protein"
FT                   /note="SCF80.01, unknown, partial CDS, len: >193 aa.
FT                   Similar in parts to Streptomyces coelicolor TR:CAB53333
FT                   (EMBL;AL109974) hypothetical 34.2 KD protein SCF34.22 (326
FT                   aa), fasta scores opt:opt:  296 z-score: 300.2 E(): 2.4e-09
FT                   40.5% identity in 148 aa overlap."
FT                   /note="SCF76.20, unknown, partial CDS, len: >49 aa."
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK56"
FT                   /protein_id="CAD55443.1"
FT                   /translation="MQGNGRSFPGLRSTGPPDLPTSRPPGLPASGPTTPGDPGRGAGLL
FT                   QEVPQEIPARQGRPVRRFPVAPVMTESGRPRVPTGSAMRPSTRSRSMDNRSSSSGVARP
FT                   PAAYGTSPTMVLLYRPGAAWTADPYVLSPGRRSPLTLFAAEHFLGGISGYEAAETTDEN
FT                   PAAHVAVVRRVPLAHLRHTLGVDSTDWTAARRTLAGTAHPLGRLEAE"
FT   repeat_region   201825..201877
FT                   /note="degenerate repeat region with 3x CCTCCCGA, 2x
FT                   CCTCCCGG, 1x CCTCCGG."
FT   misc_feature    202356..203904
FT                   /note="99% identical to Streptomyces coelicolor
FT                   EMBL:AB017013."
FT   regulatory      202688..202693
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        202699..203217
FT                   /transl_table=11
FT                   /gene="SCO0481"
FT                   /gene_synonym="SCF80.02"
FT                   /product="putative secreted chitin binding protein"
FT                   /note="SCF80.02, possible secreted chitin binding protein,
FT                   len: 172 aa. This CDS has been previously sequenced but was
FT                   unclassified: Streptomyces coelicolor TR:Q9Z9M5 (EMBL;
FT                   AB017013) gene for ChiG, partial CDS (fragment) (172 aa),
FT                   fasta scores opt: 1151 z-score: 1339.7 E():0 99.4% identity
FT                   in 172 aa overlap. This CDS is similar to several e.g.
FT                   Streptomyces reticuli TR:O87962 (EMBL; Y14315) chitin
FT                   binding protein (Chb2) (201 aa), fasta scores opt: 193
FT                   z-score: 234.7 E(): 1e-05 37.3% identity in 201 aa overlap.
FT                   Contains a possible N-terminal signal sequence."
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJF2"
FT                   /protein_id="CAB57190.1"
FT                   /translation="MHARRKTAALIGAVLAPVVAVSLPASSASAHGYISDPPSRQAQCA
FT                   AGTVSCGDITYEPQSVEGPKGLTSCSGGNSRFAELDDDSKGWQVTPVSKTTTFSWRLTA
FT                   QHATSTWEYYVGGQRIALFDDGGAKPGSVVNHQVDFGGLTGQQKVLAVWNVADTSNAFY
FT                   ACIDVNVGG"
FT   regulatory      203329..203333
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        203342..204076
FT                   /transl_table=11
FT                   /gene="SCO0482"
FT                   /gene_synonym="chiG"
FT                   /gene_synonym="SCF34.01"
FT                   /product="secreted chitinase"
FT                   /note="SCF80.03, secreted chitinase, partial CDS, len:> 187
FT                   aa. Previously sequenced and characterised. Streptomyces
FT                   coelicolor TR:Q9Z9M4 (EMBL; AB017013) chiG (fragment) (244
FT                   aa), fasta scores opt: 1238 z-score: 1463.2 E():0 98.9%
FT                   identity in 187 aa overlap. Contains a possible N-terminal
FT                   signal sequence and a Pfam match to entry PF00182
FT                   Glyco_hydro_19, Chitinases class I."
FT                   /note="SCF34.01, chiG, chitinase, partial CDS, len: >90 aa;
FT                   identical to the C-terminus of TR:Q9Z9M4 (EMBL:AB017013),
FT                   chiG, Streptomyces coelicolor chitinase (fragment) (244
FT                   aa), fasta scores; opt: 638 z-score: 812.8 E(): 0, 100.0%
FT                   identity in 90 aa overlap. Highly similar to SC5H1.29c
FT                   (EMBL:AL049863), chiF, Streptomyces coelicolor chitinase
FT                   (296 aa) (81.1% identity in 90 aa overlap). Contains Pfam
FT                   match to entry PF00182 Glyco_hydro_19, Chitinases class I"
FT                   /db_xref="GOA:Q8CK55"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR016283"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="PDB:2CJL"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK55"
FT                   /protein_id="CAD55444.1"
FT                   /translation="MQHRKLALLAATGAAAALCTLTMAPSAVAEKSDTRTAAAEFVVSE
FT                   AQFDQMFPSRNSFYTYSGLTAALSAYPGFSNTGSDTVKKQEAAAFLANVGHETGGLVYV
FT                   VEQNTANYPHYCDASQPYGCPAGNDKYYGRGPVQLSWNFNYKAAGDALGIDLLNNPDLV
FT                   QNDSAVAWKTGLWYWNTQTGPGTMTPHDAMVNGAGFGETIRSINGSLECDGGNPGQVQS
FT                   RIDNYERFTQLLGVEPGGNLSC"
FT   misc_feature    203465..203875
FT                   /note="Pfam match to entry PF00182 Glyco_hydro_19,
FT                   Chitinases class I, score 195.40, E-value 9.1e-55"
FT   misc_feature    203804..204073
FT                   /note="Pfam match to entry PF00182 Glyco_hydro_19,
FT                   Chitinases class I, score 87.60, E-value 7.6e-24"
FT   misc_feature    203804..204330
FT                   /note="sequence corresponding to Streptomyces coelicolor
FT                   gene for ChiG, partial cds (EMBL:AB017013) from 1449 to
FT                   1975"
FT   CDS_pept        complement(204073..204474)
FT                   /transl_table=11
FT                   /gene="SCO0483"
FT                   /gene_synonym="SCF34.02c"
FT                   /product="putative secreted protein"
FT                   /note="SCF34.02c, putative secreted protein, len: 133 aa;
FT                   unknown function, possible CDS suggested by GC frameplot.
FT                   Contains an Arg-rich region"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK23"
FT                   /protein_id="CAB53313.1"
FT                   /translation="MDALLPFVLLAGGLAAVLGSFTWLASRVRRRGLAGGAMGAALASY
FT                   EEAFRTTAYASHVEIRAQAERRSPLLSPDDWRWAPAAPDGTGAEAGRTASRGSSRSRRG
FT                   RARWFRRRRGPLATGHSGGHEGAGGPDGS"
FT   CDS_pept        complement(204539..205705)
FT                   /transl_table=11
FT                   /gene="SCO0484"
FT                   /gene_synonym="SCF34.03c"
FT                   /product="putative monooxygenase"
FT                   /note="SCF34.03c, possible monooxygenase, len: 388 aa;
FT                   similar to SW:TETX_BACFR (EMBL:M37699), TetX, Bacteroides
FT                   fragilis tetracycline resistance protein from transposon
FT                   Tn4351/Tn4400 (388 aa), fasta scores; opt: 582 z-score:
FT                   637.6 E(): 3.7e-28, 33.9% identity in 351 aa overlap. Also
FT                   similar to monooxygenases e.g. TR:P96555 (EMBL:AB000564)
FT                   Sphingomonas sp. salicylate hydroxylase (395 aa) (27.2%
FT                   identity in 360 aa overlap). Similar to others from
FT                   S.coelicolor e.g. TR:Q9Z4Y6 (EMBL:AL035707) S.coelicolor
FT                   possible salicylate hydroxylase (420 aa) (32.9% identity in
FT                   340 aa overlap). Contains Pfam match to entry PF01360
FT                   Monooxygenase, Monooxygenase"
FT                   /db_xref="GOA:Q9RK22"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK22"
FT                   /protein_id="CAB53314.1"
FT                   /translation="MNSPTPAAARISIIGAGPGGLTCARVLRRHGIAVTVYDRDPDAAS
FT                   RDQGGSLDLHEEDGQLALREAGLLEEFFALARCESQEERRFDTAGRLLGRRLPDEGETA
FT                   RPEIDRGQLRGLLLESLDAGTVRWGHGLESVSGPAEGPRTLTFTDGSTVETDLVIGADG
FT                   AFSRVRAAVSDAVPRYTGVGFLEAWFDDMESAHPELSELVGRGSAHVADGQRGLFAQRN
FT                   SGGHMRVYVMRRVALDWMTASGLRPDDTDGIRARLLAEYAGWSPRILRMITENDGPYVD
FT                   RPLFALPVPHTWRPTPGVTLLGDAAHLMPPLGVGVNLAMLDGAELALALAASATVDDAV
FT                   RTYEKTMLPRSAEIAGMLEGGAGFLLEEPDAEDLARLGAPGADGGPGE"
FT   misc_feature    complement(204629..205246)
FT                   /note="Pfam match to entry PF01360 Monooxygenase,
FT                   Monooxygenase, score 59.40, E-value 7.7e-14"
FT   CDS_pept        205854..206465
FT                   /transl_table=11
FT                   /gene="SCO0485"
FT                   /gene_synonym="SCF34.04"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SCF34.04, possible tetR-family transcriptional
FT                   regulator, len: 203 aa; shows weak similarity to
FT                   SW:TCMR_STRGA (EMBL:M80674), TcmR, Streptomyces glaucescens
FT                   tetracenomycin C transcriptional repressor (226 aa), fasta
FT                   scores; opt: 201 z-score: 254.2 E(): 8.4e-07, 32.2%
FT                   identity in 152 aa overlap and to many putative
FT                   transcriptional regulators. Contains Pfam match to entry
FT                   PF00440 tetR, Bacterial regulatory proteins, tetR family.
FT                   Contains probable helix-turn-helix motif at aa 38-59 (Score
FT                   1212, +3.31 SD)"
FT                   /db_xref="GOA:Q9RK21"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK21"
FT                   /protein_id="CAB53315.1"
FT                   /translation="MPDSPTPGRRERKKAATRQAIADAALQLFLEHGFDRVSVRDVAER
FT                   ADVSTTTLFAHFPSKESLVFDREQEVDAALAAAVRERPDGQGVVEALRAHALESWVPIV
FT                   TDPRRARFTALVSDTPALREYSERMWMRHADTLSTVIAEELDREPDDSACAALARFVLE
FT                   IPALTTGRHDPRATVETVFDLLLHGWRSQAGPRPPQADGR"
FT   misc_feature    205914..206045
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 45.10, E-value
FT                   8.7e-11"
FT   CDS_pept        complement(206447..207670)
FT                   /transl_table=11
FT                   /gene="SCO0486"
FT                   /gene_synonym="SCF34.05c"
FT                   /product="putative monooxygenase"
FT                   /note="SCF34.05c, possible monooxygenase, len: 407 aa;
FT                   similar to TR:Q9ZI64 (EMBL:AF039534), NahW, Pseudomonas
FT                   stutzeri salicylate hydroxylase (389 aa), fasta scores;
FT                   opt: 328 z-score: 383.8 E(): 5.1e-14, 27.0% identity in 403
FT                   aa overlap and to the N-terminal half of some epoxidases
FT                   e.g. SW:ABA2_LYCES (EMBL:Z83835) Lycopersicon esculentum
FT                   zeaxanthin epoxidase precursor (669 aa) (26.8% identity in
FT                   336 aa overlap). Also similar to many putative
FT                   oxidoreductases e.g. TR:O54177 (EMBL:AL021411) Streptomyces
FT                   coelicolor possible oxidoreductase (397 aa) (56.1% identity
FT                   in 403 aa overlap). Contains Pfam match to entry PF01360
FT                   Monooxygenase, Monooxygenase"
FT                   /db_xref="GOA:Q9RK20"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK20"
FT                   /protein_id="CAB53316.1"
FT                   /translation="MVHTSRPARRVLISGASIAGPALAHWLDRYGFEVTVVEKAAAVRG
FT                   GGYAIDVRGTAREAVDRMGLLPALTEAHVDSQRITFVDAAGETVGSLQPEQLTGGEAGV
FT                   DLEVRRGDLADALYAPLRDRVEFLFEDSIATLDDTGDAVHVVFDSGLRRTFDLVVGADG
FT                   LHSNTRRLVFGPEEPFHRYLGHVFAGFTLPNEFGLAHEAVIWNEPGRSAVLYAHEPAGR
FT                   LHGFLTFTREAPPFDAFRDPRAQRDLVAARFPERVWHLPRLVEGMREADDLFFDIVSQI
FT                   HLRTWSHGRVVLAGDAAHATSFISGQGSSVALVGAYVLAGELAAHADHTEAFAAYERRM
FT                   RPFAERNQALATSGGSAVTPATRQELEARNALLRDPEAAARAMVTTSAREGRAAHSSLE
FT                   LPDYRPSA"
FT   misc_feature    complement(206615..207211)
FT                   /note="Pfam match to entry PF01360 Monooxygenase,
FT                   Monooxygenase, score 95.00, E-value 1.5e-24"
FT   CDS_pept        207842..208348
FT                   /transl_table=11
FT                   /gene="SCO0487"
FT                   /gene_synonym="SCF34.06"
FT                   /product="putative MarR-family transcriptional regulator"
FT                   /note="SCF34.06, possible MarR-family transcriptional
FT                   regulator, len: 168 aa; shows weak similarity to TR:Q53002
FT                   (EMBL:U51475), MucS, Rhizobium meliloti exopolysaccharide
FT                   synthesis regulatory protein (190 aa), fasta scores; opt:
FT                   126 z-score: 160.1 E(): 0.15, 24.8% identity in 145 aa
FT                   overlap and to hypothetical transcriptional regulators.
FT                   Contains Pfam match to entry PF01047 MarR, MarR family"
FT                   /db_xref="GOA:Q9RK19"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK19"
FT                   /protein_id="CAB53317.1"
FT                   /translation="MTPEAAEPAGPDDPHDDLLTVLPRLTQLSAAFNKGRLTERAAEAA
FT                   GLALDRPAMGVLVTLRAADQPLRIGEIADRMQVVGPHVTRQVQALEKRGLVRRVADPHD
FT                   RRASLIEPTGDGLDAANRYMTSLLGWFAEALADWPPQDREDLTRLLTRLADDVTARLAR
FT                   LDAED"
FT   misc_feature    207986..208300
FT                   /note="Pfam match to entry PF01047 MarR, MarR family, score
FT                   64.20, E-value 2.8e-15"
FT   CDS_pept        208394..211810
FT                   /transl_table=11
FT                   /gene="SCO0488"
FT                   /gene_synonym="SCF34.07"
FT                   /product="putative hydrolase"
FT                   /note="SCF34.07, putative hydrolase, len: 1138 aa; unknown
FT                   function, probable CDS suggested by GC frameplot,
FT                   positional base preference and amino acid composition.
FT                   Similar to TR:Q9S3L0 (EMBL:AJ238748) alfa-L-ramnisidase
FT                   from Clostridium stercorarium (874 aa) fasta scores; opt:
FT                   554, Z-score: 585.8, E(): 5.4e-25, 27.513% identity
FT                   (30.672% ungapped) in 796 aa overlap."
FT                   /db_xref="GOA:Q9RK18"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK18"
FT                   /protein_id="CAB53318.1"
FT                   /translation="MHRIVKRAVETFQAQRRTHMSEETTEGSTEGSTGESTGNGTEGWN
FT                   RRVFLRGTVTTAGVAGVTALTGRGAVAAAGSGTGDGPAKTGTTGTGLRVVRTGVEYTEN
FT                   LLGTDVERPRLSWELAAPGHGARQTAYHVRVTRGSGGRGPRTRTVWDSGKVASDRSVGI
FT                   PYGGPALLPRTRYHWQVRVWDAAGRRSRWSETRWWETSLPADGWRARWIGAEEPPSPPS
FT                   LEGASWIWSPGATASDAPEGERRFRATLTLPAGSVVKRAVVSATADDDFTLYVGGQQVL
FT                   HAPLQTDGWRTGRTADVTEQARSADGAILVAALATNRPGASVNPGGFLARLLVETEDGR
FT                   TRELRTGDGWRTSGTAQEGWERPGFDDGDWEPAAVLAPYGQGPWGGNVTVTGPEAPAPL
FT                   LRRDFTVHGRVARARLHISGLAYYEAEINGRRVGDQVLDPGFTDYDETVLYAVHDVTEL
FT                   LRSGENAIGVAVGRGFYGMTTPNVWNWHRAPWHGEPRLLAQLEIDHPDGTRTTVATDGE
FT                   WRITEGPTLSNSLYAGETYDARRAPEGWSRAGFDDSGWRSAGVREAPGGTLRAQPHDPI
FT                   GIVDTVRPKAVGELRDGVYVVDMGRTMAGWTRLTVRGAAEGTVVRLVHGEKLEDDGSVH
FT                   AETGHVPGRFQTDEYVCAGRDEEVWEPSFSYKGFRYVEVHGLHARPAPEDVLGRLVHSR
FT                   VDEVSSFSCSEPFYEWLDRAMRRTVLNNLHGIPTDTPMYEKNGWTGDAQLGTPVMTYAF
FT                   GMQRFLSKWLGDLADSQNDDGQLPVIVPSGGWGYGDLGPSPEWTTVYPFVVRELYRVYG
FT                   DERAAREHWETLTRYLDWELGRLRDGLAVTALGDYLAPGYGGNPPEDTRLTATAYLYRA
FT                   LLHTAELGEALTGLPGDNDVPGRYRAAAEELRKAFNEAFLGPDGHYRTAKDPDYRQTSN
FT                   AIPLAFGLVPPGARATVLESLVADIEERGNHLNTGALGTSVLLRVLCAHGRPDVAHAVA
FT                   TRRTYPGWGYWHDNGADTMWEMWPLDSRSRDHYFQGTVAQWLYENVAGLRPGDAGWRTF
FT                   TVRPDARTGVEWARTSIRTVRGEAAVAWSAVDGRLRLTVRVPVGSRAEVHVPVSEGGRA
FT                   TVPRGAEFVRSVPGFDILRAGHGSWEFTGDA"
FT   CDS_pept        complement(211823..212035)
FT                   /transl_table=11
FT                   /gene="SCO0489"
FT                   /gene_synonym="SCF34.08c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCF34.08c, conserved hypothetical protein, len: 70
FT                   aa; unknown function, similar to hypothetical proteins from
FT                   several bacteria e.g. SW:MBTH_MYCTU (EMBL:Z95208), MbtH,
FT                   Mycobacterium tuberculosis hypothetical protein (71 aa),
FT                   fasta scores; opt: 329 z-score: 486.3 E(): 9.9e-20, 70.3%
FT                   identity in 64 aa overlap. Also similar to TR:Q9Z388
FT                   (EMBL:AL035654) Streptomyces coelicolor small conserved
FT                   hypothetical protein (71 aa) (74.2% identity in 62 aa
FT                   overlap)"
FT                   /db_xref="GOA:Q9RK17"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK17"
FT                   /protein_id="CAB53319.1"
FT                   /translation="MSTNPFDDADGRFLVLVNDEGQHSLWPAFAAVPGGWTTVFEENTR
FT                   DACLAYVEANWTDLRPRSLARTADA"
FT   CDS_pept        212124..213215
FT                   /transl_table=11
FT                   /gene="SCO0490"
FT                   /gene_synonym="SCF34.09"
FT                   /product="putative esterase"
FT                   /note="SCF34.09, possible esterase, len: 363 aa; similar to
FT                   enterochelin esterases e.g. SW:FES_ECOLI (EMBL:J04216),
FT                   Fes, Escherichia coli enterochelin esterase (374 aa), fasta
FT                   scores; opt: 422 z-score: 474.2 E(): 4.7e-19, 32.5%
FT                   identity in 332 aa overlap"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK16"
FT                   /protein_id="CAB53320.1"
FT                   /translation="MRWAGADAFAAFGLTAVPGTDAFWDGLTTPRSIPDGDGWTTLFLR
FT                   RGPRAASIVFESWSAPVPLRRWRDTDCWYAEVRMPPRLRVTYRFVVGEEAYADPYNPAG
FT                   AGGERSVAATPDAPAQPHWPLVGAGDVLPLPRVRLRWTSERLGGRRTVRVHPVGGGGPV
FT                   VLLLDGDDWLYLHPATSAFDSAVASGEMPPVTLVFLPAGDRGAEFGCRPALWEAVRDEL
FT                   LPLVAGSGVRADPGRTVVAGQSLGGLSALYAALEFPELVSRVACQSASLWWTPGAADLP
FT                   DPLGGPVGGAIAARLRARPDLSGLRIAFDVGEHERRMLPHCALVESLTEQAGATVRVSR
FT                   SASGHDRAGWRHALLRDVAWALA"
FT   CDS_pept        complement(213302..214924)
FT                   /transl_table=11
FT                   /gene="SCO0491"
FT                   /gene_synonym="SCF34.10c"
FT                   /product="putative ABC transporter transmembrane protein"
FT                   /note="SCF34.10c, probable ABC-transporter transmembrane
FT                   protein, len: 540 aa; similar to transporters e.g.
FT                   SW:PRTD_ERWCH (EMBL:M60395), PrtD, Erwinia chrysanthemi
FT                   proteases secretion ATP-binding protein (575 aa), fasta
FT                   scores; opt: 433 z-score: 468.5 E(): 9.7e-19, 29.1%
FT                   identity in 413 aa overlap. Similar to TR:O87312
FT                   (EMBL:AF027770), FxtA, Mycobacterium smegmatis hypothetical
FT                   protein at exochelin locus (574 aa) (39.7% identity in 524
FT                   aa overlap). Similar to others from S.coelicolor e.g. to
FT                   the N-terminal half of TR:Q9ZBY5 (EMBL:AL034355), CydCD,
FT                   Streptomyces coelicolor probable ABC transporter (1172 aa)
FT                   (29.6% identity in 550 aa overlap). Contains hydrophobic,
FT                   possible membrane-spanning regions. Contains Pfam match to
FT                   entry PF00005 ABC_tran, ABC transporter and PS00211 ABC
FT                   transporters family signature"
FT                   /db_xref="GOA:Q9RK15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK15"
FT                   /protein_id="CAB53321.1"
FT                   /translation="MAWGTLLMGLYQAGETAFPIALGLIVEHTMRDRSPQALGVSVAAL
FT                   AVIITTVSLSWRFGMRILQKANTTEAHRWRVRVAGRGLQPVARDVDLKSGEVLTIATED
FT                   ADQTADIIEVVPLLISSLVAVVIAAVALGLADVRLGLLVIVGTVAILSVLSVMSRRIGS
FT                   STREQQARVARAGAKVADLIIGLRPLHGFGGNHAAFRSYREISTEAKRQSVTVARVSGV
FT                   YAGTALALNAVLAAAVTLTAGWLAFRGRIGIGELVMAVGLAQFVMEPLKLFSEMPKYVM
FT                   IARASAERMALVLAAPPVTTPGTERPAAGGDLEVDGVRHGALRKVRFRVRAGEFVAVAA
FT                   YQPLAAADLAAVLALNVPPDTYEGTVRVGGRDLAELAVEEVREHLLVNPYDGEIFAGTL
FT                   RSNIDPSGTSRTVPEAVEASMLTDVVALHREGLDYAVRDRGANLSGGQRQRLSLARALA
FT                   ADSEVLVLRDPTTAVDAVTEQLIARGVAKLRRDRTTLVITSSPALLDAADRVLVLDEGV
FT                   ITAEDTHRNLLATDEAYCVAVTR"
FT   misc_feature    complement(213377..213880)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 71.90, E-value 1.4e-17"
FT   misc_feature    complement(213554..213598)
FT                   /note="PS00211 ABC transporters family signature"
FT   CDS_pept        complement(214989..225920)
FT                   /transl_table=11
FT                   /gene="SCO0492"
FT                   /gene_synonym="SCF34.11c"
FT                   /product="putative peptide synthetase"
FT                   /note="SCF34.11c, probable peptide synthetase, len: 3643
FT                   aa; similar to parts of many antibiotic peptide synthetases
FT                   e.g. the C-terminal half of TR:Q9Z4X6 (EMBL:AL035640)
FT                   Streptomyces coelicolor CDA peptide synthetase I (7463 aa),
FT                   fasta scores; opt: 1948 z-score: 1929.3 E(): 0, 33.7%
FT                   identity in 3723 aa overlap. Also similar to parts of
FT                   putative peptide synthetases from the exochelin
FT                   biosynthesis locus of Mycobacterium smegmatis TR:O87314
FT                   (EMBL:AF027770), FxbC, putative peptide synthetase (4976
FT                   aa) (42.3% identity in 3756 aa overlap). Contains 3 Pfam
FT                   matches to entry PF00550 pp-binding, Phosphopantetheine
FT                   attachment site, 3 Pfam matches to entry PF00501
FT                   AMP-binding, AMP-binding enzyme, 4 Pfam matches to entry
FT                   PF00668 DUF4, Domain of unknown function, 2 PS00455
FT                   Putative AMP-binding domain signatures, 2 PS00012
FT                   Phosphopantetheine attachment sites and 1 PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9RK14"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK14"
FT                   /protein_id="CAB53322.1"
FT                   /translation="MMEPTASLVRLSPAQLAGLRRRTGDFSDQVITEACAVALAYWAEG
FT                   RGPAGLDLAPGTLFTDVLGWADSGGTAPTGWGADAGTVTVPGGVVPHEAQLALDDLADF
FT                   PDRPLGTVGPCGPAERLELLAGWNDTDADRARPGLVEMFREQARARPDAVAVVDERRTL
FT                   TYRQVEKLSAQLAHQLLARGLAVEDVVGISLERSAEMVIGLLAVLRAGGAFVPLDPHWP
FT                   AERRAVVIEDAGVVVQLDASGEPAPGEPEAVAVDLGDWRFGDRPTEDTGVTVPGDALAY
FT                   VIFTSGSTGRPKGAMIRHEAISERLLWQIHEILGFGHDDASLFKAPLSFDISINEIFLP
FT                   LVSGGRLVVLRPGGERDPHHLLSVIDEQRVTFTYLVSSMLDVLLEMAGDSGRLDSLRHV
FT                   WCGGEVLTPELYERFRTRLDIPLYHGYGPAETTIGVSHVVYRGAAERLSTSIGRANPNT
FT                   RLYVLDDELRPVPVGVGGELYAGGLLLGRGYVNAPGLTASRFVANPFADDGSRLYRTGD
FT                   LARFAPDGSLDFLGRADNQVKIRGMRLEIEDVEVGLAEHPRVRHTCVVARKNTAGGTYL
FT                   VGYVIPAAGHEDLRADEVKAWAGEHMVEYMVPTHVVVMTEFPLTANGKLDRNALPEPVI
FT                   PAGSSAPPTTDEERTVCAAVAALLQLDRVGVDQDFFQLGGDSILAISLLGRLRDAGLYV
FT                   TARQIFTHSTVGALAAVASREDTTVVDHRDVPTGSVVGSPVVQWLGETTDAIDGFVQSV
FT                   VLNTPADLTADALDLILAAVVRRHPMLRARLVRGERWGFDIPEAEAVPAVALWRESDQP
FT                   LDACLALATGELDPVGGAMLRAVWRREARQLALVVHHVVIDGVSWRVLMDDLATAWRQF
FT                   TSGTAVELPSGGTSFRRWTQLLERAAFDADSAYYRRALPGPDEPLGGRPLRADDTVARE
FT                   RIRTVSIGATATAALLGDTPAKFHTGINDVLVTALAVALARRRHDLGQTQTFAHIELEG
FT                   HGREAAFVAPSAGFEPELSRTVGWFTTLFPVTVDPGTAPDPTAPAYLSAALKAVKEDLA
FT                   RVPDHGVSYGALRHLARVAFDAPAPQVLFNYLGRFDAGSSGDWQLASVNGQLGEQRDPR
FT                   MRLPRALEFNAIAEPDATGAYTLVTAISWPDGMFTDTDITTLGAYYVEALTGLAALENG
FT                   GHSPSDFHPLPLTQADVDALDGPALRDILPLTPLQEGLYFHSVYDGDATGSYVEQQLLT
FT                   LEGEVDPGRLAAAATRLLTLHPNLAARFVPLADGRVVSVLESGREAPFTVLDRPGITDD
FT                   EIRAHAEHDRRAGFDLATGPPMRYTLIRSGPRRHVLVQTVHHIVADGWSVPPMLRTLLA
FT                   EYRAPGSGHALGGFPEHVRRLAARDGAASDRVWDEQLADLPGPSLIAEGHPPSAHFADT
FT                   ATTADTDVDAAARAAGVPLSVAVHGAWALTLGGILHRDDVVFGSTVSGRDADVPGIGDM
FT                   VGLFINTIPLRARWADTTTARELLTAVRAHQAAVLPHQHVSLARIARRAGAGALFDTLV
FT                   VFDVATDVAGLRRPGDPLAVTGIVNEGAPHYPLTLVVERTPDGRPRFNLIHDAELLREP
FT                   EVREILRTFTRTLTHLLTRPEAPVGGLASEGTGRVEPVPPATLGELFDAAARRGPAAAA
FT                   VTQCALDGATRSLTYGELSLAKDELAAVLRAAGVGPGKRVAVAVPRSVEQVVALVAVVG
FT                   AGGAYVPLDLAYPDERLEYVLADSAPQVVLVTPEQRDRFARLLDRANVPARLLVLGEEP
FT                   PPTAAEPGPAARWHDPAYVIYTSGSTGRPKGVVVPHSSVVTLLANTRPVMNFGPDDVWV
FT                   QFHSFSFDFAVWELWGALTHGGELLVPDYGLTRSPVDFHRLVRERGVTVLNQTPSAFHR
FT                   FAEADRHAGEPLPALRRIIFGGEGLDLARLRDWVARHGTESPELVNMYGITETTVHVTH
FT                   RVLTAADFAPGDRAASPIGGPVPGLVTHLLDDRLRPVPPGRVGAIYVAGDQVSLGYLGR
FT                   PGLTAGRFVANPFTADGSRMYHTGDLARRTLDGQLEFAGRADDQVQLKGFRIEPGEVES
FT                   AIRDLDGVVDAAVTVADTDDHLVAHVVGRVPADLTGLLSAKLPAHMVPGRVLPVDALPL
FT                   TVNGKLDRRALAERATRTPSAEPAPHGGNDSVLATLVGLFAETLPGSAPDADTDFFAAG
FT                   GDSIVAITVINRARAAGLPVAPRDVFLLRTPRALAEHLATRTPPPEASPAPTGHQDGPL
FT                   PPTPIMLRQRELGGSLARFAQARTLAAPEGTGFADAERAARAVVGAHPALRLRLRVEHG
FT                   VWSLSTEPAREVAVTRGSGTDVTQTADEAAGRLDPENGDIVAFTWLETSRTLVVAVHHL
FT                   AVDAVSWLILLDDLAAAMRGAVPAPPTTPYAEYARALTHRAAQQTDGLDHWISTLGAPA
FT                   PLPAAGKRRETTVVLAPGVSDRVTRTAPAALGLGLTELLCGALRTALTRVQRTPTDLAI
FT                   DLERHGRVPALDHHDYTRTVGWFTAIAPVRLTAHTDPVAAAREVTARRPDEHAHVAYGG
FT                   LRYLNPQTAPLLGTARPQALFNYLGRGAESDAPRLTGADAGSPYAVEVNAWTDAATGGL
FT                   HAAFTLAEGVPDEITEHWHRALERIADAAATAERTAPVSPLQRGLYFQAQLTGPAGHYV
FT                   AQSYFTFERRLEPDALSRAAACVLARHPATGAGFTTDEDGNPVQVLAAGRRIDVHTVEA
FT                   ATDAEVDALRLGDRERGFDPAEPPLIRLTVVRLPDDRDGLLLSYHLLLWDGWSREIVLR
FT                   DLFDAYRAVLAGEPLDPGPAAPGFEDHARALAARDPAPSERFWARHLAGLSGPTLLAGP
FT                   APALPDDLPRALAHTLTAERSDALRAAARTYGVTLNSVLTGAFGLLLGARTGRADAVFG
FT                   VTVSGREGEGLADIVGVLLNTVPMWTRARPHDTVRAYLTAVQEARVDAMEHEHLGLGEI
FT                   QRASGHDTLFDNLFVLQNFLDLDAFAEMNARHGITSVRADDSTHYPFTWVVTPGDRLTV
FT                   KLEYRDHDTGHARALLDDYLRVLDDLAGRSGAAESRAPIGALPGLAPAPEPAPRTGIGT
FT                   DTVVDRFDRAADREPDRTALVAHGSTMTFAHLRDRSRAVAGVLARRGIGPGATVGLALP
FT                   RSLDSIVALFAVLRTGAAYVPLELDHPDERIAAVVADARPDAVLTVSAVTPRLTGGPDL
FT                   IELDRPLPDAEPCVTFAPDDPDRLRHPAYTIYTSGSTGRPKGVVTEYAGLTNMLVNHRR
FT                   RIFEPVLARHGHRTFRVAHTVSFAFDMSWEELLWLADGHEVHVCDEELRRDAPRLVAYC
FT                   LEHGIDVVNVTPTYAQQLLAEGLLDDPARRPALVLLGGEAVTPALWTRLAATEGTVGYN
FT                   LYGPTEYTINTLGVGTFECPDPVVGVAIDNTDVYVLDPWLRPLPDGVPGELYVAGVGIA
FT                   RGYLGQPAQTAHRFVACPFGAPGERMYRTGDLVVRRPDGNLMYLGRTDQQVKIRGHRVE
FT                   PGEVEAAFAAHPAVRFVAAVAQPDPQVDGAHRLAAYLVLDGADLAEVAAQVGAALPDFL
FT                   RPTHYAQVDRIPLTVNGKADTKALPEARPLGALTTAGERAPRTETETTVCELFAEALDL
FT                   DDDEVSAVSDFVALGGHSMLAVRLTGLLRREYGPVITIRDLFTLRTPEAIARHLDDHS"
FT   misc_feature    complement(215004..215204)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site, score 58.90, E-value
FT                   1.2e-14"
FT   misc_feature    complement(215082..215129)
FT                   /note="PS00012 Phosphopantetheine attachment site"
FT   misc_feature    complement(215460..216677)
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme, score 360.70, E-value 1.6e-104"
FT   misc_feature    complement(216951..218081)
FT                   /note="Pfam match to entry PF00668 DUF4, Domain of unknown
FT                   function, score 227.30, E-value 2.2e-64"
FT   misc_feature    complement(218154..219251)
FT                   /note="Pfam match to entry PF00668 DUF4, Domain of unknown
FT                   function, score 4.30, E-value 9.8e-10"
FT   misc_feature    complement(219300..219491)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site, score 49.80, E-value
FT                   3.8e-12"
FT   misc_feature    complement(219375..219422)
FT                   /note="PS00012 Phosphopantetheine attachment site"
FT   misc_feature    complement(219729..220967)
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme, score 473.00, E-value 2.4e-138"
FT   misc_feature    complement(220563..220598)
FT                   /note="PS00455 Putative AMP-binding domain signature"
FT   misc_feature    complement(221241..222350)
FT                   /note="Pfam match to entry PF00668 DUF4, Domain of unknown
FT                   function, score 178.50, E-value 1.1e-49"
FT   misc_feature    complement(222552..223745)
FT                   /note="Pfam match to entry PF00668 DUF4, Domain of unknown
FT                   function, score 89.10, E-value 8.7e-23"
FT   misc_feature    complement(223785..223976)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site, score 62.90, E-value
FT                   9e-16"
FT   misc_feature    complement(224229..225431)
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme, score 451.90, E-value 5.6e-132"
FT   misc_feature    complement(225042..225077)
FT                   /note="PS00455 Putative AMP-binding domain signature"
FT   CDS_pept        complement(225978..227783)
FT                   /transl_table=11
FT                   /gene="SCO0493"
FT                   /gene_synonym="SCF34.12c"
FT                   /product="putative ABC-transporter transmembrane protein"
FT                   /note="SCF34.12c, probable ABC-transporter transmembrane
FT                   protein, len: 601 aa; similar to the C-terminal half of
FT                   TR:O85018 (EMBL:AF034152), ExiT, Mycobacterium smegmatis
FT                   ABC-transporter associated with ferric exochelin
FT                   biosynthetic and uptake (possibly involved in exochelin
FT                   secretion) (1122 aa), fasta scores; opt: 1778 z-score:
FT                   1789.6 E(): 0, 50.4% identity in 585 aa overlap, to
FT                   TR:Q54204 (EMBL:X89010), StrW, Streptomyces glaucescens
FT                   putative ABC-transporter from the hydroxystreptomycin
FT                   production locus (591 aa) (33.1% identity in 577 aa
FT                   overlap) and to many other ABC-transporters. Similar to
FT                   many others from S.coelicolor e.g. to the C-terminal half
FT                   of TR:Q9ZBY5 (EMBL:AL034355) CydCD, S.coelicolor probable
FT                   ABC transporter (1172 aa) (30.3% identity in 574 aa
FT                   overlap). Contains hydrophobic, possible membrane-spanning
FT                   regions. Contains Pfam matches to entry PF00005 ABC_tran,
FT                   ABC transporter and to entry PF00664 ABC_membrane, ABC
FT                   transporter transmembrane region. Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9RK13"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK13"
FT                   /protein_id="CAB53323.1"
FT                   /translation="MSATDTRVATAPAVLRTATGGESGRWVAAHCREVPWLTAATVLTT
FT                   VAGAALQVLPVLLLGRVVDAVAGGESQDVLVTIGILMVAAALLGAVATAVSTCLIGRLG
FT                   ADLLARLREGAVRAVLAMPSARVEQVGRGDVLSRVGDDVAVISKGIRTAVPTVFSAGVL
FT                   VAIATAGMFGLDWRLGLAGAGALPAYALALRWYLPRSAPLYRKQRVAQADRAQALISGL
FT                   NGIDTVRAYRLEGAFRERVTRESWRVRELGIEVFRFFGRFVGRENRAEFIGLTLIIVVG
FT                   YALLEADAATLGEVSAAPLLFHRLFTPLGAIMFTFDEAQKSGASLTRLVGVLGEDAADR
FT                   LVGDASVGTAAAGAYPVTVRGLTFTYPGADEPVLRDVDLTIPAGGSLALVGATGAGKST
FT                   LAALVAGIGTPQAGSVRVGPADLAELDEAGARALVSILTQETHVFSGPLADDLRLAAPE
FT                   ATDAELLDALRTVGAGQWVDALPDGLDTPVGEGGERLDVTKVAQIALARLVLGRAPVVV
FT                   LDESTAEAGSEGAAELERAVLAACAGRTTLFVAHRLTQAMAADRIAVLDAGRVVEEGTH
FT                   AELVALGGRYARLWRAWREGGRAGC"
FT   misc_feature    complement(226080..226634)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 89.20, E-value 8.1e-23"
FT   misc_feature    complement(226590..226613)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    complement(226857..227675)
FT                   /note="Pfam match to entry PF00664 ABC_membrane, ABC
FT                   transporter transmembrane region., score 93.10, E-value
FT                   5.7e-24"
FT   CDS_pept        complement(227786..228838)
FT                   /transl_table=11
FT                   /gene="SCO0494"
FT                   /gene_synonym="SCF34.13c"
FT                   /product="putative iron-siderophore binding lipoprotein"
FT                   /note="SCF34.13c, probable iron-siderophore binding
FT                   lipoprotein, len: 350 aa; similar to TR:Q46023
FT                   (EMBL:U02617) Corynebacterium diphtheriae
FT                   DtxR/iron-regulated lipoprotein precursor (355 aa), fasta
FT                   scores; opt: 479 z-score: 518.8 E(): 1.5e-21, 34.4%
FT                   identity in 358 aa overlap and SW:FATB_VIBAN (EMBL:J03529),
FT                   FatB, Vibrio anguillarum plasmid pJM1 ferric
FT                   anguibactin-binding protein precursor (322 aa) (26.2%
FT                   identity in 305 aa overlap). Also similar to other
FT                   iron-siderophore binding proteins. Contains an
FT                   appropriately positioned PS00013 Prokaryotic membrane
FT                   lipoprotein lipid attachment site and a possible N-terminal
FT                   signal sequence. Contains Pfam match to entry PF01497
FT                   Peripla_BP_2. Contains a probable coiled-coil from 189 to
FT                   219 (31 residues) (Max score: 1.558, probability 0.98)"
FT                   /db_xref="GOA:Q9RK12"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK12"
FT                   /protein_id="CAB53324.1"
FT                   /translation="MLLRTTRTKPWRRLAAALSAAALGVGLLAGCGSDSDDPADEAGGG
FT                   TPAAAGAFPVTVEHAFGTTKIDKAPERVVSVGYTDDQTVLAFGIKPVGMVDQYPNPAGQ
FT                   SPDINTQWPWVKDKWGDTKPEVVMKNGDTGPNFEKIAALRPDLIVAVYSEIDQAAYDKL
FT                   SKIAPTVGRTKGEKEPFSAPWQDNALHIAKALGKAEEGEKMVADIQGKLDAAKQAHPEF
FT                   ADKTAVVLSWYKDSVAPFTSTDVRGRLVTGIGFKYETEIDKVAGGDFYTTLSPERVDLV
FT                   DVDRVFVINDKADQDALKKFELFTNLDAVKNGKVSYLLDSEGPAVGAAISQGTLLSMPY
FT                   AVDELVKSAG"
FT   misc_feature    complement(227870..228631)
FT                   /note="Pfam match to entry PF01497 Peripla_BP_2, , score
FT                   96.40, E-value 5.5e-25"
FT   misc_feature    complement(228746..228778)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        complement(228889..229752)
FT                   /transl_table=11
FT                   /gene="SCO0495"
FT                   /gene_synonym="SCF34.14c"
FT                   /product="putative iron-siderophore ABC-transporter
FT                   ATP-binding protein"
FT                   /note="SCF34.14c, probable iron-siderophore ABC-transporter
FT                   ATP-binding protein, len: 287 aa; similar to SW:FEPC_ECOLI
FT                   (EMBL:X57471), FepC, Escherichia coli ferric enterobactin
FT                   transport ATP-binding protein (271 aa), fasta scores; opt:
FT                   946 z-score: 1003.1 E(): 0, 52.3% identity in 262 aa
FT                   overlap and to many other iron-siderophore ATP-binding
FT                   proteins. Similar to many others from S. coelicolor e.g.
FT                   SCI51.25c (EMBL:AL109848) S.coelicolor probable
FT                   iron-siderophore uptake system ATP-binding component (301
FT                   aa) (58.9% identity in 258 aa overlap). Contains Pfam match
FT                   to entry PF00005 ABC_tran, ABC transporter, PS00211 ABC
FT                   transporters family signature and PS00017 ATP/GTP-binding
FT                   site motif A (P-loop)"
FT                   /db_xref="GOA:Q9RK11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK11"
FT                   /protein_id="CAB53325.1"
FT                   /translation="MVVQSITGTETEVDGASRLAARGVTVGYGTRSVIDGLDVAIPPGV
FT                   ITTIIGPNGCGKSTLLRTLSRLLRPTGGTVVLDGEDIAALRTRDVAKKLGLLPQAPVAP
FT                   EGLTVSDLVARGRHPHQSWLRQWSSDDADVVRQALAMTGVSDLADRPVDSLSGGQRQRV
FT                   WISMTLAQGTDLLLLDEPTTYLDLAHAVDVLDLVDDLHESGRTVVMVLHDLNLAARYSD
FT                   NLVVMREGAILAQGHPRDVITAGLLHEAFGLRAKVIDDPVGDRPLIVPIGRTHVELDRS
FT                   APELLK"
FT   misc_feature    complement(229063..229623)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 196.10, E-value 5.3e-55"
FT   misc_feature    complement(229246..229290)
FT                   /note="PS00211 ABC transporters family signature"
FT   misc_feature    complement(229579..229602)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        complement(229791..230897)
FT                   /transl_table=11
FT                   /gene="SCO0496"
FT                   /gene_synonym="SCF34.15c"
FT                   /product="putative iron-siderophore permease transmembrane
FT                   protein"
FT                   /note="SCF34.15c, probable iron-siderophore permease
FT                   transmembrane protein, len: 368 aa; similar to
FT                   SW:FEPG_ECOLI (EMBL:X57471), FepG, Escherichia coli ferric
FT                   enterobactin transport protein (330 aa), fasta scores; opt:
FT                   741 z-score: 794.3 E(): 0, 38.7% identity in 326 aa overlap
FT                   and to many other iron-siderophore permeases. Similar to
FT                   others from S. coelicolor e.g. SCI51.26c (EMBL:AL109848) S.
FT                   coelicolor probable iron-siderophore uptake system
FT                   transmembrane component (375 aa) (45.9% identity in 333 aa
FT                   overlap). Contains hydrophobic, possible membrane-spanning
FT                   regions. Contains Pfam match to entry PF01032 FecCD_family,
FT                   FecCD transport family"
FT                   /db_xref="GOA:Q9RK10"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK10"
FT                   /protein_id="CAB53326.1"
FT                   /translation="MNGTDMRADGADAAVDVKADVRTSVAPGVRFGGLSFVWRPWVAGV
FT                   TLLLAVAGFLVFCLSIGVGDFPIALPRVVATVFGGGEQVDRFVIMDLRMPRALAGLVVG
FT                   VALGVSGALTQSIARNPLASPDVLGITSGAGAVAVFLVTVSGGAATAVADSVGLSAAAL
FT                   AGGLGTGLLVYFMAWRRGIDGFRLILIGISVNAVMQAITTWLLVTADIRDVARAQAWLV
FT                   GSLDNRSWGEVHVALWCTLVLLVVVASVAFQFKPLHFGDDVAAGLGVRYGTVRAVLLLC
FT                   AVLLAGVAVSAAGPVPFVALVAPQVAMRLARCPTPPLVASGLVGALLLTGSDLLARTAL
FT                   PVSLPVGVVTAAIGGPFLVYLLVRANRR"
FT   misc_feature    complement(229806..230708)
FT                   /note="Pfam match to entry PF01032 FecCD_family, FecCD
FT                   transport family, score 305.20, E-value 8.1e-88"
FT   CDS_pept        complement(230894..231970)
FT                   /transl_table=11
FT                   /gene="SCO0497"
FT                   /gene_synonym="SCF34.16c"
FT                   /product="putative iron-siderophore permease transmembrane
FT                   protein"
FT                   /note="SCF34.16c, probable iron-siderophore permease
FT                   transmembrane protein, len: 358 aa; similar to
FT                   SW:FEPD_ECOLI (EMBL:X57471), FepD, Escherichia coli ferric
FT                   enterobactin transport protein (334 aa), fasta scores; opt:
FT                   796 z-score: 833.5 E(): 0, 43.9% identity in 330 aa overlap
FT                   and to many other iron-siderophore permeases. Similar to
FT                   others from S.coelicolor e.g. SCI51.27c (EMBL:AL109848)
FT                   S.coelicolor probable iron-siderophore uptake system
FT                   transmembrane component (348 aa) (46.8% identity in 344 aa
FT                   overlap). Contains hydrophobic, possible membrane-spanning
FT                   regions. Contains Pfam match to entry PF01032 FecCD_family,
FT                   FecCD transport family"
FT                   /db_xref="GOA:Q9RK09"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK09"
FT                   /protein_id="CAB53327.1"
FT                   /translation="MYGAMTTTEVERPAPTPRGPTEARRRRVAGLGLLAALLLVAAAAS
FT                   LAVGARALSPAEVWHGLFAAPESDQRLTEIRLIVQTVRVPRTVLAVVAGIALGVAGALI
FT                   QGYTRNPIADTGLLGVNSGASFAVVSGIAAFGFTSPFQYVWFGFAGAAVAGVVVFGLSS
FT                   IGRGAGNPLTLALAGQGVTVFLAAMTTAVALTDKASLNALRFWNAGSLTGVGFDVIGPV
FT                   SAFIAAGLLLALTTLPSVNLLNLGDDVARGLGVNIALTRTVGIVAITLLAGAATAACGP
FT                   IAFLGLMVAHVARYLTGPDYRWLVPYAGLLGAVVLLVCDIVGRLVVRPGELDAGVVVSL
FT                   LGAPFFAVLVWRGKFKSA"
FT   misc_feature    complement(230915..231826)
FT                   /note="Pfam match to entry PF01032 FecCD_family, FecCD
FT                   transport family, score 302.30, E-value 5.8e-87"
FT   CDS_pept        complement(231970..233325)
FT                   /transl_table=11
FT                   /gene="SCO0498"
FT                   /gene_synonym="SCF34.17c"
FT                   /product="putative peptide monooxygenase"
FT                   /note="SCF34.17c, probable peptide monooxygenase, len: 451
FT                   aa; similar to monooxygenases/hydroxylases associated with
FT                   peptide siderophore biosynthesis e.g. SW:PVDA_BURCE
FT                   (EMBL:AF013993), PvdA, Burkholderia cepacia L-ornithine
FT                   5-monooxygenase (444 aa), fasta scores; opt: 982 z-score:
FT                   1149.4 E(): 0, 43.5% identity in 405 aa overlap and
FT                   SW:IUCD_ECOLI (EMBL:M18968), IucD, Escherichia coli
FT                   L-lysine 6-monooxygenase (425 aa) (31.3% identity in 425 aa
FT                   overlap). Also similar to others from S.coelicolor e.g.
FT                   TR:Q9ZBH9 (EMBL:AL035206) S.coelicolor probable
FT                   oxidoreductase, partial CDS (353 aa) (38.1% identity in 349
FT                   aa overlap)"
FT                   /db_xref="GOA:Q9RK08"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK08"
FT                   /protein_id="CAB53328.1"
FT                   /translation="MSQVLPADSTLVHDLIGIGFGPSNVAMAIAIREHNAQAGGQEELD
FT                   ARFFEQQPRFGWHRGMLIDDATMQVSFLKDLVTLRNPASRYSFLCYLQSRGRLIDFINH
FT                   KNLFPLRVEFHDYFEWAAAKVDDMVSYGHEVVGVAPVVRDGVVDHLEVTVRSGEGLEVH
FT                   RARNLVVGTGLRPLVPEGVERGDRVWHNSELLSRVDTLEGTSPSRFVVVGAGQSAAENV
FT                   AYLHRRFPSAEICAVFARYGYSPADDSAFANRIFDPAAVDDYFTAPDGVKQRLMDYHGN
FT                   TNYSVVDIDLIDDLYRQMYREKVLGTERLRFLNVSRLSDVKETPDRVRATVTSLVTGEE
FT                   SHLDADVVVLATGYGPADPLGLLGEVADRCLRDDEGRVRVERDYRVTTDPALRCGIYLQ
FT                   GGTEHTHGITSSLLSNTAVRVGEILESLLDRGLESASDEVRTVADGTGTGAR"
FT   misc_feature    233501..233989
FT                   /note="Pfam match to entry PF00551 formyl_transf, Formyl
FT                   transferase, score 111.20, E-value 6.8e-31"
FT   CDS_pept        233501..234448
FT                   /transl_table=11
FT                   /gene="SCO0499"
FT                   /gene_synonym="SCF34.18"
FT                   /product="putative formyltransferase"
FT                   /note="SCF34.18, possible formyltransferase, len: 315 aa;
FT                   similar to TR:Q50378 (EMBL:U10425), FxbA, Mycobacterium
FT                   smegmatis putative formyltransferase required for exochelin
FT                   biosynthesis (360 aa), fasta scores; opt: 942 z-score:
FT                   1102.4 E(): 0, 49.5% identity in 309 aa overlap. Also
FT                   similar to many methionyl-tRNA formyltransferases e.g.
FT                   SW:FMT_PSEAE (EMBL:AF073952), Fmt, Pseudomonas aeruginosa
FT                   methionyl-tRNA formyltransferase (314 aa) (30.3% identity
FT                   in 307 aa overlap). Contains Pfam match to entry PF00551
FT                   formyl_transf, Formyl transferase"
FT                   /db_xref="GOA:Q9RK07"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK07"
FT                   /protein_id="CAB53329.1"
FT                   /translation="MRVVMFGYQTWGHRTLRALLDSEHDVVLVVTHPRSEHAYEKIWSD
FT                   SVADLAEEHGVPVLIRNRPDDDELFERLKDADPDIIVANNWRTWIPPRIFGLPRHGTLN
FT                   VHDSLLPKYAGFSPLIWALINGETEVGVTAHMMNDELDAGDIVRQEAVPVGPADTATDL
FT                   FHKTVDLIAPVTVGALGLIASGQTEFTKQDRSRASFFHKRSAEDIRIDWNWPAEDLERL
FT                   VRAQSEPYPSAFTFHRGRRLEILAAVVSEARYGGTPGRIFYREGEDVVIVAGADARRGR
FT                   NHGLAITRVRTEDGRELAATEYFTSMGGYLTARP"
FT   CDS_pept        complement(234534..234773)
FT                   /transl_table=11
FT                   /gene="SCO0500"
FT                   /gene_synonym="SCF34.19c"
FT                   /product="hypothetical protein SCF34.19c"
FT                   /note="SCF34.19c, unknown, len: 79 aa; unknown function,
FT                   probable CDS suggested by GC frameplot, positional base
FT                   preference, amino acid composition and the presence of a
FT                   potential RBS"
FT                   /db_xref="InterPro:IPR035172"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK06"
FT                   /protein_id="CAB53330.1"
FT                   /translation="MTEESSSQTGSEPAEAEGTALTPDADGQYNLKDKFREALERKRGK
FT                   QAEAAALAANADVAKIRGTHGPAASQRSFRRKSG"
FT   regulatory      complement(234779..234784)
FT                   /note="possible RBS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(234812..236764)
FT                   /transl_table=11
FT                   /gene="SCO0501"
FT                   /gene_synonym="SCF34.20c"
FT                   /product="putative secreted protein"
FT                   /note="SCF34.20c, putative secreted protein, len: 650 aa;
FT                   unknown function, shows very weak similarity to
FT                   SW:Y0D8_MYCTU (EMBL:Z78020) Mycobacterium tuberculosis
FT                   hypothetical protein (628 aa), fasta scores; opt: 233
FT                   z-score: 232.7 E(): 1.3e-05, 23.6% identity in 512 aa
FT                   overlap. Contains PS00017 ATP/GTP-binding site motif A
FT                   (P-loop)"
FT                   /db_xref="GOA:Q9RK05"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK05"
FT                   /protein_id="CAB53331.1"
FT                   /translation="MIAPHRRAGTSLLDLHHPYHLHPPSKEEHVRPRRAVARTASALVA
FT                   ALALTVGLGGPAVAAHEAEAGPATTGTGSVTHEENDRVPEGSVWTQHYFPSADRSGTRL
FT                   HADVLLPEGLKRKEKVPVILSIGPYFAHAGQTGPEGWSRTGPSARFQDFIEGTDLFDEG
FT                   YAFVMVDLRGFGGSTGCLDWGGPGEQADVKAAIDWAAKQPWSTGAVGMYGKSYDAVTGL
FT                   IGNNLDQRALRAVVAQEPVWDMYQYIYSNGVPRPNVTGTAGAYNSIASMPPMADDDPRY
FT                   QAAARYEESHPECLTENSAGYRISDQRDPHWTSRDLARMARGSDTPLFVTQGFVENNTK
FT                   PEEMEEYLDNHRGPERGWLGQWDHVRGGDRVEDGRLAMGRAGWYDETLSFYDQYLKGTR
FT                   PTVRYPAYAVEDSTGAWRAQRTWPVTERTVTLPLGGGSYVDDGGASARAALTASGSPAP
FT                   KAPPQPAGRWDMENAPATEQPAPAGLAAELAKRQRAGEVASSFFVWSKPLKSTTRVTGT
FT                   PRVSLTARGAGNVMLKLYDVAPDGTAVMFDEQVSLVKSGRMSVDLKATDWTLAAGHVLA
FT                   VEIGSIQTGSWRDTPSGETVEVKGARLGLALDNPADDVATAGDRSPYLDTYLRQYTVSL
FT                   PAGPGTFSVVPGGRS"
FT   misc_feature    complement(236120..236143)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   regulatory      236958..236962
FT                   /note="possible RBS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        236974..237408
FT                   /transl_table=11
FT                   /gene="SCO0502"
FT                   /gene_synonym="SCF34.21"
FT                   /product="putative membrane protein"
FT                   /note="SCF34.21, possible membrane protein, len: 144 aa;
FT                   unknown function, probable CDS suggested by GC frameplot
FT                   and positional base preference. Contains hydrophobic,
FT                   possible membrane-spanning regions"
FT                   /db_xref="GOA:Q9RK04"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK04"
FT                   /protein_id="CAB53332.1"
FT                   /translation="MARGVESIRRTALGALGAVLLLIGVALLVLPGPGLLLVFAGVVLL
FT                   ARAVPALDRFVAPVRVRAMRAAEESVSSRWRIAGSVLVGLFLLAAGAAWGLVPELPYSG
FT                   WATGASLIISGFVLFALLGWSHRRVRAARRGSPPASEGTR"
FT   CDS_pept        237532..238512
FT                   /transl_table=11
FT                   /gene="SCO0503"
FT                   /gene_synonym="SCF34.22"
FT                   /product="hypothetical protein"
FT                   /note="SCF34.22, hypothetical protein, len: 326 aa; unknown
FT                   function, shows weak similarity to the N-terminal half of
FT                   SCH10.22C (EMBL:AL049754) Streptomyces coelicolor putative
FT                   lipase/esterase (301 aa), fasta scores; opt: 178 z-score:
FT                   202.4 E(): 0.00065, 30.1% identity in 163 aa overlap"
FT                   /db_xref="GOA:Q9RK03"
FT                   /db_xref="InterPro:IPR017395"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK03"
FT                   /protein_id="CAB53333.1"
FT                   /translation="MSAQTHPTDFVPASAPVLSVAPVVLPAPGRPVDLRLRVSAPVTGT
FT                   GLPVILLSHGQGYSNHLSSLDGYAPLATYWAAHGFVVIQPTHLSSRTLALDPGTPGAPL
FT                   FWRSRAEDMTRVLDGLDLLEKAVPQLSGRLDRSRVAVAGHSMGGHTASLLLGARLTDPD
FT                   DGTEVDLTEPRIGAGVLLAAPGRGGDALSESAAESMPFFLSTDFSRMTTPALVVAGDRD
FT                   DSAHLTVSGPEWHTDPYSLSPGPKSLLTLFGAEHGLGGVAGYDVAETTDEDPGRVAAVQ
FT                   RLTWAYLRSTLYPGDTAWQVARDALDSGPDPLGRVESKQAPHPRP"
FT   CDS_pept        238623..239942
FT                   /transl_table=11
FT                   /gene="SCO0504"
FT                   /gene_synonym="SCF34.23"
FT                   /product="putative DEAD-box RNA-helicase"
FT                   /note="SCF34.23, probable DEAD-box RNA-helicase, len: 439
FT                   aa; similar to many e.g. to TR:O64430 (EMBL:AB010259),
FT                   Drh1, Arabidopsis thaliana DEAD box ATPase/RNA helicase
FT                   protein (619 aa), except where the A.thaliana protein is
FT                   longer at the N-terminus, fasta scores; opt: 806 z-score:
FT                   892.9 E(): 0, 35.3% identity in 447 aa overlap. Also
FT                   similar to many putative RNA-helicases e.g. SW:RHLE_ECOLI
FT                   (EMBL:L02123), RhlE, Escherichia coli putative
FT                   ATP-dependent RNA helicase (454 aa) (36.4% identity in 451
FT                   aa overlap) and to TR:O54116 (EMBL:AL021529) Streptomyces
FT                   coelicolor probable DEAD-box RNA-helicase (498 aa) (67.7%
FT                   identity in 424 aa overlap). Contains Pfam matches to entry
FT                   PF00270 DEAD, DEAD/DEAH box helicase and to entry PF00271
FT                   helicase_C, Helicases conserved C-terminal domain. Contains
FT                   2 PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9RK02"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK02"
FT                   /protein_id="CAB53334.1"
FT                   /translation="MNAKPTASFDGLGLPPVLVETMTSLGVTRPFPIQAATLPEALAGR
FT                   DVLGRARTGSGKTLAFGLALLAGTAGRRAEPKRPLALVLVSTRELAQQVSDALAPYARA
FT                   LGVRLTTVVGGLSINRQTQALRDGAEVVVATPGRLTDLVSRRDCHLNQVRITVLDEADQ
FT                   MCDLGFLPQVSGILDQVPSDGQRLLFSATLDGDVDQLVRDHLHDPVPVSVDPASASVST
FT                   MEHHVLTVHPADKYATATEIAARDGRVLMFLDTKAGVDRFTRELRAAGVSAGALHSGKS
FT                   QPQRTHTLARFVEGGVTVLVATNVAARGIHVDDLDLVVNVDPPADAKDYLHRGGRTARA
FT                   GRAGSVVTLVTPDQRREVNRMMSEAGIRPTVTPVRSGEQKLTDLTGAKRPPAGRGKESG
FT                   NAPFRGMGTRPAGAAKGSRKAVEARRAAEARAAARVRKGR"
FT   misc_feature    238680..239315
FT                   /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box
FT                   helicase, score 165.20, E-value 2.6e-51"
FT   misc_feature    238773..238796
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    239400..239645
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicases
FT                   conserved C-terminal domain, score 101.10, E-value 2.1e-26"
FT   misc_feature    239442..239465
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        240123..243131
FT                   /transl_table=11
FT                   /gene="SCO0505"
FT                   /gene_synonym="SCF6.01"
FT                   /gene_synonym="SCF34.24"
FT                   /product="putative large, multifunctional secreted protein"
FT                   /note="SCF6.01, possible multi-domain protein, (fragment),
FT                   len: >152 aa. Highly similar to Amycolatopsis orientalis
FT                   TR:CAB45032 (EMBL; AL078635) putative large
FT                   multi-functional protein (987 aa), fasta scores opt:  595
FT                   z-score: 714.7 E(): 1.9e-32 58.6% identity in 152 aa
FT                   overlap."
FT                   /note="SCF34.24, possible large, multifunctional secreted
FT                   protein, partial CDS, len: >891 aa; contains a region of
FT                   weak similarity to members of the glycosyl hydrolase family
FT                   at approx. aa 700-890 e.g. to part of SW:CTA2_BACCI
FT                   (EMBL:D88360), Cit, Bacillus circulans
FT                   cycloisomaltooligosaccharide glucanotransferase precursor
FT                   (964 aa), fasta scores; opt: 279 z-score: 292.6 E():
FT                   6.1e-09, 33.3% identity in 213 aa overlap and region of
FT                   very weak similarity at approx. aa 200-400 to part of a
FT                   dehydrogenase SW:SNDH_ACELI (EMBL:D28511) Acetobacter
FT                   liquefaciens L-sorbosone dehydrogenase (449 aa) (26.2%
FT                   identity in 279 aa overlap). Similar to CZA382.11
FT                   (EMBL:AL078635) Amycolatopsis orientalis possible large,
FT                   multifunctional protein (987 aa) (63.2% identity in 880 aa
FT                   overlap). Contains a probable N-terminal signal sequence"
FT                   /db_xref="GOA:Q8CK54"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CK54"
FT                   /protein_id="CAD55445.1"
FT                   /translation="MHPRLFSRARRHLILLLTSAVALGGAWAAPASSAAPADIPPQEPG
FT                   VTLRVFDVQTPLNELCTLKPGQTPNHDKLMPTVDWSTTADFGGIADNFVSQASGYLVAP
FT                   RDGTYVFRLVSDDGSRLALDGATVIDHDGLHGAEPKDGTVELTAGAHPLRIDHFDRGGG
FT                   QQVQLSWMPPGESGFTVVPTEALSTDAGVVRVTAPGRKECEAGRDTPGDGLPLTSVRPD
FT                   LDLTDLRPEGFEPQVTGMDWLPDGRLAISTWGGTDNVAGEVYLLDNVTGETSRDKVTVE
FT                   KVASGLREPMGIKYVDGSLYVSQKHELTRLVDSDGDDVTDEYRTVATWPYGGNFHEFAF
FT                   GLLYRDGYFYVNLSVAIDLGGATTNPQPAPNRGTTYKISKKTGKISPIAGGLRTPNGIG
FT                   WGPGGSLFATDNQGGWLPASKLVQIKQDRFFNHYTEPAGPFEDSPVTEPVLWLPQNEIG
FT                   NSPSTPLYLTKGRFAGQLLIGDVTYGGLQRAYLEKVKGQYQGAVFRYTQGLEAGVNRVS
FT                   MGPDGAIYTGGLGADGNWGQEGKLKFGLQKLTPNGGNTFDVQKMRAVPGGFDLTYTQPV
FT                   SEATAAELASRYEAEQWRYTPTGDYGGPKIAEEELAVRSATLSDDGRTVRLRLDGLKPD
FT                   RVVHVRSPRPFTSASGETLWSTEAWYTLNEMPGKQPPAATLYEAEEARLTGKAGINTDH
FT                   IGYSGSGFVDRYATEGDVTTTFDVTVPRAGTYDVGLRYSNGPDPFEGTKSLSLYAGGKK
FT                   VRQTQLPSTGDWDTWSTRTESVRLRAGHNTVSYRYDPGDTGHVNLDLITVRPHGARVAL
FT                   FDGTAASQEQWQHTDGRKAAWPLAEERSMEVCCGDIRTKDAYQDFKLHVEFRVPLLPDD
FT                   VTGQDRGNSGIYLQDRYELQILDSYGDTTLDTNEAGAIYLKKAPDTNAATAPETWQTYD
FT                   IVFRAARFDENGAKTADARVTVVWNGETVHDDVALDGPTAAGRAETPAAGAIRLQDHGN
FT                   KVRFRDIRVEPLN"
FT   regulatory      243258..243263
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        243269..244099
FT                   /transl_table=11
FT                   /gene="SCO0506"
FT                   /gene_synonym="nadE1"
FT                   /product="NH(3)-dependent NAD(+)synthetase"
FT                   /note="SCF6.02, nadE1, probable NH(3)-dependent
FT                   NAD(+)synthetase, len: 276 aa. Highly similar to many e.g.
FT                   Bacillus subtilis SW: NADE_BACSU (EMBL; M15811)
FT                   NH(3)-dependent NAD(+) synthetase (EC 6.3.5.1) (spore
FT                   outgrowth factor B) (sporulation protein OutB) (general
FT                   stress protein 38) (Gsp38) (272 aa), fasta scores opt: 901
FT                   z-score: 1027.2 E():0 53.9% identity in 267 aa overlap."
FT                   /db_xref="GOA:Q9RJM5"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RJM5"
FT                   /protein_id="CAB58266.1"
FT                   /translation="MSEPASIALQKEIVRELEVAETFDAEREIERRVAFLAERLTSTGL
FT                   RALVLGISGGVDSTTAGRLCQLAVERARAAGHEALFYAMRLPHGVQADEDDAQQALSFI
FT                   RPDRVLTVDIKPASDAALDALLAADVAFRDPHHQDFVHGNIKARQRMIAQYAVAGAHGG
FT                   LVVGTDHAAEAVSGFFTKFGDGAADVVPLTGLTKRRVRAVGDALGAPAALVRKVPTADL
FT                   ETLDPGKADEDALGVTYEEIDDFLEGKPVTEQVFETIVTRYRQTDHKRRLPIAP"
FT   stem_loop       244021..244110
FT                   /note="possible stem loop consisting of 90 bp with a 28 bp
FT                   inverted repeat."
FT   CDS_pept        complement(244119..244535)
FT                   /transl_table=11
FT                   /gene="SCO0507"
FT                   /gene_synonym="SCF6.03c"
FT                   /product="hypothetical protein SCF6.03c"
FT                   /note="SCF6.03c, unknown, len: 138 aa. Similar to the
FT                   C-terminus of many hypothetical oxidoreductases e.g.
FT                   Streptomyces coelicolor TR: CAB53280 (EMBL; AL109972)
FT                   putative oxidoreductase SCJ9A.19C (311 aa), fasta scores
FT                   opt:  307 z-score: 331.8 E(): 4.1e-11 44.4% identity in 126
FT                   aa overlap."
FT                   /db_xref="GOA:Q9RJM4"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJM4"
FT                   /protein_id="CAB58267.1"
FT                   /translation="MAFCNQSKFANAVFGQELHRRLAETGSPVRSALAHPGYSATGPQT
FT                   SAPAGMVRMLFGRVPRPLARSAERGALPRLYAAADPGVRGGGFIGPDGPGELRGGPKRV
FT                   RLSPAAADAATGRSLWELSERLTGVGFPPGPATG"
FT   CDS_pept        244545..245087
FT                   /transl_table=11
FT                   /gene="SCO0508"
FT                   /gene_synonym="SCF6.04"
FT                   /product="putative tetR family transcriptional regulator"
FT                   /note="SCF6.04, possible tetR family transcriptional
FT                   regulator, len: 180 aa. Similar to many e.g. Streptomyces
FT                   glaucescens SW:TCMR_STRGA (EMBL:M80674) tetracenomycin C
FT                   transcriptional repressor (226 aa), fasta scores opt: 225
FT                   z-score: 288.9 E(): 1e-08 34.5% identity in 174 aa overlap.
FT                   Contains a Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family with the possible
FT                   helix-turn-helix motif between residues 13..34 (+3.92 SD)."
FT                   /db_xref="GOA:Q9RJM3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJM3"
FT                   /protein_id="CAB58268.1"
FT                   /translation="MALAGEVVGEEVTTDEIASAAGVSKRTFFRYFASKEDVVVRFLTD
FT                   MGAGIHRELAARPAGERPSLALRSVLSGPLAACADHSDRALRVVRLILRTPALHARLLE
FT                   RQGRWREGLAAELARRPDLGPDHELYPELAAGMALTAFNTVLHRWSDSDGTADPEALTE
FT                   QAFALIAPALDGTRRQT"
FT   misc_feature    244572..244670
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 33.70, E-value
FT                   1.3e-07"
FT   CDS_pept        245194..246717
FT                   /transl_table=11
FT                   /gene="SCO0509"
FT                   /gene_synonym="glpK2"
FT                   /product="glycerol kinase 2 (ATP:glycerol
FT                   3-phosphotransferase) (EC 2.7.1.30)"
FT                   /note="SCF6.05, glpK2, glycerol kinase (ATP:glycerol
FT                   3-phosphotransferase)(EC 2.7.1.30), len: 507 aa. Highly
FT                   similar to many  glycerol kinases e.g. Mycobacterium
FT                   tuberculosis TR: O69664 (EMBL; AL022121) (517 aa), fasta
FT                   scores opt: 2606 z-score: 3028.8 E(): 0 75.3% identity in
FT                   503 aa overlap and Haemophilus influenzae SW:GLPK_HAEIN
FT                   (EMBL; U32752) (502 aa), fasta scores opt: 1714 z-score:
FT                   1992.5 E():0 51.1% identity in 503 aa overlap. Contains
FT                   Pfam match to entry PF00370 FGGY, FGGY family of
FT                   carbohydrate kinases and Prosite hits to PS00933 FGGY
FT                   family of carbohydrate kinases signature 1 and PS00445 FGGY
FT                   family of carbohydrate kinases signature 2. Also contains a
FT                   possible membrane spanning hydrophobic domain."
FT                   /db_xref="GOA:Q9RJM2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RJM2"
FT                   /protein_id="CAB58269.1"
FT                   /translation="MADFIGAVDQGTTSTRFMIFDHGGNEVAKHQLEHEQILPRSGWVE
FT                   HDPVEIWERTNSVMQNALRNGGLSGTDLAAIGITNQRETTVVWDPRTGRPYYNAIVWQD
FT                   TRTDAIAANLERSGRGDVIRRKAGLPPATYFSGGKIQWILENVDGVREAAEQGHAVFGN
FT                   TDSWVLWNLTGGPDGGIHATDVTNASRTMLMNLETLDWDDELLGFFGIPRGMLPTINPS
FT                   SHPEAFGTTRTSRPLRAAVPITGVLGDQHAATVGQVCFSPGEAKNTYGTGNFLVLNTGT
FT                   ELVRSQHGLLTTVAYQFGDNPPVYALEGSIAVTGSAVQWLRDQMKIIKTAAESEELART
FT                   VEDNGGMYFVPAFSGLFAPYWRSDARGAIVGLARYNDNAHLARATLEAICYQSRDVVVA
FT                   MEQDSSVHLDVLRVDGGVTANDLCMQIQADILGVPVSRPVVAETTALGAAYAAGLATGF
FT                   WRHTDELRTHWSESRRWEPQWSEERRAQGYAGWKMAVERTLDWVKVPES"
FT   misc_feature    245419..246540
FT                   /note="Pfam match to entry PF00370 FGGY, FGGY family of
FT                   carbohydrate kinases, score 419.50, E-value 3.2e-122"
FT   misc_feature    245593..245631
FT                   /note="PS00933 FGGY family of carbohydrate kinases
FT                   signature 1"
FT   misc_feature    246292..246354
FT                   /note="PS00445 FGGY family of carbohydrate kinases
FT                   signature 2"
FT   CDS_pept        complement(246740..247147)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="SCO0510"
FT                   /gene_synonym="SCF6.06c"
FT                   /product="putative oxidoreductase (pseudogene)"
FT                   /note="SCF6.06c, putative oxidoreductase, pseudogene, len:
FT                   83 aa. Similar to parts of Streptomyces lividans
FT                   SW:OXIR_STRLI probable oxidoreductase (EC 1.-.-.-) (297 aa)
FT                   and Streptomyces antibioticus SW:OXIR_STRAT (EMBL; M96551)
FT                   probable oxidoreductase (EC 1.-.-.-) (298 aa). This CDS has
FT                   at least one frame shift in the sequence after residue 35,
FT                   nucleotide position 4371."
FT   regulatory      247341..247345
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        247358..248116
FT                   /transl_table=11
FT                   /gene="SCO0511"
FT                   /gene_synonym="SCF6.07"
FT                   /product="putative dehydrogenase (putative secreted
FT                   protein)"
FT                   /note="SCF6.07, possible dehydrogenase (putative secreted
FT                   protein), len: 252 aa. Highly similar to many e.g.
FT                   Pseudomonas paucimobilis SW:LINX_PSEPA (EMBL; D23722)
FT                   2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase (EC
FT                   1.1.-.-) (2,5-ddol dehydrogenase) LinX (250 aa), fasta
FT                   scores opt: 532 z-score: 558.4 E(): 9.7e-24 40.0% identity
FT                   in 245 aa overlap. Also similar to many Streptomyces
FT                   coelicolor putative oxidoreductases e.g. TR:O88068 (EMBL;
FT                   AL031541) putative dehydrogenase SCI35.33C (260 aa), fasta
FT                   scores opt: 488 z-score: 438.3 E(): 4.1e-19 38.7% identity
FT                   in 256 aa overlap. Contains a Prosite hit to PS00061
FT                   Short-chain dehydrogenases/reductases family signature and
FT                   Pfam hits to entry PF00678 adh_short_C2, Short chain
FT                   dehydrogenase/reductase C-terminus and Pfam match to entry
FT                   PF00106 adh_short, short chain dehydrogenase."
FT                   /db_xref="GOA:Q9RJM1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJM1"
FT                   /protein_id="CAB58271.1"
FT                   /translation="MRLADRTALVTGATSNIGRAIAEAFAAEGAHVVVSGRSAERGREV
FT                   VDGIRAAGGRADFVHADLDGSAAASRALAREATRVLGGRVDVLVNNAGIYPPGTTTDTD
FT                   EETFDRVYAVNVKAPFFLTAVLAPAMVRAGGGTVINLGSWIARLGVPVGALYSSTKGAV
FT                   ETLTRAWAAEFGARGVRVNAISPGVVQTPPPGEVHPAEVMMRGTPAGRMGTPEAIASAA
FT                   VYLAGDESSFVHGTVLDVDGGRTAAAVIAA"
FT   misc_feature    247373..247933
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 217.30, E-value 2.3e-61"
FT   misc_feature    247784..247870
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature"
FT   misc_feature    247985..248077
FT                   /note="Pfam match to entry PF00678 adh_short_C2, Short
FT                   chain dehydrogenase/reductase C-terminus, score 42.80,
FT                   E-value 7.7e-09"
FT   CDS_pept        complement(248135..248743)
FT                   /transl_table=11
FT                   /gene="SCO0512"
FT                   /gene_synonym="SCF6.08c"
FT                   /product="putative regulatory protein"
FT                   /note="SCF6.08c, possible regulatory protein, len: 202 aa.
FT                   Similar to many other putative regulatory proteins e.g.
FT                   Streptomyces coelicolor TR:CAB53122 (EMBL; AL109962)
FT                   putative transcriptional regulatory protein SCJ1.04 (207
FT                   aa), fasta scores opt:  436 z-score: 515.3 E(): 2.5e-21
FT                   44.4% identity in 196 aa overlap."
FT                   /db_xref="GOA:Q9RJM0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJM0"
FT                   /protein_id="CAB58272.1"
FT                   /translation="MRGELTAKGRATRRRIVEGAAAVLRERGVASTTLDDIMARTATSK
FT                   SQLFHYFPAGKDELLVEVARFEADQVLEDQQPQLGRLDSWEAWREWRDVVIERYETQGD
FT                   QCPLGSLFLQIGRSTPGTRAIVVELLRQWQESLAAGIRSLQGAGALPADLDVETRAAAL
FT                   LTAIQGGVSILLSTGRSTHLRAALDQGIADLRRAGAAAR"
FT   regulatory      complement(248751..248755)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        248809..249900
FT                   /transl_table=11
FT                   /gene="SCO0513"
FT                   /gene_synonym="SCF6.09"
FT                   /product="integral membrane protein"
FT                   /note="SCF6.09, integral membrane protein, len: 363 aa.
FT                   Similar to a number of hypothetical integral membrane
FT                   proteins e.g. Escherichia coli SW:PERM_ECOLI (EMBL;
FT                   AE000335) putative permease PerM (353 aa), fasta scores
FT                   opt:  383 z-score: 425.2 E(): 2.6e-16 27.5% identity in 346
FT                   aa overlap and Mycobacterium tuberculosis TR:O53656 (EMBL;
FT                   AL021928) hypothetical 38.0 KD protein (367 aa), fasta
FT                   scores opt:  687 z-score: 755.9 E():0 33.5% identity in 340
FT                   aa overlap. Contains multiple possible membrane spanning
FT                   hydrophobic domains and a Pfam match to entry PF01594
FT                   DUF20, Putative permease."
FT                   /db_xref="GOA:Q9RJL9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJL9"
FT                   /protein_id="CAB58273.1"
FT                   /translation="MSAGLSAAKTRAALRTSARVSGELLLILVMLAVTLWVLGRMWSVV
FT                   WPLLVGLLLTTLTWPPARFLRRHGWRPALAATVVTVAFLLVVLGIVALIAVPMSSQTDE
FT                   LTDGVVEGIQRLREWAAGPPLNIGDDEITGAMDSAVARIQDSVGSITTAVATGVGAVVN
FT                   GLITAVLGVFLMFFFLKDGPRFLPWLARQLPGRLATDVPVVALRGWETLGSFVRSQALV
FT                   GLLDAVFIGLGLWILGVPLVLPLAVLTFVSAFVPIVGALFAGFVAVLIALVSNGLTDAL
FT                   IVLAIIVVVQQLEGNVFQPILQSRGLGLHAAVILLAVTLGGSLSGIVGSLLAVPFAALI
FT                   AVVWTYVREQLSERPEATATADG"
FT   misc_feature    248896..249852
FT                   /note="Pfam match to entry PF01594 DUF20, Putative
FT                   permease, score 161.60, E-value 1.3e-44"
FT   CDS_pept        249968..250621
FT                   /transl_table=11
FT                   /gene="SCO0514"
FT                   /gene_synonym="SCF6.10"
FT                   /product="hypothetical protein SCF6.10"
FT                   /note="SCF6.10, unknown, len: 217 aa."
FT                   /db_xref="GOA:Q9RJL8"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJL8"
FT                   /protein_id="CAB58274.1"
FT                   /translation="MDLFSRSWSALLAAVAGLCDEDFARPSGCAGWLVRDLVCHLVVDA
FT                   QDVLITLATPTADEPTRDAVTYWQVVEPPTGDDPLDALIVRLAAAYEQPGLLKFHLADV
FT                   GSAAGRAAALADPASRVGTQGQVLTAGDYLSAYVLECSLHHLDLIAHLPEAAPPPAAGL
FT                   RRSRELLERVVGTAFPTVFADRDALLIGTGRRAPTPAEEAALGELAARLPFPVG"
FT   CDS_pept        250850..251458
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="SCO0515"
FT                   /gene_synonym="SCF6.11"
FT                   /product="hypothetical protein SCF6.11 (pseudogene)"
FT                   /note="SCF6.11, unknown, pseudogene, len: 128 aa. Similar
FT                   to Escherichia coli SW:YAHD_ECOLI (EMBL; AE000139)
FT                   hypothetical 21.7 KD protein in BETT-PRPR intergenic region
FT                   (201 aa). The high similarity extends past the last
FT                   possible translational start codon suitable for this CDS."
FT   CDS_pept        251455..252633
FT                   /transl_table=11
FT                   /gene="SCO0516"
FT                   /gene_synonym="SCF6.12"
FT                   /product="putative lipoprotein"
FT                   /note="SCF6.12, possible lipoprotein, len:392 aa. Weakly
FT                   similar to  Methylobacterium extorquens TR:O30796 (EMBL;
FT                   AF017434) hypothetical protein MxaE (281 aa), fasta scores
FT                   opt:  205 z-score: 214.7 E(): 0.00014 32.5% identity in 295
FT                   aa overlap. Contains a possible N-terminal signal sequence
FT                   and an appropriately positioned Prosite hit to PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site."
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJL7"
FT                   /protein_id="CAB58276.1"
FT                   /translation="MNRRSLAGRLAALAAVTATLGGCAPDGGDDGAASPVSAPPGSTAQ
FT                   RTPGSGGTSARTPQGTLLVTDFGADTVTFVDPAGRGAAADLGSVRVGTAPYGIALGEDG
FT                   TAWVATAEGVAAVDTRTRVRTALVPHRTDTGPVTTGEYRGGGMGIALSPDGSRVYVGVN
FT                   VPGGKGTLEVVDTERREVTRVVPVGRRPFDVDVSRDGRQVYATNHDSFDVSVVDTGDWT
FT                   ARRIEVAPYGTEGGLGSWLKPHYAAVRPSDGALLLPFEGERLAVVDPGTGRVRTEDMTA
FT                   NTHQHGVTAGADGTLYVVGTGPIDPSEDDGPSLTVRTPEGDERVVPLDGPHETVALSAD
FT                   GRTAYVSGGFTRDGYWNGLSAVDVATGRVTRLPVGERPLAVAVLGGQGTGAG"
FT   misc_feature    251491..251523
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        <252918..>253115
FT                   /transl_table=11
FT                   /gene="SCO0517"
FT                   /gene_synonym="SCF6.13"
FT                   /product="hypothetical protein"
FT                   /note="SCF6.13, hypothetical protein, len: 66 aa. Gene
FT                   fragment shares a high level of similarity with
FT                   Streptomyces coelicolor TR:CAB53135 (EMBL; AL109962)
FT                   possible regulator protein SCJ1.17 (190 aa); fasta scores:
FT                   opt: 275 z-score: 356.5 E(): 1.7e-12; 62.1% identity in 66
FT                   aa overlap"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADB0"
FT                   /protein_id="CAB58277.2"
FT                   /translation="RVVRVAREVRVAEGTRLFEEGRRAELFRIVRTRTVGLDLRVPGRR
FT                   SPVVETPGHGELVGWCWHFPP"
FT   CDS_pept        253094..>253351
FT                   /transl_table=11
FT                   /gene="SCO0518"
FT                   /gene_synonym="SCF6.14"
FT                   /product="hypothetical protein"
FT                   /note="SCF6.14, hypothetical protein, len: 86 aa. Gene
FT                   fragment that is highly similar to Streptomyces coelicolor
FT                   TR:Q9RI29 (EMBL:AL109989) putative nitrate reductase delta
FT                   chain NarI2 (256 aa); fasta scores: opt: 409 Z-score: 526.8
FT                   bits: 103.5 E(): 9.3e-22; 74.390% identity in 82 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9ADA9"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADA9"
FT                   /protein_id="CAB58278.2"
FT                   /translation="MVLALPAGGGYDYRGTVSVWFRGLFALGPRPEVIAYAPLLFRPHA
FT                   PSACLLFAARPFTRLVHVWSAPVGYLVRPCSVHRRRATPAR"
FT   CDS_pept        complement(253403..254140)
FT                   /transl_table=11
FT                   /gene="SCO0519"
FT                   /gene_synonym="SCF6.15c"
FT                   /product="putative oxidoreductase"
FT                   /note="SCF6.15c, possible oxidoreductase, len: 245 aa.
FT                   Similar to many e.g. Bacillus megaterium SW:DHG2_BACME
FT                   (EMBL; D90044) glucose 1-dehydrogenase II (EC 1.1.1.47)
FT                   (GLCDH-II) (261 aa), fasta scores opt: 402 z-score: 449.5
FT                   E(): 1.1e-17 35.1% identity in 228 aa overlap. Also similar
FT                   to many other Streptomyces coelicolor putative
FT                   oxidoreductases e.g. TR:CAB41284 (EMBL; AL049707) (260 aa),
FT                   fasta scores opt: 395 z-score: 365.3 E(): 4.8e-15 37.2%
FT                   identity in 242 aa overlap. Contains a Pfam match to entry
FT                   PF00106 adh_short, short chain dehydrogenase and a Prosite
FT                   hit to PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /db_xref="GOA:Q9RJL6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJL6"
FT                   /protein_id="CAB58279.1"
FT                   /translation="MSGIEGKVVAITGASGGIGEASALLLAERGAKVVLGARRPERLAD
FT                   LALRIGRSGGEAAWIRTDVTRREDVAALVALARERFGRLDVLVGNAGVGLISPLDELRV
FT                   EDWERMIDVNLKGVLYGIAEALPVFREQGSGHFVNIVSTAGLRISPLMSVYAGTKNAVR
FT                   TVSEGLRQEAGDSLRVTVVSPGFVHTDFADGIPDAGARAQILDTRDRVAIPPQAVARAV
FT                   AFAVEQPDGVDVGDIVVRPTAQD"
FT   misc_feature    complement(253571..254122)
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 199.00, E-value 7.2e-56"
FT   misc_feature    complement(253631..253717)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature"
FT   regulatory      254262..254267
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        254277..254861
FT                   /transl_table=11
FT                   /gene="SCO0520"
FT                   /gene_synonym="SCF6.16"
FT                   /product="putative tetR family transcriptional regulator"
FT                   /note="SCF6.16, putative tetR family transcriptional
FT                   regulator, len: 194 aa. Weakly similar to many other tetR
FT                   family regulators e.g. Streptomyces sp. TR:O24741
FT                   (EMBL:AB001683) FarA (221 aa), fasta scores opt: 161
FT                   z-score: 205.5 E(): 0.00044 28.4% identity in 190 aa
FT                   overlap and Streptomyces coelicolor TR:O86852
FT                   (EMBL:AJ007731) gamma-butyrolactone binding protein (215
FT                   aa), fasta scores opt:  149 z-score: 191.2 E(): 0.0028
FT                   26.6% identity in 188 aa overlap. Also highly similar to
FT                   Streptomyces coelicolor SCF51A.08 (EMBL; AL121596) putative
FT                   tetR family transcriptional regulator (227 aa), fasta
FT                   scores opt: 479 z-score: 463.7 E(): 1.5e-20 43.7% identity
FT                   in 183 aa overlap. Contains a Pfam match to entry PF00440
FT                   tetR, Bacterial regulatory proteins, tetR family. The
FT                   possible helix-turn-helix motif lies between residues
FT                   36..57 (+4.21 SD)."
FT                   /db_xref="GOA:Q9RJL5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:2Q24"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJL5"
FT                   /protein_id="CAB58280.1"
FT                   /translation="MSDATKRPLRADAQRNRDKILAAAVRVFSEEGLDAHLERIAREAG
FT                   VGSGTLYRNFPTREALIEAAYRNEVARLCDSVPGLLAELPPAEALRAWTRRFIDYATAK
FT                   LGMADALRAVVASGGDPYGDSRQLIQSALTALMDAAAAAGEIRSDIRSTDMFAALAGIA
FT                   LTSSRPDQRAQAERLLDLVLDGLRPTAPRPA"
FT   misc_feature    254334..254471
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 31.00, E-value
FT                   7.1e-07"
FT   CDS_pept        254892..255473
FT                   /transl_table=11
FT                   /gene="SCO0521"
FT                   /gene_synonym="SCF11.01"
FT                   /gene_synonym="SCF6.17"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /note="SCF11.01, possible tetR family transcriptional
FT                   regulator, partial CDS, len: >32 aa. Previously annotated
FT                   as Streptomyces coelicolor SCF6.17, possible tetR family
FT                   trasncriptional regulator, len: >193 aa. Similar to several
FT                   e.g. Streptomyces coelicolor TR:CAB56142 (EMBL; AL117669)
FT                   putative transcriptional regulator SCF12.15 (188 aa), fasta
FT                   scores opt:446 z-score: 521.2 E(): 1.2e-21 43.5% identity
FT                   in 184 aa overlap and Streptomyces glaucescens
FT                   SW:TCMR_STRGA (EMBL; M80674) tetracenomycin C
FT                   transcriptional repressor (226 aa), fasta scores opt:  202
FT                   z-score: 242.5 E(): 3.8e-06 29.3% identity in 164 aa
FT                   overlap."
FT                   /note="SCF6.17, possible tetR family transcriptional
FT                   regulator, len: 193 aa. Similar to several e.g.
FT                   Streptomyces coelicolor TR:CAB56142 (EMBL; AL117669)
FT                   putative transcriptional regulator SCF12.15 (188 aa), fasta
FT                   scores opt:446 z-score: 521.2 E(): 1.2e-21 43.5% identity
FT                   in 184 aa overlap and Streptomyces glaucescens
FT                   SW:TCMR_STRGA (EMBL; M80674) tetracenomycin C
FT                   transcriptional repressor (226 aa), fasta scores opt:  202
FT                   z-score: 242.5 E(): 3.8e-06 29.3% identity in 164 aa
FT                   overlap. Contains a Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family. The possible
FT                   helix-turn-helix motif lies between residues 29..50 (+2.70
FT                   SD)."
FT                   /db_xref="GOA:Q9RJL4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RJL4"
FT                   /protein_id="CAB58281.1"
FT                   /translation="MGRWEPNARGRLEQAALELYVERGYEQTPVAEITKRAGLTERTFF
FT                   RHFTDKREVLFAGSGRLEELCVAAVAAAPTTASPMEAVAAALDAAAGAFEERGDLVGLR
FT                   QGVIDSNAELRERELIKLASLSGALADALRGRGVAEPAAELTAESAIAVLKVAFRRWID
FT                   GGRERPLRPLLAECFDVLRTLSARGAASAG"
FT   misc_feature    254925..255056
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 37.70, E-value
FT                   1e-08"
FT   regulatory      255627..255630
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        255649..256440
FT                   /transl_table=11
FT                   /gene="SCO0522"
FT                   /gene_synonym="SCF11.02"
FT                   /product="putative oxidoreductase"
FT                   /note="SCF11.02, probable oxidoreductase, len: 262 aa;
FT                   similar to TR:O54197 (EMBL:AJ000671) Streptomyces
FT                   clavuligerus clavulanate-9-aldehyde reductase, 247 aa;
FT                   fasta scores: opt: 501 z-score: 567.7 E(): 3e-24; 39.1%
FT                   identity in 238 aa overlap. Contains Pfam match to entry
FT                   PF00106 adh_short, short chain dehydrogenase and prosite
FT                   match to entry PS00061 Short-chain
FT                   dehydrogenases/reductases family signature. also similar to
FT                   Streptomyces coelicolor SCF6.15c, 245 aa; fasta scores:
FT                   opt:  818 z-score: 805.2 E():0; 56.5% identity in 237 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9RK87"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK87"
FT                   /protein_id="CAB59579.1"
FT                   /translation="MSRTDSAQQMRTIHRKDIVMTQTSKVVLVTGASSGIGEATALRLA
FT                   ADGHRVFLGARRTERLEKLAARIAEDGGTAGYRRLDVTDAADVRAFVSAAVERWGRLDV
FT                   IVNNAGVMPLSPLSELKVAEWDRMLDVNVRGVLHGIAAALPVMRAQGGGHVVNIASVGA
FT                   YEVVPTAAVYCATKFAVRALSEGLRQESAGDIRVSVVSPGVTESELADSISDPRAREDM
FT                   KTYRSVAVPASAIADAIAFAVSRPAEVDVNEIVVRPAASAQ"
FT   misc_feature    255721..256272
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 248.20, E-value 1.2e-70"
FT   misc_feature    256126..256212
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature"
FT   CDS_pept        complement(256468..256905)
FT                   /transl_table=11
FT                   /gene="SCO0523"
FT                   /gene_synonym="SCF11.03c"
FT                   /product="putative transcriptional regulator"
FT                   /note="SCF11.03c, probable transcriptional regulator, len:
FT                   145 aa; similar to SW:ASNC_ECOLI (EMBL:AE000451)
FT                   Escherichia coli, regulatory protein AsnC, 152 aa; fasta
FT                   scores: opt: 222 z-score: 287.1 E(): 1.3e-08; 26.9%
FT                   identity in 145 aa overlap. Contains Pfam match to entry
FT                   PF01037 ASNC_trans_reg, AsnC family"
FT                   /db_xref="GOA:Q9RK86"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK86"
FT                   /protein_id="CAB59580.1"
FT                   /translation="MDEIDRRLIALLQQDATRPYAALGGEVGLSAGAAHERVRKLREQR
FT                   VIRSTTVDVDPEALDRGVLAFVLVDSTAWMGDRAEDFAAVPEIQEAHVIAGSAAVLVKV
FT                   RTATTERLQDVLRRLYAIDGVSGTQATVVLETFFERPLDAG"
FT   misc_feature    complement(256537..256833)
FT                   /note="Pfam match to entry PF01037 ASNC_trans_reg, AsnC
FT                   family, score 52.20, E-value 1.1e-11"
FT   regulatory      256981..256985
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        256990..257898
FT                   /transl_table=11
FT                   /gene="SCO0524"
FT                   /gene_synonym="SCF11.04"
FT                   /product="possible gluconolactonase precursor"
FT                   /note="SCF11.04, possible gluconolactonase, len: 302 aa;
FT                   similar to SW:GNL_ZYMMO (EMBL:X67189) Zymomonas mobilis
FT                   gluconolactonase precursor (EC 3.1.1.17)
FT                   D-glucono-delta-lactone lactonohydrolase; fasta scores:
FT                   opt: 326 z-score: 392.6 E(): 1.7e-14; 28.7% identity in 258
FT                   aa overlap"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK85"
FT                   /protein_id="CAB59581.1"
FT                   /translation="MSTDGPYEILDDRFRTGRCANGDNRLEVLYDGCRWAEGPLYLPAW
FT                   RQLVWSDIPNDRILRWDEATGSVGVFRAPAGHSNGNTLDRQGRLVTCEQGNRRVTRTEP
FT                   DGRVTVLAERFDGRRLNSPNDSVVRSDGTIWFSDPDFGITSDYEGHRAESEIGACNVYR
FT                   IDPVSGQVRLAADGFDGPNGVILTPDERRLFVSDSRAARIHAFDIREDGTLSDGKVFAE
FT                   GRGDVHFDNIRFDDEGRLWAAALHDGVHCYDPDGTLIGRLRVPEPVSNVAFGGPKNNRL
FT                   FITATTSLYSLVMSVTGAPRL"
FT   CDS_pept        258029..258844
FT                   /transl_table=11
FT                   /gene="SCO0525"
FT                   /gene_synonym="SCF11.05"
FT                   /product="conserved hypothetical protein SCF11.05"
FT                   /note="SCF11.05, hypothetical protein, len: 271 aa; similar
FT                   to various hypothetical proteins, e.g. TR:CAB45341
FT                   (EMBL:AL079345) Streptomyces coelicolor SCE68.05C
FT                   hypothetical 33.1 KD protein, 300 aa; fasta scores: opt:
FT                   808 z-score: 960.4 E(): 0; 53.2% identity in 250 aa
FT                   overlap"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK84"
FT                   /protein_id="CAB59582.1"
FT                   /translation="MSDPSTTPGHTAQQKIDTSVPHSARIWNYWLGGKDNYPVDEQAGD
FT                   AYTAVFPGIVTVARSSRAFLRRNITHLVAEAGIRQFLDIGTGLPTADNTHEVAQRIAPE
FT                   SRIVYVDNDPMVLAHARALLYSTPEGATSYIDSDVLDPDTVLEAAARTLDFDRPIALIL
FT                   SNILGHIPDYDQARSVAARLVDALPSGSYLSINDGSRGIDPEFDRAQDGYNESGAAPYI
FT                   LRTVDQITAFFDGLELVEPGVVPVTRWRPDADTEDPGLIGEHGGLARKP"
FT   regulatory      258868..258872
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        258882..259715
FT                   /transl_table=11
FT                   /gene="SCO0526"
FT                   /gene_synonym="SCF11.06"
FT                   /product="possible oxidoreductase"
FT                   /note="SCF11.06, possible oxidoreductase, len: 277 aa;
FT                   similar to TR:O53622 (EMBL:AL021428) Mycobacterium
FT                   tuberculosis putative oxidoreductase MTV030.21c, 276 aa;
FT                   fasta scores: opt: 276 z-score: 329.4 E(): 5.6e-11; 24.7%
FT                   identity in 267 aa overlap and to SW:PRXC_PSEFL
FT                   (EMBL:AF031153) Pseudomonas fluorescens non-heme
FT                   chloroperodixase (EC 1.11.1.10) (chloride peroxidase)
FT                   (CPO-F) (chloropeorixidase F) Cpo or CpoF; fasta scores:
FT                   opt: 233 z-score: 279.3 E():3.5e-08; 26.1% identity in 283
FT                   aa overlap. Contains Pfam match to entry PF00561
FT                   abhydrolase, alpha/beta hydrolase fold"
FT                   /db_xref="GOA:Q9RK83"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK83"
FT                   /protein_id="CAB59583.1"
FT                   /translation="MSAWPLPEAFTGGSGTVRWNRLGAPDGRPLVLLHGTPFSSYVWRA
FT                   VARSLGRDHQVFVWDMPGYGVSEKSAGQDVSLAAQGRVFTELLEHWGLEEPLVAAHDFG
FT                   GAVALRAHLLHGARYGALALVDPVALAPWGSPFFRLVRDHAEVFEQLPEALHRALVREY
FT                   VGSTGGPGLHPAVLDRLVEPWLGETGQPAFYRQIAQADQRYTDEIQDRYTGIDVPTLIC
FT                   WGEDDAWIPVAKGRELAGLVPGSRWEPIAHAGHLVQEDAPAELTAALLDFFRRVP"
FT   misc_feature    259041..259700
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 62.30, E-value 1e-14"
FT   CDS_pept        complement(259812..260015)
FT                   /transl_table=11
FT                   /gene="SCO0527"
FT                   /gene_synonym="scoF"
FT                   /gene_synonym="SCF11.07c"
FT                   /product="cold shock protein"
FT                   /note="SCF11.07c, scoF, cold shock protein, len: 67 aa.
FT                   Identical to SW:CSPF_STRCO (EMBL:X92686) Streptomyces
FT                   coelicolor cold shock protein ScoF and similar to
FT                   SW:CSP7_STRCL (EMBL:X68245) Streptomyces clavuligerus cold
FT                   shock-like protein 7.0, 66 aa; fasta scores: opt: 362
FT                   z-score: 493.9 E(): 3.8e-20; 74.6% identity in 67 aa
FT                   overlap and to Streptomyces coelicolor SC10A5.26c, 67 aa;
FT                   fasta scores: opt: 383 z-score: 518.2 E(): 1.5e-23; 82.1%
FT                   identity in 67 aa overlap. Contains Pfam match to entry
FT                   PF00313 CSD, 'Cold-shock' DNA-binding domain and Prosite
FT                   match to entry PS00352 'Cold-shock' DNA-binding domain
FT                   signature"
FT                   /db_xref="GOA:P48859"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48859"
FT                   /protein_id="CAB59584.1"
FT                   /translation="MASGTVKWFNSEKGFGFIAQDGGGPDVFAHYSNINAQGYRELQEG
FT                   QAVTFDITQGQKGPQAENITPA"
FT   misc_feature    complement(259821..259973)
FT                   /note="Pfam match to entry PF00313 CSD, 'Cold-shock'
FT                   DNA-binding domain, score 101.10, E-value 9.5e-27"
FT   misc_feature    complement(259914..259973)
FT                   /note="PS00352 'Cold-shock' DNA-binding domain signature"
FT   regulatory      260336..260340
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        260346..261098
FT                   /transl_table=11
FT                   /gene="SCO0528"
FT                   /gene_synonym="SCF11.08"
FT                   /product="putative lipoprotein"
FT                   /note="SCF11.08, possible lipoprotein, len: 261 aa; similar
FT                   to various hypothetical proteins, e.g. TR:O07236
FT                   (EMBL:Z96800) Mycobacterium tuberculosis hypothetical 22.5
FT                   KD protein, 218 aa; fasta scores: opt: 157 z-score: 172.7
FT                   E(): 0.03; 25.3% identity in 194 aa overlap. Contains a
FT                   Prosite match correctly situated to entry PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site.
FT                   Contains probable N-terminal signal sequence"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK82"
FT                   /protein_id="CAB59585.1"
FT                   /translation="MTVRKALALVIGAVMCTGVLATGCAREHAGASSQDAHAPGSSAAP
FT                   RPAPPRSFPRPLPGVGPVMRDRLPDGTRQALVVTGETESSSQAQVVLYEQYPAEGWRAV
FT                   AGPWPAHNGLRGWTDDHEAGDLHTPIGVFGLSDAGGRLPDPGTLLPYDEDPEFSVSGTG
FT                   YLGEPLEGSFDYVVAIDYNRVPGTTPLDKARPLGEDKGGGVWIHVDHDGPTNACVSLSE
FT                   EHMRALLTALDPDKEPVVVMGPREVLMR"
FT   misc_feature    260385..260417
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        complement(261127..262545)
FT                   /transl_table=11
FT                   /gene="SCO0529"
FT                   /gene_synonym="SCF11.09c"
FT                   /product="probable oxidoreductase (putative secreted
FT                   protein)"
FT                   /note="SCF11.09c, probable oxidoreductase (putative
FT                   secreted protein), len: 508 aa; similar to TR:P75002
FT                   (EMBL:Z80356) Zymomonas mobilis glucose-fructose
FT                   oxidoreductase precursor, 433 aa; fasta scores: opt: 270
FT                   z-score: 301.6 E(): 2e-09; 28.8% identity in 219 aa
FT                   overlap. Contains a Pfam match to entry PF01408
FT                   GFO_IDH_MocA, oxidoreductase family. Contains possible
FT                   n-terminal region signal sequence peptide"
FT                   /db_xref="GOA:Q9RK81"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RK81"
FT                   /protein_id="CAB59586.1"
FT                   /translation="MSQTPAVSRRLLLGSAAATGALATGIGSAAPVAAAEQAPRRRPGQ
FT                   KSMIGVPFAAHPTVRVAVIGLGNRGGGMITGWAAVPGCTVTAVCDIRADRAERAADRLE
FT                   SKGNPRPAEYGGSADSYARMLRRDDIDLVYIATPWEFHYEHGRAALLSGRHAVVELPVA
FT                   TELRQLWDLVDTSERTRRHLLLSENCNYGRNELAMLKAAHDGLFGDLTNGHGGYLHDLR
FT                   ELLFSDTYYTDSWRRLWHTRSTASFYPMHGLAPIAAAMDVNRGDRMTTLRATTTAPKGL
FT                   ADYRARFVPRDHPSWKETYINGDLVTCMIETAKGRTVRAEHDVSSPRPYSRINTLAGSR
FT                   GIVEDYAGSAPTGARIYVEPDHGGHTWRDFETYRKEYDHWLWQKVGDDAANNGGHGGMD
FT                   YVLQWRTVQLMRAGLVPDIDVYDSAAWCSPVPLSVTSLARGGRPVEIPDFTRGAWRERR
FT                   PGLDSAPTDMPPAG"
FT   misc_feature    complement(261583..262371)
FT                   /note="Pfam match to entry PF01408 GFO_IDH_MocA,
FT                   Oxidoreductase family, score 18.10, E-value 9.1e-06"
FT   regulatory      complement(262556..262560)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(262731..263576)
FT                   /transl_table=11
FT                   /gene="SCO0530"
FT                   /gene_synonym="SCF11.10c"
FT                   /product="putative transcriptional regulator"
FT                   /note="SCF11.10c, possible transcriptional regulator, len:
FT                   281 aa; similar to SW:FARR_ECOLI (EMBL:X15790) Escherichia
FT                   coli fatty acyl responsive regulator (P30 protein), 240 aa;
FT                   fasta scores: opt: 286 z-score: 325.5 E(): 9.2e-11; 27.7%
FT                   identity in 224 aa overlap. Contains Pfam match to entry
FT                   PF00392 gntR, bacterial regulatory proteins, gntR family
FT                   and Prosite match to entry PS00043 bacterial regulatory
FT                   proteins, gntR family signature. Contains a possible
FT                   helix-turn-helix motif between residues 36..57, score 1211
FT                   (+3.31 SD)"
FT                   /db_xref="GOA:Q9RK80"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK80"
FT                   /protein_id="CAB59587.1"
FT                   /translation="MEIDAAASGAVLKRERVRDAVLELIEDRRPGDAIPSERTLCAELG
FT                   VSRPTLRAAIDELVVAGLLVREHGRGMFVAAEKITQELLSDRRAFSLPQAAGAWTSRLL
FT                   EVRTLPAGARVGRKLRMSPAAQIHYVARLRLVDGSPMAIEYLHVPADLVSDLTSEELEQ
FT                   GDLYEHLGERHDVRVSEAVQSIEPTVVTRAEADLLDVPELSPALLFERLTTDTRGRPVE
FT                   YVHSLYRGDRYRIVSRLTLGPRDQAPPPGEGHHPGIPPGDFATKDPVTLSTRGVVQGGM
FT                   "
FT   misc_feature    complement(263355..263528)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 78.70, E-value
FT                   8.7e-23"
FT   misc_feature    complement(263403..263477)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature"
FT   misc_feature    complement(263409..263474)
FT                   /note="Helix-turn-helix from SCF11.10c between residues
FT                   36..57, score 1211 (+3.31 SD)"
FT   regulatory      complement(263583..263586)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      263793..263796
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        263803..265071
FT                   /transl_table=11
FT                   /gene="SCO0531"
FT                   /gene_synonym="SCF11.11"
FT                   /product="putative sugar transporter sugar binding protein"
FT                   /note="SCF11.11, probable sugar transporter sugar binding
FT                   protein, len: 422 aa; similar to TR:P72397 (EMBL:Y07706)
FT                   Streptomyces coelicolor MalE, putative maltose-binding
FT                   protein, 423 aa; fasta scores: opt: 367 z-score: 390.0 E():
FT                   2.4e-14; 27.2% identity in 419 aa overlap. Contains Pfam
FT                   match to entry PF01547 SBP_bacterial_1, bacterial
FT                   extracellular solute-binding protein and a prosite match
FT                   correctly situated to entry PS00013 prokaryotic membrane
FT                   lipoprotein lipid attachment site. Contains probable
FT                   N-terminal signal sequence"
FT                   /db_xref="GOA:Q9RK79"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK79"
FT                   /protein_id="CAB59588.1"
FT                   /translation="MKYRSLALLSTLVLGAGLAACSSSGGSADGAGDGRTALDVWLMRD
FT                   SVSAQFQKEFETGFEKAHPEIDVKIQIQEWEGIGEKVTAALASNDAPDVIEVGNTQVAQ
FT                   YAQSGGLTDFSGRVAELGGGDWLEGLAEPGAYDGRQYGIPYYAANRVVIHRTDLFEKAG
FT                   IDPSRIRTRDQWIAATRKLNTGGTQGIYLPGQNWYVLSGFVWDEGGDLAVQSGGGWKGG
FT                   LDSPGALRAMDFYRRLQALGKGPKDSDEAQPPQAEVMAKGQVAQIIAVPGGAKVIEEKN
FT                   PELKGKLGFFPVPGKSADGPGAVFTGGSDLVVPAVAAHQEEAFTLIRELTGDAWQKKLA
FT                   VAMSYVPNKTTLAGAVADDPGTAAMAAGAVNGHATPNTPQWAAVEAKNPIKEYMTAVLT
FT                   GEDAGSAAAEASRTITETLGGDS"
FT   misc_feature    263833..263865
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   misc_feature    264211..265050
FT                   /note="Pfam match to entry PF01547 SBP_bacterial_1,
FT                   Bacterial extracellular solute-binding protein, score
FT                   62.00, E-value 1.2e-14"
FT   CDS_pept        265141..266049
FT                   /transl_table=11
FT                   /gene="SCO0532"
FT                   /gene_synonym="SCF11.12"
FT                   /product="putative sugar transporter membrane protein"
FT                   /note="SCF11.12, probable sugar transporter membrane
FT                   protein, len: 302 aa; similar to TR:CAB55533 (EMBL:Y07706)
FT                   Streptomyces coelicolor inner membrane protein MalF, 300
FT                   aa; fasta scores: opt: 493 z-score: 600.8 E(): 4.3e-26;
FT                   32.6% identity in 291 aa overlap. Contains a Pfam match to
FT                   entry PF00528 BPD_transp, binding-protein-dependent
FT                   transport systems inner membrane component and a prosite
FT                   match to entry PS00402 binding-protein-dependent transport
FT                   systems inner membrane component signature"
FT                   /db_xref="GOA:Q9RK78"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK78"
FT                   /protein_id="CAB59589.1"
FT                   /translation="MPPGAAGRGTLWPYLLIAPAVLGMLYLLLYPLARAVLISFQDFRL
FT                   RQLILGDADFVGLRNYRTLLGDPEFWEVVRRTFVFMAVGVVAIMVLSTLVALMTERLGR
FT                   AARTVVLSSLVLVWAVPVVAATTVFQWLFHSEFGIVNETLTGLGFESYEGYPWFAHGGA
FT                   AFGIVVVLIVWQSVPFAAITLYSALVTVPAELYESARMDGAGAARVFRSVTFPLIRPIF
FT                   MLVLSLEVIWTFKAFVQIWVMTRGGPGEATTILPVYAVQTALAGQRYDLGSAASMLTVL
FT                   LMSGVLVLYFRQLFRQEGEQP"
FT   misc_feature    265699..265932
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 55.40, E-value 1.3e-12"
FT   misc_feature    265702..265788
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp sign."
FT   CDS_pept        266046..266903
FT                   /transl_table=11
FT                   /gene="SCO0533"
FT                   /gene_synonym="SCF11.13"
FT                   /product="putative sugar transporter membrane protein"
FT                   /note="SCF11.13, possible sugar transporter membrane
FT                   protein, len: 285 aa; similar to TR:CAB46387
FT                   (EMBL:AL096743) Streptomyces coelicolor putative integral
FT                   membrane transport protein MalG, 296 aa; fasta scores: opt:
FT                   538 z-score: 675.0 E(): 3.2e-30; 33.7% identity in 279 aa
FT                   overlap. Contains Pfam match to entry PF00528 BPD_transp,
FT                   binding-protein-dependent transport systems inner membrane
FT                   component and prosite match to entry PS00402
FT                   binding-protein-dependent transport systems inner membrane
FT                   component signature"
FT                   /db_xref="GOA:Q9RK77"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK77"
FT                   /protein_id="CAB59590.1"
FT                   /translation="MSTPRPRPPVRRALRRLPLNAAAALTVVVCLFPVYWMVTTAFKPS
FT                   TDIQSYDPRLVPGAWTLEHFRKAVGADGFALFWRNSLLVTLSAVLLALLVALGAAYAVA
FT                   RMRWRGRRQFMLAVFVAQMAPWESLIIPIYIISRDTGMLDRLPTLTLIYFMITLPFTVV
FT                   VLRGFIAGIPPELEEAAQVDGCTRAGAFRRVAFPLLAPGLMATSLFGFITAWNEFTYAN
FT                   FLIIKQQDSRTLPVWLSSFQSTFGTDWGATMAAATLFALPALVIFLALQRHVTAGLASG
FT                   GVKG"
FT   misc_feature    266547..266774
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 55.20, E-value 1.4e-12"
FT   misc_feature    266550..266636
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp sign."
FT   regulatory      266996..266999
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        267007..268626
FT                   /transl_table=11
FT                   /gene="SCO0534"
FT                   /gene_synonym="SCF11.14"
FT                   /product="putative beta-hexosaminidase (putative secreted
FT                   protein)"
FT                   /note="SCF11.14, possible beta-hexosaminidase (putative
FT                   secreted protein), len: 539 aa; similar to TR:Q9ZH39
FT                   (EMBL:AF072374) Pseudoalteromonas sp. S9
FT                   beta-N-acetylglucosaminidase, 783 aa; fasta scores: opt:
FT                   1097 z-score: 1169.9 E(): 0; 36.6% identity in 527 aa
FT                   overlap and SW:HEX1_VIBFU (EMBL:U41417) Vibrio furnissii
FT                   beta-hexosaminidase (EC 3.2.1.52)
FT                   (N-acetyl-beta-glucosaminidase)
FT                   (beta-N-acetylhexosaminidase) ExoI: fasta scores: opt: 783
FT                   z-score: 836.7 E(): 0; 34.1% identity in 478 aa overlap.
FT                   Contains Pfam match to entry PF00728 glyco_hydro_20,
FT                   glycosyl hydrolase family 20"
FT                   /db_xref="GOA:Q9RK76"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK76"
FT                   /protein_id="CAB59591.1"
FT                   /translation="MDLPRPELALVPRPRRLSARSGRFRLDRTTRLRVTPGAGPAAVLL
FT                   RTLLAPATGLPLDSAADGAFVLALDPALTGLGDEGYGLTVSPQGVLLRAARPAGLLRGV
FT                   QTVRQLLPYEALSGQPVRGVPWELPAVEITDVPRHAWRGSMLDVARHFQPVSYLQRYVD
FT                   LLALHKLNVFHLHLTDDQGWRMPVAAHPRLTEVGGRRAESMVGPAGSDRFDGVPHGGSY
FT                   TRAELRGLVAYAAERGVSVLPETGVPGHVRAALAAYPELGTDPARRLDVWTHWGVCENV
FT                   LGTGENVLDFFRTVLDEVMDVFPSPYVHIGGDEVPTTEWELSPAARARAAREGLAGPRA
FT                   LHPWFIARLAEHLVRAGRRPVVWAESGVALPLDCTVMSWRDPAHARAAALRGHQVVHAD
FT                   HRATYFDYPRGAGPGEPPAQPGVVVDLRAVHEVDLAPPTPQAASRVLGAQGQLWTEFVR
FT                   TPEHIEYLTFPRLCALAERVWDGTSGWRDFTARLAGHRARLDALDVPHAAPPPGPPVSF
FT                   PHTPHHPSTLPLGRESYRKDPA"
FT   misc_feature    267238..267768
FT                   /note="Pfam match to entry PF00728 Glyco_hydro_20, Glycosyl
FT                   hydrolase family 20, score 120.40, E-value 3.4e-32"
FT   misc_feature    267730..267747
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide"
FT   CDS_pept        268623..270044
FT                   /transl_table=11
FT                   /gene="SCO0535"
FT                   /gene_synonym="SCF11.15"
FT                   /product="putative hydrolase (putative secreted protein)"
FT                   /note="SCF11.15, possible hydrolase (putative secreted
FT                   protein), len: 473 aa; similar to TR:AAD30364
FT                   (EMBL:AF078737) Caldicellulosiruptor sp. Tok7B.1
FT                   xylanase/endoglucanase, CelB, 1426 aa; fasta scores: opt:
FT                   484 z-score: 506.2 E(): 7.9e-21; 33.0% identity in 327 aa
FT                   overlap. Contains a Pfam match to entry PF00942 CBD_3,
FT                   cellulose binding domain. Contains possible n-terminal
FT                   region signal sequence peptide"
FT                   /db_xref="GOA:Q9RK75"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR036966"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK75"
FT                   /protein_id="CAB59592.1"
FT                   /translation="MRNRPTAGRARLALALSVLLGGGALTALPAQAAPAADGLTVQYRT
FT                   SASGATADQTEPWFKVRNTGSSIVQLSQVKIRYYFKADSPNASYRFACSWAVRGCAAVT
FT                   GTFGTLANPTAAADRYLEIGFTSAAGTLAPGADTGDLQLRFYQSNWQPLRQSDDYSFGG
FT                   GQTSYATWDKVTAQLAGATVWGTAPEGNDPTDPTDPTDPPGGGQTLFDDFDYSSHTDPA
FT                   IAAHGWSVRSNSGGPGVPGATWDPSKVTFVSAGGNSVMNLETSTAGTGASTTQTEVLTK
FT                   SVKFKDGTYAARVKFADTPKSGPDGDHLVQTFFTINDLKAPMADDYAEYDFEYLPNGGW
FT                   GEPSNILYTTSWETYNPDPWQAVNQHSEQRSSYAGWHDLVVTIDAGAITYYVDGQPFGT
FT                   HDAQYLPERPMSINFNQWLIDLNGQTSTTPRSYDQQVDYVLHVKDQVLTPAEVAAKVAG
FT                   YRAAGTGFVDEVPAA"
FT   misc_feature    268743..268994
FT                   /note="Pfam match to entry PF00942 CBD_3, Cellulose binding
FT                   domain, score 95.20, E-value 1.3e-24"
FT   CDS_pept        complement(270061..270282)
FT                   /transl_table=11
FT                   /gene="SCO0536"
FT                   /gene_synonym="SCF11.16c"
FT                   /product="hypothetical protein SCF11.16c"
FT                   /note="SCF11.16c, unknown, len: 73 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK74"
FT                   /protein_id="CAB59593.1"
FT                   /translation="MGERQDRDWVAMTPGDFDRDAPLVLNVGTGPATVPAEPDEYGTAP
FT                   LFGETAPAPGTRPRSRRGRPAPGQEPLF"
FT   regulatory      complement(270292..270296)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      270643..270646
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        270655..271482
FT                   /transl_table=11
FT                   /gene="SCO0537"
FT                   /gene_synonym="SCF11.17"
FT                   /product="putative secreted protein"
FT                   /note="SCF11.17, hypothetical secreted protein, len: 275
FT                   aa; highly similar to TR:P95755 (EMBL:D89734) Streptomyces
FT                   griseus hypothetical protein adjacent to SgaA, 258 aa;
FT                   fasta scores: opt: 858 z-score: 936.4 E(): 0; 54.9%
FT                   identity in 264 aa overlap and to TR:CAB51262
FT                   (EMBL:AL096872) Streptomyces coelicolor putative endo
FT                   alpha-1,4 polygalactosaminidase SC5F7.23c, 282 aa; fasta
FT                   scores: opt: 303 z-score: 336.5 E(): 2.3e-11; 33.6%
FT                   identity in 223 aa overlap. Contains probable N-terminal
FT                   signal sequence"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK73"
FT                   /protein_id="CAB59594.1"
FT                   /translation="MSRTQVHTPRKPVLAGIGATAVLVTAAALVPGSTPAEAATYSPPP
FT                   AHAGFDYQIGGAYTPPAGVEVVSRDHTASPAPGLYNICYVNAFQAQPGAEGDWDDDLLL
FT                   RDANGDVVYDTDWGEAFLDIRTAGKRERIAEQVGTWIDGCADKGFQAVEPDNYDSYTRA
FT                   GDLLDAADAQGLIKLLAERAHADGLAIGQKNTVELAPNRKANGLDFAVAEECGEWDECG
FT                   DYTDAFGDRVIVIEYTAKGLSKACAGFGDELSIVRRDLDVSPKGSSGYVRETC"
FT   regulatory      271511..271514
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        271520..272848
FT                   /transl_table=11
FT                   /gene="SCO0538"
FT                   /gene_synonym="SCF11.18"
FT                   /product="probable sugar transporter sugar binding
FT                   lipoprotein"
FT                   /note="SCF11.18, probable sugar transporter sugar binding
FT                   lipoprotein, len: 449 aa; similar to TR:AAD35680
FT                   (EMBL:AE001734) Thermotoga maritima putative sugar ABC
FT                   transporter periplasmic sugar-binding protein TM0595, 419
FT                   aa; fasta scores: opt: 333 z-score: 361.2 E(): 9.5e-13;
FT                   24.1% identity in 406 aa overlap. Contains a Pfam match to
FT                   entry PF01547 SBP_bacterial_1, bacterial extracellular
FT                   solute-binding protein and probable N-terminal signal
FT                   sequence"
FT                   /db_xref="GOA:Q9RK72"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK72"
FT                   /protein_id="CAB59595.1"
FT                   /translation="MDAVRRAARPSRRGVLRAGGGAALAAAAGTAVTGCGAGADDGVAA
FT                   DGTVTVEMWHGQADTAKKVLEGLVADFERAHPKIRVKLGGGVLSDVMLQKVTAALAAGS
FT                   YPDIAYIFGSDLARVARSPQVVDLTDMVGSGPVPWKNYWAASRDAVTLNGRVRAAPAVL
FT                   DSLAVVCNRKLFREAGLDLPKAGWTWQDFVSSARTLTESGRGRFGTGWPGTGDEDTVWR
FT                   LWPLIWDLGGDVVDGGGKGIGFADTGARALEVVADLARDKSVYVDPKPGSEQMYQVFQS
FT                   GRMGMVVTGPWQLPDIETAGIDYHVAPLPSFSGRPVTISGPDTWTVFDNGEARSKAART
FT                   FLTWLARPEQDVRWDIEAGSLPLSRRTEALPAWQDKVARTEGLNVFTTALETARVRPVH
FT                   PAYPEVSQALGQAIVAVLLGRSSPKKALRACADEANAALLIPR"
FT   misc_feature    271976..272827
FT                   /note="Pfam match to entry PF01547 SBP_bacterial_1,
FT                   Bacterial extracellular solute-binding protein, score
FT                   91.70, E-value 1.4e-23"
FT   regulatory      272848..272852
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        272863..273813
FT                   /transl_table=11
FT                   /gene="SCO0539"
FT                   /gene_synonym="SCF11.19"
FT                   /product="probable sugar transporter membrane protein"
FT                   /note="SCF11.19, probable sugar transporter membrane
FT                   protein, len: 316 aa; similar to TR:CAB52981
FT                   (EMBL:AL109950) Streptomyces coelicolor putative integral
FT                   membrane permease, 319 aa; fasta scores: opt: 606 z-score:
FT                   689.2 E(): 5.1e-31; 34.9% identity in 312 aa overlap.
FT                   Contains a Pfam match to entry PF00528 BPD_transp,
FT                   binding-protein-dependent transport systems inner membrane
FT                   component and a prosite match to entry PS00402
FT                   binding-protein-dependent transport systems inner membrane
FT                   component signature. Contains probable N-terminal signal
FT                   sequence"
FT                   /db_xref="GOA:Q9RK71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK71"
FT                   /protein_id="CAB59596.1"
FT                   /translation="MPRLPRPITVEGPPPDPRPLRRKRRRETGTAWAFVSPAVLIVLGL
FT                   SIVPVVWSLLLSFQASDLVTPSRWVGLDNYRALAQDPNFSQAVRNTLLYTVLYVPLSLL
FT                   FGLALAMVLNRRIRFVGLYRTLIFVPFVLSATAQGVLFSFILDPEFGAANSVLHRLGVS
FT                   SQGFLSDPSQALLVLVAITLWSGTGFCVVVYLAALQDVPQSLIEAARLDGAGRRHLLRH
FT                   VTMPTLTPVTVFLVLWQAIQSLQVFDLVYVTTKGGPLGSTTVIVYFIWEQAFKNATAGY
FT                   GASAAYVLAVALGLVAGAVRIVRRRGRHRLEGARS"
FT   misc_feature    273451..273684
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 61.30, E-value 2.1e-14"
FT   misc_feature    273454..273540
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp sign."
FT   CDS_pept        273810..274709
FT                   /transl_table=11
FT                   /gene="SCO0540"
FT                   /gene_synonym="SCF11.20"
FT                   /product="probable sugar transport membrane protein"
FT                   /note="SCF11.20, probable sugar transport membrane protein,
FT                   len: 299 aa; similar to TR:Q06111 (EMBL:X66092) Clostridium
FT                   perfringens putative transport system permease protein, 275
FT                   aa; fasta scores: opt: 704 z-score: 838.6 E(): 0; 38.4%
FT                   identity in 255 aa overlap. Contains a Pfam match to entry
FT                   PF00528 BPD_transp, binding-protein-dependent transport
FT                   systems inner membrane component and a prosite match to
FT                   entry PS00402 binding-protein-dependent transport systems
FT                   inner membrane component signature. Contains porbable
FT                   N-terminal signal sequence"
FT                   /db_xref="GOA:Q9RK70"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK70"
FT                   /protein_id="CAB59597.1"
FT                   /translation="MTATSARPDTAVGAHHLAKAPAAGERRRPRLPFSPWHLLLAPLAL
FT                   VFAVPLVWLVLSSVMSNAEINRFPPALWPSGIDLGGYRYVLGNAMFPRWFVNSLIVSAV
FT                   TVAANLVFGSLAGYAFARMRFAGSRVLMGLMLATMAVPFQLTMIPTFLVMKKLGLIDTL
FT                   GALIVPSLVTPFAVFLLRQFFLSLPRELEEAAWIDGCSRLRVLWRIVLPLSRPALATVA
FT                   VLTFLTTWNDLTWPLIAINHDTQYTLQLGLTTFQGQHHTQWAAVMAGNVITVLPVLLAF
FT                   LGAQKTFIQSITSSGLKG"
FT   misc_feature    274356..274586
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 66.80, E-value 4.6e-16"
FT   misc_feature    274359..274445
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp sign."
FT   CDS_pept        274756..276081
FT                   /transl_table=11
FT                   /gene="SCO0541"
FT                   /gene_synonym="SCF11.21"
FT                   /product="putative alpha-galactosidase"
FT                   /note="SCF11.21, probable alpha-galactosidase, len: 441 aa;
FT                   similar to  SW:AGAL_BACSU (EMBL:AF008220) Bacillus subtilis
FT                   alpha-galactosidase (EC 3.2.1.22) (Melibiase) MelA, 432 aa;
FT                   fasta scores: opt: 1068 z-score: 1240.5 E(): 0; 39.3%
FT                   identity in 427 aa overlap"
FT                   /db_xref="GOA:Q9RK69"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK69"
FT                   /protein_id="CAB59598.1"
FT                   /translation="MSTAHPSAPKITFVGAGSVVFTQGLLADLFAFDELKSAHIALHDI
FT                   DAERLATARAAAEYIAAERGARPRVTAHADRREALAGADFVINIVQVGMGEATRTDFEV
FT                   PARYGLRQTIGDTLGVGGIFRALRTFPLLKALGEDIAEVCPDAWLLNYTNPMAMNVQYL
FT                   AEATGLTRVVGLCHSVYWTVQGLCELLKVPYEEVTYQAAGVNHQAWVLRLEHGGEDLHP
FT                   RLDALIAEDPQLRRRVRMDMYRRLGHYPTETSEHSSEYVPWYLHHDSEVERLRLPVGAY
FT                   LGIVDENVAEYERTRDALACGAPLTVEGTMEYAPQIIHSMVTGTPRTVYGNVPNHGLIE
FT                   NLPARGTVEVPCLVDSAGLQPTRVGALPPQLAALNRAYLSTTDLVVRAATEDDPRHIRH
FT                   AAMADPATAATLRVEEIWQLCDDMVRAHGDRLQPGLRGVLAP"
FT   stem_loop       276097..276144
FT   CDS_pept        276351..278984
FT                   /transl_table=11
FT                   /gene="SCO0542"
FT                   /gene_synonym="SCF11.22"
FT                   /product="hypothetical regulatory protein"
FT                   /note="SCF11.22, hypothetical regulatory protein, len: 877
FT                   aa; similar to various hypothetical proteins, e.g.
FT                   TR:CAB44382 (EMBL:AL078610) Streptomyces coelicolor
FT                   hypothetical 66.2 KD protein, 634 aa; fasta scores: opt:
FT                   1072 z-score: 1125.7 E(): 0; 38.2% identity in 678 aa
FT                   overlap and to SW:RSBU_BACSU (EMBL:L35574) Bacillus
FT                   subtilis sigma factor sibG regulation protein RsbU, 335 aa;
FT                   fasta scores: opt: 211 z-score: 225.9 E(): 3.2e-05; 25.6%
FT                   identity in 250 aa overlap. Contains Pfam matches to
FT                   entries PF00989 PAS, PAS domain and PF01590 GAF, GAF
FT                   domain"
FT                   /db_xref="GOA:Q9RK68"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK68"
FT                   /protein_id="CAB59599.1"
FT                   /translation="MVCPDPPAAVSRRFPDGPASAAAARRFVRTALDGAARDLVDTAQL
FT                   LVSELVTNAVLHARTEVEVSVARLEGRVRVGVGDRRPGRGLVPQRCSPYAGTGQGLVLV
FT                   EQLASPFGADGGDGGKTVWFELWHDGPAPPSAGWETAVPPRPAERTVTLVDMPTALESA
FT                   FRQHRHAVLRELTLAASAGDLLGVPPEDLVAANDVNNVISAGVSAAPAGPASESGLRTL
FT                   PLPLSADALPAVRALRRVLDLAEARAGEERLLTLPALPRGRAFQNWLFDEIAGQLAGDR
FT                   PTAWTVVPRAPEVSSAELVPWDVGQVRASRMPTVAADEGNRIVATNGAAADLLGWDPDQ
FT                   LVGRRLTTLVPEHLRERHTAAFTSMLLTGRTRIVGRSVPLPALHRDGRLIPVRLYIQTQ
FT                   ETADGRTVFVAQLVPRATTFLDGPRTPGRIRKAAVGEPDGGRSPTVPPAGAGTPGARGG
FT                   MSALDRLTLLAELGAQLNNTLELDEGLQRAGRLLTRRLADWCVVDLFTADARVDRACVV
FT                   HRDPRALRPGAYEGLLPGVSEESRGPLARVLRGAGPLLLTGAPQPGQTGSALDRAYAGL
FT                   FRELGAGSAVVAPLRARRKIFGALTLARAPRGRPFTEEDLTLVDDLVHSLALGVDNARL
FT                   YQDTRSIAERLQRSLLPVLPKVEGLRLAARYAASSTTAQVGGDWYDSFVLPGGNTALVI
FT                   GDVTGHDLDAAIAMSQLRSMLRGIAVDREEPPAEVLRRLDLANHSLHREATGTCVYGLI
FT                   KGPPEGPWELTHSSAGHLPPLLTTRDGRTRYLDGGAGLLLGMDPDASRGTARDVLPAHS
FT                   TLLLYTDGLVERRDEALDGALDRLRRHAADLAREPLDTFCDELLIGLGADSADDIAVLA
FT                   VRPSPP"
FT   misc_feature    277287..277445
FT                   /note="Pfam match to entry PF00989 PAS, PAS domain, score
FT                   28.50, E-value 2.1e-06"
FT   misc_feature    277788..278255
FT                   /note="Pfam match to entry PF01590 GAF, GAF domain, score
FT                   41.70, E-value 1.6e-08"
FT   CDS_pept        279092..280228
FT                   /transl_table=11
FT                   /gene="SCO0543"
FT                   /gene_synonym="SCF11.23"
FT                   /product="possible peptidase"
FT                   /note="SCF11.23, possible peptidase, len: 412 aa; similar
FT                   to various hypothetical proteins, e.g. TR:CAB39706
FT                   (EMBL:AL049485) Streptomyces coelicolor putative secreted
FT                   peptidase, 312 aa; fasta scores: opt: 307 z-score: 329.3
FT                   E(): 5.7e-11; 34.3% identity in 201 aa overlap. Contains
FT                   Pfam match to entry PF01551 peptidase_M37, peptidase family
FT                   M23/M37. Contains possible hydrophobic membrane spanning
FT                   region"
FT                   /db_xref="GOA:Q9RK67"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK67"
FT                   /protein_id="CAB59600.1"
FT                   /translation="MNDERLTVAPTADDTDDPRQEPERAEGSERGPGRKRRGPGPVTLL
FT                   LLPALVTVTGVAAFLALGGLPDPWPDDSDAKASTAADIDPSYVPWLRKAASACTVLEPS
FT                   VLAAQIDQLSGWSDDSDDLSGQKGIAAFTDSEWRAWGKDDDGNGHASPRDPADAIMALG
FT                   RRDCSLAEKVTGLRTEGRVNGDLVELTLAAYAVGPDAVTGAGRVPAAAKTYLAEVQALV
FT                   PRYEALDREDSADGSGGPAGALLTAPVSPLTITSPFGSRQHPLTGVTKLHTGVDFAAPQ
FT                   GAQVVAARRGRVVFAALTSAYGNRIVIDHGTIQGKRVETTYSHLSALETSVGQTVEAGA
FT                   PIGRVGSTGLSTGPHLHFEVILDGYYTDPRPWVVANGV"
FT   misc_feature    279947..280207
FT                   /note="Pfam match to entry PF01551 Peptidase_M37, Peptidase
FT                   family M23/M37, score 111.30, E-value 1.8e-29"
FT   CDS_pept        280257..281789
FT                   /transl_table=11
FT                   /gene="SCO0544"
FT                   /gene_synonym="SCF11.24"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="SCF11.24, hypothetical secreted protein, len: 510
FT                   aa; similar to various hypothetical proteins, e.g.
FT                   SW:YM26_MYCTU (EMBL:Z70692) Mycobacterium tuberculosis
FT                   hypothetical 56.3 KD protein RV2226, 513 aa; fasta scores:
FT                   opt: 867 z-score: 952.2 E(): 0; 39.0% identity in 515 aa
FT                   overlap. Contains probable N-terminal signal sequence"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK66"
FT                   /protein_id="CAB59601.1"
FT                   /translation="MTQSKRETERKYEPPAGGLAGLPDLTGVGPVASVTAAGPEELDAV
FT                   YHDTVDLRLAGSSATLRRRTGGPDAGWHLKLPLTGDTREEVWAPLSDDVPAALRELVLS
FT                   RTRGAPLRPVVRIRSTRAVRRLHDAEGGVLAELSLDEVRADATAAGGGRGEWGELEVEL
FT                   AEGVHAGLLDAVEKKLRKKGIVRSDSPSKLARALRDTGVGGAGVPRTPDGVVAGSSGSY
FT                   VLSYLREQVGVLVGLDPAVRRELPDAVHRMRVTCRRLRSCLRSYRSVLDRRVTDPVAAE
FT                   LRWLAGELGAARDQEVLRERIGAALDGLPDELVLGPVAARLRVWDVSRDEDVRSRTRMA
FT                   LGSPRHLRLLDALDELVRHPPLRSGAGRKPARTMARAVLKEYARLAGRMDLALARPSGR
FT                   SRETELHEARKAAKRLRYAAEVARPALGKPVARLGKQAKAVQQLLGEHQDAVVAQDTLR
FT                   RLAVAAHGAGESAFTWGVLHGRERAGAEARQRELPGLWRAASDPALRAPLEH"
FT   CDS_pept        281913..284459
FT                   /transl_table=11
FT                   /gene="SCO0545"
FT                   /gene_synonym="SCF11.25"
FT                   /product="putative secreted protein"
FT                   /note="SCF11.25, possible secreted protein, len: 843 aa;
FT                   similar to TR:O87849 (EMBL:AL031013) Streptomyces
FT                   coelicolor putative secreted protein, 602 aa; fasta scores:
FT                   opt: 2859 z-score: 3026.4 E(): 0; 72.1% identity in 555 aa
FT                   overlap. Contains possible N-terminal signal sequence"
FT                   /db_xref="GOA:Q9RK65"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK65"
FT                   /protein_id="CAB59602.1"
FT                   /translation="MRLRSMGVALVATAALVTLPAPITATAADTPLSQGRTATSSSAEN
FT                   AGTPSQNAVDGDTATRWSSAASDDQWLQVDLGATASVTRVVLDWEAAYGKDYKIQLSQD
FT                   GSTWTDAKTVTGGDGGTDTLDVSGQGRYVRMQGVHRATPWGYSLWEFQVFGTTGGTAPG
FT                   GSCDTANAAQGRPATASSVENAGTPATAAFDGDTGTRWSSQASDPQWVRVDLGAVQDLC
FT                   KVDLNWEAAYAKDFRIEASADGQSWQTLKSVTGATGGKASYDVSGSGRYVRVHGTARAT
FT                   GYGYSLWEVAVHTGTTGAPPVEGGGDLGPNVIVVDPSTPNLQQKFDQVFAQQESNQFGG
FT                   GRYQFLLKPGTYNGINAQLGFYTSVSGLGLNPDDTQINGDITVDAGWFNGNATQNFWRS
FT                   AENLAITPSNGTDRWAVAQAAPFRRIHVKGGLNLAPNGYGWASGGYIADSKIDGTVGPY
FT                   SQQQWYTRDSSVGGWTNGVWNMTFTGVEGAPGSNFETGPYTTLDTTPISREKPFLYLDG
FT                   NEYKVRVPAKRTNARGVSWPANAGGTSLPLSQFYVVKPGATAATINAALDQGLNLLFTP
FT                   GVYHIDQTIEVDRANTVVLGLGLATIIPDGGVDAMHVADVDGVRLAGFLIDAGPVNSDT
FT                   LLRIGTPGGNADHAANPTTMQDVFIRVGGAGPGKATDSVVVESDDVIIDHTWIWRADHG
FT                   EGVGWETNRADYGLRVNGDDVLATGLFVEHFNKYDVYWSGERGRTIFFQNEKAYDAPNE
FT                   AAITHDGIVGYAAYKVADSVNVHDAVALGSYCNFTADPGIVQHHGFQVPVKPGVRMRNL
FT                   QVISLGGMGQYRHVVNDTGAGTSGTDTVPSKVVQFP"
FT   CDS_pept        complement(284523..287897)
FT                   /transl_table=11
FT                   /gene="SCO0546"
FT                   /gene_synonym="SCF11.26c"
FT                   /gene_synonym="pyc"
FT                   /product="pyruvate carboxylase"
FT                   /note="SCF11.26c, pyc, pyruvate carboxylase, len: 1124 aa;
FT                   highly similar to TR:Q9F843 (EMBL:AF262949) Mycobacterium
FT                   smegmatis pyruvate carboxylase (EC 6.4.1.1) Pyc, 1127 aa;
FT                   fasta scores: opt: 5701  Z-score: 5851.2 E(): 0; 76.356%
FT                   identity in 1125 aa overlap and similar to TR:O54587
FT                   (EMBL:AF038548) Corynebacterium glutamicum pyruvate
FT                   carboxylase Pyc, 1140 aa; fasta scores: opt: 4925 z-score:
FT                   5186.1 E(): 0; 65.2% identity in 1128 aa overlap. Contains
FT                   Pfam taches to entries PF00364 biotin_lipoyl,
FT                   biotin-requiring enzymes, PF00682 HMGL-like, HMGL-like and
FT                   PF00289 CPSase_L_chain, carbamoyl-phosphate synthase
FT                   (CPSase) and prosite match to entry PS00867
FT                   carbamoyl-phosphate synthase subdomain signature 2"
FT                   /db_xref="GOA:Q9RK64"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK64"
FT                   /protein_id="CAB59603.1"
FT                   /translation="MFRKVLVANRGEIAIRAFRAGYELGARTVAVFPHEDRNSLHRLKA
FT                   DEAYEIGEQGHPVRAYLSVEEIVRAARRAGADAVYPGYGFLSENPELARACEEAGITFV
FT                   GPSARILELTGNKARAVAAAREAGVPVLGSSAPSTDVDELVRAADDVGFPVFVKAVAGG
FT                   GGRGMRRVEEPAQLREAIEAASREAASAFGDSTVFLEKAVVEPRHIEVQILADGEGDVI
FT                   HLFERDCSVQRRHQKVIELAPAPNLDPALRERICADAVNFARQIGYRNAGTVEFLVDRD
FT                   GNHVFIEMNPRIQVEHTVTEEVTDVDLVQSQLRIAAGQTLADLGLAQENITLRGAALQC
FT                   RITTEDPANGFRPDTGQISAYRSPGGSGIRLDGGTTHAGTEISAHFDSMLVKLSCRGRD
FT                   FTTAVNRARRAVAEFRIRGVATNIPFLQAVLDDPDFQAGRVTTSFIEQRPHLLTARHSA
FT                   DRGTKLLTYLADVTVNKPHGERPELVDPLTKLPTASAGEPPAGSRQLLAELGPEGFARR
FT                   LRESSTIGVTDTTFRDAHQSLLATRVRTKDMLAVAPVVARTLPQLLSLECWGGATYDVA
FT                   LRFLAEDPWERLAALREAVPNLCLQMLLRGRNTVGYTPYPTEVTDAFVQEAAATGIDIF
FT                   RIFDALNDVEQMRPAIEAVRQTGSAVAEVALCYTADLSDPSERLYTLDYYLRLAEQIVN
FT                   AGAHVLAVKDMAGLLRAPAAATLVSALRREFDLPVHLHTHDTTGGQLATYLAAIQAGAD
FT                   AVDGAVASMAGTTSQPSLSAIVAATDHTERPTGLDLQAVGDLEPYWESVRKVYAPFEAG
FT                   LASPTGRVYHHEIPGGQLSNLRTQAVALGLGDRFEDIEAMYAAADRMLGRLVKVTPSSK
FT                   VVGDLALHLVGAGVSPADFEQDPDRFDIPDSVVGFLRGELGTPPGGWPEPFRSKALRGR
FT                   AEARPLAELSEDDRDGLGKDRRATLNRLLFPGPAREFDTHRASYGDTSILDSKDFFYGL
FT                   RPGKEYTVDLDPGVRLLIELQAVGDADERGMRTVMSSLNGQLRPIQVRDRSAATDVPVT
FT                   EKADRANPGHVAAPFAGVVTLAVAEGDEVEAGATVATIEAMKMEASITAPKSGTVTRLA
FT                   INRIQQVEGGDLLVQLA"
FT   misc_feature    complement(284529..284729)
FT                   /note="Pfam match to entry PF00364 biotin_lipoyl,
FT                   Biotin-requiring enzymes, score 57.00, E-value 4.2e-13"
FT   misc_feature    complement(285453..286310)
FT                   /note="Pfam match to entry PF00682 HMGL-like, HMGL-like,
FT                   score 146.30, E-value 5.2e-40"
FT   misc_feature    complement(286560..287888)
FT                   /note="Pfam match to entry PF00289 CPSase_L_chain,
FT                   Carbamoyl-phosphate synthase (CPSase), score 600.30,
FT                   E-value 1.1e-176"
FT   misc_feature    complement(287019..287042)
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2"
FT   CDS_pept        complement(287987..288988)
FT                   /transl_table=11
FT                   /gene="SCO0547"
FT                   /gene_synonym="SCF11.27c"
FT                   /product="putative acyltransferase"
FT                   /note="SCF11.27c, possible acyltransferase, len: 333 aa;
FT                   similar to TR:CAB52353 (EMBL:AL109747) Streptomyces
FT                   coelicolor putative multi-domain beta keto-acyl synthase,
FT                   2082 aa; fasta scores: opt: 402 z-score: 416.4 E(): 8e-16;
FT                   32.5% identity in 329 aa overlap, and to TR:Q55226
FT                   (EMBL:L34880) Streptomyces sp. acyltransferase DauA, 338
FT                   aa; fasta scores: opt: 326 z-score: 349.0 E(): 4.5e-12;
FT                   33.4% identity in 326 aa overlap. Contains Pfam match to
FT                   entry PF00698 acyl_transf, acyl transferase domain"
FT                   /db_xref="GOA:Q9RK63"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK63"
FT                   /protein_id="CAB59604.1"
FT                   /translation="MTDDRPAPTGGTPRTVLMCPGQGAYLPGALRHLSGVPSVSRVLGT
FT                   VDAHGTALGSTRTPVGRLLTDSAAPDPDLLLRTDPLAFDLATYAAVVASAAVLLDLATP
FT                   PVHAVLGHSVGDLAALTVAGVITIEQGVRLLHVRDRLLRDAALPAAGLLATDLSAEPAA
FT                   DLLRAEGLPQVRIAARNAPGQTVLAGPDDQLAAVRSAARALGRRATPLTSRTAYHHPLL
FT                   AEVQRAFRRLLRAQPVAPPTLPVYTAAAPGPARTPAQLRTVAAAHLSEPLAFHRTLCAL
FT                   RLAGFTTYLDSGPRALLSTLARAGLPGCITAAPSRTPAGLDRIRLRLTAALR"
FT   misc_feature    complement(287996..288946)
FT                   /note="Pfam match to entry PF00698 Acyl_transf, Acyl
FT                   transferase domain, score -19.70, E-value 8.8e-09"
FT   CDS_pept        complement(288985..290271)
FT                   /transl_table=11
FT                   /gene="SCO0548"
FT                   /gene_synonym="SCF11.28c"
FT                   /gene_synonym="fabB2"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase"
FT                   /note="SCF11.28c, fabB2, possible
FT                   3-oxoacyl-(acyl-carrier-protein) synthase, len: 428 aa;
FT                   similar to TR:Q54208 (EMBL:L43074) Streptomyces glaucescens
FT                   fabB, 423 aa; fasta scores: opt: 1375 z-score: 1459.4 E():
FT                   0; 52.1% identity in 420 aa overlap. Contains Pfam match to
FT                   entry PF00109 ketoacyl-synt, beta-ketoacyl synthase"
FT                   /db_xref="GOA:Q9RK62"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RK62"
FT                   /protein_id="CAB59605.1"
FT                   /translation="MSPRHAAGPAPGERAAVVTGLGLTTSLGGDVPSTWRALLDGGCGV
FT                   ERVDFGEPAGPAQVYLAAPAAVDPGTVLSSAKAAHCDRSAQFALVAAREAVRDAGFPDP
FT                   SALAGDGSRVAVVVGVGLGGLTSVLEQDHRLRTQGAGRVSPRTIPVMLPNHAAAEVGLM
FT                   VGAKAGVHAPVSACAAGAEALAQALGMIRDGRADIVVAGGTEAALHPLVLAGFARLRAL
FT                   SRRHDDPKGASRPFDADRDGFVMGEGAGMLVVESAAHAAARGARVHGRLTGAGITNDSH
FT                   HVAQPAPGGPGCAAAVDAALRDAGLVPEQIQHVNAHATATPLGDLGEAQALHSVFAKGV
FT                   DDVTVSATKGAFGHTLGAAGAIEAVLTVLALRDRTAPPACSLERVDPEIGLNVVGRDPA
FT                   TLPCGPLAAVSTSMGFGGHNVALAFADAS"
FT   misc_feature    complement(288991..290226)
FT                   /note="Pfam match to entry PF00109 ketoacyl-synt,
FT                   Beta-ketoacyl synthase, score 110.50, E-value 3.2e-29"
FT   CDS_pept        complement(290268..290546)
FT                   /transl_table=11
FT                   /gene="SCO0549"
FT                   /gene_synonym="SCF11.29c"
FT                   /product="putative acyl carrier protein"
FT                   /note="SCF11.29c, possible acyl carrier protein, len: 92
FT                   aa; similar to SW:ACP_HAEIN (EMBL:U32701) Haemophilus
FT                   influenza AcpP, 76 aa; fasta scores: opt: 162 z-score:
FT                   219.6 E(): 7.3e-05; 47.3% identity in 55 aa overlap.
FT                   Contains Pfam match to entry PF00550 pp-binding,
FT                   phosphopantetheine attachment site"
FT                   /db_xref="GOA:Q9RK61"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RK61"
FT                   /protein_id="CAB59606.1"
FT                   /translation="MPSTADERQLLDELRDLLAATVEDLTVEEIGPDSSLQDDLGVDSL
FT                   ARLELVAAIEDRWQIEVPQEQADRLTTVRQIAAHLAEAVAAPAGGTA"
FT   misc_feature    complement(290307..290504)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site, score 59.90, E-value
FT                   6.1e-15"
FT   regulatory      complement(290555..290558)
FT                   /regulatory_class="ribosome_binding_site"
XX
SQ   Sequence 291000 BP; 39089 A; 105537 C; 106715 G; 39659 T; 0 other;
     tggcctgctc gtcgtcccga gagaggggcg gtgggcgggg tggtcagcgt tcccggggcg        60
     gtcggcgacc gtcggcgcgg ccgcggtcgt ggtcgtggtc ggggcgcggt ggtgcgggtg       120
     agcccgtggg gcacaacggg catgataggc agtggagttg gtgccgcacg tcgggggcca       180
     caggtacatg cggagggggc acgggggacg ccatgagcga tgccgtggaa gaggccgagg       240
     cgcgagcggt ggagccggtc ggtgcgaagc agcgcgacgc cttcatctcg tacagccaga       300
     gcaagaacgc gccactcgcg aaacagctcc agcgcggcct ggagcggctg gccgtctcgc       360
     gcttccggcc catgcggatg agcgtgttcc gcgatgtcac cagcctgccg gccaatcacg       420
     acctgtggca gtcgatccag cgcgaactgg cacgctcgcg ctatttcatc ctgctcgcct       480
     ccccggaggc cgccgcctcg ccctgggtgg ccagggaagt cgactactgg ctgcgcgagc       540
     gcgacacgga gcacctgctc atcgccgtcg cgagcggtga gatcgtgtgg gacgacaggg       600
     ccggcgactt cgactggcgg aagaccacgt ccctgccacg caatctcgcg ggccacttca       660
     cggccgcacc gctctgggtg gacctccggg agatcgggga acggtcccat cactccatgc       720
     gctacccacc gttccgcgcc gcggtcgcca ccctggcgtc gccgttgcac ggccgtccca       780
     aggaagagct ggaacacgac gacttccggc agctccggtt cgtcaaacga ctgagctggt       840
     cgggcgtcgc cctgctcgtg gcgctgctcg tccttgcggt ctacggcttc ttcgacgcca       900
     gcagacagcg cgaagccgcc ctgtcccaag cccgcacctc cgcctcgcag gcgctcgccg       960
     cccgctccgg gcaactgctc gggaccagtc ccaaccaggc cgcgcagtac gccctgtacg      1020
     ccgaggagac caggtccacc ccggagtccc gacgcgccct ggcccaggcc gtgaccgccg      1080
     cgccgtacgc caggcggagg ctgcgggcgg acgccgactc cgtgacggac atgcagggtg      1140
     cgtcccgccc ggccgccacg gacgtcgtcc tcagcgggga cggcacgacc gcggcgtacc      1200
     gctcggtgtt cgacgacgac cgggccgtac gcctctacga cgtgccctct gcccggcagt      1260
     cgcgcgtggt gcgcgccgag ggcacgccca gggcgctgag ccgcgacggc cgggtcctgg      1320
     ccatggaggt ctacctcaac cgggtccagc tgtgggacac ccggtccggc agactcctga      1380
     gcacgatggc caccgggcac acggagaacc ttccccacgt cggtcacggg ctccatgccc      1440
     tggcactctc acccgacgga cggtgggtgg cggcctcgca ctacaccccg gagggtgagg      1500
     cgttcgcggt cgtgtggcgg gcgtccgacg ggcgcgagat cacccgggtt ccggtgagtg      1560
     acgcccgggt ggggctcggc ttctccgcgg acgggtcccg gctgaccctg gtcgaccagg      1620
     accgtcgcga ggtccgggag ttccggacgg actcggcgcg ctgggaggcg gcccgctccc      1680
     tgcccgggat gccgggcagc acggcggaag ccttgcggta cagcgaggtt ctgctgttcg      1740
     acggggcgcg caaggccctg acccggacgt ccgagcgtgc cgaggtgtgg gacctggaac      1800
     agcgccgccg catcgccgtc cggtccttgg gaccgtacga ggacatgacg gtcgccgacg      1860
     acaaggggat cttcctgctg ggcgggcagg acggcacggt ccggctctac gacgccgcgc      1920
     tgcggcccgg tacgacactg ggccggctga cccggccggc cagcaccatc gccatgtcgg      1980
     ccgacggcac ccaggtggtc gtcgcctcgt acggcggaga gctcaacctc ttcaccaccg      2040
     gggtccgacg gggacagcag gtggcgttcg acgagaagga tttcaccttc ggggatctga      2100
     cccccgacgg tcggatggcg gtgcaccggt ccgaggggcg caccgagttc tgggatccgg      2160
     ccacgggccg caggctcggc gtgattccgt acgccaacct gtcggtgaac ctggaggaca      2220
     cggcctacac gctcagcggg gacaagcgat acgtcggcat gcagagcgtg gagggcttcg      2280
     aggacgaagg gcggttcgac gtctgggacc tgcgtaccgg aaggcgcacg gactgcggga      2340
     cggccgtcgg cggatcctcc ttctcgccga tccgccgccc cggcctgtcc ttcctcccgg      2400
     gcgaccggta cgtggtcggc gaatggaacg gcgccgtgga actgctcgac acccgcacct      2460
     gcacccgcag cacggtgacg gaggactccg gcagattcgc cctgagcggg gaccgcagga      2520
     cgctggttct cctgaacgac gacggggtcg acacctggcg ctgggacggt gatcacgcct      2580
     tcgcgcgggc ggcccgcacc accctgccga gcgaggccca tcccgtggac atgagtgtcg      2640
     accacgaggg caggcaggcg gccttctctg accgggagag ccatgtgtac gtcgtacggc      2700
     tcgactccgg cgagcgcgta cgcgccaccg ggtacctgcc cgacaagacc gatgccgtgg      2760
     cgttcagccg ggacggccgt ctgctgttcc aggggttcat gaccgagagc acccggggtg      2820
     tacgcgtcct ggacgccggc agcggcgatc agctcgacat ctggaccacg gaccccccga      2880
     ccggttccgt gcagcccaac gagggcatgc aggtcgtccc cggccccgcc gacgacatcc      2940
     tcacgctcgg ccccgaccac aaggtcgtgc gccgcacggt cggtgtgggg gcctggcacg      3000
     acctgttgtg cggcctggtg agccagcccc tgcctgcccg ggaacgggac cgttatctga      3060
     aggatttgga cgtggaggat ccctgtcgct gaggaacgcg cggagcgccg tgccgcaggt      3120
     gggcggtgag gaaggcggtg accttggcga cggccggggt gacgtgctcg tcccggtcgt      3180
     agagggagac gtgggtgccg ccgtcgatca cgaagagttc cttgggctcg gctgccttct      3240
     cgatggcatc gcggctgaag tgcgccgtgt cggcctcgga gccgacgatc atcaggagcg      3300
     ggcggggcga gatgaggtgg atcagggcgt acgagtcgta ctggatgatc tggtcgagac      3360
     tgcgcaccgg ccagggctgg accgcgcggg ggtggtggcc gcgtgcggtg cggtagtact      3420
     cacgggtctc ggcgtccacg gcctcggtga tccactcctg ccgggggacg ggctcgccgc      3480
     gtgcctccgc ggtgcgtgcg gcgctcgctc gttcgagcat ggtacgcagg gcctgcggat      3540
     cccgggcggg gcccgggccg tcgcgcatca ccgaacccag gtccaccgcg ctgaccgtgg      3600
     cgaccgcctt gatgcgcacg tcggtctggg cggcgtaggg gacgtagccg ccggaggcgc      3660
     agatgcccac ggcgccgatc cggtccgggt cgatcccgtc gcgggtgacc aggaagctca      3720
     cggccgactt gatgtcctcc gcgcgctgga aggggttctc caggccgcgc ggctcgcctt      3780
     cgctctcgcc ctggtgggcg gcgtcgaaga ccagtgcggc gaagccctcc cgggccaggc      3840
     gctccgcgta gacgctcgcg gtctgctcct tgaccccgcc gccggaatgg ccgatgacga      3900
     cggccgggag ccgaccggcg gtcggtgcgc cgggcaggaa gagggtgccg gcgagcgtga      3960
     gacgactgct gcggaaggtg acgtcggttt catgccctcg accctggcgg gtgccgcccg      4020
     ccgggacaat gggccagggc cggccccctc agcgggccgg cccgcggtgc gagactcgat      4080
     cacatgagta gcgaactggg tgacttcctc aaggcacggc ggagggagct gagccctccg      4140
     acggccgggc tccccgccga cgggcgccga cgggtcccgg gcctgcgccg ggaggaggtc      4200
     gccgtgctcg cgtcgatcag ccccggtcac tacacccgtc tggaacaggg acggcgccgg      4260
     gcctccgaac cggtgctgga cgcgcttgcc cgcgcgctgc ggctcagcgc ggacgagcgt      4320
     gcctacctct tcgagctctc gggcaaggac gccggccgac cgctggggcg gcccggccgg      4380
     caggtccgtc cccagttgcg gcgcctgctc gacgatctca cccacactcc ggccctcgtc      4440
     ctcggccggt gcaccgacat cctggcgtgg aatccgccgg ccgccgcgct gttcaccgac      4500
     ttcgcgctgc tgtcgcggga cgaacgcaac ttcgtccgtc tggtcttccg cgacccggcg      4560
     gtgcgggccc tgtacaccga ctggccctac atggcgcggg cctgcgtggc gcaactgcgc      4620
     atggaggcgg cccgggatcc gcacgatccg cgtctgtcgg cgctggtggc ggagttgtcc      4680
     gcgcaggacc cggacttccg gacctggtgg aaggaccatc gcgtggccgt ccgcggcgcg      4740
     gggaccaaag atctgcgcca cccggtgatc ggcgaactca ccctcgactg gtccgcgctc      4800
     accgacacgg ccgacccgga ccagcagctc atcgccctga ccgccgcgcc cggcactccc      4860
     tcccacgacg gcctgcgcgc cctgcgcgac ctgggcgccg tcacatcggg gcggaccggc      4920
     cccggcgtgc ccggtggcgg tggcgaaatc gccggggcct cggcgcaatg atccgcggcc      4980
     ccctaggctg ctgccccaca cgggtgtcag ccggaggggg gccttgtgcc acggtccgac      5040
     gcagcagtca gggttcgtac ccgcctgctt ttgatgtacc acctcacgcc gcaggtgcac      5100
     gtgcccgacg acaggctccg tccgctgtcc gaggcgctcg gtctcggccg gttcaccgcc      5160
     cacgtcgaag ccgccggact gctgctgccc cggctggtgc tgcacgagcg cgtccgcgag      5220
     atcacgctgc cgccgaacgc ggcccgggtc gacggtgcgg acatcaccct ggctgtcacc      5280
     cctcgccagg acccgctgct cttcgtggac gtcgaagtcc cggacgaggc gggcgactcg      5340
     gacaccatcg ccgaaaccct ctacgccacc tggcaggacc gctccgccat ccgcgtcggc      5400
     ggggtgccgc tgaccgcgtg gctcgacgag cgcttacggg cgtacggcct caccgaccgg      5460
     accgcggacc ggccaccgct cgcattcggc cggaacgtcc accagagcgt ctttcccgga      5520
     gcggccctcg cgggaaggct gttggccgcg cacgtgcccg gcgacgcggt cggccaggac      5580
     gtggtgacca tcgtgctgcg cggcacgctg gacagcggta ccggcgccac actgggcatt      5640
     cgacggcccg agacgctgaa caacgccggc cagaccatgg tcgcgcacgg cagaggcgtg      5700
     tcgttgatcg tcggctacgc accgccggtg gagaacgcgt tcgggctggc cgccgccggc      5760
     atcctcaccg cggtcgcggc cgtgcaccgc atccgacgcc aggcgttcgc ggcgctggaa      5820
     ctggaccggg ctgccgcggt cgagacgacg gacgctgccc gtgcgctggt cgcgcagctc      5880
     tcgcaccggc tcaatgatct ccagctcgat ctgagcttca gcgtcgaggt gtacgccgac      5940
     acgatcctcg taccggagct gctggtcgag agcttccacg cgtcactgcg cgacgtctcg      6000
     tcgctggcgg acgccctggc caacacctcc cgcatcgtcg agcgcgtgaa cgccgtcctc      6060
     gcgacgcgcc gcgtcggcct cgagacggcg gcccagcagt acgccgagga ccgggaccgg      6120
     gtgctggcgg cggtgatcgc cgccggctcg ctcctcgcgc tcccgcccgc gctgctcctc      6180
     gcgtacttcg gcgtcaacag cagcgacgtg gacccgagcc ggtcgatcct ggacttccag      6240
     cactacggtg tcgcctacgc gatcgcctgg tccccgttcc tgctgctgat cctggtcggt      6300
     ctgctcgcac gccgccggat atcgctgcgg ttgcccgccc cggacgccgc cacgtccgag      6360
     cgacgaaccc ggcgttttcg gcgttccttg cgttcctggc tcggccggtc gcggcggccc      6420
     gggcgatgac gccggccaaa agccgcctgg tgctctcgca cgccacgggc gacttcgccg      6480
     gtggtggccg gacacaccgc cgacgcagcg aacggcggct gccggcctgg cctgcctcac      6540
     gcgttgaggt gcgcaccgat cgacaggaag gcctgcacga gggggacctg agggaccgcc      6600
     ggggagacca cctgggaggc gtagtggacg acgaccaggt ccagagcggg tgagacgaac      6660
     agacgctgac cgtggatgcc gctggccatg aaggatccgt acgggtcgtt caggatccac      6720
     cacaggtcgt ggtacgagag ggtggccggc gagtcggccg gcgccgcggg gaagcgaacg      6780
     cgccgcggac agccgtcggg gacgctccgc gccggggcgg tcaccgcttc cggcaggacc      6840
     tggcggtcgc ccacggcccc gccgcagcgc acgagttcgc cgaggcgggc cacgtcgcgc      6900
     gcggtggcgc tgaagccgcc gcaggctgcc tcggcgccgt ccgcgtcgac gaggtagtag      6960
     gcgtcctcct cggccccgat ccgggaccag atcatctcgg acatcagtgc cgaggtgctg      7020
     agcccggtga tccgtcgcag cacctcggcg agcgcttcga cgttgccgtt ctcgtagcgg      7080
     aactccgtgc cgggctcgcc cgtggccctc gcggtggcga gatgttcccg gatggtcgcg      7140
     ggccccgagt agccgtacgg gcgcagccgc ggcgcgagga cggcgaagta gcgctgcgcc      7200
     tccagggcct tgtcgtacgg gcggccggcg tagctcatcc gcgtgcccat gtgcatcagg      7260
     tggtcgacct gggcgtctcc aaaggcggtg ccggagagtt cgggcacgta ccgggcgacc      7320
     cgggcgcctc ggtcgaggtg tccttcgtgg gcgagggtcg cggccaggag accgaggtag      7380
     gacttggcgg ccgaggcgtt gaagtgcggg acgtgggcct cgtagccgtg ccggtactcc      7440
     tcgtggacga gtctgccccg gtgcaggacg agcagggcgt cggtctcggc ctcggcgaga      7500
     agttggtcga gggtgagagt acgtccgtac gagccggtga cgccgaggcc gtcgagggcg      7560
     cccggcggcg acgccggcag gtcaccgggg ccgccccggc cccgccagac gcgacggctg      7620
     ggcatgatct cccggcctgc cgtcgtgtgt cgtcgtgccc aggccgagtc cgtgaatcct      7680
     cgtgcccaga cgaggtaggc cagtgagtcc gtgccggtca cctgtcgctc cgctcgttcg      7740
     gaatcagctc atcgcgagat cgataccgta cacgctgttc ggaaacggag gaaggggtcg      7800
     gccgccgggg cgtgactaca cgggttcggc gccccgcccc ccggggaggt cgacggctcc      7860
     gggtgcgtcc accggggtca gcccggtggc ccagaccctg ccgtagacgg agagatcccg      7920
     caggtgggcg gtgatctgct cggcggtgta acccgtgtcg ttctcgaccc accagcccag      7980
     caccgagatg agttctccgg tccacgcgcg ggcgacgatg ccgagcggga tcctgggctc      8040
     cacgccgagt tgccgcgccc ggtcccggaa ggccatctcg gcatgcgagc ggatgagttc      8100
     ggtgaactcc cgcagcgccc gcccgtcgcc ctccccacgc agaatcacct ggtagacgcc      8160
     ccgttcctgg gcggcgtgtt cgaagatgta cttgaccggc agaccggtga aaccctgggc      8220
     gtgcgcctgg cgaacggccg gcagcagacg ctcacggtcc tgcgcgaggt cgcggacgat      8280
     gccgaccagg agatcttcct tgtcccggta gtgcgcgtag aaggtggccc ggccgatgtc      8340
     ggcccgctcg gtgatctcct cgacggtgac ggcctggaac cccttgtcca gcaccagttc      8400
     gaccagggcc ttgcggagcg cggcgcgcgt ccgccggacg cggcggtctt cgggcttcat      8460
     gtccacttcg attccttctc gtcaggaccg ttgacctgac cctagcgctg cccgtacctt      8520
     gcccgacaac ccgatcgata ctgaacacga cgttctgaaa ctctggaggc ggcgatgaat      8580
     ctcgggcgtt acgtacgccg gacggcggag caccacccgg acgcggaggc ggtggtctgc      8640
     ggccacgtcc ggttgacgta tgcggaactc gacgaccaca gcgaccggct ggcggccgcg      8700
     ctcacggggc tgggcctgag ccgcggcgag cgcgtggcga cgctcgcggc caaccgcgcg      8760
     gagctggtcg tcacggaggt cgccctctac aaggcgggcc tgacccgggc gccggtcaac      8820
     gcccgcctcg gcgacggcga agtcgcccat ctgctgcggg agtcggacgc ccgcgtcctg      8880
     ctcaccgacg ccgcccacct ggacacggcg cggcgggcgg tgcccggttc gggcgtgaag      8940
     gccgtcatcg gctacgacgg ccccgccgac ctcggccccg gctaccagga actcctcgcg      9000
     gccacccccc gcgaggccgt cgacgtggag tgcgccgagg acgacatcgc cgtcctgcac      9060
     ttcacctccg gctccaccgg caagctcaag gcagccgtgc agacgtacgg caatcggctg      9120
     gccctgctgc gcaagtcggt gatgaaccag gccactcggg tcgggacggg cgaccggcag      9180
     atcctcgccg gacccgtcac ccacgcctcc ggcatgccgc tcatgggcat cttcttcgcc      9240
     ggcggatgtg ccgtcgtgct gccccgctgg gacgccgcgg aattcctcgc caccgtggaa      9300
     cgggagcgtg ccacccacgc gttcctcgtc cccaccatgg tcaacacggt cctcgcgctg      9360
     gagaacgccc gcgaccacga cctctccagc ctccgccacc tgctctacgg cgccgcgccc      9420
     atgtcaccgg cccgggtccg ggcggcctgg gacctcttcg gccccgtgct cagccagggc      9480
     tacggatgcg gcgagacgac ctccggggtg ctgttcctct ccacggagga ccaccgccgc      9540
     gccgtcgagg gcgacgacga ggaactgctg ctgtcctgcg gcagaccgct ggccgaggcc      9600
     gaggtacgga tcgtcgacga cggcggcgag ccggtggcgg acggcgagat cggcgagatc      9660
     gcggtccgcg ggcccgacgt cgttcccggc taccacaacg agccggaact gaccgcgcgg      9720
     agctttcgcg acggctggtt cctcaccggc gacctggcgc ggcggcgccg cgacggctac      9780
     gtcttcatcg tcgaccgcaa gaaggacatg atcatctccg gcggcttcaa catctacgcc      9840
     gtcgaggtcg agtccgtcct ccaccagcat ccggacgtct tcgaggccgc ggtcgtgggc      9900
     gtacccgacg agcaatgggg cgaggcggtc aaggccgtcg tcgtgccgcg ggcgggggtc      9960
     acgctcgacg cgacggaact gatcgccttc tgcgccgagc acctggcgcg catgaagaag     10020
     ccccgctccg tcgacgtcgt cgccgcgctt ccccacaacc ccaacggcaa gatcgaccgc     10080
     cgcgccatac gcgacaccta ctggtccggc gccgagcgtc gcgtccactg aacagggaac     10140
     cactccatgc ccttcaccct cactccccgc tacgacgaca acccccgcct ggaggagctg     10200
     gtcggccggc tgcgcgccta cctgaccgac gaactcctcc cgtacgagcg ggcacacggc     10260
     atcacccccg agagcaaact ggaccgggcc acgctggaga gcgtctggaa acgcagcgcc     10320
     gagctcggct tctacggcat cagcctgccg ccggaactcg gcggccaggg cctgagcttc     10380
     accgaactgt gtgccctgaa ggaggaactc acctcctccg gggcggcgtt gtcccactcg     10440
     gtcctgggcg acatgggcgg accgctgcgg gtcggcgcga tcgtgaagta cgccaccgac     10500
     gagcagcggg agcgctacct cctccccgtg gtccggggcg agcgcgcctg ctgcttctcc     10560
     ctcaccgaac aggacgcggg ttcggacgtg cggcggatgc ggaccaccgc gacgccggac     10620
     ggcgacagct acgtactgaa cgggcacaag gtgttcagtt ccgccgcccc gttcgccgac     10680
     ttcgcggtcg tcgtcgcccg gatggcggac agcgaggaga cgtacagcgc cttcctcgtc     10740
     gatctggaca cccccggctg ccgtgtcctg gacggtgccg tgcccatgtc gggccagcag     10800
     atggaaggcg acctcgtctt cgaggactgc cgggtcccgg tcgcgaacct gctcggcgag     10860
     atcggccagg ggctgcgcat cggcatcggc cgcatcaccc tcaaccggct gctccactgc     10920
     ccctccctga tcggtgccgc gcgacgggcg tgggacctgt ccgtcgacca cgcgaagacc     10980
     cgcgtcgcct tcgggcagcc gctgctcgcg ctccaggcca tccagcacaa actcgccgac     11040
     atggccacgg acctctacgc ggcgcggtcg atggtccagg ccaccgccgc gaaggccgac     11100
     cgcggcgaga acatcgcggt ggaggcgaac atgtgcaagc tgttcaccgc cgaagcctgc     11160
     ttccgcacgg cggaccaggc cgtgcagatc cacggcaagg acggcctgac acgcggtcac     11220
     gaggtggagc agatcttccg gtccctgcgc atgttccgga tcgtcaccgg cacgaccgag     11280
     atccacaaga acgccatcgt caaggcactc gtctgacccc ggcgccaccg gcggtccgcg     11340
     cccgccggtg cccgccccgc atccgcagga gtcacccatg gcagcccgat cctccgcgcc     11400
     ccccgccgac cgttccgccc gccggcccgc cgtccgtccc tacgaccgcc gtcgcgcctg     11460
     gctggtgacg gccatgatcg tcaccttcat ggtcatcaac ttcgccgaca agtcggtcct     11520
     cggcctcgcc gctgtcccga tcatggacga gctgaacatc agcaacagca cctacgggct     11580
     gatctcgagc tccttctacc tgttcttcag tctctccgga ctcgtcgtcg gattcttcgc     11640
     ctcgcgcatc tccagcagga ccatgctctt cgtcatggcg ctgctgtggg cggtcgccca     11700
     gctgcccgtg ctggcggtgg cggcggtccc gacgctgatc gcgggccgcg tcctgctggg     11760
     tgtcgcggaa ggcccggcgg cctcgatgtc catgcacgcg ctgtacaagt ggttcccgcc     11820
     cgagcggcgc ggactgccct cggccctgca gatcggtggc gccgcgatcg gcaccctggt     11880
     ctccgcgcct gtactcacct ggctgatcac ggatttcgga tggcgatcgg cgtacgccgt     11940
     cctcgcggtg gtcagcctgc tgtgggcgct ggtgtggcgg cagacgggcc acgacggacc     12000
     gttcgacgag tcccgcccgc cccgggccga cgccccgcgg cccgggacac acctgcccta     12060
     ccgcagactg ctgctcaccg ggaccgtact gggcagcatc gccagcgcct tcggagccgc     12120
     ctgggcgctc gctctggccc atgcctggct gcccgcctac ctcaggaccc agctggacat     12180
     gagtccccac gcggtggcga ccgccatcag cgccatctcc gccctcagcc tcgtactgct     12240
     gctgaccgtc tcgccgctcg tggacgccct caaggcgcgc ggggtgtcca gccgctggtc     12300
     cagcggtgcc gtacagggag cgtcggtatg tgtcgccggc tgtgccatgg ccgcctttcc     12360
     cttcaccgac ggcgccgtcg tccgcctgct cctgatcgca gtggccttcg gcacggtcgc     12420
     cgtcgcgatc cccctgcact acgtgaccgc cgccgaggtc gtccccgggg cccggcgcgg     12480
     tgccgtcttc ggcatcgtcg ccgcgacggg caccctcccc ggactgatcg cccccttcgt     12540
     caccggtcgc ctcatcgaca ccgcggacac ggcgtcctcc ggctacacga ccgcgttcct     12600
     catcgcggcc gcggtgatgc tgctggcggg caccgcggcc gtcatcgcca tccggccgga     12660
     acacgacgcg cgacgcctcg gcctgctcca ccccacgacc gaccccgaga agggtgcaca     12720
     cacatgaatc cgatgaaccg gcgcggcttc gtcgccgctg ccgcgggcgc cgccgcggcg     12780
     accgtgcccc tgagcgcgca ggcggccgag gcgtcgcccg gccggggtcc ctccgggaca     12840
     ccgactccca cccacaccgg cgatctcccc tacgacgacc gaaccgactt cgccgacgcc     12900
     gaccgcggat tcgtcgccgc gtacaccggt ggacttatca ccacgccctc cggcggcacc     12960
     gcctgggacc ccgacgccta ccgcttcctc acggacgccg ccgagaccgc gcccacgacg     13020
     gtcgatccga gcctctggcg ccaggccagg ctcctgtccc gccaggggct ctacgaggtc     13080
     acgcaccgga tctaccaggt ccgcggcctg gacctggcca acatgaccgt cgtcgagggc     13140
     gacaccggca tcatcgtcat agaccctctg acctccgcgg agaccgcggc cgcggcgctc     13200
     cggctctacc gtgcgcaccg cgggaaccgc ccggtcaggg ccctgatcta cacccacccc     13260
     cacgtcgacc acttcggcgg ctgccggggc gtcctgcccg acggcaccga ggacgttccc     13320
     gtactcgcgc cgcggggctt catggagcac gcggtcagcg agaacgtcta cgccggtccc     13380
     gccatgtccc gccgtgcggg ctacatgtac ggcaccaacc tgcccacgga cgccgccggc     13440
     caggtcggct gcggactcgg gctggcggtg tccaccggca ccatcggcct gataccgccc     13500
     acccggtaca tcgagaccac cgggcaggag gccaccctcg acggggtgag gttccgtttc     13560
     cagatgactc cgggtacgga gtgccaggag gagatgaacg tcctccttcc cgacctgcga     13620
     gccgtgtgca tggccgagaa cgccacccac acgatgcaca acatcctgac gctgcgcggc     13680
     gcccaggtcc gcgacgcgca cgcctgggcg ggatacctga cggagtcgat cggtctgtgc     13740
     acgggcacgg ccgacgtggc gttcgcctcc caccactggc ccacctgggg caacgacgac     13800
     atcgtcgccc tgctcacccg gcagcgggac ctctacggct atctgcacga ccagaccgtc     13860
     cgcctgatca acaagggcct caacggcacc gagatcgcgg aaagcctgcg ccttccgccg     13920
     cagttggagc aggtgtgggc caaccgcggc tactacggct cactcagcca caacgtcaag     13980
     gccgtctacc agcgttacat gggctggttc gacgccaatc cggcgcacct gtgggaacat     14040
     ccgccggccg aggaggcacg gcggtgggtc gagtcgctcg gcggacaggc cgccgtgcgt     14100
     gcacgcgccc ggcactacag cgagcggggc gacctgcgct tcgccgtgac gctcctcaac     14160
     cacgccgtct tcaacgaccc gtccgacacc agggcgaagc agcagctcgc cacgctctac     14220
     atccgcctgg gccgggccgc ggagaacgcg gtgtggcgca acttcttcct caccggtgcc     14280
     caggagctcg tgcacggagc cgagccggct cccaagccca cctcgggacc ggatctgcac     14340
     cgggcactga cggtcggaca gctcatcgac ggtctggccg tacgcgtcaa cgggcccgac     14400
     gcgtggtcgc tgcggctggc gctcgactgg cacatcggcg acacctactg gcaccttcgg     14460
     ctcgccaacg gcgtcctcac ctggaccagc gacgcgagcc ccgaccccga cgcggggctg     14520
     accatgacga tgaccagggc gcagctcctc gcggtgctcg ccggcaaggg caccgacggc     14580
     gtcaccatga cgggcgacgg cacgcagctg gtgcggctcc tgtcggtcct ggacactgcg     14640
     gaccaccgct tcccggtggt cactccctga ggtgatgtcc gggtaccagt ggtggactac     14700
     cgttccgcgc tctggtccgt gcccagtgcc accagggcgt ccgcctgggc gagtccgctc     14760
     tcctcgacga cggcgcgcac gctctgggcc tcgcgcacga gtgcgaaggc gatctgcccg     14820
     cgggaatccg tccggtaccc gtagacagcg ggacgtggca gggaattgta ggagaagtgc     14880
     gaagagaagt agtacgcccc ggtgtcgtac agggccacca cgtcgcccgg ttcgacggcc     14940
     ggcagctcgc gcccggtcgc ggtcaggtca ccggcgaaac agcacgggcc cgcgatgtcg     15000
     acgacctcgg ccgggccctg cttcggccgg cccgcggcgt cgaacacccc gacgcgcagc     15060
     ggccaggcgt ccggcatgaa gaccgtgcgg gtggccacct gcgcaccggc gtgggtgacc     15120
     gcgatccggc ggccgccggc cgacttggtg tactcgacga ccgaggcaat ggtgccgctc     15180
     ttggcgagca gggaacggcc gaactcggtg atcagggcgt agcggccgtc gaacagcccg     15240
     ggtgcggcgg aacgtagttc ggcgacgtgg tccgcgtacg tcgggcggtc gtcctcgccg     15300
     tcgaagttga cgggcaggcc gccgccgatg tcgagcccgg tgatctgggc gcggcccagc     15360
     tccctgttga tgcgctcggc cagttcgtac gccgtccgca ccccctgggc gatgagcggc     15420
     agcgggcagc cctgggagcc gacgtgggcg tgcagccggt tcagccaggg ccggcgcgcg     15480
     aaggcctcga tcacggcgtc gacggcgccc tcgtcgcgca gcgcgacgcc gaacttggag     15540
     gtcgcggtgg cggtgctcat cgcaccgatg gctcccgcac cgacctgcgg gttcacccgc     15600
     agtccgatgg gcccggcggc ctcccggccg gccagcaggc cgtcgacgcg ggccatctcc     15660
     tggaagttgt ccaggttgat cgcgatgccg tgggccaggg cgaactccag ctcctcgacg     15720
     gtcttggcgg ggctgtcgaa caccagccgg tcgtaggtga atccggccgc cagcgcctgt     15780
     tccagctctc cgggcgaggc cacttcgcag cccatgcccg cctccgcgag cagccgcagc     15840
     accggcacca gcccgcacgc cttcgccgcg aacgtgtgct gcaccggggc gggtccctcg     15900
     aacgcctcgt tcagcgcgtc gacggcggcg agcacaccgt cgacgtcgag gagaccgacc     15960
     aggggcgttc gcgggcccag caggccgtcc tcgaccgccc gtgcgagcgc ggcctcacgg     16020
     gcggtgccgc gctggtggag ggaaccggaa gtcactgcac cacactccag aggtgtcggt     16080
     cgtgcacggc gctcgtggga gcggccggcc gttctgcctc gtacagcttc gctccgccga     16140
     gcccggcgcg tctccgtgcc gcgcgaccac ggtcggggca gttgcctgtg cgacaggaca     16200
     gctgaacgat caaggtgatc gggtgaccgc tccggctccg gtgaaccggt gcctcactcc     16260
     gtgcgccgcg ccagccgcag tccgacgtcc gccaggagcc gcagggtggg gtcggccagg     16320
     tcgacgccga acagctcccg agcccgccgc agccggtacc gcagggtgtt cggatgcacg     16380
     ttgaggcgct gagcggccgt gcccgtgtct ccgaaggcgt cgaggtaggc gccgacggac     16440
     gcgccgtact ccgagccgtg cgcccggtcg tgctcgacca tcgcgtgcac ggggccggac     16500
     aggctctgcc acaacggcgc gatcaggtcg agcacgcgca gcgcggacac ctcgggaacg     16560
     acttcgccga acgcggccac cgcggagacc acgtccgcgg ccggccgccg cgcggcccgc     16620
     tcgcgcagca cccgcaccac cagctccgcg gcctcgcgcg acgcgggcag ccccgacagg     16680
     tccgccgcga ccgggccgac gccggcgaac accacaccgc gcggcaccga ccgcgccgtc     16740
     gccgtcaggg cacgcgccgg gtccgtctcg ccgtcctccg ccggaatcag gacgtacagc     16800
     cgccgccccg accgtgcggt cacgcagccc ggccggtacg cctcggcctg cagcgcgagc     16860
     acgtccagcg tccgctgccc ggcggcgccc cccgtcgccg gggcgggcac ggccgtcagg     16920
     tcccggctgt catacgcctc cgcgaccagc accgtgtacg gccggtccgg cgcgaccccg     16980
     gcgtcgtgcg cgacgcgggc cgccgggccg ctgccgtcga gaagcgcgtg caccgcgctc     17040
     tcccgcgccc gggccgcggc ccggccccac gtctggtggt gggcgaggtg cggcacggcg     17100
     gcccgcgccg ccgtgtgcag cgccgccgcc gcgtcctcgg ccagcggccg gccgtcggcg     17160
     gcggcccaga gggacccgag gatctccgag ccgtgccgca ccgcgacggc cagccgttcc     17220
     gcgtaccggt cgtcggcggg caggcgtacg acgccgtcgg tgttccacag ggcctggaag     17280
     aagccgctct cacgcagttc gtccacccgc cagcgcggca cctcctgccc gaggatcgtc     17340
     agcctgcgca tcgggtcggg ctcgtggtcc atccgcgagt aggcgagcac ccgcgactgc     17400
     gggtcctcga tcgtgatcgc gcccccgacc agagccgcca ccgtgttggc gagctccggg     17460
     aggtcgccga gccgcagccc ctccaccccg gtccctccgg tcggggcgct gtgggccaga     17520
     gcggtgcgca gctgaccgag cacctccgtc cacccctgcc ccggccgccg ggtgagcagc     17580
     gcggtgcgcc ccgaggcggc cgcctccagc agcgccgccc ggggcccgcg ggccccccgc     17640
     ctcagcacca cggccgcggc tccggcccgc tccgcaccac gcagcacgtc gatcgcctcc     17700
     ggcgcggcgg catccacccc gaccgcgagc aggatcagtc cggacgccgc ccaggtgccg     17760
     tcgtcccgct cctcacccgg gtcgtgcagc accgcgtcgg ccaccggcac gccggttccg     17820
     cgcggcgcca cgacgacatc cagcatgccg ggggcgatca gacggaggat ctgctcgagc     17880
     gacggcctgc cgtcgcgccg gtccggttcc cttgctgcca tgcctccatg atggtcgtcc     17940
     gggcggctct ccccctcggc gaaggggcag gtcgctacgg cagcttccgg ggccgggcgg     18000
     gtgagcgacg ggtcctgctg cgggtgcgcg gccggtctcc cgcagtacgc ccggccggcc     18060
     gcccgggggt gaggagtacc gccaggacca ccgccgccat caccgcggac atgacggcga     18120
     aaccggcgga gaaggtggcc gcctgtgccg ccaggcccag cgcgagggat ccgagcccgg     18180
     taccggcgtc gtagccgatg ttccaggcga cggaggtcat gtgccggtcc tccgcgccgg     18240
     cgaggtcgaa ggcctgcacc agcgtgaggc tctggagtcc tccgtacgcg gttcccagca     18300
     ggagcagtcc ggcgagcagg ggcaggacgg tctcgccgtc cgggccgacg gcgagggcga     18360
     tcagtgccag tcccgcgcac gcggtcgagg cgaggagggc ggtgatcggg cgcagggcga     18420
     tcctgtcggc cagttctccg cagccccagc gggccaaggc ggccgtggcg gtgagggcga     18480
     gcagacccgt ggcggcgagc gcgggggtgc tcgtgaactg cggggcgaag gtgagcacag     18540
     cgccgcctgc cgccgtgacc aggagcagga cggtgagcgg gagcaggatg cgccggagca     18600
     ccgtggcggc gggggcgggg tgcccggtac ggccgtcctg ggtgggcgga ccgtccgtgc     18660
     gggcctcgac cgcgcggccg agggcccggg tccagggcag cgcgaggacg gggaggacac     18720
     cgcaggcgac gatcgcgggg agggcgaagg tgcccatcag ccagggtgcc gccggggtga     18780
     ggatgacctg gggcagcgcc acggcgaggc cgtagaggcc gatggccgcc ccttggcgac     18840
     cacgcggggc cagggcggcc gcggcggtgg cgccgcagac ggtgacgatg ccgaagcccg     18900
     ctccgcgcag ggcggtcgtc accaggatgg gcaccaggtg gtcgctgagg ctctgcacga     18960
     gggcgggcag gccgagcagg agagcaccga gggccagcgt gcggggccag ccgatggtgc     19020
     gcagcgccgt tctgacacac agctgggcca ggacggtggc ggccatcagg acggccgtga     19080
     cgagtccggc accgaactcg tcggcacctc cggcgacggc ccacgccggt gagacgggga     19140
     gcagcagggc cagtccggcg aagcagaagg cgcccaccgt gaggaggtgg ggtatgcccg     19200
     gggaccgcag gacggattcc gtcgctcttt cagacatggt tcctgattgt ccttgatctc     19260
     cgagcggtcc ttccagtgtc cggacggggt cgccccacgt gtcggctcct tcgaggaagc     19320
     gggtccgcct accggaagcc gaggtgcgga tcggtggtac cggtcagttc cgcgctggcg     19380
     gcccacaggc gagcggcgac cgccgggtcc gccatgtgtg cggggaccgg ctcacggcgc     19440
     ggttggccac gcagaccgaa gaccctcggc ccccacagct gccctccttg tacgtcggag     19500
     tccaggacgg cacggacgac cggccacgcc ccggcgtcct tgccctgcac catcagcgcc     19560
     gcgggcagac cgcgcagtcg ctcgccgggg gtcggcgcgc cgaccggcgg gcggggcggg     19620
     gtgagggagt caagggcgcc gccggggtgg gccaccgcac tgagcaccgt gctgccggcg     19680
     gcacgcagcc ggcggtcgag ttcgaagccg aagcacatct gcgcgagttt cgaccggccg     19740
     taggtgcgct tgggccggta gtcccgggtg gactgcaggt cgtcgaggtc cagccgttcg     19800
     gatcgcgccg cgaaacttcc caccgtcacg acgcggcccg ccggcgccgc ggacagcagg     19860
     ggggccagcc accgcgtgag cgcgtagtgg ccgaggtggt tggtgccgaa catcagctcg     19920
     tggccgtcct cggtctcccg gcggggcggg tcgtcgagcg cgcccccggc gttgtggacc     19980
     accgcgtcga gacgaccgag gtccagcgcc agaccgtcca ccgcggattt cagggtggac     20040
     aggtcggcga ggtccaggtg caggtgccgc acccgcgcgc ccgggacgcg cgagcggatc     20100
     gaggcaaggg cggcgtcggc cttcgcgggg ttcctgctgc cgatgacgac gagggcgccg     20160
     gtggcggcga gctgttccgc ggtgaagtag ccgatcccgg cgttcccccc ggtgacgagg     20220
     aagttccgtc cctcggcgga cggcagccgg tgtacgtccc acggtcggct ctggggtgcg     20280
     gaggacacga tgacggactc cttgtgctcg ggcggcgtgc tcgtgaggag caccgactcg     20340
     cccaaggtcc ctcccccggc cgacagatcg ccgacagatc acgtgcaccg ccgacagacg     20400
     accgacacac ccctcggaaa cccggagccg ggaggaagtc cggccaccac cgggggacgc     20460
     cgctgggaca gtcgtaggcg gttccgcccc tccatacgtc accccttgcc gaccggcccg     20520
     actccaccgc ggacgacgga cgagccttga cctcgaccgg acttgaggtt ggaggctggg     20580
     cgggatgtcg cctccagtga agggtgctgc tcatgcatgc gatccacgtg gcctcgttcg     20640
     gtgctccgga cgtgctgagc ctggtcgacc tgcccgatcc cgtgcccggc cccggccagg     20700
     tcgtcgtcgg tatggtcgcg gccgacgtca tcttcctgga cacgctgctg cgcggcggct     20760
     ggggtcagga cttcttcccg cgcacgctgc cgtacgtgcc gggtggcggc ggggcgggcg     20820
     aggtgctggc agtcggtgac ggagtggacc cgggctgggt cggccggagt gtggtcgtga     20880
     gaaccgggac cggatacgcc gaacaggtcg tcgcgagtgc gcaggagatc atgccggttc     20940
     ccgctgggct ggccgcggtg acggccgccg cactggtgca cgactgcgtg accgctctcg     21000
     gcttccaccg gctgggggcg ccacagaagg gggaatgggt cctggtctcg gcggcggccg     21060
     gcggggcggg caccctgctg gtgcagttgg cggtcgacgc gggggccggg tggtggccgc     21120
     cgcgtccagc gacgccaagc tggctctggc ccgcgatctg ggcgccgagg tcgtcgtcga     21180
     ctacacgcgg gcggactggg tcgagcgggt gcgcgaggcg accggtggcg gcgccgcgct     21240
     cgtctacgac ggcgcgggcg gggcgctcgg tgcgaccagc gtcgacgcgc tcgcggacgg     21300
     cgggcgcttc gtcacctacg ggaccgccga cggattcgcc gccccggacc gggaatccgc     21360
     cgcgcgccgg ggcatccggc tgctcatgcc gctcatggac ggccctccgg accaggagac     21420
     cgcccgggaa ctgctgggcc tggcgctgga gagcgccgcc gagggacgcc tgcgcccggc     21480
     catcggcgcc acctacccgc tggcgcgggc cgcggacgcc caccgcgctc tggcggcgcg     21540
     tacgacggtg ggcaagtcac tgctcctgat gggcggcgag taggcccgcg ccgaccggcg     21600
     gcaccaaggg attgacaaca ccggagcgtc aatcctgatg atcttggtgt tggtcccgac     21660
     cggccgggcg atgccatgct gggccccgcc ccacaggcgt gcagcgagag gcggtcccgg     21720
     tggtcgtgtt caagacccgg cacggttcgg tccgggggtt tcgggcctcc ggcgacgtcg     21780
     tcgccgtcct cggtgttccg tatgccgccg cgccgttcgg cgtccaccgg ttccgggagc     21840
     cggctccggc gcccgcctgg accggggtgc gggacggcag gagcttcggt ccggtcgccc     21900
     cgcagtccgc gcggctgccc ggggcgcccg tgtggtcccc cggtgacgag gacatcctca     21960
     ctgtcaacct gtggacgccg gctccggacg gcggccccct gccggtgctc gtctggatcc     22020
     acggcggtgc ctacaccttc ggctcgtcgg cccagcccga cttcgacggc accgtactgg     22080
     cccgtgccgg actggtcgtg gtgactctca actaccgaat cggtttcgag ggcttcggcc     22140
     acgtcccgcc ggacgggccg atcgcccacc ccgacaaccg ggggctgctc gaccaggtcg     22200
     ccgccctgcg gtgggtgcgc gagaacatcg ccgccttcgg tggcgaaccc ggcaacgtca     22260
     ccgtcgccgg ccagtcctcg ggagccgcct cggtcgcctg cctcatggtg atggaccgcg     22320
     cccgcggcct gttccaccgc gccattgcgc acagccccgc cagcccctgt tacccgcgcg     22380
     acatcgcggc cgcgaccacg cgcgaggtcg ccgccgcggc gggctgcccg gccacgtcgg     22440
     cgggcctccg ctccacgact ccgcaggccc tggtcgccgc cgccgaccag gtggccgacg     22500
     gctaccggcg cgaccccgcc tccgggtccc gccactacga cccctcgctg tacgccccgg     22560
     tcctcgacga cgacgtcctg cccaccgacc ccctcacggg gatggcggcc ggtgcggcca     22620
     gggacgtgga cctgctggtc tgccacacca cggaggagta ctggctgctc gacgccgtcg     22680
     gcagcagcgc gaaggtcacc accgacgcgc aactcgctcg tttcgccgag gacttcggcc     22740
     tccccgacgg cttggtggcc ggctaccgcg cggcgctgcc ccgggccccg gtgctggacg     22800
     tctacctcgc cgtcttcggc gacctgctgt tcggtgagta cgccaaccga ctcgccgaag     22860
     tccacgcccg ggccggcggc cgggctttcc tgtcccgctt cgaccggcgc cgcgccgatc     22920
     cgggtgcggt agtacgcgcc tggcactgtg cggacgttcc cttcgccttc ggcaacctgg     22980
     acgacgagcg tctggccttc ctcatcggcg gcgcacccac cgccgcggac cagggactgg     23040
     cacgccgaat ggtgcgcgcc tgggccgact tcgccgccac cggaagtccg ggctggccgc     23100
     ctgtccggga ctcctccacc gaggccaccg aggccaccga ggccaccgag gccaaggtgt     23160
     ggactgccga ccctcacgcc gcccgcaccg gcgaccgggc cgccgccgtc cgagccctct     23220
     gggccgaggc cgactttccg gtcctacgcc cctgagccgg ggcgcggccg gtgtgccacg     23280
     gccacgggct gtcccgtccg ggcccccggt gccgccggca gtgtcagacg cctgccccgg     23340
     aaccgcccgc gcagcgcgcg atcgtgtgtg accagcacga tcgcccccga aaacccggtc     23400
     agcgcctctt ccagttcctc gaccagcgcc ggtgacaggt ggttcgtcgg ctcgtcgagc     23460
     aggaggaggt cgacgggctc cgagaccaga cgggccagct ccacgcggcg gcgctggccg     23520
     taggacaact cccccatgcg caagcgcagt tccgccgggc gaaagaggcc gagggcgagc     23580
     agggtgtcgg cgtgctcgtc ggcggcaccc actcggccca gcccgaacgc ctcggccacc     23640
     gtcagctccg gcggccacgg cgtctcctcc tggcgcagat gtcctacccg gcccggcact     23700
     cgcaccgagc cctcgtccgg ccgcagttca ccggcgagca ccttcaacag ggtcgtcttg     23760
     cccgcgccgt tggggccggt gacgagaagc cgaccgcgcc ggccgaggcc gagggagccc     23820
     aggtgcaggc ggtcgcccac gcgcacgtcc gacagctgta cggcggggag cgtcgcggaa     23880
     gcggccccgg tggcgctcgc ttcctccgct gccgttgcca tgcgcacggt gaaggccagc     23940
     gcgtccggcg gcggtgccac cgggttctcg gtcaggcgct cgacccgctc gcgggcgttg     24000
     cggatacggg acatggcacc gtgggcccgg ccgcgggccc ggaagccacc gtggccgaag     24060
     ttggccaggg acgccttgcg cggaatggcg ccgaggcggg cggcgtggcc ggtggccagc     24120
     cgctcgttgc gggccagctc cgaccgccac tcctcgtgtt cctggagccg gcggcggcgc     24180
     tccgcggcct tcgccgtacg gtagccgttg tagccgtcgc cgtagcgggt gacccttcct     24240
     ccctccgcct ccagaatcgt gctggtgagg cgctccagga agacgcggtc gtgggtgacc     24300
     gcgagcaccg tgccgcggtg tgcccgcagc tgtgtctcca gccattccac ggcctgatcg     24360
     tccaggtcgt tggtcggctc gtccagcaga aggacctccg ggcggcccgc gaggacgccg     24420
     gccagggcaa gtcgggagcg ctcgcctccg gagagggtgc cgagccggcg ctcgcggcgg     24480
     agcgccggca ggccgaggtg gtgcagcgcg atgtccaccc ggcggtcggc gtcgtggccg     24540
     tcccgggcct catagcgctc gacgagcacg gtgtacgcgg cgagtgcctc cggatcctcg     24600
     ccggcaccga gcgcctgctc ggcccggcgc agttcggcct ccagggcacg caggtctgcg     24660
     agggacaggt cgacggcgtc ctggacggtg gcggtcgggg gcagggggac ggactgcgga     24720
     agacagccga tgccgccggc ggcggtcacg gtcgcttcgc cgctgtccgg gcgctcctgg     24780
     cctgcgacga tcctgaggag ggtggacttg cccgcgccgt tgtcaccgat cagtccggcc     24840
     ttctcgcccg gcttcagcgt gagggagacc tggtcgagaa cggtgcggcc ggcgtagcgc     24900
     ttggtgacat gggacagggt gagttgtgag gtgcgcaaga tcgggtccct cctggccgca     24960
     cgggatcggc ccgggccgga tcggggtggg tggacggcac ggcgaggcgc ggcgacggcg     25020
     gagcggtgct ctacgccgtc ggcgccggtg atctcacagg gaacccatgc caaggacggt     25080
     acgccacgcc gcacccattg gcaagacgat acgtctcgcc ttgttcgtcg gtgcgccccc     25140
     gagcgcggtg caccgtgaac cggtggagat caactgatcg gcgcagcagt gaatcgttac     25200
     gccgggtgaa cggcgccgcc attgctcaga gcgcccgcgc cgatgctgtg agtctgggcg     25260
     tcgcatcgac aacggatcgg cagacagcgg cagtcccgcc tggcgatccc ccaccgtttg     25320
     gagctcccct tgccccttcg tcgtatcgtg accagcgccc tcgcctccct cgccctggca     25380
     ctcgcctccg ccggcgccat caccctgagc gccggtccgg ccgcagcgaa tccctgcggc     25440
     ttctacgaga ccgcctccga cgcctactac aaccactgca cctcggacgg ttcgcacatc     25500
     gtcatcgaga tcgacgactg ggggcccaac agcgagcggt gtgtggtgcc cggtgtgacc     25560
     tggatcggat ccagctccga catcgacggc gcctggtaca ccggccgcac ctgctgagcc     25620
     ccgcggcggg gacggtcagg accggtgcgg cccggccctc tcggggacgg ccgggctgcc     25680
     cggggcctcg gcagggctgg gggttcggga tgacgccgga gcttgtacgg gtgaacttca     25740
     aggcccggga cgactcggcg ctcggccgct tctgggcgga ggcgctcggc tggcgcgcgt     25800
     cgagcgaggg gccgggcgtc acgaacctgg aacccgtggg cttcgaccgg ccggacccgt     25860
     ccgcggtctg catcgacctc gtccgcgtcc cggacccgga gacggtgaag taccgagtcc     25920
     acctcgagct tgccaccacc tccgaggacc gtcgggcgga gttggccacc cgcctcgagg     25980
     aactgggcgc cacgcacgct gacgtgggcc ggagcgacgc accgtggacg gtactggccg     26040
     acccggaggg cacgtggaac ggcatccacc tcgacgtgat gtccgacccg gtcgaggatc     26100
     aggccaggga ggccgctcgg ctcgaggctc tcggcgcgac acggaccgat gccggtcagg     26160
     gggatgtctc ctgggtcgtc ctgaccgacc tcgcgaacaa caagtactgc gctcgaacgg     26220
     ggctgacgcc tcgtccgtca gccccggcgg ccgaagacct gtcgggccgt gccgaggtcc     26280
     aggaagacgg tctccccggt ggcgtcgtcc agggcgtcgt tgtcggtgac ggcgtagacg     26340
     cggccgtcac cgcccacggt cagaccctcg agcttctcct gcgtccagcc gttggtggcc     26400
     cgcaggtccg gcagcacgtc gtgcgcgagc ctcttcggca ggatccgcag ggctcccgag     26460
     ggcaccgccg acttcggcag gtccacggtg tagatccgct tgaccctggc ggcggggccg     26520
     ttgagcttgt cgcgctcgat caccgcgagg cggtctccga ccacggtgat ctcggacagc     26580
     cccatccagt caccggccgt cccggtggat tcgagccggt agccgtacca gctccaggtg     26640
     ccggccgtca cgtcgtagcg tcccagccgt acgacacccg ccgggtcgcc cgcggcctcg     26700
     cgctggagcg cggcccacac gacctcgtgc ccgcgccggt cggtggtggc ggtgactccc     26760
     tcgaagccct gcttgccgag gcccgcggcg acgtcggccg gcagcgggac gacctgccgg     26820
     gtcacgcccc gcgcgtcgag ccggacgagc ttgttgcccg cgcccgtccc gccctcgacg     26880
     gcgagccaga agccgccctg cggccgggcg tggatgccct cggcgtcata ccccgcgggc     26940
     cgcccgtcgg cgtccttgac ggtcagttcc cgggtgatga cggcggggcg gcgggccgtg     27000
     tcgacggtga ggatgcgggt ggtggagtac gccgcgtcgg tgaccgtgta gagccggtgc     27060
     ggcttgcccg gtgccgcgga cagcgcgccg agcgctcccc agccgatcgg ggcgccgcgg     27120
     tcgtcgtcgg ccgagacgat gcccgggaac gagggggtct ggccggtgcc ccgccccatc     27180
     cggaacaggc tcacggacgc gcgcacgccc gcctcggcgt cgtcctcctc gctggagacc     27240
     gcgagcagtc cgcgcgacgg gatcggcagc aggccctcgg ggccgttggt ggcgggcagc     27300
     aactggcgga agaccggccg ggtggggcgg ctgacgtcgt agaccgcgac gaagttgtcg     27360
     cgctccgagc cgacgaaggc gtagggcacg ccgtcgtact cggcgatcgc gatgccttcc     27420
     ggctcggcgc ccttcttgcc cgaccggccc tcgtcgtgca ggccgtggcg cacggcgagc     27480
     cgctcgaagc tgttgcccgc gtcccacacc ggcttgccgg tgcggctgtc gaacacggac     27540
     cagccacggg taccgccgcg ccagtcgccc tcgttggcgg tggcgaggta gcggtcgtcg     27600
     atccagccga cggcgtcggg ctcgcgccgg aggtcctcga tggacccgcg ctggtcgatc     27660
     ctgccgtcgg attcggtgtc gatgccgcgt accgaggcag tgccggcgcc gaacgccttg     27720
     gcgatccggc cggtcggcag gtcgatcagg acgacaccgt tgttctcctg gagcgtcacc     27780
     gcgagctggt tgcggctgtt gatcgagacg tactccggct ccgggtccgt cggttcggcg     27840
     atcccggcct cggccagcac gggcagcgcc cggccgtcgg cccgggtcag cggaaccgcc     27900
     cgggtccgcc agtgtgcggg ggcggcgccc cggcccaggt cgacgatctg cacgaagccg     27960
     gccggtgcct gcggcaggtc gccctcgtcg cggccgggcg gcgtcgcctc ctcgtcgcgt     28020
     tcgttctcga ccgcgacggc ggcatagcgc ttgtccttgc tgacggcgac ggagtcgggc     28080
     tgcccaccga ggtcgaagct cgccacccgc ttgcggtcgc gcagcgaaac gacgtcgagc     28140
     cgtccggagg gccgcgcgtg gctcgcgctg gtgttgacga ccaccagcac gtactggccg     28200
     accacggtca ccgaggtggg ctcgtcctcg gcgtcgtcga gtcgggccag tgacagggtg     28260
     ccgaggccgc gcgggtggcc ggggtcggag atgtccagga agccgatccg ccgggccacc     28320
     gcgtcggtgt gcacgagggt gcggccgtcc tcgctgaccg aggagatctc cgcgacggtc     28380
     ccggccgccg cgtcctcgcc ggccggacgg ttgtggaaga ccgggtaggt ggcggtgcgc     28440
     tcgaacaggc tcgaccgccc ctgctgggcc tgctgggcct gctgggcctg ctgaccacca     28500
     tgccgctgcc cgtggtgcgg ctgctccgcc cgcgcggctc ccgcggtcac caggctgccg     28560
     gcggccacca ccagggcggc cagcgcggcg cgggttctct tgctcttggg ggacatcttt     28620
     cctccggtcc ggtccactcc gtcgccgaac gttctcagcc gagggcgagt gccgcgggga     28680
     cgacgggtga acggcgggcg aagcccggat cgacggctcc gtaacgggtg gccgagcgct     28740
     gccgtacgcc gtagggagcc ggcacagtcg tcccggagcg aggcggccga tgtcgcacgc     28800
     gaggcagcca ggacggtggg cgagcggctg tacggccggc gtccgcgcac ggcggaggag     28860
     agcgggcggg ccgtttcgcg gatggacagg tggaggtgat gcgggtgacg ggcacctccg     28920
     cacacgaaag agacggtgtc gacgtgatcg tccgcatgtc cggctcggcg tacgactcgt     28980
     gggccggttt cgaggagatc accgtgcgca gctgtttcac ggtacgggtg tcccccgcgt     29040
     cgcggtggcg cgaggacccc gacgacgtgg actgcccgga ggaccccgcg ctgaccttcg     29100
     ccccgccggt gaggggcaac cacttcgacc cgcaggactg cctgctcgcc cgcgtcgtcc     29160
     ccggcgcgac cgaggtccgg ggtgccgccc cgcatccacc ggatgcccgg agcgggcggc     29220
     cgcaggtggc ctgcgccctg gacccggcag cggcgccgca ctgacggcgc tccgctcacc     29280
     gcgcagaatg gactccgtgg ccggcacggt ggccgtcggc gggaggagaa gcgtgagcgg     29340
     gattccttcg cagggcgtcg cctccgggat gcgggaggcg gcgcgtgccc ttctcgccgt     29400
     cctggagccg gagcaggtac gtgagctgcg tgccgggccc gaccgtttgg acacgcccga     29460
     gctgcgcgag tggacgtatc tgccgggccc gcgccccggc ctttccaccg aaggtctcga     29520
     cggccggcag cgcgaggtgg tcgacgcgct cctgaccacg gcgcacagcg cggcgggagc     29580
     ggagctggtg cgcggggcga tcgaggtgga gcggcaccct cgcgcccggg cggggcatcc     29640
     ggggccggac cgctactggg tgcggctgct cggcgacccg ggcggtgacg aaccgtgggg     29700
     ctggcggctg aacggccacc acctggccgt ccacgtactg gtcaccgcgg ccggggtccg     29760
     ggtgaccccg cacttcgtcg gcgcggaacc ggctcgcacc ggaaacgggc cgcggcccgg     29820
     tctccggccc ctgggcccgg aggaggatct ggcccgggag ctgatcacga gcctgggcgg     29880
     caccgcgcgg gcgtcggcac tcttcgccgc cacaccaccg gacgacatcc tgacccgggc     29940
     cgacccgttc gccgatccgg gtctccttcc ggagggcctg cggtacgacc gcctggcgcc     30000
     ggggcaacag cgccttctgg agcgtctggt gggccgctat ctcgaccgtg cgcccgaggc     30060
     gtacgcgcgc gagtgctggt ccgacgccgt gcgccgcggt ctgggctccc tgtccttcgc     30120
     ctgggccggg ggcctcgctc cgggagaccg gcactactac tgcgtccgcg ccccggactt     30180
     cctgatcgag tacgacaaca cgcaggacga cggcaaccac gcccactcgg tctggcggca     30240
     cgtccgccac gactggggaa ccgacctgct ccgcgggcac tacacggagc agcacttcta     30300
     ggtcgtgtcc gtaaagtgct gtggtcgttg gtctgttcgt ggtgcgtcgt catgagctga     30360
     ctgatgagtc gtgggcggtg atcgagccgt ttctggctcc gccgcggatg ggtcgtccgg     30420
     tgcgggatcg ccggcaggtg gtcaacggga tcctgtggaa actgtccacc ggggctgcct     30480
     ggcgggacct gcccgagcgg tatggcccgt ggaagacggt ctatgaacgt ttccgccgct     30540
     ggtctgccga cggcacctgg gaccgcctcc tggcccacgt ccagcagcac tcggacgcgg     30600
     ccggtgcggt cgactggacc gttgtctgcg tggactcaac gaccgtgcgg gcccatcagc     30660
     atgccgcggg agcccgaaaa aggggcagga ctggccgggc gaggcactcg gccggtcccg     30720
     cggcgggctg accacaaaga tccacctcgc ctgcgacggt gaaggccgcc ccctggcctt     30780
     caccctcacc gccggcaacg tcaacgactg cacccagttc gagcaggtca tggcccgcat     30840
     ccgcattcag cggtgcggac ccggcagacc cagaaccagg cccgagcggg tcgcggcgga     30900
     caagggctac tcgtccacga agatccgcac ctacctgcga cgtcgcggca tcaaggcggc     30960
     gattcccgag cgcatcgacc agatcaacgg ccgcatccgc aggggcgaga gcctctgccg     31020
     actcgaccgg gcggcctacc ggcgacgcaa cgtcgtcgag cgctgcttca acaagctcaa     31080
     gcacaacaaa gccctggcca cccgctacga caaacgcgcc cgtcactacc aggccctggt     31140
     caccctggcc tgcctcaaac tctggctacc ctgactttgc ggacacgacc tagagaccgc     31200
     caccggtacg ggcccggacg gaggaggcga cacgttggga agtgaaccgg acgccgtgcc     31260
     gggaccctcg ctgcagcaga aggtccaggg cgtgctcgac gaactcgtgg gtacgggggc     31320
     cgaaaggggc ttgcaggtcg ccgtgtacca ccacggtgct ctcgtcgtcg acgccgtggc     31380
     cggtgtcgcc gacagccgga ccgggcgcag ggtggcccct gagacaccgt tcttcggttt     31440
     ctccgccggc aaggtcatga cctcgctcgt cgcccatctg ctcgtcaaga gcggtcggat     31500
     cgggtacgac acgccggtgg ccgagctgtg gccccggttc ggcgcccacg gcaaggggac     31560
     cacgacactg cggcacgtgc tcacccactc ggcgggcgtg ccggccatgc cccgtgacat     31620
     cggccccggg gacctctccg actggtcgcg ggtgtgcacg gcgctcgccg acgccgcacc     31680
     tcggtggcgc cccggaacca ggaccggata ccactcgtac acctacggct tcctcgtcgg     31740
     cgagatcgca cgccgggcaa cggacaggcc gatgcggcag ctcctgcgcg agtgggtcac     31800
     cgagccgctg ggcctcgaag ggaacctcta cttctcggtg ccccggaccg acctggcccg     31860
     gctggcccac ctcgaggacg cccacctcga ggacgtgcgg ccgcccgcgg ccgccgcgac     31920
     cgacgacgaa gccgtcctcg ccccgtggga gctgcggccg accgcggagc tgggcaacaa     31980
     cgccgaggtc ctccgggctg acgtcccgtc ggtcggcacc ttcaccgcac ggggaatcgc     32040
     cgccatgaac gccgcgctcc tcgacggccg gctcatcgac ccggggcagc tcgcggaggt     32100
     gacggcggtg gccttcgagg gcaccgacca ggtcttcggc caccacgtcc ggctgggcct     32160
     gggctatccg ctgggcggtg tcgggtcccg gacgggcgag gcgctcacca cgttcggctg     32220
     gatcggtggc ggcggcagct acgtctgtgc cgacaccgcg gccggcatcg cccttgccgt     32280
     gaccaagacc ctcctcacac cccacttcga caccgctcga cgcctcacgg atctgatcac     32340
     ggccgagctc ggcccgccgg tctgagcgac ggtccggtcc tcgtccacac cgccgcgggc     32400
     gactccagcc cggccgatgg aatatatgga cagagcgttc atttcatggt tatatgaacg     32460
     tgccgttcat tagagcgcac gcaccgactt ccaggagatc cccatgagca cccccgagag     32520
     caaccgcgtc gccctggtca ccggaggttc cggcggcatc ggccgagtgg tggccgagcg     32580
     cctggcccgg gacgggttcg ccgtcgccgt ccagtacgcc ggcaaccggg cgaaggccga     32640
     ggagacggtc gccgccatca acgccgtcgg cggccgggca ctcgcggtcg gcggcgacgt     32700
     cgccgacgag gacgcgatgg gcaccgcctt cgacaccgta cggtcggcct tcggcggcat     32760
     cgacgtggtc gtcaacaccg ccggcatcat gatcctcgcg cccgtcgaga ccctggacct     32820
     cgccgacctg gaccggatgc accggaccaa catccgcggc accttcgtcg tcaaccagca     32880
     ggccgcccgc accgtgcgct ccggcggagc cgtcgtcaac ttctccacct ccgtggtccg     32940
     cacccagctg cccacctacg gcgcctacgg cgcctacgtc gccagcaagg cggcggtcga     33000
     ggccatgacc ctcgtcctcg cccgggaact gcgcggccgg gacatcacgg tcaacgccgt     33060
     tgcccccggc cccacggcca ctcccctctt cctccagggc aaggacgagg ggaccgtcga     33120
     caagttcgcc aaggcgaccc ccctggagcg cctcggccgc cccgaggaca tcgccgagac     33180
     cgtcgccttc ctcgccgggc ccgcccgctg gatcaacggc caggtcctct acgccaacgg     33240
     cggcctcgcg taaccgcgtc ccgcggcaga tccctccccc ttttctcctc cccagcgaaa     33300
     ggacccgctc atgtccccca ccggcaccgt cgtcgtcatc accggcgcct ccagtggctt     33360
     cggcgcgctc accgcccgtg cgctggccga cgccggccac accgtccacg ccgggatgcg     33420
     ccacaccgcc ggccgcaacg ccccgcaggt gcaggcggcc ctcgactact cgcgcgagca     33480
     cggggtcgac ctgcgtccgg tcgaactcga cgtgaactca caggcctccg tcgacgccgc     33540
     catcgcgggc atcgaggcgg agcacggcca catcgacgtc ctcgtccaca atgccgggca     33600
     catgtcgacc ggccccgcgg aggcgttcac gcccgaccag ctcgccgcgc tctacgacgt     33660
     gaacgtgctg tccacgcagc gcgtcaaccg cgccgccctg cccggtatgc gccggcgcgg     33720
     gcaggggctg gtgctctggg tgtccagcag cagcgtcaag ggcggcaccc cgccctacct     33780
     ggccccgtac ttcgccgcga aggccgcgat ggactcgctc gccgtgtcct acgccgccga     33840
     gctcgcccgc tggggcgtgg agacctcgat cgtcgtaccc ggctcgttca ccagcggcac     33900
     caaccacttc gcccactccg gccgccccga cgacgccgcc gtcgaggccg agtacgagac     33960
     ccggtacgcc gggctcatgg agcaggtggc ggacaagctc gccgcgctcg cgcccgaggg     34020
     ggcgagcgcg acgctggtct ccgaagagat cgcccgcatc gtcgccctgc ccgccggctg     34080
     gcgccccttc cgcgtccaca tcgaccccgc cgacgacggt tcccaggagg tctcggacac     34140
     ggccgaccgc gtccgcagcg ccttcctcga ccggatcgga ctcgccgacc tgctcggcgt     34200
     cgagcgctga caccaccgag gagatcaccg tgaccaccgc cgaggtcccc tccgccgtcc     34260
     gcgctttcgt cgacgccatc gaccggggtg actccgaggc gttcaccgcg gcgttcaccg     34320
     aggccgcccg cctcaacgac tggggccagg agctccgcgg tcgggacggg caccggttcc     34380
     atgaccgtcc gcctgcgcga cgggctgctc gccgctctgt cgaccacacc gtgacaccgc     34440
     gtgccgtcgc ggactccggc ggttggaccg tgcccggcgc ccacggcgag actgtcaccc     34500
     gacccgcccc atcgatcagg agttcaacgt ggcgaacgac gcgaacggcc ggccggcccc     34560
     ggggagcagg ggccgcggac gacgccccgc cgaggaggta cgggccgagg tcctgcacgc     34620
     ggtgggcgag ctgctgctga ccgaggggac ggcacagctc accttcgaac gggtcgccag     34680
     ggtttcgggg gtcagcaaga ccaccctgta caaatggtgg ccctcgaagg gagccctggc     34740
     cctggacggc tacttccacg cagtcgagga cacgctcgcc ttccccgaca ccggggacgt     34800
     ccgcgccgac ctgctcgccc agctgcgcgc cttcacccac gtgatgaccc ggaccccggg     34860
     cggacgcatc ctcaccgagc tgatcggcgc cgcacagacc gacgccgacc tggccaccgc     34920
     ctaccggcag ctgtactccg cgcagcgtcg cgccctggcc gccgaacggc tgcgccacgc     34980
     ccgggaactc ggccagatcc gccccgacgt cgacgtgcag gtcctcgtcg accagctctg     35040
     gggcgcggtc taccaccggc tcctgatccc cgacgaaccc gtcgacgacg ccttcgtcac     35100
     cgccctcgtc accaacctcc tggacggtgt gtgcccccgc cccgcctgaa cggggcggcc     35160
     gccgggcccc tccgcaccac cggccggaac gctgccggcc ggcgggaccg cgggcaccgg     35220
     tctcaggcgt ccgggaccca gctgccgtgg aatcccaggg gtacccggcc gggcagccgg     35280
     acgcgggccc gcggacggcc gccgaagttc tgggcggaga ggatcaccag gtcggtcgcg     35340
     ccgcggtcgg ggtcgttcac gtacgacagg acgtaaccgt cgtcctcgtc ccgagccccg     35400
     cgccgcggga cgaacaccgg ctcgccgacc gccgcgcccc gggggaagcg gtggagctgc     35460
     ctgctgcccc gcagcatgtc gtgcttcacc aggtagttgg tgaacttctc gtccgggcac     35520
     actccgtcga cggtctcgta ggcacgccac atctcggccg cgcacgcggt gtaggcgtag     35580
     cggtgccgcc gggagaccag ggactcgttg atgcggggga actcctgcgg gcggtcgtcc     35640
     agacgggtgc tgcggacccg ggccgcgccg aggtcgacgg tccaccggtc gagcgtcggt     35700
     gacccggtgg cggagggccc gcccacgccg cgccccgcgg cgtagaacgg cgcggggaag     35760
     ccgatgtact ccagcacgac cgtgtcgccc tggtcgtagg cgttgagcgt gtgcgagtag     35820
     tacacggggt cgatctcgaa ccagcgggtg gtgccgccgg tgcgcggcag cagcccgagg     35880
     cgcatggggt gccggtcgtt ccacacgtac gggacgatcg ccccggcctc cgccgcggcg     35940
     ccgtcgaagg tgatcggcac gtccacgatc accacgtact tctcggtgag cgcgaagtcg     36000
     tgcatcatcg gcgcgtccgc gacggggatc cgcgtggccg gccgggccct gccggtccgg     36060
     tcgacgacga tgtgccgcac gtggtcccag gtggggtagt acgcgatcgc gtgcagctcg     36120
     tcggccaccg cgtcgtactt ggtgtgcgcg gcgaacgctc ccttctgcgt ggcgcggaag     36180
     tcgtacgggc gcagggtgtt gagttcgccg tccagttcgt acggcagggg cccgccttcc     36240
     tgcagggcga gaatgcggcc gtggtacggg atcacgtgcg tgttgcacgg gaagtcgtcc     36300
     ggcggcgcct ggccggggta ggtctcgccc agtttcgccg tcacctgcga ggagcgcacc     36360
     cagcggttgc ggtaccactc cgcgcgtccg ccccgcagcc ggaccccgtg caccattccg     36420
     tcgccgatca tccagtggtg ggcccggacg tcctcgatgc ccagcgcgtt cgggccgttg     36480
     cgcaggtagc ggccgtccag atcagccggg atgcggccga cgacgtcgag gtcgaaggcg     36540
     gtcagctcct cggtgaccgg cgcgaaggcg ccttccagga acggggtcgc gggcgcgctg     36600
     ccgcccttcg gggccgcggg ggtcgcctgc gccgcggccg agaagaagcc gggtccgagg     36660
     ccgctgccga ccacactgcc ggccgccgcg accgcggcgc ccctgaggat tctccgccgt     36720
     gagtgactgc ccatcgtgat ccctcgttcc ctcgtcggtg tccggccgcg cgggccggat     36780
     gcgcgatgac gggaccaacc ctcctccgcg gcggccgccg aggcaggtgg cccagcctcc     36840
     gaatcgtgcg gggtgctggc accacccccc gcggtccccg gcgccggctg tcccgccacg     36900
     gcgaacgcag aggtggttcc aggtccgctc ccctcggccg aaggcgcatg ctccagctcg     36960
     ccgggacgac ggccgcgacg accgccgtcg gtccgctcgc cggcggctcc cccgcccacg     37020
     gagcggccct ccctccggcc cgggccggca tcggagcgcc ggcgttcccc ttcggcctcg     37080
     gccgggtcag gccgaccgcg acgctcctcg accagggcga cggcacctgc acgatccgcg     37140
     acgcccgcgg gaaactgctc cccgtgcaga acgactcccc cgcggccggc gccttcgtcg     37200
     cgcaggaggc ggacgacggt gcggccgaca accgctggcg catcctgcgc cgaacggcca     37260
     ttgacacgcg tgtgcgggtc gttccaggat gaccttcgtt gacaacgttg tcgcctggcg     37320
     aagaggacca tcatgggccc cgtttccctc cctgtaggcc gcaggctcct cctgcaactc     37380
     ctcggcgcga ccggcgccgc ggccgccctc cagccggccc tggggtcccc ttcggccgcc     37440
     gcggccgcgt ccggagccgc cccgagcgtc gacccgccgg acgacgtcgc cgccacgtac     37500
     caccgcgtgc tgctgcggca cacccgctgg tccgagacgc agtgggacga ggccaagggg     37560
     gcctacagcg accggaactt cgggttcgcc gtcgtcctcg gccatgccgt gctgctgacc     37620
     cacgggacct tcgacgagga cgcggccggc gtcgaccggg agacgctcag gcgccgcacc     37680
     ctggcgacgc tgcgccacta cgccgcctcc aaccggctga ccggcggcac ccagtggggc     37740
     cggaccctgt tcttcgacac caccttccag tcgtacttcg tcctcgccgc gcacctgctg     37800
     tgggacgagc tcgacgccgc cacccgctcc gcggtcgaca ccatcacccg cgaacaggcg     37860
     gcgtacacgc actccttggg tacgggcgac gacccgtact ccggctcctg gaccccgaac     37920
     gggctcgcgg gcgggtacgt cggcgacacc aagctcgagg agatggggct ctacgcgcag     37980
     accctcgcgc cggcgctggc ctgggccccg gacgaccggc gccgctccga gtgggcggcc     38040
     gactacggca catggtcgcg caacgagggc ggcctgccgc ccgccgacct ggccaacccc     38100
     gcgcgggtgg acggggtgcc ggtctcgcac aacaccgcgc acaacgcgta cgacaccttc     38160
     atcgtggaga accacggctc cttcggtccg cactaccagg aggagatgtg gcgcacctcc     38220
     gggcgcaacg cggcacactt cctcgccgcg gggcagccgc tgcccgaggt gctgaccagg     38280
     cagcccaacg cggagccgct gtggcggacc ctgctgggcg tcatgtcgga cgcgggcgag     38340
     ccgctgatgc cgatggtgga cgaccgcgag cacctgtacg gcagggacgt cataccgctg     38400
     gccttcctgt cgcgggtcgc gggagaccgg gcggcggcgc gcgcggagac ggagctggcc     38460
     gcacgcctgg aggcgtacca ggcgtatccg cccgagtacc ggctggcgaa gttctcgggc     38520
     gagcccaagt acgagccgga ggcgcgcgcg gagctggcca tcagctatct gctgcacgtg     38580
     tggccgcagg cggggccgcg ggtacgtccc ctgtcgcgcg aggagttgtt cgcgttcgcg     38640
     tcgggggtca ccgacttcgg gaccggcccc ggtctggtgt cccaccagtc gcccgcggcc     38700
     tgggcgggca cggtgacgaa gcccgggttc gtgaagttcg cctggcagcc ggcgcacgac     38760
     gactggctgt tccggctcgg cggcgccacc ccgatgttcc tgccctcgac cgccgcggag     38820
     gtcaccggca ggacggtgcg cgtgcacacg gcgctgcggg acggcttcga cggcagtgcc     38880
     acggtactgc gcctcggcga gggcttcgcc gggtacgcca cgctccccac gggcgccgtg     38940
     gtctacgcct gcgaggggcc gggcgcggcc gcttcgcggc tggaggtgca caacctcacc     39000
     atgcccgggg tggcgggcct cgacggcagc cgcacctacc ggttcgcgga gggctcggcc     39060
     acggtccgcg cgcaggacac cacaccctcg gccgcggggc gcgtcgacga actggccttc     39120
     cccggcacga cggtgcggca cctgcgcatg ctgggcgtcc agcccgaccc ggcgtacggg     39180
     tactcgctgt acgcggtcga ggcgcgggac ggggccgagg ggcccgacct cgcgcggggc     39240
     ggcacggcga cggcctcctc gcagtcggcc ggcatgggcc cggagctggc cgtggacggc     39300
     aacggcgcaa gccgctgggc ggtctcgcgc gaggaccgca ggcgggcgga cagctggtgg     39360
     gccgtcgacc tcggcgccga gcgcgccctg gaccgggtca cgctgcgctg ggaggcggcc     39420
     gccggccgct cctaccgggt gcagggttcg ccggacggcg agcggtggac cgatctggcg     39480
     accggcccgg ccccctcgtt gcgcagcggt ggcggctggc tcgacgtcga cggccgtgcc     39540
     gggctcgtcg tccgcggcgg gagcgagcac aggctggcgg tgtacggcga cacgatcgtc     39600
     ccggccgagg gggcccggga gccgctggtg atcgaggggc actgcggtgt gtccgccggg     39660
     gacctgagcg cgctggcccg tcgggccgcg cccaccgccg gggacggccg ggtccgcgcg     39720
     gcgcgggtgg acgggtacct gagcctgttc aacctgtcgg cgcaggaggt ggagacccgg     39780
     gtcgcggtgc cgcagcaggg cggaagccgg gaggtctacg agggtgacca gacggtgacc     39840
     cgggagggca tcgactacgg tgcgcggctg gacgcggcgt cggcctcgct gctcgcgccg     39900
     cgcttcaccc tcagcgcgct gtccggccgc tcgctgccct ccgggctgcg ggtccgggtg     39960
     gccgacgggg cgaccctgat cctgtccggc gcccactgcc ggctgcggat cgaggcccag     40020
     ggccgtggca ccgaggcgac cgtgcggggc ggacgcgaga cacgggtgac gctgcgcggg     40080
     gcacaggcct tcccgcatca cgaccacgcc ctgggccgga acaccttccc gaccaacccc     40140
     ctgccgccgg ggatgtccgg tcccggcgcc gccgtggacg gcgacccgga cacggcctgg     40200
     cacccgggtc gggacggccg catggtggtc gacctgggga cgcgcaccgg ggtgcggtgg     40260
     gtggaggcgc ggtggaggac cggcgcggcg ccggcggccc gcgtggagtt cagcaccgac     40320
     ggggtgcgct accagcaggc cggcaccctg gacggccgcg gacgcgtccg ccggctcacc     40380
     cgggcgggct cggcccggta cgtcgcggtg acggtgcagg gtgcgccgca cgcacacgag     40440
     gggctggtcc ggctctccgt gggctgaggc ggtcccgcag gggcctgccc gatcggcccg     40500
     gggcaggggc ccggtgggcg tcagtccagt acgaaggtgc cgccggcgct ggtcgccacg     40560
     tcgggcccca gggcgccggc cggcgtccat gccccgggcc ggccggcgcc gcgggccagc     40620
     agttcggtga cggtggcggt gacgtcggcc gtgaagtcca tgccctcgtc ggcccggagc     40680
     catccctcgc gccgggtgcc gtcggcccat tccactacgg cgtgtcccca ggagtgttcg     40740
     cgcggtcggg gggcggcctt gacggtgacg cgtccgagcc gggcgacggc gaggcgtcgc     40800
     agcgccggga cggacagcag gcggcccagc gcggggacca cggcacgcag tagcggcgtg     40860
     ctcggtgcga gggaggacgt cgcggtgacg aacggtgccc cgctggccgc ccgggccgcg     40920
     accagctcgc cggaggcgac acccgcggac ctggccgacg tcccgtcggg gaaggtgagg     40980
     cgctgcgggt cggcaccgag gcgcgaggcc accagccgcc cgtcggcgta gcggcgcccg     41040
     ccggcggtga gggtgtccac gatgctggtc gccagggcgg cgccgacggc accggcctcg     41100
     acggccaccg aggccacgga gtcgatccgc acccggtgcg gcgcgggccg ttcctcgcac     41160
     agtttcgcca cgaccgcctc cgtcgcgagc acgccgaatc cggcgccggt gaccagggtg     41220
     ctgccggccc gcgtcgcgtc ctcgtgcagg gcgaggagtc cctccacggc gaccacgtcg     41280
     ttggcctggt cgacgtagtg gccgccgacc gacatgcagg cgcgggcgat caccggcgcc     41340
     gtggtggcgt aggcgcccat cgtgttcacc acggcccgcg ggcgctgccg caggacctcc     41400
     tccgcgatcc gctcggccga gtcggcgacg acggtcttcg cgtccgcggg gaggccggct     41460
     gcggcgccgg cggcggccat ccgctcccgg ctgcgcccga ccggcacgac cgtcaggccc     41520
     cgcgcggcca gtcgcccggt cacgccccgg cccacgcggc cggtggctcc gacgatccac     41580
     acctcgtcgt tcgtcctgtt cccgcttgtc gtcccgctgg tctcggtcat gtccgtgtcc     41640
     ctgtctgctc cggacggcac cggggacggc cgccccagtg atgacacaca gtgccatgac     41700
     tacaggctag cactgacgac acagcgagac atcacctgtt agagtcggcc catggcaagg     41760
     tgggacccgg gcgcggagca gcgcctgaaa cgggcggctc tggagctcta ctcggagcac     41820
     ggctacgaca acgtgaccgt gaccgacatc gccgagcggg ccggactcac ccggcgctcg     41880
     tacttccgct acttccccga caagcgcgag gtcctgttcg gcggctcgga actgctgccg     41940
     ccggcagtgg cgcgagccgt cctggcggca gaccccggcg cggctccgct caccgccgtc     42000
     ctcgacgcga tgtcccaggt cggcgcccag ctcgtcgcac aggtggaggg tgcggcgcag     42060
     cgccgggcgg tcatcgacgc cagcccggaa ctgcaggagc gtgagcggac caagtcggcc     42120
     gcgatcagcc gggcggtcca ggacgccctg gtccgacgcc aggtggacgc cgacaccgcc     42180
     gaactcgtcg cacagctcgc cacagtggcg ttcggcagcg ccttccggcg ctggatcgac     42240
     gccgaggggc acgccgattt cggcagctgc ctggacaccg tgaccgaccg gctgcgggcc     42300
     gtcctcaccg gaacgtgacg atccttcaac cgcccgggac gacacgccgg cgtcgtcgtg     42360
     ggcgggcgtt cactcggccc gcatgaccga ctcctcgtgc agcaggtcgt cccgccgctc     42420
     gggcgtggcg tggcgcggcg gcggcccgtc cgagccggcc gggtactcct ccagcggcac     42480
     cagtcctcgc tcccaggcgg acaggaccgg ctcgacgacc cgccacgcct cctcggcctc     42540
     gtcgccccgg atggacaggg cggggtcgcc gcgcaggacg tccagcagca gccgcccgta     42600
     ggccggcagg tcgggggtgt ccatgcgggc ggtcagcgag agctgggtga gggtttcggg     42660
     acgggagccg gtcgcggtca ggtccacgct caggctctcc ggctccagtc cgaagcgcag     42720
     cacgttggga cggacgtcct ggtcctgccc gaagggcagg tgggggacgg agcggaagcg     42780
     cacggcgacc tccttgcggt ccgtgccgag ggccttgccg ctgcgcagcc ggaaccgggt     42840
     gcccgcccaa gcgccagctg tcgagttcca gcacgctctc gtcgcgctct ggctcgcggc     42900
     ggcccgcaag atctgccgct acgacggggc cacgcgacgg ggcgaatggc actggaagac     42960
     gggcaggccc gtccaccggc tcagggggca ggtgctgggg ctgctgtcct tcggcgccat     43020
     cgcgcggctc gtcgccgagc gggcccgggc gttcggcgtc gaggtgtggg cgcacgaccc     43080
     gttcgtcgac gagtccgaga tccgtgccgc ccgggtccgg ccggtctcct tcgacgacct     43140
     ggtggagggt gcggaccatc tggtggtcca ggcgccgctc actccgcaga cgcaccacac     43200
     cttcgaccgc gcgacgctcc gccggatgaa gcccaccgct gtcctcgtca acaccgcacg     43260
     cgggccgatc gtggaggacg cggcgctgta cgaggcgctg accggagggt ggatcgccgg     43320
     tgcggcgctg gacgacatcg aggaggaacc cgccaagcaa cgcgactggc ggccgaacaa     43380
     ccccctcttc gaactgccca acgtcgtcgt caccccgcac gccgcctact actccgagga     43440
     agccatcggc acggtacgca ccatcgcggc ggaagaggcc gtacgggtcc tgaccgggga     43500
     acccgcgcgg taccccgtca acgaacccgc cgccggctcc caccgcgcgg aaggcgcgtg     43560
     agcgggcccg ctcccggtca ggagcgcagg cgggtgagtt cgtccgcgcg gcggtggtcc     43620
     ttcggccgcc cgagggcacg gcgcatgcgg atcaggtcgt cgagtgcggc gtagcggacg     43680
     gtgaatcccg acgggtcgtg ggtggtctcg gcccgggcca ggcagggcga cacgtccatg     43740
     tcgccccagg ggagcgcggg ggtgcacagg tcgccaccgg ccccggtgac ctcgtacgcc     43800
     gcctgtgcgc ggtccaggtc cggtggttcg gcgcagccgc acgccgccag ggcggaacgc     43860
     agggcgcgcg cctcggcggg ggtaccgtcc cacaacaggt ccaggtctcc ggtcagttcg     43920
     gtggagccgt gcatgatgcc ggcgacctgg ccgatgacca ccgcgtggga gccggcgtcg     43980
     tggagggccc ggaggaacgg gaaggggtcg aagccgagcg ccccgtccgt ggcgaaggtg     44040
     ccccggacgt cgtcggcctc ctccgggcgg cgcccgacgg gggcccgttc tctcgtcgcg     44100
     tcccgggtcc gggtgatcgc ccgccgcagg cgcagggcag ctgttgtccg gctcatggca     44160
     cccatccaac accgccctgc cgcggtcgcc ccgttcgggt gggcggtcgc ggcggcggca     44220
     tgacggggcg ccgttacggg gtgaccgggg cgagccggta ccggccgccc cggtgggtgg     44280
     cgaaggacac cactgcctcc tcggagcggt cggcgtcggc gccctcgacg cgcaccgggt     44340
     gcggggtgcg gatccgtacg gggttgccga gcagcgaacg cacctccgcg cgcgtgatgc     44400
     cggcgccggt ccactccagg tcgacctcga acccgccgcg cgcccgcaga ccccggaagg     44460
     atccagtggg ccatgcctcg ggcagggcgg gcagcagctc gatctcgccc gcgtggctct     44520
     gcaggagcat ctcggtgatg ccggagacgc cgccgaagtt gccgtcgatc tggaagggcg     44580
     ggtggaggtc gaagaggttc ggcgcggtgc gcgccggggt gagcaggtcc gccaggtgct     44640
     ggtaggcccg cgccggttcc agcagccggg cccacatgtt gatcttccag gcgagggacc     44700
     agccctgtcc cgccgtgccg cgcagctcca ggctcttctt ggcggccgcg gcgagttccg     44760
     gggtgcccct cggggtgatc tgggcgctgg ggaacacgcc gtacaggtgg gacacgtggc     44820
     ggctcctgac cagggccgcc tcctcccagt ccaccagcca ctcctggatc tggcccaggt     44880
     ggccgacgcg ggtgggcgcg agccggtcgc ggacctcggt gacccggccg acgagtcggc     44940
     tgtcgcggtc cagcacctcc gcggcctggc ggtaggcgtc gaagaggtcc cgcagcagct     45000
     gcatgtccat ggtggggccg gcgcagatgc tgacgctctc gccctcgtcc tggtggtggg     45060
     tcacctcggg cgactgggag gggttggtga cgagccagcc ggtctccgcg tccacctgga     45120
     gggtgtcgag gaagaattcc accgccccct tcatcaccgg gtagttgcgg ctcagcgcgc     45180
     ccgtgtcccc ggtgaaccgg tagtggtccc acagcatcac gcacagccag gcaccgccgg     45240
     tcggccacat gccgtactgg gcggcgtcca ccggcgcggt gccgcgccag ccgtcggtgt     45300
     tgtggtggag cacccagccg ggggcgtcgt agagggcctt ggcggtgcgg gtgccggact     45360
     cggccagttc gtgcaccatg cgcacggccg ggtcccagca ctcggcgagg ttgccgggtc     45420
     cggcgggcca gtagttcatc tcgaagttga tgttgacggt gtacttggac tcccaggccg     45480
     ggttcaggct gtcgttccac agtccctgga gattggcggg ctgtccgggt gaccgggagc     45540
     aggaggcgag caggtagcgg ccgtactgga agtagagcgc ggccagttgg gggtccttgc     45600
     cgtcggcgaa cagcgggatg cgttcgtcgg tgggcagctc ggcacgttcc gagggaccca     45660
     ggtcgagggc gacccggccg aacaggcgcc ggtggtcggc gacgtgccgg gtgcgcaggt     45720
     gtgcgtacgg cttcctcgcg gccggcgcca ggtggttgcg ggcccgggag gcggggtcgg     45780
     cgccgacgtc gaggtagttg cggtagctgg tcgccaggga gatgacgagg gtggcggcgt     45840
     cggcgccctc gacggtgagt gttccgccgt cggtggagac ccggccgccc tcggactcgg     45900
     cgcgggccag gccccggaag cgcaccgagc cgggccggcc gtaccagtcg ccgccgacac     45960
     cgtcgagggc gatggtgtgc gcgtccacgg ccgagccgcc ggagcgctgc gggctggtga     46020
     agcgggcggt gaagccgacg gcacccgggg tgtccgcgct cagccggacg acgaggacct     46080
     ggtcgggggc gctggcgaag acctcgcgga cgtggcgtac cccgccccgg gtgtaggtgg     46140
     tgcgggcgac ggcggtctcc aggtccagct cgcgttcgta gtcggcggcc tcgccctcac     46200
     cggcgagggt gagttcgagg tcgccgagca cctggtaggc ggcctgctcc gaggggctgc     46260
     ccaggaactc ggcgtcgatg aggcgctgtg cccggttcca cttctcctcg accaccagcc     46320
     ggcggatctc cgccaggtgc cgaacggcgt cgggacgggc gtagtcgccc gggccgccgg     46380
     cccacaggct gtcctcgttg agctggagcc gttcggtgtc ggtgccgccg aagaccatgg     46440
     cgccgagccg gccgttgccg accggcaggg cctcgagcca ctcctgcgcc ggggcgcggt     46500
     accacagccg catcggtgcg gcggcgtggt cctcgcccgg cgccgccgac gcggcggtgt     46560
     ccgccgtctg cggtgcggcc ggcgcgggag cggcgctcag cgcggtcgcc gccgcggagg     46620
     ctccggccgc ggccaggacg tttcgtcggg agaactcggg catggcaaag cctccaggca     46680
     tgtgtcgagg gcggtgcgaa tgctctgtgc cgggcgcggg cgggtccggg agcccgcgcc     46740
     caccgcaccc cgggcagcgg ctcgtgcggc acgctgcccg ggggtgttcg ccggggggcg     46800
     accggtcagc gaccgctcac tgggtgtccc cgtcgggcag cgggtagggg aagccggcgg     46860
     tgacgccgat cttgtcgtac tccatcctgg aggcgtcgta cccgtcctcc cagttggtgt     46920
     tcttcacgtc gttgcactgg tagctctggt acgactggtc ggtggtcctg cccacctcga     46980
     tgtcctcgaa ggtgaagccg cagccgccgg cgtccatgtg aatgccccgg gtgccgctgt     47040
     cgggcatcga ctcgtccggg atcacgtcgc cgacgaccat ctggcgcacg tggttgtcca     47100
     tcgggtacgg ctcgacgttg ttgacgccgt aggtgtagaa ggcgcccatg tcgccgctgt     47160
     ccaggccggc ttcgtcgatg cgcaggtact cgaaggtgtt gccgcgggcg tagttgtcct     47220
     tgagggccac ttccggccgg acctcgaggc tgatgccgta gcgggcgctg tgcttgacgt     47280
     ggctgtggct gaccgtgttg tgcccggtgt tcatcagctc gatgccggag gcgtcgccgg     47340
     ggttcagttc accgtagtgg gtgatgtagt tgttggtgag cagatggccg ttggaggtgt     47400
     tcccctcgcc cgggtagggg ccctccacct tgattccgtc ggcgccgatg ttctccagca     47460
     ggctgtcgcg gacggtcagg tggtcgttgg cggcgagcgc gtagacggcg tggtagccgg     47520
     tgtccgagat cttcagccgg gacagggtga cgtccttgct gttggtgacg gagacggcgc     47580
     cgaagcggtt gcgcggcatc tcgatctgcc ggtcgtactc cgggtacttg tgcacctcgc     47640
     cggagtcgcc gtcgctgatc cacccgttgc ggtaccagtc gacgaagtcg gtgtactgca     47700
     gggcgagtcc gtccagcgtg acgttctgga cccgccggtc cggggcggtg ccggccaggt     47760
     cgaacagggt cttgaccgtg ggccgcagca cggtgacgtc gtcgatgtcg ccgcggggct     47820
     tgtagtagag ctgccccttc ttgaagtcca ggtagtactc gccggcctgg tccaggaagt     47880
     cgagggagtt ctggaggaag tagcgcgagc ccccgccgga gttgttgagc gcgtaccggg     47940
     tccagtactt gagcgtcatc tggttcttgg ccgggttcca gtcccggatc gggacggtgt     48000
     cggtgaacca gctccagctg ccgccggacc agaccaccgc ctgggcgttg ccgaggtccc     48060
     acgtggcgtc ccagtcaccg gggttggagt acagccactg gtggacggcc tccttctccg     48120
     gctccgggag ggtggaggtg aggtatgggg cccactcctc ctcggacttg cggttggggt     48180
     agcgggcggt ggtggcgcgg gtgccgtcct cgaagagggt gtagaagggg ttgtccgtgc     48240
     cgacgtcggc acggtagatg ccgtccttgt actcctccca gccggtcacc ggctcggcgc     48300
     ccgtcacgcg ggccttgccg gggccgtcgt aggagcggta gacgacctgg tggccaccgg     48360
     cgcccgagtc gcggtcgtcg agttcgacgg tccggttcac cgggtagtcg ccggccctca     48420
     ggttgacgtg gatgtcgcag cgcatcctgc cgggccggtt gagacccttg tcgcggatgt     48480
     ggtcgcgggc cttttcgatg gtcttgaagg gcttgtcctt cgtgcccttg gccttgtcgt     48540
     tcccgtcggg ggacacgaac agctcggtgg ccctgcagcc cgccggctgg gcgctcgcgt     48600
     cgggtgtgcc cacagtggcg ccgccgacca gcagggcgcc ggccgcgagc agcaggggga     48660
     gtcttgcggt ccttcgtcgt acggggcgta cctgggtggt tggcacgagg tctccttgtc     48720
     gtacggagtg cgtgagggtg cgtggtgtcg tcgtccggat ccacgtgggc cggacggggc     48780
     gggtgtgccg taccgtcacg ggcgccggag ccggtgcgga aaccggagct ggagccggag     48840
     ccggacggaa gccggaaccg gagccggtgc ggaagccgga accgccggca cggaagccgg     48900
     tgtcgcgcgg gcccgtgctc cgggtgcggg ggcttcgtgc cctcctccgg cggcgtcgcg     48960
     ccggtcgcgg acgccgtccg gagcggcatg gggcggggac cgcccctgcg gacacccgct     49020
     ccggtggagc acccgcacgg catcgcgtac acgattagtg ggtcactgat cgagcaacga     49080
     tagttaatat gttcgtgccg tggtgtcgtc aatacgcttg gctgaacctg aaattgatga     49140
     ccaaaggggc gacgaactcg cggcccgtga gtcataagtt cacgcatccc aggaagcgcg     49200
     gtgccatgac cgatcccgtc ctgccggagt ttccccagct cagtgcggag gaccgggcgg     49260
     ccctcgcgga gctcgcccgg cggcagcagg ccggcctccg gctgcgcggc cggatcgtcc     49320
     tggcctgtgc cgagggactg accaacgcgg aggtcgcgca gcggctcacg gtcagtccca     49380
     ccacggtggc caagtggcgg gagcgctatc tccggcgggg cctcgccggt ctgcacgacg     49440
     cacctcgctc ggggcggccc cgcagcagca accggcagga ggcggaggcc cggatcgcgg     49500
     ccgtggtcga acaggcccgc gccggtgccc cggtgccctc gacccgctcg ctgtccgaca     49560
     cgctcggact gtcgcagtcc accgtcgccc ggatctggcg ggagcaggag gccaggctgc     49620
     ccgaacggcc ggacggacgt ccgagccggc cgcgcggggc ggcggacggg caggagggcg     49680
     gggaagcgag ccgcacccgg ggcggtccgg tgccgggcac gccgcgcatg ccgcggcagt     49740
     tgctctccga ccacgtgtac gcgctgctgc gcgactggat cgtcagcggc cggctggcac     49800
     cgggtcagcg cctggtcgag tcggagatcg cacgcggttt cggcaccagt caggccccgc     49860
     cccgcgaggc gatcaaacgc ctcgcctacg agggcctggt catctcccaa ccgcaccgcg     49920
     gcacttatgt cgcgcaggtc tccgaacggc aggcgcagga catccgggac atccgggtga     49980
     tgttcgagga gtacgcggcc cgccgggtgg ccggacggct ggacgccgag cacacgcggc     50040
     tgctcgccga ggacgtgacc cgactgcgcc gggccgcagc cgaggacgac atcggcgcct     50100
     tccgcgacgc cgacatgtca tttcaccggc atgtgtgcga agccgcccgc aacgcggccc     50160
     tgatccgcct gtggcgcatg atcgagtcca gcctgtggga cctgcacgtc ctgggcgacc     50220
     cgcgctacgc gggcggctgg ggcgcgatgg ccgagcacca cgccgaactg ctggacgtcc     50280
     tgcgctccgg tgacccggat gccgccgggc cgatgttcgc cgaccatgcc gcgggcgaga     50340
     ccgcccgcta cctgaccgac gggtccgggc ccgccacctg acccggacgg tgagccgagc     50400
     gccaccagcg gtttcatctc acgccgctcc gcccatcctc cgcacgacac ccttgatgag     50460
     cgcggcgagc tccgccaccc gctcgggggt ggcctcggac ttgagcagcg aggaactgac     50520
     ggcgaaggac cggccgcccc cggccggtcc gggaacggcc gccgccacgc acacgatccc     50580
     ctcggcggcc tcctggtcgt cgacggcgtg cccggccgtg cgcacctcgc gcacctccgc     50640
     gagcagcgcg tcgagcgtcg tgagggacca gggcgtgcgc gcctcgaacg gctcccggga     50700
     tgccagcagt tcacacaccc cgctgtcgtc caggccggcc agcatggcct tgcccagcgc     50760
     cgtgcaggtg accggcagcc tcgcccccgc ccggctggtg aggcgcatca ggacggtgcc     50820
     ctcgtgcacc gccaggtaga cgacgtccgc gccgtccatg gtggccagct ggagcgtctc     50880
     ctcccggtcg cccaggcggc tcacctgctc ccggaagctg cgtacgggat cgaaggcgtc     50940
     gagataggac tgggcgagcc ggagcaggcc cggtccgaga gcgaagccgc cgtccacggc     51000
     gtggaccagt tcctgttcgc gcagggccgc gcagatgttg acgacggacg cgcgcggtat     51060
     gccgcccgcg gcggcggcca gttgggcggg cgacagcgcc cggccgcggg cgtccgccag     51120
     cgcgtcgagg atcgcgcccg cccgcagcac cgccggcgcc ggtgcggcac tggcccatac     51180
     cgatccgtcc cgagtactca tggcgtcaca ccctagctgt cagcctgttg acagtaaacc     51240
     agtccattga caacaagcgg tgccgtacac cgatactggg cccgcaagtc ccggagcggc     51300
     ggcgccggca cggcgccgat cacggcggac gtccgcgcgc accgggaagt cggcacccct     51360
     ctcatcacgg tgacgaccgt cttcgccatc tccgcaccgg gccggccgta cggacatgtc     51420
     cggcgcgagc ggcggcacgg ccggacccgg ctcccgacca aggaaagcga cccatgaaac     51480
     tcgtacggct cggagacccc gggcgggaac gccccgccgt catcgacgac cggggcgtca     51540
     cccgggacct ctcctccctg acctccgaca tcgacggcgc cttcctcgcg gcggacggca     51600
     tcgcccgcac ccgtcgggcc ctggccgacg acgtcctgcc cccgctgcgg accgaggggc     51660
     tgcgcttcgg accacccgtc gcgcggcccg gcgcggtggt ctgcatcggc cagaactacg     51720
     cggcccacgc ggcggagtcc ggcagcgagc cgcccacccg cccggtgatc ttcttcaagc     51780
     cgccgaacac ggtggtcggc ccgaacgacg aggtggagat cccgcgcggc tccgccagga     51840
     cggactggga ggtcgaactc gccgtcgtca tcggccggac ggcgcggtac ctggactccc     51900
     ccgggcaagc cctggagcac gtggccggct acgccgtctc caacgacgtg tccgagcggg     51960
     acttccagct ggagcactcc gggggccagt ggtccaaggg caagtcctgc gccacgttca     52020
     acccgctcgg ccccttcctg gtaccggccg acgaggtgcc cgacgtccag gctctgcggc     52080
     tgcggtcctt cgtcaacggc gaaccgcggc aggactcgcg caccgccgac atgatcttct     52140
     ccgtcgcgca gctcgtgtac gacctgagcc agtacctggt cctggacccg ggcgacgtca     52200
     tcaacaccgg caccccggag ggcgtcgccc tgtccgggcg cttcccctac ctgcggcccg     52260
     gtgacgtgat ggagatcgag atcgagggac tggggcgcca gcgccaggcg cttgtccccg     52320
     cacggacctc ttctcagtca tcacttgtat gatacgttac gactcgatga gggcacggtt     52380
     gcgggactga ctcccgacgg ccgcacgacg cccgttcccc tggcccgacg gcacgctccc     52440
     ccacctccca cgccccctcg gtcttccctg gcgcggggtg ggtgggccga cgggcgggac     52500
     ggcgaggaga gcacaagagg gggagcagtt gaagatcacc ggattccgga gcctgacgac     52560
     cgtgcaccgc tgggggcgcc ccgtcggaga cgccaacggc ttcgtcgcac aaggcgtcac     52620
     cgaggtcccg gtcctgctgg tcgagaccga cggcggcctc accggagtgg gcctcggcgc     52680
     acacggcgac gccgagcggg tcttccccgc cctcgacggc caggacccac gggccgtcac     52740
     cacgctctac gaccggatgc tggcccacac cttcaagagc ggccacgccg gcaccgcctt     52800
     cggcaccatc ggcgccttcg acacggcgtt gtgggacctc aaggcgaaaa tggccggcga     52860
     gccgctgtgg cgcaccctcg gcgccgcgga ccgtttcgtg cccggctatg cgtccggcct     52920
     cgacatcgcg ctggacgagg aggagttggt cgcgctgtac tccggctggg ccgcacgcgg     52980
     cttcaccggc gccaagctca agggcggcct ggacaccgaa cgcgacatcg gcaggctgcg     53040
     cgcggtcgcg gaggtgctgc gccccaacac ccgctccccc gccctgatgc tcgacgtcaa     53100
     cgagtcctgg ggcaggcacc aggccgtgcg gctgctcgcc cggatcgagg accgcgtcga     53160
     actcgcctgg atcgaggagc cggtgcgccg ctgggacgcg agggggcacc gggccgtggg     53220
     ccgggccggg cgcaccgccg tcgccagcgg cgagaacctg acgggcctcg agcagttccg     53280
     ccccctgctg gcggcggacg cgctccaggt cgtacaggcc gcgggcgtct ggggcatcac     53340
     ccacttcctg cgggtggcga ccctcgccca cggccacgac ctgccggtca gcccggtcgg     53400
     ctaccacgcc aacccgttgg cgcacgcggc cgccgccgtc cccaaccacc tggtcaccga     53460
     ggtgcaggac atcggcacac cggccggact gaccgtggac caggcgatcg aggacggcgg     53520
     catcgtcctc ggcgacgcgc cggggctcgg catcacggtg gacgagagcg cactcgccgc     53580
     cccgcggcag aacgccggct gggcccgccc cgacggcccg cacgtacgcc cccgcgacgc     53640
     cggcctgcgg ctggtgcccg agccgggccc cccgggtccg gccgcccgcg tccgggcggg     53700
     caccccctcc ctgggcgtgc ccggccccgt ccaccgtccc gcgcgcagcg agcacaccga     53760
     gagggagaac acgccgtgac gcgaccacgc gccgtcctcg ccatgaaccc ccggctggtc     53820
     cacgccgtct tcgacgaggc cgccctggcc cggctgcgcc gcgccgccga catcgacacc     53880
     ggccaggtcc tcgccgaact ggactccgcc cgctcccgcg acgcgctggc cggtgccgag     53940
     atcctcgtcg cgggctggga cgcgcccgtc gtacgggccg agcacctgcc cggcaccgag     54000
     cggctgcggg ccgtggtcta cgcgggcggg gtcgccgcga cctgtctgga ggacccggcc     54060
     gccttcgccg cccgcggcgt ggtcgcggcc aacgcccgcg ccgccaattc cgggccggtg     54120
     gccgagtaca ccctcgccat gatcctgctc gccaacaagc gcgtcctggc cgaggagcgc     54180
     cgctaccgcg cctcgcggac cctgcccgac cacttcggcg cgtacgccgg acgcggcaac     54240
     taccggcaga cggtcggcat cgtgggcgcc tccaccgtcg gccgcgcggt gctcggcctg     54300
     ttgcgcccct tcgacctgga cgtcctcctg tacgacccga cgctcacggc ggagcaggcg     54360
     gccgccctcg gcgcgcggct ggtgccgctc gacgaactga tggcgcacag ccgcgtggtg     54420
     tccctgcacc agcccctgac tcccgcgacc cgcggccaga tcgacgcggg acggctcgcc     54480
     ctgatgccgg acggcgccac gctcgtcaac accgcgcggg gtgccgtcgt cgaccaggac     54540
     gccctgctgg ccgaagtgcg caccggccgc atcgacgccg tcctcgacgt caccgaaccc     54600
     gaaccgcctg acccgggcag cgagctgtgg gccctggaca acgtcgtgct caccccgcac     54660
     ctggcgggtt cgctcggcgg ggagctgcac cgtatcggtg acgccgtcgc cgacgaggtg     54720
     gagcggttcg cgacaggccg gcccttcgcc cacccggagg acctcgcggc ctccgcccgt     54780
     acgagggtgt ggtgagggcg atgcgttccc gtaccctcgc ccgcggtccg gtgctgaccg     54840
     cactgggcct gggcgccgcc cagttgggca acctggcccg caagaccagc gacacggacg     54900
     cgcggggtgc cgtcgacgcg gcctgggaca gcggtgtccg ctacttcgac accgcaccgc     54960
     actacggcct cgggctgtcg gaacgccgcc tcggcgccgc cctcgcccgg cgcccgcggg     55020
     ccgagtacac ggtgtccacc aaagtgggcc ggctgctggt gcccagcccc gagaccgcgc     55080
     accggcagga cgacggcggc ttcgccgtgc ccgccgcctt ccggcgcgac tgggacttct     55140
     ccagggacgg catcctgcgc tccctggagg gcagcctgac gcggctcggg ctcgaccacg     55200
     tcgacatcgt ctacctgcac gatcccgacg agcactggca gcaggcctcc accaccggcg     55260
     tcgacaccct cgtcggactg cgcgaccagg gggtggtgaa ggcggtcggc gtgggcatga     55320
     accaggccgc gatgctcgcc gagttcgtcc gccgctcgga cgtcgacctc gtcatggtgg     55380
     ccgggcggca caccctgctc gaccagtcgg cgcaggacga gctgctgccg ctcgcccggg     55440
     agcgcggggt gggcgtcgtg gccgccgccg tctacaactc cggcctgctc gcggccgacc     55500
     gtccgccggg cgacgccacc tacgactacc aacccgcgtc ccgcgagctg atcgcgcggg     55560
     ccgacgcact cgcggacgtc tgcgagcggc acggcgtcac actgcccgag gccgcgatcg     55620
     cctacccgct gcggcacccc gcggtcgtgt cggtggtgct cggcgcccgc gacgcggggc     55680
     agtcacgcac gaacgcggcg cggctcgcgg ccggggttcc aaacgcgctg tggacggagc     55740
     tggcggacct cggtctgctc cccgaggtgc ccggcgcgcc gtccactccc ggggagccgt     55800
     catgaccgtc gtcgacgccc atctgcacgt gtgggatccc gagcaggccg cctacgagtg     55860
     gctggggccc gcgatggctc ccgtcgaccg cgccatgcgg ttccacgacg cccttccggc     55920
     cctgcgcacg gccggggtgg gcgcggccgt cctcgtccag gcggccgaca acgacgagga     55980
     caccgacctc atgctggcga ccgccgccag gcacccggag gtcgtcggcg tcgtcgcctg     56040
     ggtcccgctg gacgacccgg gcagggcccg ggcccgcctc gccgcgctgc gccgcgaccc     56100
     gcacgtggtg ggcgtgcgca ccctgctcca cgagcggtcc gacccggact gggtcctcgg     56160
     ccccgacgcc gacgcgggcc tcgcgctgct cgccgaggcc ggtctgccct tcgactactc     56220
     gaccacgtcg cccgccgcgc tgcgccatct tgccgaactg tcggcccggc accccgccct     56280
     gcgcctggtc gtcgaccacc tcggcaagcc gcccgtcggc ggcggccgcg aggaccgggc     56340
     cgagtggcac cgcctgatcg ccgccgccgc gaagcacccc ggcgtccacg cgaagctgtc     56400
     cggcctctac tcggcctcgg gcgcactgga cgcgtggacc accgacgagg tgcggccctt     56460
     cgtcgaggac gcgctggagc tgttcgggcc cgagcggctg atgtacggcg gcgactggcc     56520
     gatctccctg ctggcgggcg gctacgcgcg cacctgggag gccatgtgcg aactcctcgc     56580
     gccgctcgcc cccgacgacc gcgccgccgt cctcggcggc accgccaccc gcttctaccg     56640
     cctcgacccc gccctgctga acaccgcgca ccacgcggcc gtgtgatccg ctccggaagg     56700
     aacgccaaca ccatggaaca ccagaccacg acgccggaca cggccgagct ggccggctgg     56760
     ctgcacagct gggtgacgga cgaaggggcg atcaacggct tccacaacca cagtgtgtgg     56820
     ggcaccaacc cggccacctt cctcgacttc accagcggac acaccacgtt cgccggtccg     56880
     gccgtcggcg cctgggcccg ggccctggcc gcccggccgg acgagcgggg cgtcgccctg     56940
     ctgcgccggc tgctgcgtta ccagtgctcc gaggtgcagc ccgacggaca gtacgcgcac     57000
     atcggcttcc aggtcggcga gtcggcgacc agcggcctca tccacaacgc cgtcggcagc     57060
     ctcggcatgc tgctcgcggt gcgccacgcc gggcacctgc tgcccgccga ggaggtggcc     57120
     gccgtactgg ccgccgtacg gcgcaacctg gacgcctgcg aggtctacgg cggcgggcgc     57180
     ccgggcgagg agggcacctg caaccaggag tacgcccggg tctgggtcaa gcagctctac     57240
     acggagctga gcgacgacaa gacctacgcc gccgagattc ccgaggacct ggcggagctg     57300
     atccggctct tccaccaccg gggagtgccc gacccggaga gcaccggcac gttccgcacc     57360
     gtgcgcgacc gcgccgaggg cggcatcctg gaacccgccg agtactacgg cctcatgatc     57420
     gtgccgctgg tgctgggcca ccgcgcccag ggcgatcccg aactgctggc cgaggcgcgg     57480
     cggttgtgcc ggcacgtggc ccgctccgcc tggacggacg agtccggcgc cacccgctac     57540
     caccgctact ggtacgtccg gggcgagcgc gccctgaaga cggacacccc gatgctcatc     57600
     gcgggcatgg gactgaccct gtacggcatc cacgaggtgc tggccgaggg cccggacgcc     57660
     gagctggagg cgttcaccga ggcctgcctc gccacctacg cccgctacca gacgccggcc     57720
     gggtacttcg cctccgcgag cggctggcac aacgaggccg acatcgcgcc cagcaccgcc     57780
     tggcacgcgc acgacctgct gttcctgatg gcccggtacg gtccggacga ggacttctgg     57840
     gaccgggtga ccgcgccgcg cgaccggcgg tcggtgctgg tcagcgatcg cgcgtactgg     57900
     gccgagtccg gcgtccactg gtccgtgcgc agcccgctca cggcgggcga cctgcacctg     57960
     tacggccgca aggaccgggc cgtcttcgcc cgggagttct tcgcctggac ggaccgcgag     58020
     ccgctgcccg aggagctgcg ccacccggac gtccccgagt tcttcgtcgc cgacgacggc     58080
     atctaccgcg tcgaccacgg cgaggccccc accgacatca ccgccgtcgg ccccctgccc     58140
     taccggggac ggctgtgacc accgaacgac accgccggct ttccccaccg aggaaaagag     58200
     agatgacaat gacgtcgacc aacagaggga gcaaggcgcg cggtgccgcg cttgccgccg     58260
     tggttccact gctcctcgtc gcggcctgct cgtcgggctc cggctccgcg gagggcgagg     58320
     acggcgagat ccggatgatg gtgaacctca ccgacaacct caaccaggcc tactgggaga     58380
     agctggtcaa gcccttcgag gacgagaccg gcctgaaggt gaagatagag ggcccgacgg     58440
     gcaagtccgt cgccgagtcc ttcccccagc aactggccgc cggcacggcg cccgacgtca     58500
     tccagtcgat cttccccgac gacgacacgg cgcccgaact gatcgacctc ggcggcgagg     58560
     cctgggccaa gggcacgccg atgttcgacg agtacgccat gggcgacgcc cactacgcgg     58620
     tcggcgtagg cacccagacg cagtcgctga tctactacaa caagaccgcc ttcgagaagg     58680
     ccgggatcag cgggccgccc accacctggg acgagctgac cacggacctc ggcgccctcg     58740
     agaaggccgg gtacacgccg atgcagacgg ccggcgactt ccagaccggc ctccagctcc     58800
     agcagatcta ccaccccacg ctgaaccagc tgcacccgaa gtggcagacc gccgtcgccg     58860
     acgacaggct ctcggtcggc gacgcctaca agcccgcctt ccagatgtac gccgactgga     58920
     tcgaggccgg ctacatcggc aagagcgacg tcgggctcag cccctcccag gcggacggca     58980
     acttcaccgc gggcaaggtg ggtctctaca ccaacggcag ctggttcgcg gcgagcctgg     59040
     acaaggccgg ggacctcccg ttcgaggtgg gcgtgttctc cccgccggcc gcggacggtc     59100
     aggcctaccc gggcccgcag ggcgccacca tggccaaccc ctacatgatc cgcaagggca     59160
     tcggggacga ggacggcgcc aagcaactgg tggagtacct ggtcaccgac gccaaggccg     59220
     tcgaggcgca gctcggttcg gacggggtgt tccgcaaggg cgccgagtcg aagcagtcgg     59280
     gggtcgacgc gcagatccag ggcatcctcg acgacgcccc cgcgctggtc gccgtgggcg     59340
     aggggcaggg caacgtccgg ctgcccgtca ccggcttcaa cccgcagttc accgaggtcg     59400
     cgcagagcct gtacaccggg gcgggcccgg cggacgccgc caagagcatc gaccagtggg     59460
     tcgacgagaa ccgctgaccc atggaacaga catctgtctc gaagccgcgg gcctggcgcg     59520
     acctgggcgc ccgcgtcagc atggtcgtgc ccgcggtgct cgtctacgtc gccctgctgg     59580
     tcgtaccggt gatctacgcg atctactaca gcttcaccga gtacaacgga ttcccccacc     59640
     gggtccccga gttcatcggt ctggacaact accggaccat gttcgggtcc gacgacatca     59700
     ccggcaccat ggtggtcacc gccgtggtcg ccgtggtggg cgcggtcgcg gtcaatctgg     59760
     ccgcactggg gctcgcgctg ctgctgcagc gcaccaaccg gttcaacacc ttcggccggg     59820
     tcgtcatgtt ctacccgcac gtgctcagcg cgctggtcgt gggcttcctg tggcaggcca     59880
     tcctcggccc gcagggcgtg gtcaacacca tgctggagaa ggccggcacc gacagcctgc     59940
     ccttcctcag cgatcccgac tgggccctgt ggtcgatgat cctcgtcatc gtctggtcgc     60000
     tcttcggcgt ccagctgatc ctctacctgg cgggtctgca ggcggtgccg gcggatctgc     60060
     tggaggcggc gcggatcgac ggcgcgagcc ggtggcagac cttccgtgcc gtcacctggc     60120
     cctcgctggc gtccaccgtg acggtcgccg tcatcacctc ggggatctcc ctgctcaaga     60180
     cgtacgacgt ggtcgtgtcg ctgaccgggg gcggcccggc gggatccacc aagacgctcg     60240
     cctactcgat cctcgcagtc tccttcccgc agcgggacat cggcgtcgcc tcggcccagg     60300
     ccgtgctgct gatcgtcgcc gccgcggtcc tggccatcac ggtcctcgtc ctgcgcaggc     60360
     gggccgagga cgacgcggag tccatcggat gaagaaaaca ctcacctcgg ccgccaccgt     60420
     ccggggcgcg ttcgtctccc tggtgtccct cggcatgctc gtgccgatgt acctcctggt     60480
     ggtcaacgcc ttcaagagcc agcaggagat cctcgccaac ccgttctcgc cgagcttcgg     60540
     cacggcgacc ttccagtacc tcgccgacgc ctggaacaac cccgacttca gcatcctcaa     60600
     gggctacggc gtcaccatcg cgctggtgct ctgtgtgaac gccctcgcca tggcggtgtg     60660
     cgcgcccgcg gcgtacgtgc tggcccgcac gccgaagccg atctcgcggc tgctgctgtt     60720
     cttcttcatc gcgggcatgt tcatccccac ccaggtgatc ctggtgccgg tcatcttcgt     60780
     gctgcggggg atcggcctga tggggacgct gccggggctc atcctgttca tgacggcgac     60840
     caccatcccg ttcacgctgt tcgtgttctt cggctacatc cgggtgctgc ccaggtcgct     60900
     ggacgaggcc gcggccatcg acggggccgg ccggtaccgc acgctgtggc ggatcatcct     60960
     gccgttgatg cggccgatcg tcgccacggt cttcatcctc aactcgctca gcgtctggaa     61020
     cgacttcgcc agcccgcaga tgatcctcgg tcccggcagc ggcgtctaca ccgtcaccac     61080
     gggggtgtac gcggccgtcg gccagtactc caccgactac accaaggtgt tcccgaccct     61140
     gctgctcgcg gtgatcccga tcctggtgat cttcgtcgtg atgcagcggc acatcatgag     61200
     cgggctcgcg gcgggggcgg tcaagggctg accggcccgt gcccgtccgc gccgggcccg     61260
     tcacccgccc ggaagcgacc cgcttcgcga aggagtgacc tgccatgccc gcaccccgca     61320
     caccccgccg ggtggcgtcc gtgatccggc tgcgcccgga acacgccgag aggtaccggg     61380
     agctgcaccg tgcggtgcct gggccggtgc tggacgccct ctcccgcgcg cacgtcacca     61440
     actactccat cttcctgcgc gatcacaccc tgttcgccta cttcgagtac accggcgacg     61500
     actacgaggc cgacatggcc gccatcgccg ccgaccccga gacccagcag tggtggacgc     61560
     tcaccgatcc ctgccagcag cccctggact cggcgcagcc cggggagcgg tgggtgaccg     61620
     gcgcggaact cttccccctt tactgaccgc cacccacgcg aaggaacacc gtcatgccgc     61680
     acacccccac tcccccgtcc cccgaactcg ccggtctcgc ggccgtcgtc acgggcggcg     61740
     cgtcggggat cgggctcgcc acggccaggc tcctggcccg ccgcggcgcc cgggtcgccg     61800
     tcctcgacct cgcgccggac gccgtgccgg ccaccgacct cgaggccctg ctgcccgtcg     61860
     ggtgcgacgt caccgacgac gcctccgtcc gggccggcct cgaccgcgcg gtggacctgc     61920
     tgggcggcct ggacatcctg gtgaacaacg cgggcgtcgg cgcccagggg acggtcgcgg     61980
     acaacgacga cgccgagtgg caccgcgtcc tggacgtcaa cgtcctcggc atcgtgcgga     62040
     ccacccgggc cgcactgccc cacctgcgcg cctcgcggca cgcggcggtg gtcaacacct     62100
     gctcggtcgc ggcgaccgcg gggctgcccc ggcgggcgct gtacagcgcg agcaagggcg     62160
     ccgtgcagtc cctgaccctc gccatggccg ccgaccacat ccgtgaggga atccgggtga     62220
     actgcgtcaa ccccggtacg gcggacaccc cgtggataga ccggctgctg tcgagtgccg     62280
     acgacccggc cgccgagcgc accgcgctca acgcccgcca gccgaccggc cgtctggtga     62340
     gcgccgagga ggtcgccgcg gccatcggct acctggcgtc cccggcggcg gcgtccgtca     62400
     ccggcacggc cctcgccgtg gacggtggca tgcagggtct gcggctgcgc cccgacggcg     62460
     gctgaccgag gcacggcgca ccggaccggc ccccgcaccg caccccgcac gtcagtcgca     62520
     cgagaagcga cgaaagggca cccccgtgct ggaaacccgg cgccgaccgg cccggtccct     62580
     gtgggtcgcg gtcgcccggc cctgacggcg gggcgccgtc ggggccgcgt ggatcgcgca     62640
     gtgcgaccgg aacgtccccg cggcggggat cggacgaccg tgaccggctc agcccgcatc     62700
     gccgcgcggc cgaggcgccc gtgcgaggac gggtccctcg gccgcttcgt ggtgcttcct     62760
     acgcgtccgg cgcgtcggcc gggcggcggc gggcccacga cgacgtgatg tgctcgcgca     62820
     tcgcctccgc ggccgcgtcg ccgtccccgt cgagcaccgc ggcggcgacc cgggcgtggg     62880
     cctggtgcgt cagctcgatg tcctcgcgcg tcgggtcccc gctgtactgc ggggagcgca     62940
     cggccttgcc ctggatgctg gagacgatgg cccgtccgaa cgcgtcccgg gaggcgtggt     63000
     ggatgatctc gtggaactcg atgtccgcgc gcgagtaggc ctcgggatcg tcgatcaggc     63060
     ccgcgagttc gtcgagcttg gccgagagcg ccgccgactg ttcctcgtcg atgcgcccgg     63120
     cggcgcgggc ggccatcgcg cactccagag tggtcctgat ctcgatcagg ttgtccagat     63180
     agaccaggcg gtccgcgcgc tggaacagcg cgtcgaggac cagcgggtcg agcaggctcc     63240
     actggtcctg gcccagaacg acggtccccc agccctgacg ggtcgccacc agccccttct     63300
     cggcgagcgt cgtcgtcgcc tcccggatca cggtccggct cacctcgtac tcctcgcaga     63360
     gctcacccgc cgacggcagc gcggtgcccg gcgggtactg gccgagcacg atggccgtcg     63420
     cgaggctctg gacgacggcc gcagcgagcg gcggccggcg tcgttgaggg cgggacacgg     63480
     cggtggtgtc cgcggatggc ttgatcatct ggtcagagac tcccaatgtt cgtgcaggtt     63540
     cgcccggccc ccgctgtcca atgaccccag gttagccgaa catgctaagg tcatcactcg     63600
     tatcacaagt tacgactcgg tcgtgggaga cgcgatgcgc atcaccggat accggtccct     63660
     tgccacggtc cacgagtggg ggcgaccggt gggcgacgtg aacggcgtcg tcaccaccgg     63720
     tgtcaccgag gtgccggtgc tgctgctgga gacggacgag ggcctgaccg gcgtgggcct     63780
     cggcggccac gccgacgtgg agcgggtctt cccggcactg gagggtcagg acccccgggc     63840
     ggtcacctcg ctctacgaca ggatgctcgc ccacgtcttc aagtccgggc acggcgggca     63900
     cgtgttcgcc acgatcggcg ccctcgacat ggcgctgtgg gacctcaagg cgaagatcgc     63960
     ccaggagccg ctgtggcgga cgctgggcgc cgccgaccgc ttcgttccgg gctacgcctc     64020
     cggcctggac tacgcgctga gcgacgacga actcgtcgcg ttccacgggc ggtgggcgcg     64080
     gcgcggcttc acgggtgcca aggtcaaggg cggcctcgac gtggaccggg acgtacggcg     64140
     cctggcggcg gtccgcgacg tgttccgggt caacagcgag cgccccgcgc tcatgtacga     64200
     cgtcaacgag tgctgggggc gccaccaggc ggtgcgcctg gcccggcagg tcgaggagcg     64260
     ggtcgaactc acctggatcg aggaaccggt ccggcgctgg gacgtcgcgg gacaccgcgc     64320
     ggtcgcgacc ggcatccgtg ccgccgtcgc gaccggggag aacctgacgg gtctcgagca     64380
     cttccgcccg ctgctggccg cggacgcggt gggggtcgtg cagaccggcg ccgtgtgggg     64440
     catcacccac ttcctgcgcg tctcgacgct cgccttcggg cacggcctgc cggtgagccc     64500
     cgtcgggtac aacgccaacc cggtcgcgca cgcggcggcc gccgtgccca accacctggt     64560
     gaccgaggtg caggacctgg ccttcccggt cgggttgcgg gtggaccagg agatcgccga     64620
     cggcgggatc gtcctcggcg acgccccggg actgggcatc gaggtcgacg aggagcggat     64680
     cgtcgcacgg gccgcgtcgg gcggatggtc cctcccgtcc ggaccgcacg tccgtccggc     64740
     cgacgccggc ctaagactcg cgccgcaggc gcggtgagac cgcatcgggg gcacgtcgag     64800
     cgcgccgagg gcgcgtggag ggagcagcac atgagcatgc ggaaggccct ggtggtccgc     64860
     ggcgggtggg agggccacga cccggtcggc tgcaccgagt cggtcatgcc cgcactggag     64920
     cgcgcggggt tcgaggtcga gatcgccgag gacctggcgg tgtacgagga cccggggctg     64980
     ctcgccgcca ccgacctcgt cgtgcactcc tggtcggcgg gcgggctgac ggcggaccag     65040
     gaggcgaacc tggtcgacgc ggtggaggcg ggcaccggct tcgccggctg gcacgggggc     65100
     gtggtggcca cgaacgtcgc caatccccgc tacctgcgga tggtcggagg ccgcttcctg     65160
     tggcacccgg acggcttcaa ggagttcacc gtgcggatcc gcgccacccc cgaccgggac     65220
     ggcgagatcg tcgagggggt cacggactac gacgttcaga ccgagcacta ctgggtgctc     65280
     acggactccc tcaacaccgt cctggccacg tccgtgctca ccccgggccc ggccgacccg     65340
     tgggacgaac ccgtcgagtt ccccgtggtg tggacgcgcc ggtggggcgc ggggcgggtc     65400
     ttcatctgca ccctggggca ccgcgtcgcg gacctccggg tgccgcagac ggcggcgatc     65460
     gtcggccgcg gactcgtctg ggcggcgcgc gggtgaggcc cgggggtgcc cgggccgccc     65520
     ggcgctcccg tccgcgacgg cccggcacgc cgcccgtgtc aggtgctctc gcgcgcgacg     65580
     acccggtggc ccacgtcccg gtgcgggacg tcgaccgcgg caccgcgcat ccgcgccagc     65640
     agcagctcgg cgcccaactc cccgatccgc gcgctgggta cggccaccgt ggtcagcgcc     65700
     ggaaccaggt gccgggccag ttcgaagtcg ccgaagccgg ccacggcgag cctgcccggc     65760
     acgtcgatgc cgcgccgtac gcaggcctgg agggcaccgg cggcgaagac gtcgctggag     65820
     aacatcaagg cgtcggagtc cgggtacctc tccagcgcca ggtccagcag ggcgacgccg     65880
     gtgtccatgg tgaccggttc gggaccggcg tccacggtgc gcgcctcacc gcccagcagg     65940
     tcccggacgg cgccggtgta gccgtcgagg cgttccgcgg cccgggggtc gcccgaggtg     66000
     tgccgcccgg cgaaggtgat ccgccgccgg ccgcgctcca cgaggtggcc caccatcgcc     66060
     gctgccgccg ccgcgttgga gaagccgacc agcaggtcca ccgggtcgcg ggaccagccc     66120
     caggtctcca cgaccggcac cccggccgcc ctgagcagcg tcagcgtgcc cggggtgtgg     66180
     cgggtcccca ccatgagcag tccgtccggc cgccggccca ggaagctgcg cagcacctcc     66240
     tcctcgtgct cgggccggta gtcggtggtc ccgacgaaga tctggtagcc gtgggccgcc     66300
     agcgccgtgg agaaggcgtg caccgtgtcg gcgaagaccg aggcgttgat ctgcggcacc     66360
     agggcggcga ccgttcggct gcggttcgaa gccaggttgc tggcagccag gttgggcacg     66420
     tagccggtgg ccgtgagggc cgcctggacc ctcgcgcgcg tctcgtcgga caccgacagg     66480
     gggtcgcgga cgacccggga gaccgtctgg gcggacaccc cggcggcggc cgcgacgtcc     66540
     gacagggtca ccgaacgggt cgcggagcgt ttgcggggac ggcggggcgg cggctggctc     66600
     acgccggaaa cgatatcggg cgtcacaggg ctccccgcgc caccagcgcc cgcatcaggt     66660
     ccgcgatgcc gaacgtccac ggcacgcaga cgtcgctcgg ccggatccgg ttggcgagcg     66720
     tgcccagctt cggcgtggcg acggcgacga ggtcgccgtc gtgatgcgtg aacccctgcc     66780
     cgggcacgtc gcggtcctcg acgggcgcga acatggtgcc gaggtagagc accgcgccgt     66840
     cggggtactg gtggtgcggg cccagcaact gcgccacgag gtccaggggg tcgcggctga     66900
     tggcggccat cgaggactcg gcgtccagcc ggtagccgtc ggcgccctcg acggtcaggg     66960
     tcaccgtggc ccgccgtacg tcgtccatgc ggaagcccgg ctcgaacagg cgcaggaacg     67020
     ggccgagggc ggccgaggcg ttgttgtcct tggcctgggg cagcagcagt gcggaacggc     67080
     cttcgacgtc gcggaggttg acgtcgttgc cgagtgtcgc gccgaccacg gccccggtgg     67140
     aggagacggc cagcaccacc tcgggctccg ggttgttcca gcgcgaggcg gcgtggactc     67200
     cggcgtcggc gccgctgccc acggcggcca gcacgggcgc cttggtgaag atctcggcgt     67260
     cggggccgat gccgacctcc aggtactggc tccacgcccc ctgcgcgacc aggagctcct     67320
     tgagcgcggc ggcctcctcc gagccgggcc gcagggcggc caggtcgtcg ccgacgagcc     67380
     ggcggatccg ctcccgggcc tcggcggcgc ccgcggcgtc cccgcggacg cgttcctcga     67440
     tcacccgctc cagcatcgag acgacgaagg tgaccccggc ggccttgacg gcctgcaggt     67500
     cgaccggcgc gagcagccac ggccgtcgcg ggtcccgggt gtctacgggc gtgttggcca     67560
     gtacctcgtc gagcccggcg atccgctcgc cgcgggcggc ccgcaggcgg gcggcggggt     67620
     ccggcgtctc gcacaggtcg cgcacggtcg ggaaggccgc ggtgatgtcg tgcaggccgt     67680
     cctcgcggac ggccacgacg gacggcccga ggccgggacg ccagacgcgg ccgacgagcg     67740
     cgcccccggt tccgtcggcg ggcagggtgg tcgcggcgtc gggccactgg ttcatcggat     67800
     tcccttcgtt gttgccccgg tccgtcccga acggcgcgag gcggtcgggg cagggacgtt     67860
     gacactgcga gcggcgccag cctagcgtgc atgttagcgc tatcgatagc gctaacaaca     67920
     ggataaggag tcccatggcc tcgcgcgaca aacccggcgt cctcgccggg taccgggtcc     67980
     tcgactgttc catcgccatg gccggcccgt tcgccgccca gcgcctgggc gacctcggcg     68040
     ccgacgtcgt caaggtcgaa ccggtcaccg gggagtggca gcgccacgcc gcggccggcg     68100
     gggcgggagg caaccggatc aacgtctcct tcctctccct gaaccgcaac aagcgatccc     68160
     tcgccgtcga cctcaaggat ccggcgggca aggaggtttt gcgccgtctc gtcacgaccg     68220
     ccgacgtctt cctccagaac taccgccccg gcgtcgccga ccgcctcggc gtcgactacg     68280
     cctccctggc cgcgatcaac ccctccctcg tctacgtctc catctccggg tacggcgagg     68340
     acggccccta cgcccggcgt ccgggccagg acctgctgtt gcaggcgatg tcgggtgcca     68400
     tgctgtccag cggccgcgcg ggcgaggcac cgcgggccgc gggccagtac ctcgtggacg     68460
     ccgtcaccgc ctccaccgcc ttcgagggcg tgctcgccgc actgctgcac cgcgaacgca     68520
     ccggcgaggg ccagctcgtg acggtgaaca tgctcgacgc cgtcaccacg ctccagatgc     68580
     aggaactgtc ggtccacacc gtcggcgggc tgccccagac ccgctccgcc gaaccgcacg     68640
     cccacgtcta catccgctcg ccctacggcg ccttccagac ctccgacggc tatctggtcc     68700
     tggccttccc gccgttgaag aggctcggcg agatcctcgg cgaggacacc ttcctggcca     68760
     tggaggacga ggagcacggc tggacccacc gggacgagat cttcgcccgc acggccgccc     68820
     ggctgctgac ccggccctcg cggcactggc tcgacgcctt cgccgccgcc ggcatctggg     68880
     cgggccccgt ctacggctac gccgacctgg tccaggaccc ccagatccgc cacaacggca     68940
     ccttcgtcac ctacgagcac cccaccgagg gcagcgtgac cgtgcccggc tttccctaca     69000
     agttctccgc caccccgccc cgcatcgacc gcggcgcccc gctcgtcggg gagcacaccc     69060
     gcgaggtgct gagcgaagcg ggcctcacgg aaggggagat cgaggaactc ctcgccgccg     69120
     gcgccgtgac ggagacggcc tcatgacgca cattggcgcg ccctaccgcg gtctcacctg     69180
     ggaccacccc cgcgggtacg acgcactggc cgcgtgcgcg ggtggcctcg tccactggga     69240
     cgtacagccg ctggagggct tcgagtccca ccccgtcgac gaactgtgcg cccgctacga     69300
     cctcgtcgtc ctcgaccacc cgcacctcgg cgaggcggtg gtcaccgggt gcctgcggcc     69360
     gctcgacgac ctgttcaccc cggcggaact ggcccgctgg ggcgccggct ccatcggccc     69420
     caccatgcgg tcgtacgcca tggacggccg tcagtgggcg ctgccgctgg acgccgccac     69480
     ccaggtcgcc gccacccgga ccgacctcgt cggtgagccg cccggcacct gggacgaggt     69540
     acgccgcctg gcccgccggg cccccgtggc cctgtccctc gccggcccgc acgcgttcct     69600
     caccttcgcc tccgtcgcgc tcgccgtggg cgaggaaccg gccgccgacc cggaccagct     69660
     gatcggcgac ggcacgggac tggcggtgct cgacctgttg gccgacctcg acgccctcgc     69720
     cccgcccggg acccgcgaac tcaacccgat cggcctgctg gaactcatgg ccggcacgga     69780
     tcggctggca cactgcccgc tggtgtacgg ctacgtcacc tacgccgacc gcctgacctt     69840
     caccgacgcc cccgccgtga ccgcgggcgg gcgcccgggc tccacgctcg gcggcgcggg     69900
     catcgcgctc agcgcccgct gcgtgccgtc cccggaactc ctcgcccaca tgcgctggct     69960
     gatgtccccc gaggcgcagg gcgacttcct gccccggcac agcggacaac ccagcgcccg     70020
     caccgcctgg acctccccca agaccgtcgc cgccgacttc taccgacgca ccgccgccac     70080
     ctgcgagcag gcctgggtgc gtccccggca tgccggatac atcggcttcc agaccgccgc     70140
     gtcggccgcc gtacgcgccg cgctcgcggg cgagaccggc caccgtgaag cactcgaccg     70200
     gatgcgcgcc ctgtaccgga cgagccggac agcgaaggaa ccccagacat gagcgacact     70260
     ggccacctcc cgccgcccga cctcggcacc gacctcgtcc tgctggacgt caccgaccgg     70320
     gtcgccatcc tcaccctgaa ccggcccgcc aagctcaacg ccgtcacccc cggcatgtcc     70380
     cgggccctgg tgcgggccat cgagtggtgc gacacgaccg acgaggtccg ggcactcgtc     70440
     gtcacggggg cgggcgaacg ctccttcagc gtcggctcgg acatcggcgc actcgaccag     70500
     tacgccaccc cgtgggactt ccgcaaccgc gtcgactact gcgacgccat ccgcgccgcc     70560
     cgcaccccga ccgtcgccgc ggtcggggga tacgccctgg gcggagggct ggagaccgcc     70620
     ctgtcctgcg acatccggct cgccgcggac accgcgtcct tcggcgcacc ggagatcacg     70680
     ctcggctgga tcgggggcgg cggcatgacc gccttcctca gccgcgcggc cggcccgggc     70740
     aacgcggcac tgatgctgct caccggcgaa cgcatcgacg ccgaacgggc gttggcctgg     70800
     catctggtga gcgaggtcgt gccccgcgcc ggtctgctcg accgggcccg cgccctcgcc     70860
     gccgtgatcg cctcccgcgc cccggtggcg gccgagacgg cgaagatcaa cctgcgggcc     70920
     gccggaaacc tgcccgagga ccaggcgctc gcctacgagc gcgacctgca gaccatctgc     70980
     ttcgccaccg aggacgcggc ggagggcagg cgcgcgttcg ccgagaagcg ctcccccgtc     71040
     ttccacaagc gctgagagga acgtcatgaa gcaaccccga gccgcactcg tgaccggtgc     71100
     cggaggcgcc ctcggccggg ccaccgccgt ccggctggcc gccgacggcc acgacgtcgc     71160
     cgtactcgac cgcgacgccg agtccctgga gcacaccgcc gcgctggtcg agaaggcggg     71220
     cgcccgcgtg ctcgccctcg gcaccgacct gcgcgacgcc ccggccgtgg cggcggccgt     71280
     cgagcggacc gtgaccgacc tgggcccgct gcgggtgctg gtcaacaacg cggccgtgta     71340
     cccgagccgg gccttcctcg acgtaccgct cgccgagtac gaggaggtgg tggcggtcaa     71400
     ccagcgtgcc tactgggtcg ccgcccaggc tgccgcgcgg cacatgacgg gcacgggcgg     71460
     cggggcgatc gtcaacgtcg cgtcgatcac cctccacggc ggctgggact cgctggccgc     71520
     ctacgtctcc accaagggcg ccgccgtcgc cctgacccgc gccctcgcca gggagctggg     71580
     tcccgccgag atccgcgtca actgcgtctc ccccggggcc tttccgactg cggcggagga     71640
     gatccacgag gaccccgacg cctatcggcg gcacgtactc gaccaccagg ccctgaagcg     71700
     gcgcggacgg cccgaggaac tggcctcggt ggtgtccttc ctcaccggcc ccgacgcctc     71760
     gttcgtcacg ggccagtgcg tcgaggtcaa cggagggtgg gtgatggcgt gaagctgtac     71820
     ggacgctccc acgaccggca gtccctcgcc cggcacgcgg gcgacctgag cgcggcgggc     71880
     ggggtgcgcg ccgtcgtcct ggacgacggc tccgaacgcg gcatccgcac gctggagttc     71940
     cggaccggcg gcgggctgtc gttcgacgtg ctggtggacc gggcgatgga cctcggcggg     72000
     gccgagttcg agggccgggg cttcggctgg cgctcggcga cgggcttcag gcacccggga     72060
     ctgcacgaat accgcgacga cgacggcctg tccatgatgc gcagcttctc ggggctgctg     72120
     ctcaccgcgg gcctggacca cacgctcttc ggcgccgagg tggacgcctc ccagtaccgc     72180
     tatccgccgc ggggcacggc ggtgcacgcc ctccacgggc gggttgccaa cctgccggcc     72240
     cggctgaccg ggtacggcga gcggtggcag gaagacggcc gctgcgtgct ctgggcggag     72300
     ggcgaggtgc gccaggccgc gatcttcggg gagcacctga ggctcacccg ccgcatcgag     72360
     gccgatctcg gcggcagcga gatccgcctg accgaccggg tgcgcaacgc cggcttcgac     72420
     ccgacgccgc acatgtacct gtaccacgtc aacgtcggct ggcccttcct ggacgagggc     72480
     gcccgctacg agctgccgcc gcaccgcacc ctgtggcgca gcgacagcgt cgccgagcag     72540
     ggcgtgtccc acaccgcgat gcccgccccg ctgccgggct tcgtggagca ggtctacgaa     72600
     cacgaactgg agccggacgc ggcgggcctg gcccggcccc gcctggtcaa cgaacgcctg     72660
     ggtgtctact tcgagttgga gttcgacacg gtccggttcc cgtccttctt ccagtggctg     72720
     cacctgcgcg agggcgccta cgcggtcggc ttcgagccgt ccacccacca tgtgcagggc     72780
     gaggccgcgg cccgggagga cgggtccatg acgttcctgg cccccggtga ggagcgggag     72840
     tacaccaccg cgttccgggt gggccacctg gactgaccac cggaagcgcg gtgcgcgcgc     72900
     ggatacgggg acccggcgcg tcaggacgcg cgccgggtcc ccgtacgcgc gcgtcccgtc     72960
     agccacgccg ccgtcaccag cagcgcgggg agcagcggtg cggcaccggg cagcagacgc     73020
     tcaagcagcg cggccgcggc cgcgcccagg atcagcagtg ccgtcgtgac cagggcaggc     73080
     cactggacgc gcccggacgt caccgcgtcg gtgacggccc ccgtcagcag gcccgtcagg     73140
     tacgcggtcg gcacctgcgc gcccatcgcg acgcggacac cggcgttctg gcagcccatc     73200
     gcggccgcca gaattcccag catcgccgtg cgctccccgc ccgtcgggtc cccgcccgcg     73260
     gcaagccacc acgccacgac ggcccacagc aggacgagtt cgagcagcag gaagtcggcg     73320
     ggacgcaggc gtccgccccg ttgcgcgtgt cccgccgccc agccggctcc cgccgcgccg     73380
     agcacgtagc agaccaccgc gacggcggcc agcgcgccga gcctcggatc cgcgccgccc     73440
     aggccgaccc cggtcaacgc cgagttggcg gtgaccacgc tggtgaagac gccgccgagg     73500
     gcgaggaagc cccaggcgtt gacggcgccc gcggaaaagg tcagcagccg cgcggcccac     73560
     gtgtccgcgc gctgccgtga ccccggtggc gggtcccgac gccgattgcc ctccgtggtc     73620
     ctctcctcgc ctcgtccggg ccccggacgg aatcctcgcc gaccgacgtg acggcacggg     73680
     ccgcgacatg ccgggcggcg gggcgaccgc ccgggtaggg ccggccgccc cgcctggccg     73740
     gtggcccagg gggtgtcgtt tggatcttgc cggggtcgcg gggtctggta cgcacatctg     73800
     cggcgttgtc gtcggttgcc agggcttggc cctgtcgccc tcctccgcct tgcagctgca     73860
     cacaccagac cccgctcggg ccggccacaa ggcaccgtcg gccgcggccg ccctgatccg     73920
     aacgacaccc cctagctgtg ttgtcccggg acgttggtga cacgcgtgct gggttcttga     73980
     aatgggtgag ggcctccagg ttcggtgtgg attgcgacat ctccaccgag ttcaggaggc     74040
     cctcgtggtc caccgtaatg ccccgctgac cgagaccggg agactccgcc tggcccgctg     74100
     cgtcgtcgag gacggatggc ccgtgcggcg ggcggccgag cgtttccagg tcagccacac     74160
     caccgccagc cgctgggccc gccgctaccg gcagctcggc gtcaccggaa tgagcgaccg     74220
     ctccagccgc ccgcaccacc agcctcgcag gaccgcggcc gccgtcgagg agcacgttct     74280
     ccggctgcga cgcgagcacc ggatcgggcc gctacgactg gccgtccgat gcggcatcgc     74340
     cgcctcgacc gcccaccgca tcctggtccg gcacggcctg ccgccactgg ccgccctgga     74400
     ccgggccacc ggcgagcccg tccgccgcta cgaacgcgcc cgacccggcg aactggtcca     74460
     catcgacgtc aagaagctgg gccggatccc cgacggcggc ggccacaaga ctctcggtcg     74520
     ggccgaaggc caccgcagcc ggaccaacgg cgccggctgg gcctacctgc acaccgccct     74580
     cgacgaccac agccgcatcg cctacaccga ggacctgccc gacgagaccg ccccgacctg     74640
     cgctgccttc ctcgtccggg ccacggccta cttcgcatcc ctgggcatcc gcatcgaacg     74700
     ggtcctgacc gacaacgcct gggcctacag caagaacacc tggcggaaca cctgccgcga     74760
     cctggacatc agcccccgct ggactaggcc ctggcggccc cagaccaacg gcaaggtcga     74820
     acgcttccac cgcaccctgc tcgacgaatg ggcctaccag aagccctaca cctcagacca     74880
     cgaacgcagg gaagcgttca cccactggct gcactggtac aactaccacc gaccccacac     74940
     cggcatcggc ggccacacac ccgccagccg cggcaccaac ctctccgaac aacacaccta     75000
     gcggccgcgt tccatggtcg accggaaggt ccagtggccc gatccgacct cgtacacggc     75060
     ctcccctccg gtcaggcgca gcagtcgtgc cgatccgggc gcctcggcgt gctctccggc     75120
     gaccggcacg tgcacctcgg cggtgctgcc cgcggggacg tccacggtga gccggaagcg     75180
     gtcgtccgag cgttcccagt cggtgcgtgc gacgccgtag ggggtgcggt aggagcccgc     75240
     cgcggaggtc atgtcgccct ccaccgccgg gtcgacgagg agcttggcgt agccgacgga     75300
     gtcctcggtc tgggagatgc cggcgacgcg ggtggtgaac caggagtcga tggcgccgag     75360
     catgaagtgg ttctgggact ggcccggtcc gccgtcccag gactcgccca gggtggtgtt     75420
     gcccgcgagt acctggtagc cgtagctggg gctggtcgtc tgcgtggcga tggcgtgcac     75480
     cacgtcgtcg cggtccgcgg cgctcagcac ccggaaggcg gcgggcagtg agatctcgcc     75540
     caggaccagg tggttcccgg cgtccttgat cgcgtcggtg aagtgggaga gcagtcggtc     75600
     ccgctcgccc tgcgggtagg cgcccatgtc gagggcgagt gcctcggcgc cgtgtccgcc     75660
     gccgccgaag gtgcccgtgg tggcgtcgta gtacttcgcc gtcagtgcct cgacgctcgc     75720
     ggcggccttg cggcggtact cgtcggccgc ggcggtgtcg ccgaggagcg aggcgatgcg     75780
     gccgagggtg tcgacgaccc gccagtaccc gtaggtgccc gccacggcgc gcgggaaggt     75840
     ccggtcgggg gtgaaccagt cgcccaggcc gtagtcgagg atgccgtcgg ctgcctgggc     75900
     ctccaggaag gcggcgtagc gccgcatgtc cgggtagtac gtctccaggg tctggcggtc     75960
     tccgtaggtg aggtagagct gccaggggac gaggacgaag gcgccgcccc agttggagtc     76020
     gttgcggtag gcgcccggga gactggtgta ctccgggacg gtgctcggga ccagcccgtc     76080
     cggcgtctgc gcgtcggcca tgtcccggac gatcttgcgg aggtaggccc gcatgtcgta     76140
     gttgccggcg agggcgggga agacgagctg gttctgttcg agccagccga gcttctcgcg     76200
     gctcgggcag tcggtgagca cgctcatcat gttgccctcg atcgagcggc ggatcagcga     76260
     gtggatgccg ttgatcagcg ggtcggagct ggtgaagtcg ccggccgagg cgttgtcggt     76320
     gcgcaggacg tgtccgcgga cgctcaccgt cgcgttctcg ggcaccccgc gcagctccag     76380
     gtagcggaag ccgtggtagc tgaaccgggg gtgccagctc tcggcgtgcc acccgcccgc     76440
     ggtggtgtag ctgtcccaca gaggggcgcc gacgttgctg atggactgga aggcgtggcc     76500
     gtccttcagg ctctccgccg ggtacacgcg gatcgcggtg ccctcgggcg cgcggacggt     76560
     gatctcgggc cagcccgcga tgttgcggcc caggtcgaag acgcggctgc cctcggcgcc     76620
     gtcgacctcc ttgcccttca gggtctccac gacgcggatc ggctcggtct cccgggcgct     76680
     gagcagggcg ggccggtcgg cggtgccggg gcccgccacc gcgaccgcgt gccgccagcc     76740
     gcgccggtcg ccggcgggtt cgtcccaccg ggggatctcg cggcgggcgt cgtagtcctc     76800
     gccgccgtac cagttcgacg cggtggtcgg gcccagcgtg gtgcgccagt cgtcgccgct     76860
     ggtgatcgtg cgcacccggc cgtcggccag ggtcacttcc agccgggcga tcagtttggg     76920
     gtcgctgagg ttgccgtaga gcttgcggta gcggtcggcg gtgctgacga cgttggacat     76980
     gccgttgccg agggcgacac cgagggtgtt ggcgccggtg cgcagccggt cggtgacgtc     77040
     gtaggtggcg tactggacgc gttcggcgaa gtccgtgttg gccggttcga ggaccgcgtc     77100
     gcccaccggt tcgccgttca cggtcgcgtc gtacacgccc agcccggcga tgtagaggcg     77160
     ggcgctgcgg acccgcttgg gcagggtgaa gtcgtcggtg agcaggggca gcccggcggg     77220
     caggtagggg gtgggctgcc gttggccggt gactgcggcg agccgtgtgg cgggtccgtc     77280
     ggcgctgtcg gcggcggaga cggtgtagtc gacaggcagg ccggggatcc ggccgtcgtc     77340
     ggtgaggacg tcggcgcggg ggtagagcgc cacctcgtcg aaggtcttca cgctcttcag     77400
     gtcgagggtg agggtgatcg gcgcgtcgga gacgtccggt ccggtgtgcg cggcgctcgc     77460
     gtagcccgcc gcggtctgca gggcgctgtt gggcaggccg tcgacggcga gggcgggttc     77520
     ccagctcttg cgtacggtgt tgctctcgga cgccgtgacg gcggcgccgc gggccagccc     77580
     ggtggtggcg gtcgtggagt cgcggacgtc gatctcgccg acctggaggc gccaggtgcg     77640
     gccggggaag gactcggcga gcggcaggcc gagccgggtg acgtcgagtc gtacgtagcg     77700
     ggcggtggtg cgggggaggt ggacgacgac cggttcgacc gtccggtcgc tcaagcgcca     77760
     gtcggggtgg gtgatccact gcgcgtccca gtccgactgc cgggtcagac cggtctcgaa     77820
     cacggcggtg gtgctccagc cgctgtgccg ctttcccttg ccggaccaga gcatgacgcg     77880
     ccagtagacc ttcgcccggg agcccgggtc cttgcccgcg taggtcgtcc cgggcacgga     77940
     cgactccacc ttcccggagt cccagaggtc ggggcgggag gcgcgcagcc gctggaggga     78000
     ggtggcggcc tggacgcggt aggcggcctg gcgcgtgttc ggggcgccgg cggtggtctg     78060
     ccagctgagg tcgggggtgg tgtcgtcgat accgagggcc tcggtcaggt gctgggtgcg     78120
     cagcgccgtc ggggtgatgg tgccggtcgt cgcggcgtcg gcggtgaccg cgccggccag     78180
     cagggtgacg aaggcggtga caccggcgag ggcggcggcg gtccggtgtc tgacgggtgg     78240
     gttcgttctg ggcatggcgg ctccttgggg cgggtggtcg tgaggtcagc tgcggcgcag     78300
     ttcgacggtg gtccggctcc ggaagcgcag ggtcaccggg ccgagcaggc cggacggcag     78360
     tggcttcttg cgctcgttgg acagcgtgtt ggcgacccgg acccgcagcg tgttgcgccc     78420
     ggccctgacg tgccccgtga cgtcggccgc gaacggggcc cacagcagcg gcggcagcgc     78480
     ggtgccgttg acggacacct ccgcgacgtc gcggacgtcc ccgaggtcca gcacgacgcg     78540
     gcggccgcgc agccggtcgg cgtcgacatc gatgtcggtg gtgtacgtgc cgctgcccga     78600
     gaacagcgcg tcgtgctccg tccagctgcc caggggcgcg gtgacgggct ccgcgccctc     78660
     gcgttcgaag gtgagggtcc agtcgccgtc caccgggacc ggggtgagcg tgtcgtcgat     78720
     gcgcacggtg ccgtggtagc ggtggccgcc gtcggcgccg acgagccggt gggtcccggc     78780
     cgccgtcgcc tccaccgtgg cgcgcagggc gttgccgtgg cgtgtcacgg acaggacggg     78840
     cagggtcgct tcggtgaggt ggggccggtc gcggtggccg ccgcggacca cgacgacggc     78900
     ggtccggaag ggctccaggt ccagcgggac ccgcacgccg ttcttggtgg cccggtacac     78960
     gggggcggtg ccgccggtgc cggtcgcggg gtcccagatc tcgggcacgc cggtggccgg     79020
     gagagcggcg gcggtgcgca cccgcgcgcc gctctcgttg ttgatcagga agacggtgtc     79080
     ggggccccgg cgcacccgca gcacccggac ggcgtcctgg ggcggttcga gcacggcggc     79140
     ggccgtgccc gcttcgacgg cgacggctcc gagcgcgccg gtgtccgcga cccggacggc     79200
     gtgcccgcgg cccagcggcc tgcgggccgg tgtccggttc ccgaacaggt cggcgagtcc     79260
     gtgggcgagg gtgcggtcgc cgccgtccgc ctcctcggtg tccagggcgc ccaccgcgat     79320
     cacggtgccg ccggtccgga cgaactcccg cagcacgcgt acgccgtcgg cgtccaggac     79380
     cggcgtccgg gggatcacga cgaggtcgta ggcggccgct ccgacgacga ggcgtccctt     79440
     gcggacctcg gcgtgggcca gcagcgcggg gtctcgggtc agggcaccct cgtgcagcag     79500
     gtcgaagtcc acctgggcgc gctccagggc gtaggccgcc tcgctgagcg ggccgtccac     79560
     gtcctgctgc cggtccgtgc cggtccactg ctcggcggcc cgctgcggct ggagcagcgc     79620
     ggtgcgggcg gcggaggtgc cgcggccggc ctccatgacc cggccgatcc actcggcgag     79680
     cggccgcatg gcccaccacc agggggcgcg cggcccgaag ggcggcggga agtacacgcg     79740
     actctcgtcg gtccacaggg cgtgcagcac cgtcaggttg acaccgcggg cggcctgcgc     79800
     gccgacggtg gcgtgcacga agccgggggt gacctgccag cccatgttgc cgaacatctc     79860
     cagcagggcc cgctcgcggc ccatctggtg ggccacggac accgggttgc gcgggatcat     79920
     ggtgggctca ccggccacgt actcggcggt gatgatgtcg ccgccgggca cctgggccca     79980
     ttggttgacc ttgtgcaggt cgcccgtgga ggggatgcgc ttggcggggg cggtctcgtc     80040
     gtagagcggg ttggtgatca gggcgacgcc gcgcttctcg taccactggg cctgcttgcg     80100
     gaaggcggtg gcgaagcggt cggagacggc cctccagtag tttccgcggg cgatgcggcc     80160
     ggagcggccg aggtcgtcga aggccgcggc gtaggcggtg ccgggggtgg ctccgacggt     80220
     gcgcagggcc cggtcgagcg ccggtgacca gggcaggcgc ttgaagtggg cctcggccga     80280
     cgcgaagaag ggctcgtcgt cccagaagcc ggggacgacc gtgccgaagt agtggccgaa     80340
     ccggcggtgg tactcacccg ggacgatgtc caggaacagt tcgacgggtt cgtcgtcgag     80400
     caggtcgacg tagctgcggc tgtagccctg gctgtcgtcg gcgaggagca cgccaccgaa     80460
     gaggtcgacc tgccactccc ccgccgggac gtgccaggtg tggccgccgg tgagccggtc     80520
     ggtcaggtcc acgacgtcgg tggcggcggt ggctgccgtg ggccgggcgg ctgcggccgc     80580
     gagggtgaac cccgctgtcg acagggcgcg ttcggggaag tcgcccgcgg cggcggagcg     80640
     gtcgaaggcg ccggtgtaca gggtggtgcc gtcggccgcc tcgacggtga ggctttccca     80700
     gacggcacgc tggtcgccga cggcgcgcac cccggccccg cccgcctcct cggccaggtc     80760
     cgccacggtc cccttgtccc tgccgtcgag ggtgacggag aggccgccgt cgcccagagt     80820
     gatccggagg gtgtggaact tggtcttgtt gaagccgtcg gtgcgggggc tgcgcagcag     80880
     ctcggccggt tcggcaccgt cggtcagccg ctccacggtg accacaccgg tctggtcgaa     80940
     ggacacggcg tatccggtgc gcccgtcggc cgagccccgg acgaggagtc ctgcggctcc     81000
     gtgctcggcc ttcgcgctgc cggtgacggt gcagtcgccc cactccgcgc tgtccctgag     81060
     gacggcggcg ccgtcgagga ccgcggcgtc cgcgaccagc cgtcccgcgt ccacgccgac     81120
     gccggtgctg cgcctgaggt cgatcgacgc gggcccgcac accacggtgg tggagcgggc     81180
     gagtgccttc aggcgcaggt cgggccgggg ggcgtaggtg cgggtgccga cctggccgcc     81240
     cttgacgatg aactcgccgg cccgtccgct ggggaagtgg tcgtcgttga acaaccagac     81300
     gcgcatgccg gtgcgttcgg cggtgcgcag cacgtggccc acgatgtcga accactcctc     81360
     ggtgaagaac accggcgtca tctcggcgtt gtcgaaggag aagaggatca cctcgtacat     81420
     gcccttggac ctcaggtccg cgagctggcg gtccaccagt tcgggcgtga cggggccgtt     81480
     ccagtaccag tacacggtgg gacggctgtc gtggcgcggg tcggcgaagt gccgggcgga     81540
     ccaggcgtgc cgctcctgcc cggccggtcc ggccggtccg gccggtcggc cggaggcgtg     81600
     ggccgcgtcg ggcaggccga cggcgacgag ggcgccggtg gcaccggccg cggccacgaa     81660
     acggcgtctg gacagggggt gttcgggcat ggctgtgctc ccggttggtg gtgtgctgcg     81720
     gaggcccgcg gcggggccgc gctggtgtga tcagccctgg gcgaggcgcc gtacctggtc     81780
     ggcggtgagg acgcggttgt gcagccggaa gtcgcggacg gcgccgtgca ggtacgggtg     81840
     ggtgctgttc tgggaccggc ccaggtagtt gcggctggtc cggccgagca ggagggggcc     81900
     ggagaccatc gccgtgttcc gtccggcttc gacgccgtcg acgtagagca cgccggtgcc     81960
     ggcgccgagg gtgagtgcca cgtgggtcca ccggcccagc ggcagcggcc cggtggcgtc     82020
     gacgaagtcc tcggcctcca tgcccgcgat cttcaatgcg gcgcgggccc gcccggcgcc     82080
     cgtggtcgcc gtgaggaaga ggtaggtgtc cttgctgtag cccaggtcga agacgcggac     82140
     ggagggggcg agggtgtcga cgcggacccg gacggagacg gtcaactccg ccaggccact     82200
     gggcagtccg gcggggagta cgacgtggcc gtcgcggccg tcgagcgtca ccgccgtgcc     82260
     gtcgtcgccg gtgctccagg tcgcgccgcc ggccagggag ccgtcgccga acgtcccggt     82320
     gcggtccgcc accgaggtgc cgtgtccttc gtcgaggggg tagcgggcca cgtcaccggc     82380
     ggtcgggctc gggggcgtga cggaccagta gacgttgtag cgctggtggt ggatctcgtg     82440
     gaaggggcgc agggggatcc gcctgccgtc cgccacggcc gtgaaccggg tgggctcgcc     82500
     gggtgtgcgg cgcagtgtgt cgggacggac ggccggcagc gtcgtgagcg gcgtgtcccc     82560
     ataggcgccc gccaggacga gcgggccgta cgacaccgcc ttgacctgcg ggttgtcggg     82620
     cgccggtcgc cagacgggaa cgcggggcag gacgagttcg acgcggtccc cggtccgcca     82680
     gtgacgtgtc acggtcgtgt acgtgcccgg ttcgagacgc ccgccggtgc gtcggccgtt     82740
     caccgtcagc ccggcacgtc cgtcgcccgc ggccagccag ccggccacgc ggatccgcag     82800
     cgcgaacctg gcctctcccc cggtgacggt cagacgggtg cggtcgcccg tgggcatgtc     82860
     ggtgtcctga cggagcgtca cccccaggtc gtcccagcac acttcggagg ggacgaacag     82920
     gttgacgtga agtgcgggcc ggcgggtgcc gggggtgcgg aagtagacgg tgtcggcgaa     82980
     cttggtgtgc gtctccaggc ccgtgccgtg gtcgcaggag aagttgtcgt agtccccgct     83040
     gtagctgccg ggggccgagc cgagaccgcc cttcggttcg cgccgcgagc ccgcccacag     83100
     cccggtgtag taggtgacga agccgtgcgc cgagtcgggg tcctgctcgg cgagcatctg     83160
     gttgtacagc gtccactcgt agtggtccag gtactccgtg cgctccgggt cgtggcggaa     83220
     gaggtcccgg ccgagcttga gcatgttgta gctgttgcag ttctcgcagg tgacctccga     83280
     gaggcggctc gcgatctcgt ccggcggccc gaagagttcc tggttggagt tgccgccgat     83340
     ggcgtacgag tggtggcgta cgacggtggt ccagaaggtg tcggcgatgt ccaggtagcg     83400
     tcggtcgccg gtggcctcgt aggccggtac ggcaccgacc accttggcga tctccgtgtt     83460
     ggcgtgccgc ccggcgagtt cgtcgcgccc ggcggcgagc ggcgcgtaga gctcgtcgtg     83520
     gtcgaagcgg cgcgcggtgc gcaggtgcac cgggtcgccg gtctccaggt ggagccgggc     83580
     gaggacgtcg ttcatgccgc cgaactcgac cttgagcacg ctctgcatcc gctcgcgcga     83640
     cagcggggcc gtgcgcgcct cggtccaggc ggccatctcc agcaggacgt cgaacgcctc     83700
     ccggttcccg ctgagccggt actggtcgag gagaccggcc atgatcttgt gcagggtgta     83760
     gtacggcgcc cagggcttgc ccccggcctc cagctggtcg aagaccgact ccgggaacgc     83820
     ggagaggtag ccgcggtgga acccggccgc cggtgccgcc cgctggcact cggccagggc     83880
     cgagacgagc agacgggcct tgtccgcgta ggcggtctcg ccggtaccgg cgtgggcctg     83940
     ggccagggca ctgaggaggt gcccggtggt gtggccgcgc agttggacgt ccggggcctc     84000
     ccagccgccg cacggttccg cggcggaggg caggccgacg ttgagccgga aggtgtgcag     84060
     cagccggtcc gggtccacga agcggaggta cgcgcaggtg cgccgcatgt tggcgaggaa     84120
     gggactgtcg aggaggcgga cggccgagag cgggaagggc tccagcaagg gccctgggcg     84180
     gtgcgcaccg ttcgtcggcg agggtgtcgc cccggcgtgg gctggcgggg tcgccgcggc     84240
     tgagccggcc ggtgcggccg ccgcggcggc ggccggtgtc gcggcggcgg ccgtggcggc     84300
     ggacgcggtg aacaggacct ggcgtcggga gggggcgggt ctgctgtgcg gtgcgggcat     84360
     ggtgcggggc tcagctccct tcgattgaat cgttttactc gattctccgg agacgctaag     84420
     tggcgtcacc aggagcgtca agggttccca caagaacctt ctgacgcgcc ataagtccct     84480
     ccgaaccgcg agtcaccggg cgcggaacgg gcatgacccg gcgcggacgg gcctcggcac     84540
     cgtccgcgct gttttgaatc gttcaattcg agtggagtca gaccgtcttc tgcgcgtacg     84600
     gaaccagtcg caccggtccc accagcccgt actcctggcg ggcgagccct ccgaagacct     84660
     ccgggcggct caccctcagc cggttgacga ggggcgtcgc gacctcgatc tcgatggtgt     84720
     tcgtgccgcg gcgcagcagc gggcccacgt cgacgacggg gtcgaggcgg tcggccggtt     84780
     ccgcgtcacg gccgttgacg ctcacccgga aggtgtcgct gacccgaccc agctccagga     84840
     gggcgccgtg ggtggggccc cagtcgccgg ggagggtgac cgtggtgcgg tagcggccga     84900
     tgcccgcgca gtcctccagt tccgcaatgc tcgaccaggg cagcagggtg tcgagcgtca     84960
     gggtgcggcg cacccgctcg gtccgggtcg ggcggtcacc ggggcgccag tcctcgacct     85020
     cgacgtgcca ccggcccggc tcgatcgggc cggggaccgc cgggagggtg gtggtcacgg     85080
     tccggccctg cgacagccgc gtgcggtacg tgccggccgc tcgggcccgt acggtgagcc     85140
     cgcgcgcggt gaacagcacc tcgtcggcgt ccgaggagag ggcgtgcggg cggtttccgt     85200
     gccggtcgcc gaacaggccc gggcgcccca gcgcgacgac gagcgtctgg ccgggcctca     85260
     gcgcgacgcg gaacgtcacg tcctggccgt ccagggtgta ccggcccacc cgtgcggccc     85320
     tgccggtcca ggggtcgagg aggtagggca ccgcgtcgcg gcctcgcgtg cggcgcaggg     85380
     tgacgtcgtg gtcgatcgcg gccacgggcg gtttgacggt ctccgcgtgc ttgccgttga     85440
     ccaggtagta gtagtcggcg tccgccgtga cccggtgcgc gttcaggagc gtcgacggaa     85500
     cggagtgccg tacgtccggg gtgacgccga gcgcggcgag ggcgtcgccc accgcggtct     85560
     tctcggtgac tcggacgacg cccggcagcg cgagcaggcg ggtgaggacg tcgcgcagcc     85620
     gctcggtctc gcccgcctcc ggcacgcccg gtgtcagcgc ctggtcgaag ccgcccagga     85680
     ggaccacggg cagtccggcc tccgcgaacg cgaggatcct gcgggcgtcg gcgagggcga     85740
     gggtgggggt cgagccgtgg aagaagtcac cctcgacgaa gagcgccttg taggccggtc     85800
     cgccgggagc gagccggcca cccaagacgg tggcgttcgg caggtcgagg agtggaccgc     85860
     tgaggaactg gtgcgtccac ccgagcggga cgccggtcga ggtgaaccag gacgcgccga     85920
     tgcccgtggc cgtgtagccg gtctgccgga agacggcgac gtccgcgcgg gcggtgcccg     85980
     actgcagcac cgcgtggacg cggccgaggt acccggcgat gtcctcggcg tgccgccagg     86040
     tgggctgccg cggcccccac gactcgccgt accccggcgt gccgttgtag gggctgaagg     86100
     cggcgaagcc gggccactcg gcctccgggg cgctcgcgta cgagaagccg tgcatcaccg     86160
     tctggttgac gcccgccgcg taggcgccgc ccatggtgcg cagcacgcgg tcccaagtgg     86220
     tgctgtaggc cgagccgttg taggcgcctg cctcgcagga caggacggtg tgccccgcca     86280
     tgtcccggcc gccggccagg caccggtagt cgtccaggtt cttgaacccg agggactccc     86340
     cctccgcgat gtcgaggatc gccgcggtgg cgactgcgtc ggtctgcagg ccgtacggct     86400
     gggcgcgcag ggtcatgccg agggagtgcg cccagtcctt cagggcgccc acgtggtgcc     86460
     ggttgaacag gtcggagacc gtggcccaga agtcgtgccg gatctgccgg gtcagctggg     86520
     ccccgaaggc gaacacctgg ttgctgtcgt cgaggacgag gacgggcagc cagggcagca     86580
     gcggtcggcc cgtgcgctgc tcgaagacct cgggcaggcg tgccgtccag accagtccct     86640
     cggactccag ttccaccgag tcctcgaaga aggagccgcc cgcggccttc agcaggcgtc     86700
     gcagtgagcc ggtgaggacg tgccgttccc agtagtcggt gacggcggtg gtgcccgccg     86760
     ggctcaggtg gtcgaccacg aaggccccgg gcgcggagtg cggacccgac tccggctgct     86820
     gacccgagcc ccgctgccag taggagatca gcatccactc gccgtccgcg ggtgccgtcc     86880
     aggtcaggcc gccgtcggtg acggtgtccg tgaggtcgcg gacgctgtcg gggtcgagcc     86940
     cggtctcctt gcgggtggag ttggcggggt cgacccgagc ggcctggacc gcgagcaggc     87000
     gctgggcgcg aacgccggac gccgcctcgt ggacgggcgc gggcacgggc ccgcggtagg     87060
     tggccccggc ggccagcgaa gtgcgcccgt gggcgagttc ctgggcggcg gcctcgtcgt     87120
     cgggggtgac tccgggcacg gccacgggcc agctcgggcc cagggtgagg tcgacggtca     87180
     ggccgcgtcg tacggcccgg cgcagggcgg cctcgacgcc gtcgcgccag ggtctgctgc     87240
     cccagccgtg gtgggcggtg tccagcagcg acttgtcccg gatgctgtgg tggacggcgg     87300
     cgatctcggc tccgccgaaa ccggcgtccg cgatctggtc gatctcgcgg gccacctcgt     87360
     cggggtcgac caggccgtcc ggccaccacc accggaactt cgggcgcacc gaccgggcgg     87420
     ggtcggcgaa ccaccgggcc gggccggcgg cccggtcggc ggccgggccg gcggggaggg     87480
     cggcgacgcc gggcgaggcg gtgacggcgg tggcggtcac ccccgcggtc acggcggcgg     87540
     ccagcaccgc gcgccgggac atcccgccac gctgcgagac gagttcgtgc atgagtgcgc     87600
     cccagggttc ggaggaggtt tccgttgatt gaatcgattc aatccggtgc aaacgcggga     87660
     acggtaatcc gagccgatca tgggggtcaa gacatgtgca ccggtgactt ccgtgttccg     87720
     cggcgcgggc gcccgctctc cgcaggcgga ttgcgcttcg ctaccccccg tcccggtccc     87780
     gctggggcac ggtgcaggca cgggcgaact cggcgagagt gcggaagtcg tcgtcgcgca     87840
     ggccaatccg cgggttgacg tggtgcagaa gtccgggtgc gcggtggtgg gcggtcacgt     87900
     aggcctggtc caggccgccc tgttcgtcgt ccacccaggc gaaggggcgg ccgttggcgt     87960
     actccaccag gggggcggtc ttccagtgga ctccgtcggg gcggtcctgg agcaggacgt     88020
     cgccgaagtc gacgaagggg agttcgggaa ggccgatgac cggggctatc cagcggttgg     88080
     cctccgccat ccacgtggtg gcccagcaca gttcgtagtc gagccggagc aactccgccc     88140
     cgtgccgcgg atgcagccag acgcgcaggg ggcggcggcg caccagagcg gaccggtgcc     88200
     cgtcgggggt ctggccgtcc ctgggcactc tgagggtgat gtatccggcg ggccgcctct     88260
     gaggcttggc cgcgtagggg ttgaggggcc cgtccacgtc gaggaagagc agcggtcggc     88320
     tcacgatcgg tccccctgtc gcacccgtgg tgcgccgcac cggcctggcg gttcgaccgc     88380
     cgcatcgttc ccggcgtccg gccaccgccg ggcgggcggt tgtcggcgat tcggccaacc     88440
     tacccgctcc gcacccctgt tgtcccgcac gggtccgtgc atccgccacg aaacgacacg     88500
     cgccgtggtt cggggccctg accgcgaccg aaacacatgt gttcgatacc tcggtccggt     88560
     cgttgagctt cacgaccacg ctcaacgacc gtcaaggggg atccattgac ctcgaccgcc     88620
     gcgaacggac cgcggaaacc cacgcctcca cctcctccac cgcctccacc gcctccaccg     88680
     cctccggcgg agatcaccta cagcggacgg tattccgtca atccgctcgc cgaggtctcc     88740
     ttccgacgga tgtgcgcaca gatcccggcc gtcctgggcc ggatcgcacg gctgtcgtgg     88800
     cggaccgacc ggcgggccgt gcagctgctg ctcggctgcc aggtgctcac cggtctcgcc     88860
     gccgccgtgc tgctgaccgc caccgcccac gccatgaacc ccgtcctcgg cgacggctcc     88920
     gccgccgacc ggctgcacgg cgcgctgccg gcgctgtcgg tggtggcgct cgccgccgcg     88980
     ctgggccgcg gtgccgcggc ggtggccacc tatgccgagc ggcggatcac cccccggctg     89040
     acgaccgaga cggacagcgc tctggtcgag gcggtgtgcc gggtcgaagc gtccgcctac     89100
     gcgcaggagg gcttctcgga ccggcacgag gccgccgaga tgggagtggt ccgcacccag     89160
     gtgatggtca ccgacgccca gcggttcctg tccgcgctga tccggatggt cacggccggc     89220
     ggggtgctgt cggcgctcaa tccgctgatg ctgccgctgc tcctgctcgc cgtgctgccg     89280
     gccggtgcgg gcgcggtcct caccgcccgg gtcgactacg aggtccacta cgccaacatc     89340
     gccgaccgca acgtgcgcgg catgatgcgc tggtgggcga ccacgtcgaa gtacggcgac     89400
     gaggtccgcg ccaactcgat gaccgactac ctcgtccact ggtaccggtc actgtccgac     89460
     cggtgcgacc ggcgcacgct gtccgccgcg ccgcgcaccc tgcggatcgc cgtgctgtcc     89520
     gcagcggccg gcggcgtgtt cctcgtcgcg acctggggag ccctcgcctg gctggcggtc     89580
     tccggccgga tcgaactggc ggtcgcggcc acggccgtca tcgccgtgca gaccacgctc     89640
     gccgcactct cccaagtcgt cgtcaacggg gccgcggtct tccacaccag cctctacctg     89700
     agcgacatgc aggccttcct cgacgacgcc gcggcccgcg tcccgaagcg cggccccggc     89760
     aagcaccgcg cgccgaccga gcggatccgg ctggaggaag tcgtctacca gtaccccggc     89820
     aaggacaggc ccgccgtcga cggcgtctcc ctcaccctgg agcgcggtca gatcctcgcg     89880
     atcgtcgggg cgaacggctc gggcaagtcc accctgaccc ggctgctgac cggcatctac     89940
     cttccggaca agggacgggt cacctggaac ggcaccgacc tcgccgacat ggagcccgcg     90000
     accgtgtggg cgcacatcgg tctggtgccg cagatcttcg cccagtggcc gatgccggtc     90060
     cgcgagaacg tcaccctcgg ccagccccgc ggctacgacg acacaccggt gtgggaggcc     90120
     gtggaggcgg tcggtctgcg cgaagccgtc gacaacctcc cggcgggcct ggacaccctg     90180
     ctgtcccgtg acgtcttcgg tggtaccgag ctctcgggcg gccagtggca gcgcgtggcg     90240
     tgcgccaggg ccctgtaccg ccgcccgggg ctgctgatcc tggacgagcc gacgtcccag     90300
     atggacccgc gcggtgagca ccagatcttc gagcaaatca aggcgatcgc cgccgagcgc     90360
     atcaccatcg tggtcaccca ccgcctggag aacacgagga tcgcggacca catcgtcgtc     90420
     atggagcacg gccggatcac cgagcagggc cgctacgacg acctcgtcca cgccggcggc     90480
     accttcgccg aactcctcgc actctcccag gaccgctgac ccgtccgcgg tcagcgggcg     90540
     gtgagggcct cggcggcctc cggttcgtcc gcgtccgcgg gggccgtcct ccccggcccg     90600
     cgcaacgcca cgtagacgaa caggacgccc atgacggcga cgcccgccca catggcctgc     90660
     tgccagccgt cgacgaagga ctgctgggcg gcgtgcagca ggtccgggcc gtgcggtccg     90720
     gcgccgcccg cggcctcgac cgcgttggcc acaccctggc gggcctcgtc cgcggggccc     90780
     tgggggatgc cgtccagccg tccgtcgatg gcagcgcggt agccgcccgc cagcagggcc     90840
     ccgagcaggg cgacaccgag tgcggtgccg aactcgcggg tgacgtcgtt gagtgcggac     90900
     gcgacgccct gcttcccgcg cggcagggag ccggtgatgg cctcggtgga cggggtcatc     90960
     gacaggccca tgccggtgcc catggccagc atgccgggca ggatcgtcag gtatccgtcg     91020
     tccacggaga cgaacagggc catgagcgcg aggccgacgc cggccagggc gatgcccgcc     91080
     gccatggtcg cacgggaacc gacccgtgcg gcgagcatgg gggcgaggcc ggaggtcgcc     91140
     atcatcatga cggccatggg catcagcgcc accgtggaga gcaggccgga ccagccgagc     91200
     acggcctgga agtacgggaa gaggaccacg gcgatgcccg cctggacgcc gaagaccacc     91260
     aggagcgtga tagagccgcc cgccaggccg cgctcacgga acaggcgcac gtccagcagc     91320
     gcggcgtcgc ggcggcgcag ttcccaggcg acgaagccga cggcggcggt gatgccggcg     91380
     acgaggccgg tcagcgtcac cgggtcggtc cagccgcgtt cggggccttc ctggaggacg     91440
     aagatgaggc cggtcacggc gacggtggag atcagcgctc cgaccgtgtc gaaccggtgg     91500
     gcagcggtct cgcgggagtc ggggaccgac ttcagcgcca tggccagggc cacgaggacc     91560
     aggaccaccg ggaggacaaa cagcagccgc cagtcggcga cgtcgacgag gagggcggag     91620
     aggaacatgc ccaggatgcc gccgcctccg gcgacgcccg tccacacgcc gatcgccttg     91680
     ccgcgctgct cctcggggaa ggtggacgtg atgacggcaa gggtgacggg catgatcatc     91740
     gcggcgccgg caccgccggc cacgcgagcg gcgagcatga cctcggccga gggagccagt     91800
     ccggcgagga cgctcgccgc accgaagaca cccagaccgg cgacgagcat gggcctgcgg     91860
     cccagtcggt cgccgacggc cccgagcggg agcagcagag cggccagggc cagcgtgtag     91920
     atgttgatga tccacaggac cgtgctctgg gaggcgccga actcgacggc catgtgggtc     91980
     tgtgcgacgt tcagaccgga caccgaggcg acgacggcca tcagtgcgac ggagacggcg     92040
     atcaggatcg tgcgcagctg acgcgcgtcg ggggtgctcc cgccgccggc ttcgggggcc     92100
     cgtacgggtg ggctggtgct catgggttcc tttcgtgggg catgccgcag cccgacgggg     92160
     cgtggagggt gtcggggaag tgcggttcga ctgcgtccga agctaagccc gccttgcgtt     92220
     cgaggcatac aatgttgctc atgacgcaag aagatggaga cctggacagc ctcgtacgca     92280
     aacgcatccg cgccctgcgg gtggcgcagg gctggtccct ggaggaactg gccgggcgtg     92340
     ccaggctcag ccagtcctcg ctgagccgca tcgagaacgg ccggcgccgc ctggccctgg     92400
     accagctggt cactctcgcc cgagccctgg acaccacgtt ggaccagctc gtggagacgg     92460
     ccgacgagga cgtcatcacc agtccgatga tcgacagcgc ccacggcctg atgcgctggc     92520
     cggtgaaggg cgatcccggc atgaccgtgg tgcgtcagcg catgacccag ccgccgcccg     92580
     agaatccggc gcgcatgcgt gcccacccgg ggcgcgaatg gctcgtggtc ctgtccggca     92640
     cggccgtcct catgctcggc caccgccgct tccgcgtcga gacccaccag gcagccgagt     92700
     ttcccacgat gatgccgcac gcgatcggca ccgccggcgg cccctgcgag atcctgggca     92760
     tcttcgaccg cgacgcccgc cgcggccacc agcgcgaggg aggcgagccc gaggcccggg     92820
     acagggccga gtgacggcgc ggggcgccgg gccccggcgg gcagggcgag cgcgaggagg     92880
     ggctcggccg cggctcgtgt gggccggcgc cgcgcaccgg gccggtggcg ggcgggcggg     92940
     gcacgcccgc tactcgatca gggcgtccgc ggcgatgatc accaggccga tcagcatgtc     93000
     cagggccccg gcccggcagg aggacagccg gccgagcccg gcggtgcggg ccgccgaggt     93060
     gcccagggcg aagagcagga cggtgttgag caccagggcc gtgtcggcgg ccgtttcctc     93120
     cgcccaccac ccggcctcgg cggcgagcag catcatcacg gtcggcagca cggcgacggc     93180
     cagcggccac tcggcgagca ccgcgcgcag tctgctcggt ccggccgtcc cgtcgccgga     93240
     cgcacgctgg gcgatgacgt gcgcgtaccc gtgggcggcg cccgacgtca gcgccgtgag     93300
     cagcacccac agcgcgtcct ggccggggtt ggccgcttcg cccggcacgt ccagcgccgc     93360
     gaccagcgcg ctggccagta ccaggccgta gattcctttg aacagccacc gctccggccg     93420
     gcgccgcagg attcccctcg gcgcgacgcc gccggccgag ccgcggccgg caccctcggg     93480
     cattcaggag agccagtcgg cgtaccgggt gggggccagg tgggcgtcca ggtcggtcag     93540
     gacgtctccc tcgaccgccc cgaacatgcc ggcgcccgga tcggtgacga ccgttcgcgc     93600
     gtcgcccttg tgggccaggg tcaggcggcc cagctcgtcc agggggaaca cttccggtcc     93660
     gccgatgttg cggatgccgt tcagcggggc gcccacggcg acgtccgcga ccgcggccgc     93720
     cacgtccttc gccgcgatcg gctggatcgg cgtggcgggc agccggacgg agtcgtcgga     93780
     agcggtccag gacaggaccg cctccatgaa ctccatgaac tgggtggcac gcacgatcga     93840
     gtacgggacg gggccgtccc tgaggatctc ctcctggagc accttcgcgc ggtagtagtc     93900
     cagcgccggg acccggtcga cgccgacgat ggagaggatc acgaagtgcc ccgtcccggc     93960
     ccgccgcgcg gcggccagca gggtgtccat cgacgcccgg aagaaggcgg gtgaggcgtc     94020
     gtcgaaggtc ggggagttcg tcaggttgac cacgacctcg gctccctcga ccgcgtcgtc     94080
     cactcccccg ccgccgacga cgtcgacgcc ggtggaccgg gagtggggca ccgcctggtg     94140
     cccggccgcg ttcaggtcct tgacgacctg cgagccgatc agccccgtcc cgccgatgac     94200
     cgcgatcttc atgcgcacgc ctctcttcct tccggagccg ggtggctcag gaaccactgt     94260
     gtcggtgtgt gcggaggacg gctctttgaa cgccccgaag ggatgagaac ggaccggctc     94320
     cggggtgccg gaacgccgga gtggccgagc ctgtcgcctc ccgcccccgg cagggcgcgg     94380
     caccccagca ggcttcggca tcaattcaag agcgaatatt gctctagatg ccgccttgcc     94440
     ttagatcctg tccaaggtag ggtggtggct gcgaagaacc acaccgagga gcaagccttg     94500
     cctgagaaca accagaagcc gctgaccacg gtcgccggtg cgccggttcc cgacaaccag     94560
     aactccctga cctccggccc gcgcggcccg atgctcctgc aggacgtgtg gttcctggag     94620
     aagctcgcgc acttcgaccg ggaggtcatc ccggagcgcc ggatgcacgc gaagggctcg     94680
     ggcgccttcg gcaccttcac cgtcacccac gacatcaccc ggtacaccag cgcgaagatc     94740
     ttctccgaga tcggcaagaa gaccccgctg ttcacccggt tctccaccgt cgccggtgag     94800
     cgcggtgccg ccgacgccga gcgcgacatc cgcggcttcg ccgtgaagtt ctacacggac     94860
     gagggcaact gggacctggt cgggaacaac accccggtct tcttcttccg cgacccgctg     94920
     aagttcccgg acctcaacca cgcggtcaag cgcgacccgc gcaccaacct gcgcaacgcc     94980
     gagaacaact gggacttctg gaccaacctc cccgaggccc tgcaccaggt cacgatcgtg     95040
     atgtcggacc gcggcatccc ggcctcctac cggcacatgc acgggttcgg ctcgcacacg     95100
     tacagcctga tcaacgccga gggcgagcgg ttctgggtca agttccacca ccgcacccag     95160
     cagggcatca agaacctcac cgacgccgag gccgaggccc tggtcggcaa ggaccgcgag     95220
     tcccaccagc gcgacctctt cgacgcgatc gaggacggcg acttcccgaa gtggaagctg     95280
     ttcatccagg tcatgccgga ggccgacgcg gagaactacc gcttccaccc cttcgacctc     95340
     accaaggtct ggtcgaagaa ggactacccg ctgatcgagg tcggcgagtg ggagctcaac     95400
     cgcaaccccg acaactactt cgcggacgtg gagcaggccg ccttcagccc ggccaacgtg     95460
     gtcccgggca tcagcttctc ccccgaccgg atgctgcagg gccgcctctt ctcctacggc     95520
     gacgcccagc gctaccgcct cggcgtcaac caccaccaga tcccggtcaa cgccccgaag     95580
     aacccggtga actcctacca ccgcgacggc gccatgcgcg tcgacggcaa ccagggagcc     95640
     accccgggcg tcgagcccaa ctcctacggc cgctggcagg agcagccggc ctaccgcgac     95700
     ccggcccagg ccgtgggcgc cgtcgccgac cggttcaact accgcgagga cgacgacaac     95760
     tacttcgagc agcccggcaa cctgttccgg cagatgagcc cggagcagca gcaggttctg     95820
     ttcgagaaca cggcacgcgc catcgacggc gcctcggcgc agaccatcga gcgccacatc     95880
     ggcaactgca cccaggccga cccggcctac ggcgcgggcg tccgcaaggc gatcgaggcc     95940
     ctggccgccg gcaacctctg atccggccgg tcagcgacac acgcggtaca tccgcaccgc     96000
     accggcgcgg gcacctcgga ggtgcccgcg ccggtgcggg cgtaccgcca cggagaacta     96060
     cttcatggac atgcacgaca gcggtggact gactcccgag cagacggagc gcgtggtcgc     96120
     catcgccatg gatctggccc gcgagggcgg caccgagcaa ctggtggagt tcgtacagca     96180
     cgggctgccg gtcgacgtac gggaccccgc gggcaactcc ctcctcatgc tcgccgccta     96240
     ccacggtcac gccgacaccg tgcggaccct gatccggcac ggcgccgacc cggacctccg     96300
     caacgaccgc gaccagtccc ccatcgccgg cgccctgttc aaaggcgccg acgacgtcgt     96360
     agcggtactg cgtcaggccg gcgcggacct ggactccgga acgccgaccg cgcgggccgc     96420
     ggcggccatg ttcggccggg aacacctgct cgcgacctga accggcggtg acgtcacagg     96480
     cggagccggg gaccgggcac tcgaccccca catggcgtga accatcggtg cgggcccgcg     96540
     tccgaagcgg aagaatggcc gtcgaactcg gcacttcgca ttacgcggtg gcgcgaagac     96600
     atcggtggac attcacaggt tgcttgatca actcccaaag cgtgagcacg aattacacac     96660
     atcccctcta cacagtggcc ccgatggtct agattgaccg tgcttcagcc gttcaggcac     96720
     ggggcgaccg gtaatgatct ttaggtcggg ggcagggggg tctgctgctg tcactgtgca     96780
     ttgctcgtat tgatgtgaca tagccggaac gttgtgcgcg gacaggccgg ggggccgtcc     96840
     gtggggagga acagcgcggc gcgggaggcg ggggcctccc gagggggagg aacagtgcta     96900
     ggcgaatacg tcgaaccact gggaacctgg ggggttctgt gcggcaaggg ggattggtca     96960
     gcgcgtttcc gtctgcgcgc ggacagttgg cggacggggc gaccagccgg ctcacgagcg     97020
     actgggagca gcggtaccgc cgtaccgtga tcaccagcga taccgtgacc accgccgtcg     97080
     tggtggcggg catcggcaat ttcttcgggg tccgggacgc ggccaactgg cacgagaaat     97140
     ggggaattct cgcgttcggc acctggctgc tggtgctggg cgccctcgcg gtgagccggt     97200
     cgtggtcacc ggccgtgctc ggccagggcg ccgaggaatt ccgtcggctc ggccgctcac     97260
     tgttcatggc gaccgtcgtg ctggcgctcg gcggaatcgc cctcacctcg cgcaacatca     97320
     aactctggat cttcgtcgcc gttcccgcaa tcgcgatctt catcatggtc gcgcgctatg     97380
     cgctgcgcgt ccggctgcac agacagcgca agcaggggcg ctgcctcaga cccgtgctcg     97440
     cggccggaag tccggccacg gtgcgcgatc tgatcgcccg gacccggcgg ttcccgcacc     97500
     tcggctggcg ggtggacgcg gtgtgcacga cggacgacgg gctcgagggc ggccaactgg     97560
     acggagtgcc ggtcgtcggc ccactggagc acgtcgccca ccacgtccgc cgcgacggct     97620
     accgggtggt cgcggtcacc ccggacccgc actggtcacc gcaccgcctg caacggctgg     97680
     cctggaacct ggagggcagc gacgccgaga tggtcgtcgc tcccgtcctg atggaggtgg     97740
     ccggcccgcg gctgcacgtc gacgcggtgc tcggtatccc gctgctgcgg gtcagcatgc     97800
     cgaccttcac cgggggccgc cgcgcggtca aggcggtcgt cgaccggttg ggcgcggccg     97860
     tcctgctcac actgttcgcg cccctgatgc tgttcgtcgc gctgctggtc ctggtggaca     97920
     gcaggggcgg ggcgttctac cgccagcgcc gggtcggcaa ggacggccgc gagttcacca     97980
     tcctcaagtt ccgcaccatg gtcgcggggg ccgacggggc acgtgccgcg ctggccgacc     98040
     gcaacgaggg cgcgggcctg ctgttcaagc tccgccggga cccgcgggtc acccgggtcg     98100
     gggcggtgct gcgccggtac tcggtcgacg aactgccgca gctcctcaac gtgctcgccg     98160
     gatcgatgtc gctcgtggga ccgcggccgc cgctgcccga ggagtccgcc gcctacggcc     98220
     cggacatccg aagacggctg ctggtcaagc ccggcctcac cggtctgtgg cagatcagcg     98280
     gacgcagcga cctgccgtgg gaggaggccg tccggctgga cctgcggtac gtggaggact     98340
     ggtcgctcgc cctggacacg gtgatcctgt ggaagacgct gcgtgcggtg gtccacggac     98400
     agggggcgta ctgatgcgcg ggggccgccg gcccgtcgcg cggaccgcag gccgtcaagg     98460
     cctgcctggg gggaggaacg ggtcatgagg gtcagcgttt tcggcctcgg ctacgtgggc     98520
     tgcgtgtcgg ccgcgtgcct ggccggcatg gggcaccagg tcgtcggggt ggatgtgaac     98580
     caggcgaagg tcgacctggt caacgacggc aaggccccgg tggtcgagga acggatcggc     98640
     gagctgatcg ccgaggtcgt gggcagcgga gcactgcgcg ccaccggcga cgtccgcgag     98700
     gcgatcatgg agagcgagat atccctggtc tgcgtgggca ccccgtcgga gcccaacggc     98760
     agcttgtgca ccacgtactt ggaacgcgtc accgaggaga tcggcaccgc gctcgccgaa     98820
     cggggcgggg gcggtgggcg gcacaccgtg gtgttccgca gcaccatgct ccccggcacc     98880
     tgcgcgaacc tgctggtgcc gatcctggag aagtacgtcg gcggcaccgc cggggtggac     98940
     ttcggggtcg cggtcaaccc ggagttcctg cgtgagggca cgagcgtgcg ggacttcttc     99000
     gacccgccca agaccgtcat cggcgaactc gacgcggccg gcggcgacgc ggtgctggcc     99060
     ctgtacgaca gcctgcccgg cgaggtgttc cgggtgccgg tcgcgacggc cgaggcgatc     99120
     aagtacgccg acaacgcctt ccacgggctc aagatcggct tcgcgaacga gctgggcgcg     99180
     gtgtgccatg cgctcggggt ggactcgcac caggtgatgg acgtgttcct ggccgaccgc     99240
     aagctgaaca tcagccccgc ctacctgcgg cccggtttcg ccttcggcgg ctcctgcctg     99300
     cccaaggacc tgcggagcct ggtccacgcg gcacagcggg ccgacgtctc ggtgcccatc     99360
     ctctcccacg tgctgccctc caactccgcg cacctggagc gcgcggtcga gctggtggag     99420
     cgcaccggga agcgccgggt ggggatgttc ggactgtcct tcaaacccgg caccgacgac     99480
     ctccgcgaga gtccgctcgt ggagctggcg gagcgcctct tcggcaaggg ttacgacctc     99540
     aggatccacg acgccaacgt gagcctgtcc cggctgctcg gcgcgaaccg cgagtacgtc     99600
     gagacccggc tgccgcacct cgcccaactg ctcgcggact ccgtcgacga ggtcctcgac     99660
     cacgccgagg tgtgcctggt cgggaccagg gacccggccg tgctctcggc gctgccccac     99720
     ggcgccgggc cgctgctgat cgacctcatc caccttcccg acgccgacac gcgccggacc     99780
     gaaccggggt acatgggcct tgcttggtga cacgacgtct ggtgaaacgc cgttcggtgg     99840
     cacagccggc gaccggccgg ggcggcgcgc cctgatcctg gtggagaacc tgtcggtacc     99900
     cttcgaccgg cgggtgtggc aggaggcgac gaccctgcgc gacgcgggct gggacgtgca     99960
     cgtcatctgc ccccggggca gcaagcggga cacggagccg gaagcggtcg tcgaccgggt    100020
     gcacatccac cgctacccgt tgcgcgccgc caccggagga ccggccggct acctgcggga    100080
     gtacggggcg gcgctctggc acacggcccg gctggcccgc cgggtcggcc cggtcgacgt    100140
     ggtccacgcc tgcaatccgc cggacctgct gttcctgccg gcgctgtggc tgaagaggcg    100200
     cggtgcgcgg ttcgtcttcg accagcacga cctgataccc gagctgtacc tgtcccggtt    100260
     cggccgcggc aaggacctgc tctaccgcgc cgtgtgcgcg ctggaacggt ggacctaccg    100320
     ggccgcggac gtcgtgctcg ccacgaacga gagctacaag gacgtcgcga tacgccgggg    100380
     cggccgccgc cccgacgacg tcttcgtggt gcgcagcgca cccgcgaccg atcgcttcca    100440
     gccggtgccg cccgaaccgg agttgaagcg cggcaagccc catctgctgt gctacctggg    100500
     cgtcatggga ccccaggacg gcgtggacta cgccctgcgg gccctcgcga aactgcgcga    100560
     cgaggtcggt cggacggact ggcacgcggt gttcgtcggc tccggcgacg ccttcgacgc    100620
     gatggtggag ctgtcccggt cgctggggct cgacgagcag gtgcggttca ccgggcgcat    100680
     tccggacgcc gacctggtgc gccacctctc caccgcggac gtgtgcctct cccccgaccc    100740
     ccgcaatccg ctcaacgacg tgtcgaccat gaacaaggtc ctggagtaca tggcgatggg    100800
     ccggccgatc gtctcgttcg acctccgcga ggcgcgggtc tccgccgggg aggccgccct    100860
     gtacgcaccc gccaacgacg aggcggcgtt cgcccggctc gtcgcacggt tactggacga    100920
     tccggacgag cgcgcccgga tgggcaagat cggccaggag cgggtcaccg gacggctctc    100980
     ctggcgcaac tcgcaggcgg cgctgctcgc cgcgtacgcc gccgcctgcc gtgaccacac    101040
     tccggtgtcg gcgggcgccc cggtccgaac agggttcaaa gcagggaaaa ggccgcgcag    101100
     ttgagcgatg acacgatacg cctggtcacg gtcgggcgaa ttctccggcg acgacggcgg    101160
     ctgctcgccg tcctcgtcgt ggtgggcgcg ctcgccggct acggcgtctc ggtgctgttc    101220
     ccgccgcgct acacggcatc ggcctcggtc ctgctgccgg ggcagtggga gcagcgcgag    101280
     ctggtcaccc aggtggagat agcgaccagc tcggcggtgg tcgaccgggc cgccgacgag    101340
     ctgcgctgga acggggtggg caggagcgag ctgcgcgacc gggtgagcgc cgagaccgcc    101400
     gacgggaaca tcgtcaagat ctcggggacg gccgcaaccc cggagcgtgc gcagcggctc    101460
     tccgacgagg tggcccagca gttcgtgacc tacgcggcgc ggatcgccag cggcaccacc    101520
     ggcgccgacg aggccgccgg gccggaggcg ctgcgggagc aggtgacacg gaccaaccgc    101580
     cgcatcaccg acctggccaa cgcggccgat cccgggcaga ccgtggaaag cgtccaggcc    101640
     cgcaccgagc tggagaagct gcgcagcgcg ctccaggacg ccatgcagaa gctggaggag    101700
     gccgacccgg cgaacaaccg ggccggcatg gtcgtcatgg gtccggcggc ccggccggcc    101760
     ggcgaggctc cgccgacgcg gctgcagctg atcggcggcg gcgcgctgct gttcttcgtg    101820
     ctcgccgtca tcgcccatct caccgcggcg cgggtgaacc ggcggccgcg ctccgaatcc    101880
     gagatcgccg cggcgctggg aacggcgctg ctgggaaccg tggacgtacc cggtgaccgg    101940
     cgcgcccacc ggccgaaggc gcgcggcgcg caggcccggt tccggcggct gctgggcgtc    102000
     gacgtccggt gggacctgcc gaccccgcgg tcctccggcg acgaggccgg ccggcggctc    102060
     cgctaccggc gggtccgggc ccgcctgcgg gaacgggtgc ccacggcccg gcggctgctg    102120
     gtcgtcgtgc cggacgacga cgaggtggcc cgccgggcgg ccggccggct cgccgccgac    102180
     gccgaggacg atccgcggct gcgggtggtg gaggtctcgg tggcccggcc gatcgtgccc    102240
     gaccgcgaca ccgagtccgg cgcgctggtc gtgctcagcg cgggcgcccg taccgccgag    102300
     gaactcgccg gtgtcgccga ggcgtgcgcg gacggcgggc acgaggtcgt cggcgtcgtc    102360
     gtcgccggcg cggtccgggc ccgtccgacg gcgtcggccg acgagccccg gggggacgcc    102420
     gccgccgggg ccgcggtgca cgaccacgcg acgggaggtg tcgcatgacg acgacggaca    102480
     cggcttcgca gccgtcggcc tccgctcccc tgctggactt gcaggcactg gtcgtggcgg    102540
     tgcgcagacg acggcgcctg tggggcagtc tggccctgct gggcctgctg ctcggcgctg    102600
     cggtggcggt cctgctgccg ccccggccga ccgcggtgac caaggtgctg gtcgcgcaca    102660
     aggacgacca gcccaacgac accggaacac tgatccgcac ggatgtcgaa ctgctggaca    102720
     ccacgcggat cgccgccgcc gcgctgcgga ccctcggttc ccgggagaac ccggaggact    102780
     tcatgcggga ctaccggggc accgggctga ccaacaacct gctgcggatc gacgtgaccg    102840
     ccgacagcga cgcggaagcg gtcgcccggg ccaaggcgct ggccgacacg ttcgtcgcgg    102900
     accacgtgcg gcggatgcgg gaggccgccg aagccgagtc caagtccctg ctggaccagc    102960
     gcgaccgtat gcgcaaggaa ctcgccgagg tcaacagcgc gatcggggac cgctcaccgg    103020
     acgacgaacc gaaggcgtcg gcgagcatcg agtcgctctt cgcccgccgg gccgagctcg    103080
     actcgcggat cgccgaattc gaccagcggg ccgcggaggc gctcaccggc acgcccgagg    103140
     tcgtggccgg cacgcagatc gtggacgccc cgcacgcggt ggagcactcg ctgcccaggg    103200
     ccgtgggtac cgacgccgcc atcgggctcg ccctcggact cgtcctcggg ctcgcgctct    103260
     ccgcggtggg cgccgtggtc gcggaccgcc cggtgctgcg ccgggagata gcggcgaacc    103320
     tgggtgcctc cgtcctggcg gagctgcggc gccggccgcg ccggtcggcc cggtcgtggc    103380
     ggcgccggcg gacccgggcg gcacgtgaac ggctcaccac caccctgacc cgcctggtgc    103440
     gcggctccgc ggaaccggtg tccatgctgg aactgggctg tgcgcgcggc accggcctga    103500
     tcgccctgga cgtcgccggg gcgctggagg cggacgggcc cgtggtcgtc gtcgacggtc    103560
     tgcccggcac gcggctcgcg ggcgcccacc gggggcccgg cggtccgacc gtgctgagcg    103620
     gcgaacgggc cacggccgaa gggcaccagg ggcgcaggct cggcgtcggc tcggtggcac    103680
     cgggcacggc gtggaccgac ctgcggtacc tcggcagccg gacggtgctc gtcgtacggg    103740
     ccgggcacgg cagcaccgcg tggctgcaca ccgtggcgcg gcagctcgcc gaccagcgca    103800
     tcgcggtgat cggcgtggtc ctgatcgacc ccgatccgcg tgaccggacc gacggcaccc    103860
     tgtgggacgg cccgcacctc gcgcggcgcg tccccggcga acggccgaag cggcacaacg    103920
     gtgggggtac cccccacgcc gtccaggcag tgggggaagg ccggctccgg gcggagcggc    103980
     cgtcgatgcc ggccgcgacg gtcccggaca gcgatcagga ggcgcggtag cacatgtgcg    104040
     gcatcgcagg cacgtaccac tggccggacg gcaaggccgt gaccgaccgg ctcaccgacg    104100
     tcctcgccca ccgcggtccg gacggggcgg gccgctacag ccatcccgcc ggcgagggcg    104160
     aggtgcacct cgggcaccgt cggctggccg tcgtcgacct gtccacaacc ggcgcccagc    104220
     cgatggtctc ggagggcctc gccctgtcgt acaacggcga gctgtacaac gcgcccgagc    104280
     tgcgcaccga gctggagtcg gccggggtcc gcttccgcgg cacctccgac acggaggtgg    104340
     tcctggaggc ctggcggcgc tggggcacgg actgtctgcc gcagctgcgc ggcatgttcg    104400
     cgttcgcggt cttcgacgag cgcaccggtg aactggtgct cgcccgcgac cagctcggca    104460
     tcaagccgct gttcctgctc cggcgcggcg cgggcctggt gttcgcctcc gagctcaagg    104520
     cgctcgccac cgcgaccggc gggaagctgg aggtggacca cgcggcgctg gtggcctcgc    104580
     tgctgtacta ctgggtgccg gactcgcgct gcgcgttgcg cgaggcggag aagctgccgc    104640
     cgggcagctg gctgcggtgc cggcccgacg gccgggtgga gcgcggccgg ttctggaatc    104700
     tgcgggacgt cgccgccgag ggccgggagc gggcccgcag cggcgagcgg ccggacctgg    104760
     ccgccgtcgt cgaggagtcg acccggcgcc acctgctctc cgacgtgccg gtggcgacgt    104820
     tcctctccgg cgggctggac tccagctacc tgaccgcgct ggcggcccgc gaccggcccg    104880
     ggatctccgc ctacacgatc gggttccgcg ccgaggacgc caggttcgag gcgatgcccg    104940
     acgacctgcg ctacgcccgg caggtggccg agcggttcgg cgtcgacctg cacgagatcg    105000
     agatcgcccc gaacgtgctc gacctgctgc cgcggatgac gtaccacctg gacgagccga    105060
     tcggcgaccc cgccgcgatc aacaccttcc tgatctgctc ggccgcccgg gaggccgggg    105120
     tcaaggtgat gctctcgggg atgggcgccg acgagctgtt cgccggctac cgcaagcacc    105180
     tggccaacgt gctggcgctg cgctaccagc gcgtcccgcg gccgctgcgg cgcggggtgt    105240
     ccgcagccgt gggccggctg ccggtcgcgt cgagccgccg ggggtaccgg tcggtgcgct    105300
     tcgcgaagcg gttcctgtcc ttcgccgatc tgccgcagga gaccgccttc cggcgcagct    105360
     acacgatgta cgaccgtcag gagctgctcg acctgatcga tccggatctg gcgggcacgg    105420
     tcgaggacgt gctgaccgag cacgcggacg tctacgagga caacgacctc gacgacttcg    105480
     tgaaccgcat gtgcctggcc gacgcccgga tgttcctgcc gggcctgaac ctcgcctaca    105540
     cggaccgctc cagcatggcc gcgtcgaccg aggtgcgggt gccgtacgtg gacgtcgagg    105600
     tggtgaaggc ggcgttcgcc gtgcccggtg accgcaagat cgtcgggcgg cagggcaagg    105660
     ccgtcctgaa ggaggcggcc acctcagtac tgccccggga gatcgtgtac cggcccaagg    105720
     gcctgttcag cgccccgctg cgggcctgga tgagccgtga cctggcgccg ctggtgcgcg    105780
     aggtggtgaa cgacggcgaa ctcgtcaggt cggggttcct gcgccgggac gcgctgcggc    105840
     ggctcgtcgc cgaggacgcc gccgggcagc gggacttctc caaacacctg tggcacgtgc    105900
     tgaccctcga gtactggtac cgcggcgcga cctccgggtc cggcgaccac tcctcgtcga    105960
     cggcctagca cctcggcact ccccctgcac ctcggcaccc cccacacctc agcacctccc    106020
     ccgcaccacg accggcagag agacaagagg accttcggtg aaacaggttg tgcagaacta    106080
     caagagcggc gagctggcgc tgctcgacgt gccggtgccg ggctgcaagc cgggcggcgt    106140
     gctggtgcgg accgcctact ccctgatctc caccggcacc gagctgatga aggtgtccga    106200
     ggccggcatg tcgatgctgg gcaaggccag gtcacggccg gaccaggtgg ccaaggtcgt    106260
     gcagagcgtg gccaccaacg gggtgcccgc cacctatcgc aaggtgatgg gcaagctgga    106320
     ctcctacaca cccctcggct actcgctgtg cggggtggtc gagcaggtcg gcgaggggat    106380
     cgacgacgtg aaggccggcg acctcgtggc ctgcgcaggc aacgagcacg ccctgcacgc    106440
     cgagctgaac tgggtgccgc gcaacctcta cgccccggtg ccggacggtc tcgcggcgcg    106500
     ggacgcggcc ttcggcaccg tcggttcgat cgcgctgcag ggcgtccgtc agggcgagtc    106560
     gcggctcggc gagacggccc tggtcatcgg gctcgggctg atcggccagc tggtggtgca    106620
     gctgctcgtc gcctcgggcg tgcgggtggt cggggccgac cccgacgcgg aacgctgcga    106680
     gctggccgag cggctgggcg ccgccgcctg cggcgatccc gcgtccccgg ccgtggagag    106740
     cgccgtcgtc gaactcaccg acggccacgg cgtggaccag gtgtacctgg cggccggcgg    106800
     cggcagcaac cagcccgtcg agctggccgc gcggctgtgc cgggaccgcg gccgggtcgt    106860
     cgacatcggc aagtgccgcc tggacctgcc gtggaacgcg tactacgaga aggagctgga    106920
     cgtccggttc tcccgctcct acggccccgg tcgttacgac ccggagtacg agctggaggg    106980
     gcgggactac ccgatcggct acgtccgctg gaccgagcgg cgcaatctgg cctgcttcct    107040
     cgacctcgtc gcccggggcc gggtcgacgt ggcgccgctg atcacccgta ccgccgactt    107100
     cgacgacgcg gtcgagacgt accggagtct gcaggacggc gccctcaagg cggtcgccgt    107160
     gctgttccgg taccccgggc agcccgacgc cgaggcgccg gccggggcgc cggcggtgac    107220
     ggtgcccggg gtgcggcgcg gcgccggcgc ggccgcaccg gcacgggccg cccggacacc    107280
     ggtgcgcctg gccttcgtcg gcgccggcaa ctacgcgacg tcgatgctgc tgccgcatct    107340
     ggcccggcgc gagggcgtcg agctgtcgac ggtcgtcacc acgacggcgc tgtccgcggc    107400
     caacgcgcag cgcaagttcg ggttcgggga ggcgacgacc gatctggacg ccgtgctcgg    107460
     cgacgcgtcc gtggacgcgg tgttcgtggt cacccggcac agctcgcacg ccgaactgac    107520
     ccgcaaggcg ctgctggccg gcaaggccgt cttcgtggag aagccgctgg cgctgaccgg    107580
     ggaggagctg accggagtgc tcgcggcggt ggaggagtcc ggcaacgacc gggtgcaggt    107640
     gggcttcaac cgccggttcg cgccgctgct ccaggaggcc aggaagcggt tcggcgcccg    107700
     caccggaccg gccagcctgc gctacctcgt caacgcgggg cggctcgacc acggcagctg    107760
     gtatctccag cagggcaccg agggctcgcg gttcgccggc gagggcggtc acttcgtcga    107820
     cacggcgagc tggctcctcg gggccgaccc cgtctcggtc tacgcgctcg ccccgtcgag    107880
     caacgaggac cttcaggtcg tgctgggcta cccggacggg tccaccgcca ccctcagcta    107940
     cgtcaccacc ggagcggccg gtttccccaa ggagacgctg gacctggtcg cggacggcaa    108000
     ggtgctgcag ctcgacgact tcgtccgcag ttcggtctac gacggccgca agcggtgggt    108060
     cagttcgcgg ctgcccaagg cccgggacaa gggccagtcg gccgaactgg ccgcgttcgt    108120
     ccgggcggtg cggaccggcg ggccgatgcc ggtgccgctc gagtcgctgg tcgccaccac    108180
     ggcggccacc ctcgccgtgc ggaccgctct ggccgccggc gctccggtgg gtctggcgga    108240
     ggcgcgatga ccgtgacccc ggggagtgcg ggctggtacc tgcggcggct gtcccggatg    108300
     gggccgcgcg aggtggccgg ccgggtgggc gacacggtgc gcaggcgacg gtggcggtcg    108360
     gtgcgaccgg acgccccggg cgtgagcggg gcccggttca ccgcggtcct gcccgccggg    108420
     acgatcgccg cggtgccgcc ggacgccgcg aagcgcctcg tcgccgaggc ggaccgcctg    108480
     ctggccgggc acgtcgagta cttcggcgtg cgccgcgacg acctggtcga gccggactgg    108540
     tgcttcgacc cgaagaccgg gcgccgggcg ccgtggggct acgccttcga cgtgccgtac    108600
     cgcgacgagg acgcggtcgg tgacatcaag cagatctggg agccgtcccg gcaccagtac    108660
     ctcaccgtgc tcgccgcggc ctacgcggtc accggcgacg agcggtacgc cgagcgcgtg    108720
     gccgagcacc tgcggtcgtg gtgggcggcc aacgcgccgc tgcgcggggt gcactgggtc    108780
     agcggcatcg agctggggat ccggctgctg tcctgggtgt ggatccgccg gctgctcgac    108840
     ggctggccgg gcgccgccgc gctcttcgag gacaacccgg cggcgctgga gcagatctgg    108900
     caccaccagc gctggctggc cgccttcccc agccggggtt cgtcggcgaa caaccacgtc    108960
     gtggcggagg ccgcggggca gttggccgcg gcctgcgcct tcgggtggtt ccccgagtcg    109020
     gcacggtggc gggacgacgc gctgcggtcg ctggagcggc acctgcgcgg caacacgttc    109080
     ctctccggcc tcaaccggga gctggccacc gagtaccacg ggctggtgct ggaactcggc    109140
     ctggccgcgg tggcggaggc ggacgccgcc ggtgtgccgg tgcccgcgac ggtccggctg    109200
     gtgctgctgc ggatgaccga cgcgctcgcc gccgtcgtgg acgaccggct gcgtccgccg    109260
     cggcaggggg acgcggacga cggccacggc ctggtggtgg acggcgcggg caccgaccgc    109320
     tggggctcgc tgctcgccac cggggacgcc gtgttcgggt cgcttccctg gtggccgacg    109380
     gtgaccggca cggatgtgcg caccccgctg ctggcggcgc tggtccggcc ctacggcggg    109440
     gacggagcgg ggcgggccgt gacccgcccg gcgcgcaggc cggcccactt cgcggacgcg    109500
     gggctcacgg tgctgcgcgg gccgggcggg atctggtgcc gctgcgacgg cggtccgcac    109560
     ggcttcctgt ccatcgccgc gcacgcccac gcggacgcgc tctcggtgga ggtccggcac    109620
     gacggggtcg acgtgctcgc cgacccgggg acctactgct accacggaca gccggtgtgg    109680
     cgggggtact tccgctcgac gctcggccac aacaccctgg agctggacgg cgccgaccag    109740
     tccgtctccg gcggcccgtt cctgtggacc cggcacgccc gcacccgggt cctggccgtg    109800
     gacacgtccg acgagaaggt gtcccgctgg tgcgccgagc acgacgggta cggggactcc    109860
     gtgcaccgcc gccgggtgga gctgacggcc gcgagccggg agctgcgggt ggtggacgag    109920
     gtgcgcggcc cgcgccggtc cgtgcgcctg gcgttccacc tcggcccggc ggtcgccgcg    109980
     gacctggcgg gcagccgcgc cgcgctcacc tggacccggg acggcgagga acgctcggcg    110040
     gtgctcgacc tgcccggcgc cctgtcctgg cgggcgcatc gcggggagac ggacccgccg    110100
     ctgggctggt actcccccgg cttcgggcgc aaggaaccgg ccaccaccct ggtcggcacc    110160
     ggtgtcaccg acggtgcgca ggagttcacg accgtactcg gctttcgcgg ctaggaaggg    110220
     aaggagggga ggacgcatgg ggagcaggcg gaggggcgga acgtggtcgg ccgcggcgtc    110280
     gctggcgctg gcgctgctgg cggccggctg taccggtacg ccggacgcca aggccccgga    110340
     gccgaccgcg ccgtcctccc cgtccggggc gcggaaggtg gcccgggtgt gcgagaagcc    110400
     cgccgccggt ccggcgaagg cgccggcggg tgcggtgacc gtcgatccgg cggtcgtcgg    110460
     cgacttggcc gacaagaccc gcaacagccc cgccaacacg accttctggc tccggccggg    110520
     caagcaccgg ctcgcgtccg accgctactc ccaggtcgtc cccaaggagg ggaaccgcta    110580
     cctcggcgca ccgggcgcgg tgctcgacgg ccgcaagacc aaccagtacg cgttcggcgg    110640
     caccgcgcgg gacgtcacca tcggccatct caccgtgcag ggtttcgtcg cgccccacga    110700
     cgagggtgtg gtcaaccacg actcggccga cggctgggtg atcgagcacg ccacgatccg    110760
     gcggaactcc ggcgccggac tgatggccgg tgaccgccag caggtccggg ccagctgtct    110820
     gcgcgacaac ggccagtacg gcatcaacgc gtacaagggc gacggcgtca tcaacgacct    110880
     cgtgctcgag ggcaacgaga tcacgggcaa caacaccggc gactgggagc gcaggcggcc    110940
     gggctgcggc tgcacggggg gcgtcaagtt ctgggccgtc cagggcgccg acgtgcgcgg    111000
     caactgggtg caccacaacc gcgggaccgg cctgtgggcg gacaccaaca acaacgactt    111060
     cctcatcgag gacaacgtgc tggagggcaa cgacggtgcc gcgctgatct acgagaccag    111120
     ctacaacgcg gtcgtccgcg agaacaccat ccggcgcaac aactgggtcg agggccgcga    111180
     gaacaccgac ggcggcgacg acttcccgta cgccaccgtg tacatctccg agtcgggcgg    111240
     cgaacctcgg gtcgaggcgc gcacggacaa gatcgagatc taccggaacg tgctggagga    111300
     caactggtcg ggcatcaccc tgtgggagaa cgcggaccgg ttctgcaaca gcccggccaa    111360
     cacctcctcg ggcgactgca cgttgctggt ggaggacgtc gaccgctgtg ctcgcccggc    111420
     gatcgcgagc gccccgctgt acgcggactg ccggtggaag acccagcggg tggacgtcca    111480
     cgacaaccgc ttcaccctgg acaagtccgt cgtcgagtgc accgacggtt gcgaccgcat    111540
     ggcgctgctg gccaactacg gcacctatcc ggactggtcg ccctaccggg gcgagcgggt    111600
     ggccgaggcc gtcacgctcc gccagcacaa ccgctggcac gacaacgtct acgtcggacc    111660
     gtggaagttc gtcgcccacg acccgagccg ggtgctcgac ttcgggcagt ggcggggcgc    111720
     gccctaccgg caggacgcgg acagcaccct gcgtcccggg ggcggtgatt gagatggaga    111780
     ccgggcgcac gccgaagctg gtcgggacgg tctgggggct gctgatcctc aacacgctcg    111840
     gctccacggg ggcggagacc gtcgtcccgc tgccccgctc gctcatccag atggtcacca    111900
     tgggcgcgct ggccgtcgcg ttctcgctgg cgctcgcgct caatctccgg ctgcgggtgc    111960
     gcgccagcgc cttcctgttc ctgctcaccc tgctgctggt gccgagcgtg atctccagcg    112020
     cggacctgga gtccgggttc ggcgcgctgt tccgctgtgc ccggctgggc ctcttcgtgg    112080
     gcaccctgtg gctgctcagc cgctggtggg acggcagccc cacgttcgtc cggcaccaca    112140
     tccggatgta cttcgcggtg ctctgcacgg tggccgcggg cgcgctcgtc tcaccgggtg    112200
     cggccatgcc cgacctgtac ggcgggcggc tggtcggcgc cctgtggccg ctcaccccgc    112260
     cccagatcgg ccagtacgcg gcggtgatca tcggtctcgc cctgctgctc gtgctgagcc    112320
     gccagaccga ccggcgcagc gcggccctgg tgatcgttcc gtccctgctg ctgctggtgc    112380
     tgacccatac ccgcacggcc accctcggtc tgctcgtcgg cctgacgctg gcgatcggct    112440
     cgctcgccct caccagcgcc gccgcccgcc gcttcttctc ctgggcggtg ctgtgcgccg    112500
     cggtggccgc ggtggcgttc gcctccgcgc tgcacgcgtg gttcctgcgc ggccagagcg    112560
     aggagaactt cagcaatctc accggccggg ccaaggtctg ggacgccctg ctggcggccc    112620
     ccaggacggt gggcgagaag gtgttcggca tcggcctggg cgacaagtcg ttcgacgggc    112680
     tgccgatcga caacagctgg ctggccgtct accacgagca gggtctgatc ggcatcgccc    112740
     tggtggcgac ggtcttcgtc gtgctgggcg gggtcgcgtt gctgcggccg ccgtccccgg    112800
     cgcgggcctg cgcgatcttc ctgatcagct actgcgccct cgcgtcgtac accgaggcgg    112860
     gtctgggcga cgcctcgccg tacctgctgc acctcgccgt ggccgcctcg ctgctggcct    112920
     cgcccgccgc ggccacgccc cgggtgacgc ccgaaccccc gcgccgacgc gtcccgcgct    112980
     gggcccgcac cccggaggtg acctgaccat gcacgtcctc gtggtgcaca accgatacaa    113040
     ctcggcccag ccgagcggcg agaacaacgt cgtcgaccag gaggtggcgc tgctgcgcgc    113100
     ggccggccac cgggtgggcc tgttcgagcg gcgcagtgac gacatcgcct cgcggtccct    113160
     gctcggcaag gtcgccgtgc cgctcctcgt gccgtggaac ccggcggtcc gccgggagct    113220
     ggccgaccgg ctgcgcaccg agcggccgga cgtggtgcac gtgcacaacg tcttcccgct    113280
     gctgtccccg gcggtgctgg ccgcctgcgc cgacgccggg gtcccggccg tcgccacgct    113340
     gcacaactac acgcaggtct gcccgcccgg cacactccag cgcgacggcc ggccgtgcac    113400
     cgagtgcgtc ggggcggcgc cgctgcccgc cgtgcggcac ggctgctacc ggaactcgcg    113460
     gctggcgacg gtgccgctcg cggtcggcct gtcggtgaac cggcggcgct ggtggtccgg    113520
     tgtggagcgg ttcttctgca tctcggcggc ccagcgtgag gtcctggtgg gggcgggcct    113580
     gccggccgaa cggctggcgg tgaagcacaa cttcgtgccc gaccccgagg cgcgccgtgc    113640
     gggccccggc gagcacctgc tgtacctcgg ccgcctcgcg gaggccaagg gcgtacggct    113700
     gctcatggag gcgtgggacg agctggccgc ggacggcggc gtgggcgttc cgctcgtcgt    113760
     cgccggcacg gggccgctgg aacgcgaggt gaccgcctgg gcggcgggcc gggacgacgt    113820
     gcgctacgtc ggcctgtacg acccggagca gtgcaggcgg gccctcgccc gctcggtggc    113880
     cgtggtggct ccctcgacgt ggctggaggc gttcggcctg gtggtcgtgg aggcgatggc    113940
     ggcgggggta ccggccgtcg ccgccgggca cggcgccttc gccgagctcg tcgacgacgg    114000
     ggtgaccggg ctgctgcacc ggccgggcga ggccgcctcg ctcgcgtccc gcatccgccg    114060
     gatcgcggcg gagccggagg gcaaccagga gatgggccgg gcggcccggc gccggtacga    114120
     gcagggcttc agcccggccg tcggcctgga gcgcctgctg gaggggtacc gcaccgcgat    114180
     cgcggggcgg tcggcactgg ctcgcgacgg ggacgtccgc gcgggcaggg gggatggggg    114240
     cagtagatga cacgatgccg actctgcggt tcggcggcga tggagagcgt cgtcgatctc    114300
     ggagcgactc cgccgtgcga gagtttcctc gccgcggacc aactggaccg gccggagccg    114360
     gcgtacccgt tgcacctgcg ggtgtgcacc gactgctggc tggcgcagat ccccgcgctg    114420
     atcacgcccg aggagacgtt cacgcagtac gcgtacttct cctcgtactc gagctcctgg    114480
     gtggagcacg cgcggacgtt cgtcaccggc gccgtggagc ggctgggcct cggcccgggc    114540
     tccttcgtgg tcgaggtggc gagcaacgac gggtatctgc tcaggcacat ggtggaccgc    114600
     gggatccgct gcctgggcgt ggagccgtcg gtgaacgtcg gtgcggcggc gcgggaggcg    114660
     ggggtgccca cgctcacgga gttcctgagc ccggacaccg gcgcggccgt gtccgccgag    114720
     cacggcccgg cggacctggt ggtggccaac aacgtgtacg cgcacatccc ggacgtggtc    114780
     ggcttcaccc aggggctgcg tgccctggtc gccgacgacg gctgggtctc gatcgaggtg    114840
     cagcacctgc tgaccctgat cgaggagaac cagtacgaca cgatctacca cgagcacttc    114900
     cagtactaca cggtcgcgtc cgcgatccgg gcgctggcga gcggcggcct cgcgctggtg    114960
     gacgtcgagc tgctgcccac gcacgggggt tccatccggc tgtgggcgcg gcccgccgag    115020
     gtggcgggtg agccgagccg ccgggtgagt gacgtgctgg accgggagaa ggcggccggg    115080
     ctgcgggagc tgtccgggta caccgagttc tcgtcccggg tggccaaggt gcggcgggac    115140
     ctgctgcggt tcctgatcga cgcggccgag cgcggcgaca cggtggtcgg ctacggcgcc    115200
     ccgggcaagg gcaacacgct gctcaaccac tgcggcgtcc ggcccgacct gctcgcgtac    115260
     acggtcgacc gcaatcccta caagcacggc aggttcaccc cgggcacccg cattccgatc    115320
     ctgtcgcccg agcggatcgc cgccgaccgg ccggactacg tcctcgtcct gccgtggaac    115380
     ctgcgggagg agctggtcga gcagctctcc ttcgtgcacg agtggggcgg ccgcctggtc    115440
     ttccccatac cggaactgag cgtggtcgag gccgcgtccg agaagggcac agcatgaagg    115500
     tcgtactgtt ctgcggcggc tacgggatgc ggatgcgcga gggcgccttg gacgacgtgc    115560
     ccaaaccgat ggcgatggtc ggcccgcggc cgctgatctg gcacgtcatg cgctactacg    115620
     cgcacttcgg gcacaaggag ttcatcctct gcctcggcta cggggcccac cacatcaagg    115680
     acttcttcct caactacgag gagacgacct ccaacgactt cgtgctgcgg ggcggacgga    115740
     ccgagctgct ctccgccgac atcgccgact ggacgatcac gttcgcgcag accggtatcg    115800
     agtcgcccat cggggagcgc ctgcgccggg tgcggcacca tctggacggc gacgagatgt    115860
     tcctcgccaa ctacgcggac gtgctcaccg acgcaccgct gcccgagatg atcgactcct    115920
     tcgcccggcg ggacgcgggc gcctcgatga tggtggtgcc gccgcagtcc tcgttccact    115980
     gcgtggacct cggtgaggac ggtctggtgg gcggcatcac cgcggtgagc gacctgccgc    116040
     tgtgggagaa cggcggctac ttcgtgctcc gccaggaggt cttcgaccac atcccggaga    116100
     acggggacct ggtggccgac ggatgcaccc aactggccaa gcgggggcgg ctggtggcgc    116160
     accagcaccg gggcttctgg aagccgaccg acacggtgaa ggagcgcgcc gcgctcgacg    116220
     ccgcctacgc ccggggggag cgcccgtggg ccgtgtggga acgggacggc gcgatgtcgg    116280
     gcgccggggt gaggaccgcg tgatacggct cggtgccggg agcccggaac ggatcgtcgc    116340
     ggtgggcgcg cactgcgacg acatcgccat cggtgccggc ggcacgctgc tgacggtgtg    116400
     cctggcgcgg ccgggggtgc gcgtcgacgc gctggtgctc tccggtggtg gcggtgagcg    116460
     ggagcgggag gagcgggccg cgctggccgc cttctgcccg ggcgccgacc tgcggctgac    116520
     ggtgctcaag ctgccggacg gccggatgcc ggcgcactgg gaggaggcca aggccgcggt    116580
     cgaggagctg cgcgagcgga ccgagccgga gctggtgctg tccccgcgca ccgacgacgc    116640
     gcaccaggac caccgcggtc tggcgaaact gatgaccacc gcgttccgcg accacctggt    116700
     gctgcgctac gagatcgtca agtgggacgg cgacctgggc cgcccgacgg cgtaccagcc    116760
     gctgtcggag gacgtcgccg aagagaaggt gcggctgctg caggagcact acccctcgca    116820
     gcggcaccgc ccctggtacg accgggaggc cttcctcggc ctcgcccgga tccgcggcat    116880
     cgaatgccac gcgcgctatg ccgaggcgtt cgacgtcgcc aaactcactc tcaacctggg    116940
     gggttgaacc ttgcgcgtac tgctcaccgg acaccagggc tacctgggca ccgtgatggc    117000
     cccggtcctc acggccgccg gacacgaggt cgtcggcctc gactccggac tgttcgccga    117060
     ctgcgtcctg ggtccggcgc ccgacgaccc gccggggcag cgggtcgacc tgcgcgacct    117120
     cacggccgag cacgtggcgg gggtggacgc ggtgatccac ctggccgcgc tctccaacga    117180
     cccgctgggc tcgctggcgc cggagctgac ctacgacatc aaccaccacg cgtcggtgcg    117240
     gctggcccgg ctggcccgcg acgccggggt gcagcgcttc ctgtacgcgt cgacgtgctc    117300
     ggtctacggc gccgcgggcg ggggcgacct ggtgaccgag gacgccccgc tgcgcccggt    117360
     gacgccgtac gcggagtcca aggtgcgggt ggaggacgat ctgcacgcgc tgtccgacgg    117420
     cgacttcagc ccggtgtaca tgcgcaacgc caccgccttc ggcttctcgc cccggctgcg    117480
     cgcggacatc gtgctgaaca acctggtggg ccacgcgctg ctgtccggcg aggtgctggt    117540
     gctctccgac ggcaccccgt ggcgcccgct ggtgcacgcc gccgacatcg cccgggcctt    117600
     cgccgccgcg ctggtggcgc cgcgggaggc ggtgcacgac cgggcgttca acatcggcag    117660
     cgaggtcaac aacgtgacgg tcgccgagat cgccgaggag gtggccgcgg cggtgtccgg    117720
     ctcgaaggtg gtgatcaccg gcgagacggg ggccgatccg cgctcctacc gggtggactt    117780
     ctcccggttc cgggccgcga tccccggctt cgactgcgag tggacggtga agcagggcgc    117840
     gctcgaactc gccgaggcct accggaagca cgggctgacc cgggaggact tcgagcagcg    117900
     cttcacccgc ctggccgtgc tgcgcgcggc cgccgggacc ggctccgtcg acgacaccct    117960
     gcggtggcgc cgatgaccca ggccggaggg gagatgtacg cgctggtgga gcggttgtac    118020
     ccgctgtgcc ggagcatcac gggcgacggt gtgcgcgcga ccctggacat cgtcgacgag    118080
     tacatccccc tgcacatgca cgaggtgccg accgggacac aggtgctgga ctggacggtg    118140
     ccgcaggagt ggaacatccg ggacgcgtac gtcgccgacg ccaccggccg ccgggtcgtc    118200
     gacttcgccg cgtccagcct ccatgtgctc ggctacagcg tgccggtgtc ggcgacgatg    118260
     ccgctggccg agctgcgtcc gcacctgcac accctgccgg accatccggc ctgggtgccg    118320
     taccgcacga gctactaccg gccccagtgg ggcttctgcc tggcccagga gacactcgac    118380
     gcgctgccgg agggcgacta cgaggtccgc atcgactcca cgctggcgga cggccacctc    118440
     acctacgccg agcacgtggt gcagggccag gtgtccgacg aggtgatcgt ctcctgccac    118500
     gtctgccacc cgtcgctggc caacgacaac ctggccggca tcgcggtggc cacgttcctg    118560
     gcccgggagc tggcggagcg gaatccgtac tacacctacc ggttcgtctt cgcgcccggc    118620
     accatcgggg cgatcacctg gctggcccgc aaccgggagc gggtggaacg ggtcaagcac    118680
     ggcctggtgc tggcctgcgc gggcgacccc gggcaggtga cgtacaagca gagccggcgt    118740
     ggcgacgcgg agatcgaccg ggtgctgcgg catgtgctga ccgactccga acgaccgcac    118800
     cgggtcgtgg agttcacgcc ctacggctac gacgagcggc agtactgctc gcccggcttc    118860
     gacctcggcg tgggctcgct cacccggact ccctacgcgg gctatccgga gtaccacacg    118920
     tccgcggaca acctggactt cgtctccccg gcggcgatgg cggacacgct cgccgtctgc    118980
     cgcgaggcgt tctccgtcct cgaccgcaac cggcggtacg tcaacctcag tccgtacggg    119040
     gagccgcagc tgggaaggcg tgggctgtac gactcgctgg gcggccgcag cgacgccaag    119100
     caggcccaga tggccatgct ctgggtgctc agcctctccg acggcgagca cagcctgctc    119160
     gacgtcgccg agcagtccgg gctgccgttc gagaccgtcg tcgaagcggc cgacgccctg    119220
     cacggcgccg gactcgtcaa ggcatgacgc cgatgaccgt cgaaggggag aagacgacga    119280
     caccggcgga acccgcccgg cggggcgtcg tcggcaggct gtcctggggg ctggccgacc    119340
     aggcggcctc cagcctgtcc aacttcgtgg tgggcatcta cgtggcacgc tcgctggggc    119400
     tgaccgcgtt cggcgtgttc agcctggcct gggtgaccta cggcgtggtc ctcaacgtct    119460
     cccgcgggct ggccaccgac ccgctggtgg tgcgcttcag cggcgtgccg gagtcgtcct    119520
     ggcgcggcgc ggtggcccgg gcgtcgggcg ccgcgctgct ggtcggcgcc gggatcggca    119580
     cggtgtccct ggtcgccggg ctggccatcg gcggccaggt gggagccgcg ttcgccgcgc    119640
     tcggcgtcgt actgccgggg ctgctgctcc aggacgcctg gcggtactcg ttcttcgccg    119700
     cgggtgtcgg ccgcaaggcg ttcgtcaacg acgtcgtgtg ggccgtcgcg ctcgtcccgg    119760
     ccatggtggt ggcggcccgc gcgggcagcg tgcccgcctt cctcctcgcc tggggcggat    119820
     cggccgcggt ggccggggtg tacggctggt tccagtccgg catcaggccg aggccggccg    119880
     gggcgcgcga gtggcatcgc gaccaccgcg acctcggcta ccggtacctg gtcgagaacg    119940
     tcggcgtcag cggcgccggc cagatacggg cgtacgggct cggcgcgatc gtcggggtcg    120000
     gtgccgtggg tgtgatccgg ggcgccgaac tgctgctcgg cccgttcctc gccgtgctga    120060
     tggggctgtc gctggtcacc gtggcggagg cggcgcgggt gctcaggcag gctccgcggc    120120
     ggctcgggaa gttctgcttc ctgctgggcg ccgggcagac cgtcgccgcg ctgctgtggg    120180
     gcgcggcact gctgctggtg ccggaccggc tcggcgaact ggtcctcggc gacgtctgga    120240
     gcggcgcttc ggagctcatc gtgccggtca cgctcagcgt cgcgggcgcc ggactcggca    120300
     ccggcgcggc ggccgggctg cgcgctctgg cggcggcccg gcgcagtctg cgctgccagt    120360
     tgttcgcctc cgcctgctac gtcgcgggcg ggctcggcgg tgcggtcgcg ggcggcacgg    120420
     tcggttcggc ctggggcgcc gccgccgcgt ccgtctgcgg ttcggtcgtg tggtggctgc    120480
     agttgcgggc cgccctgcgc gagcgcgacc accattccat tcccgaagtg aggaccacat    120540
     gaccccccac ccccggctga gcatcggcct tcccgtctac aacggcgagg agtatctggc    120600
     cgagtcgctg gacgccctcc tggggcagac ctacgagaac ttcgaactgg tgatctccga    120660
     caacgcgtcg accgacggca cccgggacat ctgccgccgg tacgccgcgc aggactcgcg    120720
     catccggtac atccggctgc cccgcaacat cggcgccgcg ccgaaccaca actacgtgtt    120780
     caccgagtgc cgcggcgagc tgttcaagtg ggcctcgcac gacgacctct acgcccggga    120840
     cctgctgcgc agttgtgtgg cggcgctgga cgagcggccg gaggtggtcc tcgcgcacgc    120900
     cggccaggcc gtcatcgacg gcgacggcaa ggtgaaggtc ccctacgagt acgggctcgc    120960
     caccgactcc ccgcgcgctc cggagcgctt ccgcagcctg ctcttcgagc ccgggggcga    121020
     cgacttctac ggggtgatgc ggtccgcgat gctgcgccgg gtcaagccgc acgacagcta    121080
     ccaccacgcg gaccgcacct tcgtcgccga gatcaccctg cacggcccct tccaccaggt    121140
     gccggagctg ctgtacttcc gccgcgacca ccccacccgc gccgaacggg cgaacccctc    121200
     caagcgctcc cggtgcgtca acctggaccc gcgccgggcg ggcccgctgc acccgacgcc    121260
     ccggctgctc gccgagtacg tctggggctt cgcctcggcg atcgggcggg cgccgctgtc    121320
     ctcggccgac cggcgtgcct gccaccgcca tctggcggcg tggctgacca gccgggtccg    121380
     gccgggcgtc ggcgagcggg tcgaggaccg cgctcccgtc gacccggacc ggctcaccgt    121440
     ctccgtcgac gacctggtcg ccggccgcga gggaaggcag gcatgacctc catgcgcgaa    121500
     aagcctttac gcattggcgt gttcggcctg ttcggtgccg gcaacagcgg caacgacggg    121560
     tcgctggaag ccgtgctcga ccacctgagg gccgcacatc ccgacgcggt cgtggacgcg    121620
     atgtgcggcg gacccgaaac cgtcgcgacc cggtacgggg ttcccgcgac gcggctcaac    121680
     tggtaccgcg gggagtaccg gaccgcttcg cgcgcgagcg cgatcgccgc caaggccctg    121740
     ggcaagctcg tcgacgtgtt ccgcaccgcc gcctgggtgc gccggcacga cgcggtgatc    121800
     gtgccgggca cgggagtcct ggagaccacg ctgccgctca ggccctgggg cttcccgtac    121860
     tcgctgttcc tgctctgcct gacgggccgg ctgttcggca cccgcgtcgc gctggtcagt    121920
     gtcggcgccg gtgcgatcgg ggtccggccg acccgggtac tgacgcgctg gtcgacgcgg    121980
     ctggccgcgt accggtcgta ccgggacgac cagtcgcgcg acgccatgcg ggcgatgggc    122040
     gtgaacaccg cgcgggacga ggtctacgcg gacctggtct tcgccctgcc ggggccgtcc    122100
     gcgagcgagc ccgtggagac gcggggcccg gtctgcgtcg gcgtgatgga cttccacggc    122160
     agcaacgacg agcgggacgt ggccgaggag atccaccggc gctacctcga cgggacgact    122220
     cggttcgtcc gtgcgctggt cgaggagggc aggccggtcc ggctgctcac cggcgacgag    122280
     ctcgaccggc cggtggccgc cgcgatcgtc gacgcggtgg gctcgccgct ggtcaccgtc    122340
     gccgaggcgg cctcgctggc cgacctgatg aaggagacgg ccagtgccga caccgtggtg    122400
     gcgacccggt accacaacct ggtctgcgcc ctgaaggtcg gcacaccgac cctggctctc    122460
     agctactcgg gcaagagcga cgccctgatg gccgagatgg ggatgggggc ctactgccat    122520
     ccggcccgcg aggccgacgc cgaccggctg ctcgaacagt tccgcgagct ggaacggcgg    122580
     tcgggcccgg tgcggcgcac cctctgcgag cggaacctgg tcgtcgcccg gcgcgtcgag    122640
     gaccagttcg ccgcgctgac cacggcgctg ttcccggcga ccgaccacgc ccacgccctg    122700
     cgggaggcac catgaaggcg accgaagtgc cggagatctc cggcgcgtac ctgttccggc    122760
     ccacgccgca cgcggacgca cgcggattct tctgccgcac gttcgacgcc gatgtcgtcc    122820
     gctcggtggg tctcgacccg gccgccttcg tccaggacag cgtgtcgcgc tcggtccggg    122880
     gcgtgctgcg cggcctgcac ctgcgctccg gcgccggtga ggccaagctg gtgcggtgct    122940
     ccaacgggag gatcttcgac gccgtcgtgg acctgcgtgc ggactcgccg acctatctgg    123000
     gccgggcgtt cttcgagctg tccggcgaga cgcagacgac cctgtacatc ccggcggggt    123060
     gtgcgcacgg cttccagtcg ctgacggaga cctccgacgt ctcgtaccgg atcgaccgcg    123120
     cgcacgaccc ggccgaggac gtgacgatcg ccttcgacga cccggacctc gccatcgact    123180
     ggccgctgcc ggtcgcctcg gtgtcccccc gggaccggga ggcgccgagc ctcgccgact    123240
     tcctcaagca cagggaggga tgagcccgaa gtgaacgccg aagaactcgg tctgccccgg    123300
     tcgcggcagg ccaacgagcg gctgcacgcc ctggtccccg gcggcgcgca cacctacgcc    123360
     aagggcgacg accagtaccc ggagaacctg gccccggtga tcagccacgg ccggggtgcc    123420
     cacgtgtggg acgtcgacgg caaccgctac gtcgagtacg gctccggcct gcggtcggtc    123480
     agcctcggcc acgcccaccc gcgcgtgacg gaggccgtac gacgggagct cgaccggggc    123540
     agcaacttcg tccggccgtc catcgtggag gtcgacgccg cggaacgctt cctggccacg    123600
     gtgcccacgg cggagatggt gaagttcgcg aagaacggct ccgacgccac cacggcggcg    123660
     gtgcgcctgg cccgcgccgc caccggacgg ccccgggtgg ccgtctgcgc cgaccatccg    123720
     ttcttctcgg tcgacgactg gttcatcggc accacgccga tgtcggccgg cattccggcg    123780
     gcgaccaacg agctgaccgt ggcgttcccc tacggcgacc tggccgccac ggaggacctg    123840
     ctcgcccggc acgagggcga ggtggcctgc ctgatcctgg agcccgccac ccacaccgag    123900
     ccgccgcccg gctacctcgc cggtctgcgc gagctggccg accggcacgg gtgcgtcctg    123960
     gtcttcgacg agatgatcac cgggttccgg tggtcggagg cgggcgccca gggcctgtac    124020
     ggcgtggtcc ccgacctctc cacgttcgga aaagcgctgg gcaacgggtt cgccgtcgcc    124080
     gcgctggccg ggcgccggga gctgatggag ctcggcggac tgcggcactc cggcgaccgg    124140
     gtcttcctgc tgtccaccac ccacggggcg gagacgcacg cgctggcggc cgcgatggcc    124200
     gtgcagggca cctacgtcga ggagggcgtc accgcgcggc tgcacgcgct cggcgaccgg    124260
     ctggccgccg gcgtccggga ggccgcggcg agcatgggtg tcggcgacca cgtcgtcgtc    124320
     cggggccggg ccagcaacct ggtcttcgcc accctcgacg agaacgggca gccgtcgcag    124380
     cggtaccgca ccctgttcct gcgccaactc ctggcgggcg gggtgctggc gccgtccttc    124440
     gtggtgagca gcgcgctcgg cgacgccgac ctcgaccaca ccgtggacgt ggtggccgag    124500
     gcgtgtgcgg tgtaccggaa ggcgctggac gccgccgatc ccacgccctg gatggccgga    124560
     cggccggtga agccggtgtt ccgccgcttg gtgtgaggcc gggcgaaccg tggcggggcg    124620
     aaccgtggcg gggcgacgcg ggccgacgtg ccgtcagctg ccctgctgcc gaccggcgtc    124680
     ggccctccgc tcggcccgcc ggtcgcaggg cgggccggcc gtccactcgt ccggcgggtg    124740
     ggccgggagg ccggcccacc ggtcggtcag ccggtcggcc gtccggtcga ccagccacgc    124800
     ggtgaccggg agcaccgcca gcgcggtgca ccagccgccg agggtgtcgg tcgcgtagtg    124860
     ggagcccagg gcgacctgcg cccagcccat ggccgcgccg gccaccagcc ccgccgcgaa    124920
     cacgaaggcc gtgccggccg ccctgccgag accgaggcgt ccggccgcga gcagcgacac    124980
     catgagggcg atcgcggtga ggaaggcggt gtgcccgctc gggtaggaga ggttgtcgcc    125040
     gtggatggtg cgccccacca cgggtttgag cagcgtcgtc gtccccacgg tcaggcctgc    125100
     gccggtcacg acgaacaccg ccgcgcgcgg atgccggagc agcaggcagc cggtcacgac    125160
     ggccgcgacc agcagcaccg cccccgcggg ctcccccagg aagtccgtga ccacggcgac    125220
     gtgccgccac ggcggcccca ccccgtccac cgccgcgaag atccgcatgt cccactcgcg    125280
     cggctcgctc tcgtcggcgt acacggcccc gaggacgagg accaccggcg cggcgaggca    125340
     ggccatcagc acgaaccaca cgcgcagcca cgacggcagc accgcgggcc ccggccggcc    125400
     ggtcacccgc ccaccgcccc gggcggcctg cggtactgtc ccacgtcctc gtccactccc    125460
     ccgcttcgcc cggctcggcg gcggtcgcgc cggtcagcct ccggtcgggg ccaccgtagt    125520
     cgctccagcg ggccggataa cagccgattc gggccattgc gcaaagagtg ccgcgaatcg    125580
     ttcggacgcg gtccgcatgc gcgcgccctc agcgttccgc ccgcccggac ggtgcggccg    125640
     acgtgcgtct gcgggctctg taggccgcgg ccttgacgcg gttgccgcac tcctccatcc    125700
     cgcaccaggc gcgccgggcg ccgcgtgagc ggtcgaggta gacgcgggtg cagtcggtgc    125760
     gtccgcactc cttgaggcgg gcgccggggt cggcgagcac ggcgataccg ctcctggcca    125820
     catgggtcag tacggcgggc aggcccccgg acatccgcac ccccgcgtcg ccgagccgga    125880
     cggtgggcag cggcccggcg gcggcggcgt tgacgacctc gaggctcggg atgtggaaac    125940
     ggcggtcgag gacgcggtcg agcgcgagac ggtagacggc ttcccgcagg ttcagtgccg    126000
     cgtcgaaggc cgagggggtg gcggtgacgc ggtcgggcag cccctcgcag gcggccaccc    126060
     accggccgag gtccgcgggc actgccagca ggtcgaccgg ctcgtcccgg cgggacagca    126120
     cggtgccggt cagatcgagg gccgggttgc cactcacgaa ggcgaagtcc acgtcaccat    126180
     cttgaccggt gacggcaagg atcggcaagg tgggtcccgt cgtcacctgt tgaggtggtg    126240
     acgtggtggc gagcgggcgc gagagcgcgg aagaaggagt gagggcgggc atggctggtg    126300
     ggatcctcgg catcgaggtc gtcgtcttcg acgtcctcgg cacactggtg gacgagcccg    126360
     gcgggcttcg ggcggggatc cgggaggcgg tgcccgcggc cgacgacgcg tttgtcgacg    126420
     agttgctcgc cctgtggcag gggcacgtgg agcgggagca gcggcgcgtc gtgcgggggc    126480
     ggcgcgcgta cgccgacagc gggatcatcg acgcggaggc cgctcggctg gtggccgacc    126540
     gtgcgggcgt cggtgatccg gcggccgtcg accggctggc cggggcgggc cggcgcctgc    126600
     cgccctggag cgactccgcc gccggactgg accggctgac gcggcgcctg gtggtgctgg    126660
     gcctctccaa cgccagtcac accgccgtgc cgcggatcgc cgcgtacgcc gggctgcgct    126720
     ggcacggggc cctgtcgggc gagaccgtcc gcgcctacaa gccggcgccg gaggtctacc    126780
     ggctcgccgt cgacaccgcg gggtgcccgc cggaccgcgt gctcatggtg gccgctcacg    126840
     cctgggacct ccgcggcgcc cgggcgggcg gcatgcggac cgcgtacgtg cgccgccccg    126900
     gcggagatcc gccgacgggc tccgacgact tcgacggacg cttcgaggca ctggacgaac    126960
     tggccgacgc gctccgcctc tgagcacgtg gccgtgggaa ccgggcggcc ggttctacgg    127020
     cttgcgggcc atcccggcgg cgatgagacg ctcccagacg gtcaactccc gttcaccgcc    127080
     gtcgtcgtac gttccggcgg tcgtcccggg acgccacagg gacgccggca ctatccccgg    127140
     ctccaggatc tccagtccgt ccagcagggc ctcgatctcc gcgtccgtcc gccaccggcc    127200
     gcggccgaac gtctcctgga ggaccttctc cgcctccacc gtctccgggt tgttcccgga    127260
     gcggaagtgg ctgacgaaga agaggctccc ggaaggcact tggccgcgcc agtagcggac    127320
     gatcgcggcg gggtcctcgt cgtcgttgac gtggtggagg atggcgctga acatgacggc    127380
     gacgggacgg tcgaagtcga tcagctgccg ggtgtccggg tggctgcgga tcccctcggg    127440
     gtcgcgcaca tcgacgggca cgaaccgggt ccggtcgttc tcctccagca gcgcccgccc    127500
     gtggacgagg acttggggat cggtgtcgac gtacaccacc cgggtctcgg gcgcccgccg    127560
     ttgcgcgacc tggtgcacgt tgtcggcggt gggcaggccg ctgccgaggt cgatgaactg    127620
     gcgcaccccg gtcctcgtca cgatctcccc caccgcccgc gtcagcgccg cgcgattggc    127680
     gaaggcgatc gccaccgaac ccggcaggtc gcgtttgaac acgtcgccga tctcgcggtc    127740
     cgccgcgtag ttgtccttgc cgccgagcag gtagtcgtag acccgggcga tggtcggcct    127800
     ggtgctgtcg atggaggaac tctctcccgt catggcatcc atcctctccc gcgcgggggc    127860
     accgcgacca ccacttgttt gaccttgaca ccgtgacaag gtcttcactt gctgcccagg    127920
     aggtggtccc gatgaccatg acgagacagg acacggatgc cctgggagcg ttcgagagcc    127980
     tggccgaccc cagtgcgtcc gtgcggctgc gggcggccct cgcggtcggt acggcaccgc    128040
     acccgcgctt cgtggaaggg ctcgtcgaac ggtccgcggt cgagccggag ttcttcgtcc    128100
     gcgacatgct gacctgggcg ctcacccgtc atccggtggc cgcgacgctt cccccgctgg    128160
     tccgtgaggt gggctcgaag ctcccgcagg cgcgcagcca ggcgctgcac acgctgtcca    128220
     agatcgggga ccggcgggcg tggccggcgg tcaccggggc ggcgctgtcc gacgccgacg    128280
     acgaggtggc acgcagcgcc tggcgggccg cggtcgtcct cgtccccgag ggcgaggagc    128340
     aggccctggc ccgggcgctg gccccgcagt tggggcgcgg cgaccgggag acgcagctga    128400
     gtctcagccg ggcgctggtc gcgctgggcg agtcggccgg ggcggtcctg gaggccgccg    128460
     cgacgaccgc ccccgccccg cacgtgcgtg cgcacgccct ggccacgcgg cggctgctgc    128520
     gcgacccgga ctccgggttc gaggcggcga tcgaggaggc gaagcgcgtc gtggccctcg    128580
     gcgggtccgg tcacgaggga ccatagaacg tgttgatcgg tgaggtggcg cgacggtccg    128640
     gggtcagtgc ccgcatgctc aggcactacg agtcgctcgg cctggtgcgg ccctcgggac    128700
     gtacgggctc gggataccgg gagtactccc gtgcggacat ccggcggatc ttccacatcg    128760
     agagcctgcg gtcgctgggg ctgtcgctgc gcgagatcgg ccgcgcgctc gacgaacccg    128820
     ggttcgctcc cgccgcactc gtggacgacc tcatccgccg cacacgtgaa cggatcgcgg    128880
     cggagacgga gttgctcacc cggctgcgcc ggatcgacgc ggcgggcccg gccggctggg    128940
     aggacgtcct ccaggccgtc gcgctcctcc aggcactggg ctcgaagagc gcggacgcac    129000
     gccagcgcgc ggccctctcc tcggtccagg acgcctcggt gccggtggag gccctggtcg    129060
     acgcggtgct gagcgagacg gacaccaatg tcgccggagc ccttcgctgg gcgctggcac    129120
     gatcgggcga cgacgccgcg gcactgctgg cccgggggct ggactcaccg gtggcggagg    129180
     tgcgggcgcg tgccgtgcgg gcgctcgccg agctgtccgg cgtggaggcc accgcgcggc    129240
     tgcggcacgc cctcgacgga cccgacgccg tggtccgcgg gtacgcggca ctggcgctcg    129300
     ggtcgcgcgg ggcgggcgag gcggtgccga cgctcgtcga catgatcgtg gcgggacgga    129360
     acgacaccga cgcggccgac gcgctgagcg tgctggcgag cgaccccgcg acggcggacc    129420
     ggatcgccgc cgggctcgtc ggccgtctct gcgacggcac caccgacgcg gccgcgcgcg    129480
     gccggctgac gcaggcgctt gcgggcatcc cgggcacgcg ggcgtccagt gccctggcgg    129540
     aactgtcccg ggacgaggag cgcgccgtcg cgctcaccgc gacgtatctg ctgcggctgc    129600
     gcgaggagcc gtaaatgctt cgacagttcg cctcccgccg ggcaacatgg ccgaccgtga    129660
     cgagcagcca gctgtggacc cgtgagaccg ccgaccgcta cgacgccgag gaggcggaga    129720
     gcgggatggg ctccgccgcc gttctgggac cgaccgtcga cttcctcgcc gagctcgccg    129780
     gggagggccg ggcactggag ttcgccatcg ggaccgggcg cgtgggcgtc ccgctgcggg    129840
     aacgcggcgt gccggtggcg ggcatcgagc tttccgagca catggcggcg gtcctgcggc    129900
     gcaaggccgc cgaggagacg ctgccggtga ccctcgggga catggccacg accgtggtgc    129960
     ccggcgagtt caccctggtc tatctcgtgt acaacaccat caccaacctg ctcacgcagg    130020
     acgagcaggt cgagtgtttc cgcaacgcgg cccgccatct gggccccggc ggccgattcg    130080
     tcatcgagct gggtgtgcca ccgctgcggt tcctgccgcc cgggcaggtc gcggtgccgt    130140
     tcgacgtctc cgagcggcac ctcggcttcg acaccttcga cctggtcgag cagatcctcg    130200
     tctccaacca cttcacgcgc gaccccggcg acggctccta ccgccgggac aactcccggc    130260
     accggtacgc ctggccggcg gagctcgacc tgatggcccg gatcgccgga ctcgagctgg    130320
     agcgacgcgt cgcggactgg gacggggctc cgttcaccgc ggactcggcg aagcacatct    130380
     ccgtgtggcg caagcccgcc tgagtcgctc acgacgtgct cctgtgggtg cggagaaatg    130440
     caaacggggg ctccgccgta cggtggagcc cccggccggt ccggcgccgc gtcagcgttg    130500
     gccggcgaac cagtccttct gcggggcctt ggcggccagc gcgccgcagt tggagccgta    130560
     gttccaggcc tgcagattgc cgatgacgcc gccccactcg acgcaggcgc cgcgcgcgga    130620
     cacgtagacc ggcccggcgt acgaccggta gtcgccctcg tcgtactggt ccgcgccgct    130680
     ttcgatgttg cgcacgtagg ccaccatgta cgtcggtgtg cccgtcgtgt tgcggatggt    130740
     cacggtgcag ttcttgcccg tggccgagtt gtaggtgagg tacaccgtgc cggtggaacc    130800
     gatcggcatg gagttcacca ccttgtagcc ggagccgcag accccgttgt acgacgcggt    130860
     cgcgcccgcg gtcgccgcgc cggcggcggg ggcggtcacc aacagccccg ccccgatggc    130920
     cccgacggcg gtcagcgtcg cccctacggc ttgcatggaa cgcttcatgg cacctcgatc    130980
     cgtgaatcga ctggcctccc cttggtgttg ctgaagccac cagttgagac ctttgcaccc    131040
     cttcgggggt tgtacgtcgt tggcagatgt ttacgactgt tcgcggagaa gatcaccgga    131100
     ggccccttcg gcgcccggca ccggcagcgc cagatgggcg aggtctcccg gtggtggcgt    131160
     gctcaccggc cacagcgggg cgggcgtacc gtcggcgacc gcggccgggg cgtcggtgag    131220
     ccgcatgcgc tcgcgcaggc ggccgtagaa gtccatgggc cccagccgca ccgcccgcag    131280
     ccggcgcggg gcggcgtaga cgccgagcca gtcaccggga tcgagcacgc cccgcagctg    131340
     tccgtcgatg ctcacggcgg cccggcccga ccgttcgagg atccgcagcc cgacgggctc    131400
     gtccggtgcg gtgaccacgg agcggtcgaa cgtcatgtgc ggggccaccg cggtgaagac    131460
     gagggcttcg gcgcggggcg acacgaccgg gccgcccgcg gcgaaactgt aggcggtgga    131520
     tcccgtcggg gtcgcgacga gcagcgcgtc ggcggagtac gaggcgagca gccggcccgc    131580
     gatgtagacc ccgacggaga tctgccggtc cctcgacagc ttctcgagca cgacgtcgtt    131640
     gagggccgtg acgttcaggg cgatgcccca ctcgtcgccg ctctcgcagt cggtccgcac    131700
     ccgcgggggc ggcagcagcg gtccgcgccc gtaccgcagg agcgcttcca tctccgcggg    131760
     gatctccagg agccgggagg cacgcagagt gagcagcatg cggctctccg gctccagccc    131820
     gccgtcccgg acggcgtcga gggcggagcg caccgccggg gcgggcacct cggtcaggaa    131880
     ccccactcgt cccaggtcca cgcccaggat gagggcgtcg ttctccgccg ccagccgtgc    131940
     gccgcgcagg aaggtgccgt caccgcccag ggtcacgacg aggtccgggt cgccggccgc    132000
     gtccacctcc tcccgggcgc tgtgccgccc ggtatcgctc cacacgtcga tgtccgtgca    132060
     ggcgacggcg ttctcgtcgc accactcccg gacttcccgt gccgcttcgg cggcgccctc    132120
     gcgaccaccg tggaccacga gtccgacccg ctcgatcgtc accactgcct cctgccgccg    132180
     ggccgtgctc ccgcaaccgc gatcgacgga atcctcgccg acccccgcgg cggggcgggc    132240
     cgcgacatgc cgggcctccc tcttccgtcc ggcgagtcgc gcgtcaggta ccgagtaggt    132300
     accatgccgg tatgccatca ctgaacgtga ccttcaccga ggaagagatg gaaggcgtcc    132360
     gcgctgccgc cgcagccgag ggcaagagcc tgaagcagta catgcacgac ctcggcgtcc    132420
     gcgagatgca gcgcaagcgg ttcgtcgccg gggccgtctc gtgggcggac cggctgcgcg    132480
     ccgagttcga cgaggccttc ccggacgaga tccccccgtc ccagcgcggc gagggagtca    132540
     ccgccgcctg atgagcgagc ccctgtacat cgatgtcccg tggctcctgg acgtgcagga    132600
     cgccgctctg gacaacgagg acgtgtcggt cacggactac tccgccctgg tcgcggcggt    132660
     ggcccgccac aagacccgga tgcccaccct ggccgcgtcc aaccccgaca gcgcctggcg    132720
     cgcggccgcg ctcctgcaca cggtggtgcg gctcgaaccg ctcccccacc gcaacagcct    132780
     cttcgcggcc ttcgtcaccg gtcagtacat ggaccagtcc ggggagggaa tcgacccgcc    132840
     ctacggggcg ctgtccgacc tgatcagaaa ggtccgcgag acccggctga gcatctacga    132900
     catcgccgac gtgctccgtt cctggcgcat ttgacctccg gatctccagc cgccggagtc    132960
     gtcacatccc gcgccagatg ttgtcgaacg ccgcttcctc gatactgcgg cgctggcgga    133020
     tcgcggccag ttccaccacg acgtcgttca ccgcggcgag caccgtcgcg accccgtcgt    133080
     cctcgggatc cgccacctgg tcggccgact cgtgccggac gcccaccgcg gccgcgaaac    133140
     ccgccagcac ggggtccgca ccggaccagc ggtcggtggc gcgccggtgg gccgccggat    133200
     cggccggggc cggacggccg gtgccaccgc gtgcgttccg ccgcgggcgc cgtcggccgc    133260
     cctcgtccgc tcccgcggcc gcgaggtacc gcgccgccag gccgtcgccc cggcgccaca    133320
     gccagtccgt cacggactcg gccgggtccc cgccgagcag cgacgccgcc tcgtcgagga    133380
     gccggtcacc ggacgcggcc cgcgacaccg gccgcagcag gtcgccgtcc agctcgaccg    133440
     tccccgcctc catcaggtcg atcagttccg ctccggccag ggccagtgac aggtcgccgc    133500
     gctcgaccgg atagtcggag gggacctcga gagagacgat cgtcaggtcg tgcgccgtgg    133560
     tcatgcggat ctccacatct gtcagatctg ctgcgacaca ccggccgcga tcccgttcag    133620
     cctacccacg gccccagctt ctcggggttg cggaccaccc agatgcgggt gacacggccg    133680
     tcggcgacgt cgaaggccgc gacggtcatg acggcgccgt cgcgccgggc caccaggccc    133740
     ggcaccccgt tgaccgagcg ctccaggagt tcgagtcccg gggccttgtc ggcgacggcg    133800
     gccatgtact gggcgatgcg ggcaccgccc tcgatcgggc gcagggcggt gccgaccatg    133860
     ccgccgccgt cggcggtcat gaccgcggcc gggtcgagga ggtcgacgag agcggcgatg    133920
     tccttggtct gccacgcctc cttgacctgc cgcaccacgt cggcccgcac cgcggccggc    133980
     gtctgcggag cccgcgcgcc gcgcacccgg cgccgggccg aggccgcgag ctgcttgcag    134040
     gccgcggggg tccggcggag gatgcccgcg atgtcggcga aggggtagcg gaagacgtcg    134100
     tggaggacga aggcgacccg ctcggccggc gtcatcgact ccaggacgac gaggaaggcc    134160
     atggtcaccg actcgtccag gaccatctgg tcggcaggat cggcgccgtg gccggggccc    134220
     cgctcggcgt gggcggggag gggatccggc agccacgcgc cgacgtagcg ttcacgccgg    134280
     gcccgcgccg agccgagcgc gtccagacag acccggccgg tcacggtcgt cagccaggcc    134340
     cccggggaca cgatctcctc ctgccggctc cggggcagcg cgtaccagcg tgcgtaggcc    134400
     tcctgcacgg cgtcctcggc ctcggccagc gaaccgagca accggtaggc gacattgatc    134460
     agttgacgac gctcgccgac cgtcgcgtcg gtactcgtcc cagccgtccc catccccgac    134520
     cgccccctcg ccttaccttt caccggcccg cgtcgtcggg ctggtgagac cttaccgatc    134580
     cactgccctc cggggcggaa atggggaccg cggcatggca acccaggcga cggcgcagca    134640
     ccgactctcc ttcctgcgga tcgcgatcgc cctgcagaca ctcaccatct tcctccaggc    134700
     ggtctccgcc ggactgctgc tgaccgcgtc ctacggggaa acactgcaca gcgtcggtgc    134760
     ccgggtgatg tacggggcgt cgatgctgta cgtgctcgcg gcggtgctgg cgtggaagcc    134820
     gggcggcggc ccgctgcggc ccgtccggca cgcctgcggc ttcctcgtcc tcgcctcggt    134880
     ccaggtcgtg ctcggcatcg cacatgttcc gtcggtccat ctgcccctgg gggtcctgat    134940
     gttcggcctg agcgtgctgg cgctggcgcg gcgttgagcg ccctcacccc tccggggccg    135000
     tccccggtcg ccgggcgtgg cggaggcagg aggcggccac cacgaagggc cacagcgact    135060
     ggagggaggt cacgacgcgt tcggcgacgc cggcgtcgcc gtgctgccgc atctcgatca    135120
     ggaaccacac tccaccggcg gccatcaggg tcgtcacggc gatcgagggc gcgagacgca    135180
     gcgcccaggg accggccgga cctccgttga cggccagcac cggccagacc gccaggagcg    135240
     tgaacccgac caccaccacc gcgccgtgcc gcagggagcc tccgctgctg ggcgcgggga    135300
     gcgccaccag gaccagcgcg gcgagtccgc caccgcccag cgccacgcgt ccggcggtgg    135360
     cggcgggccg cagcccccag gcggtcagca ggtggcagac gcccagggcc aggaacgccg    135420
     ccgtcatcac ccagaatccg gcggctccgt aggcccccag aacgctgatg gtctggctga    135480
     cgggatcgta ggaagcccct tcggcgtacg cggcgccggt ccagcctgcg atcagcagta    135540
     cgggtgcgca tcccgacgag agcaggaccc atctgggaac aaatcgcatc gggcaaccat    135600
     aaagcgggcg gccatggcac gcaccgcacg caccgccgtg ctcctggacc tcacacgggc    135660
     gggttgagcg cgcggaagta cgtccagctg gtctcgttcg gctcgctcca cctctccggg    135720
     gcccgggcga accgcgggtg gtggccggcg atgtgggcac gggtgcgctc gggcacctcc    135780
     gtgtacgagc cgagcttgcg gccgcggcag tggtaggtga ggccgccggg ccgcccgccg    135840
     cgggccatcc acgggaccca cggggacatc cgggtccacg acatggtcgc cgggacgctg    135900
     gggtccggtc cggccaggtc ctcgcggcgg gcgaagaact ggaagagttc cagggcccgg    135960
     tacatgtcac cggccgagtg gcgggggtac tgggccgtcg gcaggggcga ggggtaggcg    136020
     agcgggatct ccaggctgaa gcagacctgg tcgcccaggt cggtcgtcgg gaccgggaag    136080
     gggcgccact tctggttcgc cgggtcgttc cagacgtgca ccaccggctg gtcccgccag    136140
     gtctccagga tgtcgccggt gacggggtcc aggtagaacg cggcctcacg ggtgagcagc    136200
     cggtaggagt ccgggccgtc ctcggcgtcg tggacgaggc gggcgacgtt gacgccttcg    136260
     aagccgaaga gacgctcgta gggctcgtcg ggcgcccatg cgaacacact tccggaccac    136320
     cagtacgtga cctcctcgcc gtcgagggag gcccgggtgc gggcgaggga gcggagcgac    136380
     tgcgcgggtg tcgtcatggg acgtactctg cgcgaccgcc gcgcccgccg gccgggaatc    136440
     ggggcgaccc gcccgatgaa tccgggcggc ggaccgggtc tcccctgtat gactcgcatc    136500
     atcgcggaca tctcgatctc cctcgacggc tgcgtcaccg ggcccgatcc cggcccgggc    136560
     aacggtctgg gcaccggcgg cgaggccctg cacacctggg cgttctccga cgatcccgag    136620
     gagcgccgga tcgtgcgcga gacgaccgcc cggtcgggcg ccgtcgtcct cggccgccgg    136680
     ctcttcgacc tggtggacgg accgggcggc tgggacgaca ccgtcggcta cggcgccgcg    136740
     gaggtcggca gacccccgtt cgtcgtcgtg acggcctcgc caccggagtc ggtccggctc    136800
     accggcctcg actggacgtt cgtcacgacc ggtctgcccg acgccgtcgc cgcggcgcgc    136860
     gagcgtgccg aggcggcttc ggcggacctc ggccgggacc tcgacgttgt cctgatgggc    136920
     ggcggggccc tgatcggctc cgcgctcgac gccgggctgg tcgaggtgct gtccctgcac    136980
     ctggcccccg tcgtgctggg ctccggaacg ccgctgttca ccgggggaac accgcacacg    137040
     ctcgtccggc ggagcgcgaa cgccacaccg aacgccacgc acctgctcta cgaagtcctc    137100
     tgacatgcgc cgcgacgaac gcgcgacccg gagccgggcg gcctgttgac gggggcggac    137160
     cctgccccta cggtgccctc accgcgcgac ccgcgatcgg tgccgggggt ccccgagggg    137220
     atggtggcag ggcgatgaag gcagtggtcc aggagcggtt cggtcccccg gacagcctgc    137280
     ggctgcggga cgtggaccgg cctcacgccg gtgccggcca ggtgctggtg cgcgtgcacg    137340
     ccgccgccgt gaacccctac gactggcaca tgctgcgcgg agacccgtac gtggcccgga    137400
     tgctgggcgg catggggctg acccggccga agtgcccggt ggccggcctc gacgcggcgg    137460
     gggtggtgga gcgggtcggc gcggacgtgc gggggttcgg tcccggcgac cgggtcctgg    137520
     ggttctgccc gggagccttc gccgagtacg cgtgcaccac cgcaccgatg ctggtgcccg    137580
     tgcccgaggg gctgaccttc gagcaggccg cggcactgcc gatggcagcg gtgaccgccc    137640
     tgcgcggcat ccggaccgtc ggtcgcgtgc ggtccgggca gcgagtcctg gtcaacgggg    137700
     cgggcggcgg ggtgggcacc ttcgcggtcc agatcgcggc ggtcctggac gcggaggtca    137760
     ccggggtgtg cagcgccgcc aacaccgacc tggtgcgttc cctgggcgcc gcccatgtcc    137820
     tggactacgc ccgggaggac ttcaccgacg gacgcgggcg ctacgacgtc gtactggaca    137880
     acgtgggcaa ccacccgctg cgccggctgc gccgggcgct caccccggcg ggcgtcctgg    137940
     tggccaacgg cggcggctcc cccggccggg tgttcggggc cgtcggcgcc atgctgagac    138000
     tggcggcggc caacgccgtc acacggcaga ggctgcgtcc gatcctgccg gcgaccccgg    138060
     acgggccggt ccacgaggac ctgtcagccg tcaccgcgct cgtcgacgcc gggcaggtca    138120
     cgcccgtggt cggccggacc ttcgccctgg ccgacaccgc acgggcgctg cggcacgtcg    138180
     aggagggcca cgcgcgcggc aagaccgtcg tcaccgtggc gtaggcccct gccgagtcgc    138240
     cgtacccctg cgtcagtgga agccggtgcg cgcggccgtg acctcgacgg tgtccttcac    138300
     cagggccagt gccgccccca cggggctcga ccgcccgccg ctcaccgtca cgtcgcccgc    138360
     gtccgggcaa ccgaacaccg cggccttctc gggcccggtc agtgcgtgca gcgggtcgcc    138420
     ggcttccgtc tcctcgagcc gtacgcgcac gacgccgggc tcggccaccg ccgcgccggc    138480
     gaccgcccgc agccgacggg accgggcggc cgcggccaga gcccgcctcg ccgtggtccc    138540
     gtccaccggc tcggcccgca cccgcacctc ggccgggtcc cagccccagg ccagcgcggc    138600
     cagcagccgc accttggtgg cggcgtcgtc gcccgacagg tccgccgagg gatccgcctc    138660
     cgcgatgccc cgcagctgcg cggcgcggat cgcgtcgccc agcgtgtcgc cctcggccag    138720
     tcggtcgagc acgaaggtgg cggtgccgtt ggggcaggcg cggatcgtcc ggcagtccag    138780
     gccgcgcagg gacgtgcgcg acaggtcgcc cgccgggagc gccgccccgg tggccccgga    138840
     gatcctgatc atgctgccgc ccgcccgggc ggccgcgtcg aggtcccgcc agtgcgtgag    138900
     cagatggctc ttggtggccg tcaccacgtg gatgccccgg cgcagtgccg ccagggcctc    138960
     ctccgcggcg cgctcccgca gtccgggcga ggacgggacg gcctggacga acacccgcgc    139020
     gccggtgcgg tcgaaggtct cgtccagcgg cctcgcgggg tcccaccgcg agcgcggcgg    139080
     caccgacccg cccgcgtccg gccggcactg ggccgcgctc gcgcgtacgg cagccaccct    139140
     cggtcgtacg ccgtgccggc gggcgagcgc ttctccgtcc cgggccagcc ggtcgacgaa    139200
     ggcctgcccg accgggccgt acccggcgag gaccacggcg gtcgtcgtcg ccccggtcgt    139260
     ttcggtcgct ccggtcagtt cgttcatgga tccgggatcc tctcacacca ccggccgcga    139320
     gcaggccgtc agcggggcgg ccgcgcgagg ccggagcggt aggcgtgggc gaccagttgg    139380
     gcgcggtccc gggcgccgag cttggtcttg gcgcgctgga cgtgggtgcg taccgtcagc    139440
     gggctgagga acagttcggc cgcgatctcc ttgtcggact tgccgtccgc gaccagggcg    139500
     gtcacctctc gctcgcgggc ggtgagggcg gccaggtcct cgggcggcac gggggacgcc    139560
     cgggggtcgg gggaatcgag gaaccgggtg atgaggctgc gggtggccgc ggcggacagg    139620
     agggcgtcgc cggcggccac cgtgcggatg ccgtcgagga gttcctcggc cgtgacgtcc    139680
     ttgccgagga aaccgctcgc cccgatgcgc agcgcccggg cgacgtgttc gtcggtctcg    139740
     aaggtggtca ggatgaggac ccgggtgccc cggagggcgg ggtcggcgca gatctcggcg    139800
     gtggcggcga ggccgtcggt gccgggcatg cggatgtcca tgaggacgat gtcgggtcgg    139860
     tgggtgcggg tcagttcgac ggcgtcccgg ccgtcggcgg cttcggcgac cacgtccatg    139920
     tcctcgctgg agtcgatcag gatgcggaag gtcgcccgca gcagggcctg gtcgtcggcg    139980
     agcagcacgc ggatcgtcat gagggctgtt cccttgctgg tggcggggcg gggagttcgg    140040
     cggtgacggc gaagccgccg tccgcgaggg tgcccgcgct cagtcgtccg ccggaggtct    140100
     cggcgcgttc ccgcataccg acgaggccga agccgccgcc ggggcccggc gggcgcgggg    140160
     aggcgccgcc gtcgtcggtg accgtgaggg tgaggcggtc gtgggcgtag gcgaggtgta    140220
     cgtcggccgt gccggcgtcg gtgtgtttgg tgacgttggt gagggcctcc tgcacgatgc    140280
     ggaaggcggt caggtcgact ccgggcggca gggggcgccg cgtgccccgg acggtgacgg    140340
     tgacgtggag cccggcggag ccgaacgcgg agaccagttc ggggagtcgg ccgagccccg    140400
     ggggcgggcg caggtcgtcg gggccgcctg tgtcgccggt gtcgtcggga ctgcgcagga    140460
     ggcccacggt ggccttcagt tcgcgcagcg ccgaagcggt ggtgccggtg aggtgggtga    140520
     ggatctcgtg ggcctgctcc gggtgggtgc gggcgaggtg ggcggcggtg ctggcctggg    140580
     cgttggccag cgccatgtgg tgggcgacga cgtcgtgcag ttcgcgggcg atgcggatgc    140640
     gttcctcggc gacccggtgg cgggcctcct cctcgcgggt gcgttcggcg tgctcggccc    140700
     gggtgtggac ggcgtcgagg tgggcgcgac ggttgcggac cgccgtgccg gccaggaccg    140760
     gcagcaggat ccagaacacg gggccgacgc tctcgtccat ccacggccgg ccgtcgcgtg    140820
     cggagagcag ggcggcgggg acgaccagcg cgacggtggc tccgtagcag gcgtacgcgg    140880
     tgcgctgcgg ggtgcggacg gccagttcgt agagcgcgat caggacgggc agcagcagga    140940
     gtggggagat caggtagccg agagcgacgg aggcggcggc gcaggcggcc gtgacgagga    141000
     ccgcggcgcg cgggtggccg cggcgcggca gcaggcccgc cgtggccacg agcgccaagg    141060
     gctggccctg ccaccagccg gggccctggt gcacgtactg ccggctggtg acggcgagca    141120
     ccagcagcag gaaggccgtc tcgacgaggt gcgggtggct gtcggcgtac cgccgccaac    141180
     tgctgagcat ggtttcctcc tgggaccagg atcgccgatg cgcccgccgc gcggcgggag    141240
     gccgcccgtg tccggcacgg gcggcctccc tgcggcgcgg gtcaggcgcg taccgtgtcc    141300
     tgccggtcgg tgtcggggac ggccgcgagc gcgggggcgg gggtccgccg gccgagcgcc    141360
     tcgccctcca cgtcgacccg tggcagcagc cggtccagtc ggcgcggcag ccaccaggcg    141420
     cgctcgccga gcaggaccag gacggcgggc acgaaggcca tgcggacgac gaaggcgtcg    141480
     aacaggacgg cgaccgccag gccgaagccg accattttga ggagggtttc gccgccggtc    141540
     atgaagccgg cgaagacgga cgtcatgatg acggcggcgg cggtcacgac ccggccgctg    141600
     tggcggaatc cggtgacgac ggcctcggcg ggccgttctc cgtggacgac ggcctcccgc    141660
     atccgcgaca ccaggaacac ctggtagtcc atggcgaggc cgaagacgat gcccaccagc    141720
     atgagcggca tcgtgctcat gaccggtccg gtctcctcga cgcccaggag cccggcgccg    141780
     tggccgttct ggaagatggt gaccagtgcc ccgaaggacg ccccgaccga cagcaggaag    141840
     ccgagtgcgg ccttgagcgg gacgagtacg gagcggaaga cgacgagcag caggaggaag    141900
     gccaggccca ccacgacgag gaggtagggg atcagggcgt ccgtcatctt gcgggcgacg    141960
     tcgatgttga gcgcggtggt gccggtcacc tcgaaggtgg cgccggtggc ggactcggtg    142020
     gcgtgccgct cgtcgcggat ggtgtggacg agttcctcgg tccgctcgct ggtgggcgcg    142080
     gtggccggga cggcctggat caccgcggtg tccttcgccg cgttgaagcg gggcggcgcc    142140
     acggagacca ctccggcggt ggcggcgagc ctgtcggaga cggccgcgac cgccgaccgc    142200
     gggtcgtctg cctgccgggc gtccacgacg accgtgagtg ggccgttgaa cccgggtccg    142260
     aaaccgtccg cgagggcgtc gtacgcccgg cgttcggtgg tggaggtggg cttggcctcg    142320
     tcgccgggca tgccgagccg caggtcgagc gccggtacgg cgagggcgcc aagaaggacc    142380
     gccgagccga gcagtacggg caccgggcgg cgctgtacga accgggccca gcggacgctc    142440
     cacgccccgg cctcgcgggt gcgtcgggcg gcgccgcggc ccgggccccc gcgcaaccgg    142500
     cgggcgggag gggtgctgcg tcccttgcgg aaccggcggg caggcggggc gctccgtccc    142560
     ttgcggaccc ggcgggccag aagggcgtcg ggccagaagc cgcacagcgc cgggaccagg    142620
     gtgagggtga tcagcaccgc gatgacgacc gcgcccgcgg cggccaggcc catcttcgtc    142680
     agcgacggca ctccgatcac cgacaggccg gccagcgcga tgacgacggt gagtccggcg    142740
     aagacgaccg cggatccggc cgtgcccacg gccagccccg ccgcctcccg ggcgtcgtgc    142800
     ccctcggcgc gctcttcgcg gtagcgggag acgacgagca gggcgtagtc gacgccgacc    142860
     gcgatcccga tcatcatggc caggtcaccg ctggccgtcg acatgccgag ggcactgccc    142920
     agcgcgacga tcgaggcgag ggtgagggcc acgccgacga cggcggtgat cagcggcagt    142980
     ccggcggccg ccagcgagcc gaaggtgatc agcaggacca ccgcggcgac gccgatgccc    143040
     aggaactcgc cgatcccggc cggcggctca ccggccacgg ccccgccgcc ggcctcgacg    143100
     gtcaggccgg aggtccgggc ccgctccacc gccgccgtga gatccgcccg tccggcgtcg    143160
     gtgacgttgt cctcggtcac ctcgtaggtg acggtggcgt acgccgtgga tccgtcctgg    143220
     ctgaccgtcg ccgcgtcgag ggggtcggag acggcggcga cctgcggtcc gtcggccacc    143280
     tcggcgacca gggtgtcgat cgccgctcgg tactcgctcg ccgtgacctg ccggccgtcc    143340
     ggtgcgacga ggacgatccg ggcatcggcg ccttccgcct cggcgcccgg gaaccgctcg    143400
     ttgatgaggt cgaaggcgtg ctgggactcg atccccggca tggagtccga gtcgtcgccc    143460
     gcctcgccgg cgctcatggc gccgagcacg acgccgagca cgacggccgc ccacgccagg    143520
     gtcacccacc ggcgccgtcg gaaggcgcca cggcccaacc ggtacagcaa agttgccatg    143580
     gagaggtctc cgcatctgat ctggggaacc gctccagcct cacggggcgg ccaccgtccc    143640
     gtcgtcgtcc gcaccgaccg tcgcgtgtac tcactttcga gtaccgcggc agaggtcgga    143700
     tgcccgggtg gacggccggc ctgccgcacc tgccgaagcg cccgcggggc cacggggccg    143760
     gtcgcggaga cccggacggc cctcgggtgt ccgccgtccc ggccgcgcag tgcgtcgagt    143820
     ggggaccggg tcgccgtcgc ggcggcccgc gcaccgccgt cgcgacggcg cgcgggccca    143880
     ccgtccggcc ggggccgcac cagttcggcg gcggcccgct ggaacaccgc cagcggctcg    143940
     ggatcgccgt tctcggtggc cgcgcggagt tcgaggaagc gccgggtcgc caggtcgcgg    144000
     cggcccgcgc gacccgcgcc tgcccggcct cgggcaggtc ggcggggacg cggatcgcgt    144060
     cggtgcaggt gccggggccg gcgcggcggt cccggcgccc aggtgccgtg gtcggtgcgg    144120
     cggtcccggg gcgtccgcac cgcgccgcgg ccggccgtga cgacgtagcc ctcgccgcac    144180
     gtcaggcgta ggtgcggggt accgccgccg ggcagtccct cgacggtcgg ccggtcctac    144240
     ccggtcgggc gggacacgcc gagcgccccc ggcaagccgt cgtacagcgg gctcaccacg    144300
     cgagtccggc caggtgcgcg gcgacccgcg cgcggtccca ggcgccgtcg gcgacgacca    144360
     cgcggtaggc ccgggcgagg gtctcgccgg gcggcaggac cagttcctcg tggaaggccc    144420
     aggagggtgc gaccgcggcg aaggggtcgc tgcgcacgaa ccagtgggcc gggtgggtgc    144480
     ccttctcgcc cgagtggtcg ttggaggggg cgtgttcgaa gacgagcgtg gcgtggccgt    144540
     cccgtccgtc gtgctcgccg acgtaggcca gccagcgggc gctggagccc atcgggccgg    144600
     cgtcggcggg ctcgccggac tccgcggagg cggcggactg cgccgtgaag acccggccgc    144660
     cgcggaaggc gcggggcccg cgccagaaca gcccggtgta accggcggcg ggacgtccgt    144720
     gggtggtggg gctgccgaac cgcaggggtt cggcgcgccg gttggtcacc gcggacgtcc    144780
     aggtgagcgt ccagctgccg gtgtccgggt cgacgtcgcg gacctcgatg cggcgctcct    144840
     cctcggccca cagctcgccg ccgtgcgggt gccaggtcag ccgctcggcg atgacggcgt    144900
     ggtccgcctc tgcgccgatc tcctcgaagg acacgtgggc catcgagccg acccgctccg    144960
     gcagcgcgcg gtaaccctcg ccgtgcacat aggtgttgcc gccccacagg ttctgcccgg    145020
     acaggtggga ggcggtcagt tggagcccct tgtgccagcg gtggtcgttg gggcggtagt    145080
     ccgtgacgac tgcgccggac agggtccgga ccgggtggag gtacggcttg ggcgcctccc    145140
     acgcggcctc ggggcggtac acgtaggaga acaattcggt tccggccgcc ccgtgggcca    145200
     ccgtgacgcg gtcgccgtgg acgtgggtga gtgagagcgt catgggtcct cctcctccgg    145260
     gcggacgtat gccgcggaac cgtcgggcga ccacgatagc aagcgcttgc cacaaggcgg    145320
     ctcgccgcgc ggcctggccg catgggcatc ggcgggggca aggacgagtg ccctcgtcga    145380
     gagcactctc gctcggcgag acactgggac gcgccgcgtg ccgccctagg ctttttgacc    145440
     atggaaatcc cgagacacct catcgaactc cggcgcgccg tcgaggcggc ggacaaccgc    145500
     taccgcagca acaggggcga gaacgccacg gtcgccctgg cggtctggtc cgatgccacc    145560
     gccgcgctcg cccggggcat cgccgcctac gccgacgaga ccggcgtgcc gcaccgcgag    145620
     gtggagctgg ccgtacaacg cgcgacggga cgacacaccc ctgcgcggtg aacgctccgg    145680
     acgggccgtt gacagtagcg gctaatgaca gtagctttta gctatagcca ttagccttac    145740
     tggggagtga catgaccgag cgccttgccg tcgacggcgg cacgatcgcg tacgaagtga    145800
     ccgggtccgg cccgctgatc gtgctcgcgc acggcatggg agacagccgc gccgcgtacc    145860
     gcaccgtcgt cccccagctg gtggcggccg gtcaccgggt cgccgcggtg gacctgcgcg    145920
     gctgcggcga gtcgagcgtc gactggccgc agtggagccg caccgccatc gccggcgatc    145980
     tgatcgccct gatccgtcac ctgggcggcc cggccgtagt ggtcggccac tcggtctcgg    146040
     gtggcgccgc caccatcgcc gcggcccggg agccctccct ggtcacggcg gtcgtcgagc    146100
     tggcgccgtt cacccgcaag cagtcggtgc gcctcggcga cctgcgggtc aagcggttcc    146160
     ggcggggcat gctccgcctg ctcggcgcgg gcgcgttcgg cagcctgcca ctgtggcgct    146220
     cgtacctcga cgtcgcgtac ccgggtgtga agccggccca ctggagcgag cggctcggcc    146280
     gcatcgagtc cctgctgcgc gagccgggcc ggatgaaggc catgcaggcc atgggccgca    146340
     gcgcgccgac ggacgccggc gcccaactcg gcaacgtccg ctgcccggtt ctggtggtga    146400
     tgggcaccct cgacccggac tgggccgacc cgcacgcgga gggctcggcc gtcgtcgcgg    146460
     acctgccctc cgggctcggc cgcctggaga tgatcgaggg cgccggacac tatccgcacg    146520
     accagttccc cgacgaggtg gccgcgctcg tgctcgcctt cctccgctcg gacgccgccc    146580
     gtgcctaggg cgggcctgga tccggcggcc gtggtcgcgg ccggtgccgc gctggccgac    146640
     gaagtgggct tcgccaacct gacgatgggc ctgctggccg agcgggtggg cgtacgcacc    146700
     ccgtccctgt acaagcacgt gggcggccag gacgacctca cccggcggat cgcggtccgc    146760
     gctctgaacg aggccgcgga cgccgtcggc ggcgcggtcc aggggtatgc ggggcgtgac    146820
     gccctggcgg ccgccgcgcg cgcgttccgc gccttcgtcc tggagcaccc cggccggtac    146880
     gccgcgacga tcggccagga gccctcgggg ccggacgatc cgctggccgc cgccgggcag    146940
     cggctgctcg gcgcgttcac cgcggtcctg cgcggctacg acatcgagga ccgcgacgtg    147000
     aaccacgcac tgcgcctgct gcgcagcctc ttccacggct tcgccacgct gcaggcctcg    147060
     gacggcttcc agtggagcac cgacgtcgac gacagcttcg agtggctcat cgccttcacc    147120
     gaccgggggt tgcgcaccct gtgacaccgg cgccgcgcaa gcctgccgcc gggcaccccg    147180
     gccggggcag cagtggcggc cccggggccg gtgtcagccg agcggcacgt ccgcggagcg    147240
     gctgcgcacg gcgtcgagcg cggcgaggga cgacgcgtcc agggcgatct cgcccacggc    147300
     gaggttcgcg tccagatgac cggcgtcggc ggtaccgggg atgagcagta cgttcggggc    147360
     gtggtggagc agccaggcga gacccacctg ggccggcgtc acgccgagcc tgttggccac    147420
     ggtgtgcacc gcgggctcgt cggcgacctt gggcatggcg gggaacgcgc cgccgagcgg    147480
     gaagtacggc acccaggcga cgccctcggc ggagcacagc gcgagcatgt cctcgtcgtc    147540
     ccggctcacg acgctgtagg cgttctgcac gcagacgatg cccgccggga gggcccggcg    147600
     cagtccgtcc ggcgtcacgc tgctcagacc gatcgcaccg atcttgccct cgtcgcgcag    147660
     cgccgtcatc acggcgagct ggtcgtcgag gtcgacccgc tggtcgccct ccgcgcgcag    147720
     gccggggccg gtgtcgaggc ggcgcaggtt cacgaccggg atccggtcgg tgccgaggct    147780
     cctgaggttg tcctcgacgc tcgcccgcag ttcctccggt cgctgcgcgg ggcgcagcgg    147840
     gagagggccg ccggggtcgg gggcggcgcc gaccttgctc accaccacga cgtcgtccgc    147900
     ggggcggagc gcagcacgga tcacttcgtt gacgaatccg tcgccgtaga actgggcggt    147960
     gtcgaggtgg tcgacgccgc gttccaccgc tcggcgcacg agggcgacgg cggcggcccg    148020
     gtcggcgtgc aggcgttcga gctgcatcgc gccgtagccg atccgggaga cggtgcggcc    148080
     ggcgagcact ccggccccgc cggggcgggg ggtgccgccg tgcgtggcac gggaagagga    148140
     gggggtgccg gtcgacgtca tgggaagtcc gtcctcgtgc gatgatgaca gtagcggagg    148200
     accctccgct ttacgactgt aacactaccg gaggatcctc cgctttgagt ccggaccagg    148260
     aaacgagcgc tgatcccggc cggcccgacc ggccggccgg cgccgaacgc ccgctgcgcg    148320
     cacacgcgcg gcgcaaccga gagaagctcg tcgccgccgc ccgggccgcg ttcacggccg    148380
     cggacgacac cgtcccgctg gacggcatcg cccgcgcggc gggtgtcggc atcggcacgc    148440
     tctaccgcca cttccccacc cgcgaggcgc tggtcgaggc cgtctacgcg gccgagctgg    148500
     acgacgtcac ggccagtgcc tccgcactgc tggacacgct gccgcccgag cgggcgctgc    148560
     gcgcgtggtt ggagcgctac gcggcgttcg tcgcgacgaa gcgctccata ctcaacaccc    148620
     tccacagcgg ctgggcctcg ggacgcctcg tcatgcccgc cacccgcgag cgcatcacgg    148680
     ccgcgatcgg caccatgctc gcgcaggggg cacgggcggg ctcgctgcgc ggggacgtgg    148740
     cacccgacga cgtcaccgcg atgctgctgg gcgtgttcct ctcgacggcc gccgacgacg    148800
     agccggagcg cacggagcgg ctgctcgatc tcgtcgtcga cgccctcagg ccgccgggga    148860
     gttcatgacc cgcgccggcg ggtcaccggt caccggcggg ccgacgccgc cagcatcggc    148920
     agggagacga tgtcggcgag ggcctgctgg ccggcgatgt tcgcgtggac gccgtcgccg    148980
     gtgtcgtacg gcgggttgat gctgttcggc cgtaccgggt cttcgagcac ctggtcgaag    149040
     gggaggatcc cgtcgcaggt gccgccgcag ctgttccact tcgagacgaa ggtgccgacg    149100
     gcgtgccggt cgcggttgtg ctggtcggtg tagccggggc gaggggtgat gggcgtgacg    149160
     tacaccttga tgcccgcggc gcgcagccgt tggaagacct cgcggtaact ggcctcgatc    149220
     cgggcggcgt cgcagccggc cgggaggtcg ttggtcccgt agtagtagag gactcccgtg    149280
     accccgtgca gggacagtac gtcgcgctcc agccgggcgg cggcgtccag accgcggacg    149340
     gagtcaccgg tgcccgggca ggtggcggcg ctcgtggtgc cgccgatgcc cgcgttggcg    149400
     acggcgaact gccggttcgg gggcagttcc gaggtgatcc gccgggcgag gtcgtcggtc    149460
     cacctcaggt cggcgcccgg gcggctgcag tccggtccgc agttcgtcga cccggttccg    149520
     tcgacgaccg aactgccgta ggcgaccagg ctcccccgca ggcgcgggtt gcgtacgtcg    149580
     accgcgctga ccaggagcgt ggagccggtc gtcccggtga acgcggtgcc gtccgggtcg    149640
     gcggtgtggt cgccggagcc gggcggggtc aggtagttgg tgcggaaggc gctgtcgtgg    149700
     cgccccggag ccaccgtgcc ggagacggag agcgacaccg cgatgtcgtc ctgggcggcg    149760
     gtgcgcagcc cggtgctgtc gctccacacc tcaccgccgg gcgggacgac gacccggggc    149820
     cggccgtcga acgtcacggg gcgcgggcgc ccctccgtcg cggcgtcctt gccgtcgctg    149880
     tgggccaccg tcgccgcgtc gacggtgagc ggtgaatcgc cgaaggtgtt ctggacgcgt    149940
     atccggaccg cgtcacctcc ctggctcagg tgggtgatca tgcgcatcga ctggtcgcgc    150000
     agcggtgtgg gcgcgacgtt ctgctgtgag gcggcccagg acgtgaacca ggcgttgcct    150060
     cccggccggc cgtcccgctc ggtgcccgcg ggagcggcgg cggtgctcgt ggacgcggcc    150120
     aggacggagg acgccagggt gagggccagg gcggtcgcta cgcctctggc caggggcgcg    150180
     cgggcggggt cgggtactcg ggcgaggaga cggcgcatcg gtgcctgcct ttccgacgtg    150240
     acggggtgca gggctggatc ctccccggcc gttccccggt ccacgccact cgcggcccgg    150300
     cagtgccccg cgcatcgtcc ggcacgccaa ccccacgccc cctaaaccgg gttgcatccg    150360
     ccgtacgccc gggcggcgcc ccggtatcgc cccggtgtcg cccttgcgac atgtcccacc    150420
     tgtgccaccc gaatcgaatg acaccccgtc ttcggcaagc tcattctggc caacgcactc    150480
     actcgcatcg aacgcatggg aaggcagcgc actgatgaga cggatccgcc tgttggccgc    150540
     gatatcggcc ggtctggcgc tggccgccgg cgccgtggcc cccgtacccg cactcgcgag    150600
     caccccgcgt ccagacgccg ccgcgccatc ggcggaccac ggcaccgcga cggaccacgg    150660
     caccgcgacg gtcaagctga tcaccgggga cagcgtgacc gtcacccggg ccggggacgg    150720
     acgccaggcg gcgtccgtca cgccggggcc ggggagacgg ggcgtcctct tccgcaccct    150780
     cgagcaggac ggccacgtga cggtcctccc gtccgacgcc gacgccctgg tcgccgccgg    150840
     gcgcctggac cgggacctgt tcgacgtgac ggcgctcctg gcgcagcggt acgacaccgc    150900
     gcacacggac gcgctgccgc tcatcgtgga gcgggccgag ggcgtggcgg cctcctccgt    150960
     gaacgcgttg accgacctgg cgcgggacgc gtcggtccgc gaactcgaca gcatcgacgc    151020
     gcgtgccgtg cgggtcgacg aggcggaact cggccggttc tggaagcggc tcgtcccggc    151080
     cggcggacag cgcgcgaagg ccgcggccgc cactccgcgc gtgtggctgg acggccgggt    151140
     gggcgcgtcc ctggaccgca gtacggccca gatcggcgcc ccggacgtgt ggtcggccgg    151200
     ttaccggggc gacggcgtca aggtcgccgt cctggacacc ggtgccgacc agagccatcc    151260
     cgacctggcc ggccgggtcg cggcggccaa ggacttctcc ggcagctccg gcaccaacga    151320
     cgtcttcggg cacggcaccc acgtcgcctc catcgtcggc ggcagcggcg ccgcctccgg    151380
     cgggagccgt caaggagtcg cgcccgccgc gcggttgctg gtcggcaagg tgctcggcga    151440
     cgacggcttc ggcagcgagt cgcaggtgat cgcgggcatg gagtgggcgg cggaccaggg    151500
     cgccgacgtc gtcaacatga gcctcggctc ctcgggggcg accgacggca ccgatcccat    151560
     gagccaggca ctcaacgacc tcagccggcg caccggcacg ctgttcgtgg tcgcggccgg    151620
     caacgagggc gagcagggtc cccgcacggt cggctcgccc ggggccgcgg acgccgcact    151680
     caccgtcggg gccgtcgacc gggacgattc cctcgccccg ttctccagcc gcggcccgcg    151740
     cctcggtgac gacgcggtga agccggacgt cacggccccc ggtgtgggca tcgtggcggc    151800
     acgcgcggcc gggtcggcga tgggcgaccc ggtcgacgag cactacaccg ccgcctcggg    151860
     cacctcgatg gccaccccgc acgtggcggg cgcggccgcg ctcctggccc agcgtcatcc    151920
     cgactggacc ggcgcgcagt tgaaggacgc gctgatcagc acggcggtca cggtggacgg    151980
     ccagaaggtc accgaacagg gcggcgggcg gatcgacgtg cgcgccgcgg gactgggcgc    152040
     ggtgaccgcc accggcacac tcgtcatggg gccgttcacc tcgcgggaca ccgagcccgt    152100
     gacgtcgagg gtcaggtaca ccaactcctc cgacgaggac gtcacgctct cgctcgccgt    152160
     cgagctggcc acggaaggcg gcaaggcgcc cgccgaggga tcggcgcggc tcggctccga    152220
     ctccgtacgc gtgcccgccg gcagctcggc cgaggtgccg ctgaccgtcg atcccgcccg    152280
     cgccggacag ggcaagttct acggctacgt caccgcgacg accgccgacg gctcggtggc    152340
     cgcgcacacc acgctgagcc tggtggtgca cgggccgaca caccggatca ccgtgaggac    152400
     gatcgacaag gacggcgagc aggtcgccga cctccccacc atctggggcg cggagggctt    152460
     cgtcggctac agcgaccccg cggccgccgt cgccgaggtc gaggagggcg tctaccagct    152520
     caacaccagc tggaccacgt cggccgagga cggtgaggag ctgcgccacg tggtgctgcc    152580
     cgaggtcaag gtcaccaagg acatgaccgt caccctggac gcccggaaga cggttcccgt    152640
     ggagatccgc acgccccggc ccgcggagca gcgcgggatc ctgagctacc agacctaccg    152700
     tgagatcggg ggccgcagcc tgacgcaggg cacgatgtac ttcgacatcg ccaagcggct    152760
     gtacatcagt ccgacggcca aggtcaccga gggcaccttc gagttcgcct cccgctggca    152820
     gctcgtcgcc ccgctcgtcg aggcgaaggt gtcccgcacg gggttcgacc tgggcgccta    152880
     ctacatgccc gcgtcgccgc tgctgcccga gcgcggcgcg acgctgaccg cggtcgacgc    152940
     cggtgtcgcg gcggacgccg acttcagccg cgcccgcggc agggtcgcgg tggtggacaa    153000
     cccgacggga gccggtgagc gggccctggt cgaacgggcg gccgcggccg gggtcagcgc    153060
     ggtgatcctc gtccacttca acgacaccgg ctggacgcgc tggcggccta cgggcgaccg    153120
     caacgccctg cccacgctgc ggatcggcaa gggcacgggc gccgagctgc tcgcgcgcat    153180
     cgcccgcggc tcgacctcgg tgcggttctc cggtaccgcg cgcagcccgt acctgtacga    153240
     cgtgatgcag gtgtccgagc agcaggtgcc ccgcaaggtc gtgcactcgg tgtccgcccg    153300
     caacagcgcg gtggtccgca ccacctacgc cgacaacggt gtcacggggt gggcgagcga    153360
     gcagcgcttc ggctggcggc cgtaccagaa caccgcctgg ctgcagtaca cccggttcgt    153420
     gccgctcggt ttcgagcgca ccgagtacgt gagcgcgggc gacaccgcct ggcagcaccg    153480
     ggtgcaccac accacgacgt tcgacgtgga ccagccgctc atcgccggga tgcgggacga    153540
     tccgcgcacc taccgggccg gcgtgcggcc ccgggagacc tggcagggcg cggtcgtccg    153600
     tccgtccatc cccgccggca ccacgacgcc gaccgtgcgg gacggcaacg tgctgcggct    153660
     gagggtcgcg gagttcaccg actcgcaggc cgggcactgg tcgcccccct ccggcggtga    153720
     caccgcgagc gccgtgctgt accgggacgg cgagcgggtc gacggggtcg gcagcgcctg    153780
     gcagaacgtg accgttccgg ccgaacgggc gcgctaccgg ctggacatgg agacctcgcg    153840
     cgactccgag gcctggacgc ggggggtggc caccagtacg tcctggtcct tcgagtcggg    153900
     ccgcacggac gccgccgccc cgctgtcgct gctccaactg gactacgacg taccggtcga    153960
     cgtgcgcaat tccgtgcgcg gcacccgctc gcaccatgtc gaggtgcggg tgcgtaccca    154020
     ggagggactg cccgttccgc ggggtgtgag cgtccgggtc gaggcgtcct acgacgacgg    154080
     gcgcacctgg tcgtcggcgc gcacccacgc gcacggccgc aacgccttcc gggcctcgct    154140
     cacgccgccc gcccgcgggg agtcgtgggt cacgctccgc gtcacggcgc gcgacgcggc    154200
     gggcgactcg gttcggcaga cggtgcaacg cgcctacgcg gtacgccggt agcggcccgt    154260
     ccggcacgaa cggtgtgcgg cggatgacgc cgcacacccc cgccgcgccc tccccacctg    154320
     tgcagtacgg tgttcaaccg tcacggccca ggatccgggg agggcgttcg tggtgctgga    154380
     gatcgctggg ctgtcgcccg acgaggagtc ggtgtacgca ctgctcgtca ccttcggccg    154440
     ggccggcgcc gccgacctgg cggagcgtga cggcatgccg gtcgagcgga tggaccgcgt    154500
     cctggagtcg ctcaccgcca agggcctcgc cagccccacc gacggcgtcc cccgcctcta    154560
     ccaggcggcg ccgcccgatg tcgccctgct gccccggctc aagcgcagtg ccgaggcgct    154620
     ggacctcgcc cagcacgagg cggcccggct gatcgagtcc taccgggaca ccatgcgcag    154680
     gcgggacgcg gggcagctcc ttgaggtcat caccggcgcc gaggcgctgc gccagcacct    154740
     gcggcagatc cagaccagcg tgcgcgagga gatgctctgg ttctgcaagg cgcagtacgt    154800
     ggccatgccc tcgggcagca acaccgagga gttcgaggca ctggcccgcg gggtgcgcta    154860
     ccgggtgctg tacgagaagg cgttcttcga cgacgagggc gcggtcgaca acgtcgtggc    154920
     gggggtgcgg gccggtgagg tcgcccgtgc cgtgccgcaa ctcccgctgc gcctggcgat    154980
     cgcggaccgc gcggtggccg tcttcccgct cgtcgccggg gggccgcacg gcagtccgga    155040
     ggaacccacg acggcgctgg tcagggacag caatctgctg gcggccctga tcgcgctgtt    155100
     cgagcggtac tgggaggacg ccgtcccgct ggacgtcgac gactcgggcg aactctccgg    155160
     gaccgacggg ccagcggcgc ccgacgcgct ggcccccacc gaccgcaggc tgctgtcgct    155220
     gctggtggcg ggagtggccg acaaggcgat cgcctcccag atgcagctca gccgccgcac    155280
     ggtccagcgc cgtatccagg gcatgatgga acgcgccaac gccgcgaccc gcatgcagct    155340
     cgcctggcag gcggcgcggc ggggatggtt gtgacgggcg ggggcgcggg gcgacgggac    155400
     accgtggaca gtcaccgacc cgctgtgatg tgatccctgc ggcggcgtct tccccccccc    155460
     agccgcccgt tccgcccgcc ggcccgcgcc gcgtcgtcac gacgagcgga cgggtccgtc    155520
     ccccaggccc gaaagttccg tacacatgca gaagaccaag gccgcactct gggaattcct    155580
     ccaggggctc ggcaagacgt tcatgctccc ggtggccctg ctcgcgttct gcggcatcat    155640
     gctgggcatc ggctcctcgc tgtcgagtga cgcggtcact gacaacgttg ccttcctgaa    155700
     gggcgagggc ttccacctcg tcttcacctg gatggccaac acgggcctgg tcgccttcac    155760
     cttcctgccc gtcctcttcg ccatggcgat cccgctcggc ctcgcccgcg aggacaaggg    155820
     cgtggccgcg ttctccggtt tcgtcggctt cgtcgccatg aacctcgcgg tgaacttcta    155880
     cctcaccgcc aagggcgtcg acttcgagga cgagaaggcg atcgagcact acggcatagc    155940
     cgacgtgctg ggcgtgcagt ccatcgacac gggactgctc ggcgccgtgg ccgttggcat    156000
     cgttgtcagc ctgctccacc ggcgcttccg cacccagcgg atgcccgacg cgctggcctt    156060
     cttcggcggg ctgcgcttcg tcccgatcgt ctcggccctg gtcctgagcg tgctcggtct    156120
     gctcatcccg ctggtgtggc cgaccttcaa cggctggatc agcgcggtcg gccgcggcat    156180
     cgggcacacg ggcgtcttcg gaccgttctt cttcggcatg ggcgaagtac tgctgcgccc    156240
     gatcggcctg caccacatcc tcgtcgccat gttccgcttc acggacgtcg gcggctcggg    156300
     aaccgtctgc ggcgaccacg tctccggcgc actgaacctg ttctacgccc agctggactg    156360
     ctcggcggca ccaggctccg ccgtcaccga cgccacgcac ttcctctccc agggcaagat    156420
     ggcggcctac ctgggcggcc tgccgggcgc cgcgctcgcg atgtaccact gcgcgaggcg    156480
     ccgtatgcgg ccggagatca aggccctgct cgtgtccggt gtggtggcct gcgtggtcgg    156540
     cggcatcacg gagccgctgg agttcctgtt cctgttcgtc gccccgtggc tgtacctcgt    156600
     ccacgcggtc ctggtgggac tgggcttcct cacggcggcc gtgctcggcg tgttcatcgg    156660
     caacacggac ggcaacgtca tcgactggct cgtcttcggt gtgctccagg gctcgacgac    156720
     caagtggtat ctggtgccgg tgatcgcggc ggtgtggttc gccgcgtact acttcctgtt    156780
     ccgctgggcc atcacccgct tcgacctcaa gacgcccggc cgggaggacc cgccggcgga    156840
     cgacgaccac gacgagcacg acgagcacga cggtgcgcat gacgcggaac acgcggagga    156900
     gcaggtcaga gcggctcctg agccggcgcg cgagctggtc gccgggaagt acgacgcggc    156960
     cgccatgctc gacgcgatcg gcggcgccgg caacatccgg tccctggaca actgcatcac    157020
     ccgcctgcgc atgacggtgg cggacgccga agcggtggac gaggcccggc tgaagaagct    157080
     gggggccgtg ggcgtcgtca agctcgacgg gcacaacgtc caggtcgtca tcggtccgca    157140
     ggtgcagtcc gtgaaggacg ccatcgcgac gatggtcccg gcgggccggc cgtgaccgcg    157200
     cactcggctc ccgccgcacc ggggcccgcg tccgcgccgt acgacttcga caccccggtg    157260
     gaccggcgcg gcacctggtg cacgcagtgg gactacgtgc aggaccggtt cggcgtgccg    157320
     gacctgctgc cgttcacgat ctccgacatg gacttcgaga ccgcccccga ggtgctggcg    157380
     gcgctgcgcg gccgtctgga gcacggggtg ctcggctact cccgctggcg ccaggacgac    157440
     ttcctgtccg cgatcgtcca ctggtacgcg gcacggcacg gcacggccgt ggaccccggg    157500
     tcggtcgtct acgcgccctc cgtggtctac caggtctcgc ggttgctgca cctgtggtcg    157560
     cggccgggtg acggggtggt cgcccacacc ccgatgtacg acgcgttccc caggacggtc    157620
     gcggcaagcg gccggcggct cctggagtgt cccctggacg actggccgga gctggaacgg    157680
     ctgctggcgc tccccgacac ggccgtgctg ctgctgtgtt cgccgcacaa cccgacgggc    157740
     agggtgtggt cggccgcgga gctggaccgg atggcccggc tgtgcgcacg acacggcgtg    157800
     gcggtcgtca gcgacgagat ccactccgac ctggcccacg ccccgcacct ccaccgtccc    157860
     tgggtccgcc acgccggcga cggccgctgg gccgtggtca cctcggcgtc caagtccttc    157920
     aacattcccg cgctgaccgg cagttacggc atcatcggcg acccggcctc gcgcgacgcc    157980
     tacctgcggc agctcaagga cgcggacggg ctctcctccc ccgcggtgct gtcgctggtc    158040
     ggccacatcg ccgcgtaccg cgagggggcg ccctggctgg acgcgctgcg gacgtatctc    158100
     gctggcaacc tcgcgatggt cgccgaccgc ctccgggcgg cgttcccggg gctcgactgg    158160
     cggcccccgc aggcgggtta cctggcgtgg atcgacctgc gtccgctggg cgtcgacgac    158220
     gaggagctgc aacgcgaact ggtggaggtc gagaaggtgg cggtcatgcc cggggccgcc    158280
     tacggctccc cgggacgggt acggctcaac gtcgggtgcc cccggtcgaa ggcggaggcg    158340
     ggcgtcgagg cgttggtgcg ggcgctgggg cgcctcaccg gcacacagcg gcgatgagcg    158400
     cgggcactcc gggacacgac acattcaaca tgaacatcgt tttcatgtag ggtcggggtt    158460
     ccacgtccga aaggagcctc accatggccg ttcccaagcg caggatgtcc cgcagcaaca    158520
     cccgccaccg ccgggcccag tggaaggcga gcacgccgaa tctggtgccc gtgacggtgg    158580
     acggggtgac cctgcgggtt ccgcggcacc tggtgcccgc gtaccgccgc ggcctcctgc    158640
     gcccggagat ctgaccctcc tcccccgggt cagtgacgcg gagccggcgg agccaccggg    158700
     tcgagggcca gtgcggcgaa ggtggccagc cagtggtcgg tggtgaagtc accgcgttcc    158760
     accgccggca ggccggccgt gagatgcgcc ccggccgcct tgtccaggcg ggcgcggacc    158820
     gggccgtcgg gcagggcgtc ggccagggca cgcagcgcgg cggccctgct gagcgtcaga    158880
     ccgagcagat gaccgatctg cgggtcggcg tggtcggaga cgaccggcac ctccagcagt    158940
     gcgcagcggg cgccggtccc gagcccgggc aggaagcggt cgagccatcg cgcgagccgg    159000
     tccggcgcga ggaccctgcg catcgcgtcg gcctcggtga gcgccgggga gaggaagtcc    159060
     tgcccggacg gttcccagtg cgcgggcgcg tcgtggtcgt cggcgaacca gctcagcagg    159120
     cgttcccgta cggcccgttc ggtcccggcc ggcagttcgc ccgagtcgag ggcgaggccc    159180
     agcgcgaagg cgctgttggg gtggttgccg tggcgaacgg gataggtggc cttgggcagc    159240
     cagtcggcca gcagcgcgtc gacggcgtcc acggccggtt ccagggctcc ggcccaccgt    159300
     tgaccctccg ggcccccgag cgcccggcac tcggcggcga gcgcgagcag ccacgcccag    159360
     ccgtacgggc gctcgaagga ggggcgctcg cgcaggtagg cggcctcggt ggcgaggttg    159420
     ccgggggtga ggtggcggtc gagcgcggcg acggcctcct cggtgccggg cagtgccgag    159480
     gtgccgccgt gacggcgcag caggcggacc agcagccagt gcatgtgcac cgaggagtgc    159540
     cagtcgtagg cgccgtagaa ggcggggtgc agcgagcggg gttcgggccg ctcgtcggcg    159600
     gaagtgatca gatgggcggg gaagttgggg tactcgcggg tgatgttcgc cagggcgagc    159660
     tgggcgaagc gggccgcgtg ggtgctgagc ggcatcagtg ggtggctcct tcggtgacct    159720
     tgaggtcctg ctcggcgggg gtgcgggcgg cggccgccag cagggcgcgc aggccgtggg    159780
     cgacggtggc gggcgggagg gcgggcgcgg tgccgtcggg cacctgttcc ggtgcccagg    159840
     gcacgtgcgc gaagccgccc cgtaggtgcg ggaactcggt ggcgatgagg tggccgaggc    159900
     cgtaggccac gtggttgcag acgaaggtgc cggccgtgtt ggagacggcg gccgggaccc    159960
     ccgcctcgcg catcgcggcg acgcacgcct tgacggggag ggtggagaag taggcggcgg    160020
     ggccgtccgg gaccacgggt tcgtcgatgg gctgcccgcc ggcgttgtcg gggatgcgcg    160080
     cgtcgtcgac gttgatgccg acgcgctcga cggtgacccc cgggcgtccg cccgcctgcc    160140
     ccaggcagag caccaggtcg gggttgtccg cccggatggc gtcgcgcagg gcgtcgaggg    160200
     actcgccgaa gacacagggc agttccgcgg cggtgaccgc gagcccggcg ggcggttcgg    160260
     cggccaccag agaggccgcc tgccaggagg ggttcacccg ctccccgccg aagggggcga    160320
     agccggtgat gaggacacgg gtcatgggcg ttccttgccg tgcgggtcgg ttggcgggcg    160380
     cgggggcggg gatcagaagg cgaagagcgc catgatcacc gtgcagcagc cgagcagtgc    160440
     gatgcccgtc gggagctgtg ccttgatcgg cccgtactgg tccttgagtt cgagcagggt    160500
     ggccgggacg atgttgaagt tggcggccat cggggtgcac agggtgccgg cgaagccggc    160560
     cagcatgccg atcgcgagga cggccggctc gttgccgtgc atctgctgga tgagtacggg    160620
     ccagccgatc gccgccgtca tcaccgggaa ggcggcgaag gcgttgccca tgatgacggt    160680
     gaacaggaac atgccgacgc agtaggcgag tacggcgaag tacttcgagt cgtcggggag    160740
     caccttgttc atgatgtcgc cgacctggtc gccgaccccg gcggcggcga agatcgagcc    160800
     gagcacggcg aggagctggg gcagcagcag ggcggagccc atcgcctcca gcatggagcg    160860
     gccggagtgg atcgggacgg agagcttctt ctcgccggtc accagcatcc cgacgacgag    160920
     cgcggcgaca cagccgaggc cgagcccgag gagggtggcc ttgccggtct cgaagagccc    160980
     ggactcgtcg agcacggagg cgcagacgat ggcgaccagc gggatggtca gcgcggggac    161040
     gaagatcttg ttgccgagcc gggcggcggc ggcctcgcgc tgctcgccgg tggtggtgac    161100
     cgggacgccc ttgccgagga agttgaagcc ggccagcacg atcagggcga ggacggcgac    161160
     gccgagcggt tcggcgggca gggtccagcc gccgttgccc gcggtggcgt tggccacgcc    161220
     ggtgccgtag gggaaggtga gtccgagcag gccccagaag gcggcggacg tccaccgctt    161280
     ggggttgctg cggtccatgg ccatctgcac ggccatgacg acgaagacga ggcctatcag    161340
     ccagtagagc cattcgacct tgatcacttc tcggccccct cgggaagcgg caggtcgtgc    161400
     tcggcggcgg cctgcgccat ctcgcgttcg agctgcttgt ccatgagcag cagccgggcg    161460
     ccgtggatga ggaaggcgca gacggccagc gggatcgccc acagggcgag ctgggtcggc    161520
     tcgatgtcct ggtggtaggt ggagttcacg aagccggtga tcagcaggat ggagccgatc    161580
     gcgatgaagc agtcctcgcc gaagaagacg cccacggtgt cggccgaggc cgagtaggag    161640
     cgcaccttct cgcgcagctt gtcgggcagc ttggccccgg tggagcgttc ggcggcggcc    161700
     tcggccatcg gtgccaccag gggccgcacg gtctgcgccg ggccgccgat gctgttgagg    161760
     ccgaaggccg cggtgacctg ccggaccagc aggtagacgg tgaggaaccg gccggcgctg    161820
     agcttgccca gccggccgat gaggtggcgg gcctgctcgc gcaggccgta gcgctcgagc    161880
     agcccgatca ccgggagcac gatggcgtag acggtgaccg agcggctgtc ggcgaaggac    161940
     cggccgaagg ccgcgaggac ctccagcggg ttcatcttgc cgagcagtcc ggtgacgata    162000
     ccggcgacgc ccaccacgag gacggggttg cggcgcgtga cgaatccgag gatcaccacg    162060
     accacaccga ggagaacgat cattcggtgg ccttcttcag gcatgagggg gcagggcacg    162120
     gatccggagc ttcggaacgt gactcatgtg gtcccgggga ccatagctcc agatgtgtgg    162180
     cagatgcacg gacactagcg atcgttgaac gatctaacaa gaggtgaatc ctcttcgtcg    162240
     cccggagtga tcgaggggtc cgccgggcgg acggtcgcat ggacggtcgc atggacggtc    162300
     gagcgggcgt cccttgtcgg atcgttcaac gatcgtctac tttcaaggtg tgatcgacct    162360
     caacgcagat ctcggtgaag gcttcggccg ctggaccctc actgacgacg acgccctgct    162420
     ctccgtcgtc accagcgcca acgtcgcgtg cggcttccac gcgggcgacc cctcggtgat    162480
     gcgccgcgtc tgcgatctcg ccgcggagcg cggggtgcgg atcggggcgc aggtgtccta    162540
     ccgcgacctg gcgggcttcg gccggcgcgc catggacgtg ccctccgacg agctggcggc    162600
     cgaggtggcg taccagatcg gcgccctccg ggtgttcgcc gaggccgccg gcgccccggt    162660
     cgcctacgtg aagccgcacg gcgcgctcta caaccgcacc gtccacgacg agggtcaggc    162720
     acgtgccgtc gtggccgggg tgcggctggc cggcggcgcg ctgcccgtgc tcggcctccc    162780
     cggctcgcgg ctgctcacgg ccgccgcgga ggcgggcctc accggcgtcc cggaggcctt    162840
     cgcggaccgt gcgtacaccg cggagggcag cttggtcccc cgtagcgagg cgggctcggt    162900
     ggtgacggac gaggacgcgg tggtgcgccg cgcgctggcg ttcgccgtgg agggctccgt    162960
     cgaggccgtg gacggtacgg ccgtcgcggt cgccgcccgc tccctgtgcg tgcacggcga    163020
     caccccgaac gccgcccgga tcgcggcccg ggtgcgcgag gcactggaga cggccggggt    163080
     ggggatcggg gcgttcgcat gacggacgga aggcccctta cggcgcgccc ggcgggccgc    163140
     cacgccctcc tggtcgagtt gcgcgacgcc gagcacaccg cggccttcca cgcggaggtg    163200
     ctgcgccgtc gcgccgccgg ggcgctgccg ccggtcaccg aggtcgtgcc gggggcgcgg    163260
     accgtcctgc tggacggcgt gccggacccg gacgcgctgg cccgccgggt cgccgactgg    163320
     caggtgccgc cggtcgcgga cgacacgggc gccgtggtgg agatacccgt gcgctacgac    163380
     gggccggacc tggccgacgt ggcggcgctg tggggcgtcg gtccggacga ggtcggcgcc    163440
     ctccaccgct cgcacgccta tcgggtggcg ttctgcggct tcgcccccgg cttcggctat    163500
     ctcaccggac tgccccctcg gctgcacgtc ccccgccggt ccacgcccag gacccgcgtc    163560
     ccggccggtg cggtggccct cgccggtccc tacagcgcgg tctacccccg cgccacgccg    163620
     ggcggctggc agctgatcgg caccatgccc gacccacggc cgctgtggga cccggcgcgg    163680
     gaacgggcgg cgctcctcac accggggacg cgggtgcgat ttgtcacggc ggacggcacc    163740
     tgtgccggtc ccgggaccgg cacagggacc gggaccgaaa ccggcacagg gaccgggacc    163800
     gaaaccgggt ccggcgacga tccgacggcc gggacgagtc cggaggccgg ggcatgacca    163860
     ccagactcac gacggtgcgc gccggcgcgc tcacgacggt gcaggacgcg ggccggcccg    163920
     gccacgccca cctgggtgtg ccccgctccg gtgcgctgga cgcgcccgcg atgcggctcg    163980
     ccaaccgcct cctcggcaac gacccggaca ccgccgtcct ggagacgacc ctgaccggct    164040
     gcgccctgcg tcccgaccgg gacgtcgccg ccgtggtcgg cggggcgccc tgcgcggtga    164100
     cggtcgacgg caggccggcc gcctggggcg ccccggtgcg ggtgccggcc ggctcggtcc    164160
     tggacgtggg gaccgcgacc ggcggcgtcc gctcgtacgt ggccgtcgcg ggcggcatcg    164220
     ccgccgagcc cgtcctgggc agccgttcga cggacctgct gtccgggctg ggtccgacgc    164280
     ccctgcggga cggggacgtc ctggcggtcg gcgcccccgc gcggcccgcg ccgccaccgg    164340
     tcgccgctcc ctggccggga ccgccggccg agctggtcct gccggtccgc cccggcccgc    164400
     gcgccgactg gttcacgccg gccgcgctgc gcacgctcac ctcggccgcc taccgcgtct    164460
     ccccgcacag caaccggatc ggcctgcgca ccgagggtcc gccgctccag cggctgtcga    164520
     cgggcgaact gcccagcgag ggcatggtcc tgggcgccgt gcaggtaccg ccggacggcc    164580
     gcccggtgat cttcctgcac gaccacccga cgacgggggg ctacccggtc gtcgcggtcg    164640
     tcccggagcc ggctctggcc gcggccgccc aggccgtggc cggaactccg gtgcgcttca    164700
     cgctcgcctg acggccagcc agccggtcgc cgcgccgacc gcgtaccaga acagatccgg    164760
     tgcgttgaag gtggaaccca gcaccagacg ggccgccgta ctctgccggg cgaggtgcgc    164820
     cggcacgtcg ctgagctgga ggaactccac gccccaactc accgccaggg ccagggcggc    164880
     ggccttcgcc ggtgccgtcc tcggcgccgc cgcgaacacg agggcgaaca gcagcagggt    164940
     gtacagcgcg tctccgccgt acttggccac ctcacccgcc gccaaggccc tgagcgccag    165000
     tccggcgccc acgaccaaca ccgcggacac cgccgccgcc gaccgcgtcc gccccggatc    165060
     gtctcgcgcg gcgacgcggg cccgggaaga ggaaaccatg cgcccattgt gcgtggcagc    165120
     ggtccctctt ccgcgcacgg cccccgggcc ctggtggacg agtcgacgcc gcacgtggcg    165180
     gcgtcggggt ccgcgctgcc cgacggtcag caggtgggca cgcccgggag ccaggagtcg    165240
     gccacgtcga tgaagatgtt cgagacgtag ccaccgtagt cgggcaggta cgaccaggcg    165300
     tcgttgctgt agccgtcgta gtccacgagc tggccgtgga cctggcaccg cacccgtacg    165360
     gtcgtgggcc cgggcaggct cgccacgcgg gtggagtcgg tcgtcgcccg ctgccgcacg    165420
     ctcacgtcgg tgccccaggt cgggaaggac gtggtgtcgc cgccgccctc ggtccacagg    165480
     taggtgacgg tcacccagcc gttgtcgttc aggccgacgt tgtagaaggt gccgtcggcc    165540
     aggtcgatgc cggccgggtt ggcgacctgc cggccgaact cgtcgcgtcc gccgttgtac    165600
     ccgtcctcgt aggcggcctg cgcctggggc agcccttgcg gcaggtcctt ccactgctcc    165660
     cgctgcgccg aggggttcca gtggtcgtcg tgcgtgttcc acgggccgac gtcccagacc    165720
     ggcgccgtct cgcagcgggc cggcccgcac acctgcaccg agtactggcc gctgccgttc    165780
     ggcgacaggg cgcggcggga ggggagtgcc acgaagtggt cgttcgcccc gatgacgtga    165840
     ccgttggcgg tggtgtgtcc gacgaggccc tcgcgggtgg cgtagacgcg ggcggagaag    165900
     gcggcggccc tggtggccgg tgcgggctcg gcgggcgcgg tgcccgcgtc gtcggcggtc    165960
     agggtcagcg cgcgcacggc cgcggtgggc ccgcccctgg cgttccacag ggtgagccgg    166020
     gcctggacgt cgaccacctc gcggggcagt tcggcggggg cgccgggcgc cgcccgccgc    166080
     cactcggtcc aggcgccgtc ggccgcgcgc ccgcgcacgt cgacctcgac gcccgccgcg    166140
     tcgggcaccg tcgcgtcgag gtccacggtg acccggtcga cgggccggcc gacgtggtgc    166200
     gggtccagta cggcggaggc gtagccgcgg tcccggccga gggaggcggg gctgagggag    166260
     ccgtcccgca cccgcagggc gcccgcgtcg taccggacgt tgacgtcgtc ggtgccggtc    166320
     ctggacaggt ccgcgcgcca ggacaccgga gcgggcggca cggggtccgc ggccggggcg    166380
     ggcgcggcgg cgagcgtcgt accggagagg gcgagcaggc acaccgtgcc ggtcagggcg    166440
     cgtgcggtgc ggggtctgcg ccgcggggcg gatccgcggc gccgggacga gggggtcagc    166500
     atgtgggcgc tcctgggggc cgggcgtcgt cgacgtcgat gaagatgctg gagacgtagc    166560
     cgccgtggtc gggcaggtgc gaccaggcgt cgttgctgta gccgtcgtac tcgacgaggc    166620
     cgccgtggac ctggcaggcc acgcggacgg acgtcggtcc gggcggacgc gccacccgtg    166680
     cggagtcggt cgtcggctgc tgacggacgc tcacgtcggt ctccctggtg acgaaggggg    166740
     tggcggtgac gccgtcgtcg ccccgggcca gcccgtgcag caggcccagt cccggtccgg    166800
     gacggggagt ccgacgaaga cgcccgcgga tggcgggagt tgtccgcaca ccggtcgtca    166860
     catggtgaac cgccagactt gacgtgggca agtcattgca ctctgctcaa gagccttcac    166920
     ggccacccgt acggaccata catacagcca aggctgtaca gttctgactg tggacattag    166980
     cctggaggca tgagcgagaa cgagagtcct tcaccgtcgg cggtccaggc ctcgcgggag    167040
     gtccgcgcgg tcatcagccg gctgcgccga cgcatcctca aggcctccga ggtcgaggac    167100
     ctcaccctcg gccagtcctc ggtactggcc cggctgtccg accgggggag catcacggcc    167160
     agcgaactcg ccgcgatcga aggggtcaga caccagtcga tgacggcgac ggtcaccgca    167220
     ctcgcctcca tggggctggt cgagcggcgc cccgacccgg acgacggacg gcgcctgctg    167280
     atcacgctga cccccgaagg cgtccgccgc gtggaggaag ggcggcaggt acgcacggaa    167340
     tggctcgccg agcggttgca ggacaggtgc accgaggagg aacggcgcac cgtgatcgcg    167400
     gccatggccg tactggagcg actgaaccgt gactgacgcg aaggcgggct gccccgaggc    167460
     cggcacggac aagcccggct tcgaccgcgg actgctgccg ccgatgctgc tcggttcggt    167520
     gctcaacccg atcaactcga cgatcatcgc ggtcgccctc gtgccgatcg gcagggcgct    167580
     cggcgcaccg gcctcgcaga ccgcctggct cgtctccgcg ctctacctgg cgacgtcgct    167640
     cggtcagccg gtcgtcggca ggctcatcga cgtcttcggg ccgcgccggc tcttcctcct    167700
     cagtaccggc ctcgtcggcg tcgccggtgt cgtgggcgcg ctggctcccg gcctggggtg    167760
     ctgatcggcg cgcgggtcct gctcgggttc ggcacctgcg ccggctatcc cgcggcgatg    167820
     gcgctggtgc gcagcgaggc cgagcgcacc ggacgggaca gccccggcgg ggtgctcacc    167880
     gcgctggccg tggccaacca gaccgtcgcc gtcgtcggcc cgctgctggg cggcctgctg    167940
     atcgcggtgg gcggctggcg cgccaccttc gcgctgaacg tgcccctcgc cgtcgcggcc    168000
     gtgctgctgg gtctgctgcg gctgcccagg gcgaagcccg aagcgaagcc caccgcgcgg    168060
     ttcacggcga ggcccactgc gcagtccacg gcgcagtcca cgggcggatc cacaccgcgc    168120
     gggagcctgg ccgcccggct cgatctgccc ggcatgggac tgttcgccgc gatgctcgtc    168180
     tcactgctgc tcttcctgat gaacccgcac ctgcgcgact ggtacctgct cgcgctcgcc    168240
     gccgccgcgg gagcggcgtt cgcggtacgg gaactgcggg cggccacgcc cttcatagac    168300
     ctgcgggtac tcggcggcaa cgtcccgctc ctggccacct acgggcggac gctcgtcgcc    168360
     tacgtcgtct cgtactcctt cctctacggc ttcacccagt ggaccgagga gggcttcggg    168420
     ctgaccccct tccacgccgg cctggcacag atccccatgt tcctgctggc gacaggggtg    168480
     tccatcgtct cggggcgcag cacgagcgtc cgggggaagc tgctgctcgg cgcggtcggc    168540
     cagatcaccg cgtgcctggt gatcctgctg ctgggcgggg acagcccgct gtggatgctg    168600
     ctgctggtcg ccctgatctt cggcgtcccc caggggctga acaacctggc cctgcagaac    168660
     tccgtctact tccaggccga tccggagcgc accgcctcct ccgccggcct gctgcgcacc    168720
     ttcgcctaca tcggctcgat ggtcgcctcc gccgcgaccg cggcctcctt cgggcagcac    168780
     gccgacaccg gcggcctgca ccggctggcc tgggtcatgc tgggtgccgg cctgctctac    168840
     ctgctgctca ccctcttcga ccgcacgctc ggccgaacgg cggggaccgg cacgcgggcc    168900
     tcgctctgag caacccccga aggggcaggc ctgagaggcc gcaggctcaa gaactgtgtc    168960
     ccgcaagtgc attgaccaca agggtgtttc tgcctaacgt cccggtcaag cttcattgaa    169020
     tcctttcagc gccctggccg cacgcccggg cggcccccac gcgacgtccc gcgcacccgc    169080
     aagaccgcca tggctggacg cacctggtga acggtcttcg gtcgccgcct gtcgactcat    169140
     cgaaagaagc acatgcacaa aacccccgca cgccgtgcct ccgtactcgt cgccgccgtg    169200
     tcctccctca gtctcctcac cgccggatgc ggcgacggcg acggccccgt ggacgacgac    169260
     acggcggcga acgccaagaa cgccgaggcc tcccccaacg cgcccaccaa gacgggtttg    169320
     accgtcggct tccttcccaa gcaggtcaac accccgtact tcgcggtcgc cgaccggggc    169380
     ggggagcgtg ccgtcgagtc actggggtcg accttcaagg aggtgggcac ggaccagggc    169440
     gccgacgcct ccgggcaggt gtcgcacatc aacggcctca ccgagcagaa ggccgacgcg    169500
     atcgccgtct cggcgctgga ccccgacgcg ctgtgcgacg ccctcaagaa ggccatggca    169560
     aagggtgtca aggtcgtcac gtacgactcc gacacgaagc ccgagtgccg ctacgccttc    169620
     gtctcccccg cgagcgccga ggacatcgcc gtacggcagc tggagctgct cggcgagcag    169680
     accggctacc agggcgacat cgcgatcctg tccgccgcgc agacggcgac caaccagaac    169740
     gcctggatca gcagcatcaa gagggagctt gagggtccga ggtacaagga gatgcggctg    169800
     gtggacgtcg tctacggcga cgacgaggcc gagaagtcgt accagaaggc cgaggaactg    169860
     ctccgggagc acgggaagct gaaggggatc atctccccca ccaccaacgg gatcaaggcg    169920
     gccgcgaagt acctgtccca gtcggagtac aagggcgagg tgaagctgac cgggctcggc    169980
     gcccccaacg acatgcgtcc ctacatcaag gacggcacgg tggaggcgtt cctgctgtgg    170040
     gacccggcca agctcggcga gctggccggt cacgccgcgg tggccctggc ctccgggcag    170100
     atcacgggcc gggaggggca gatgttcctg gccggggaca tgggctggtt ccagctcacc    170160
     gggaacgggg tcatcaccct cggcgagccg acggtcttcg acgccgggaa catcgacgac    170220
     tacgacttct gaggcccgcg cgcagctgcc cggacgggtg ccgtccgggt gggtgccgcc    170280
     gagggaggct gccggcgggg gcccggcacc gcgctcaccg gccgtctcct ccgggcggac    170340
     ccggtgcccc ggagccgccg gcgttcaggt gttgcagcgc ctcgaccagc tcgtggcagg    170400
     cgcgctccac cgaccgtctg gtgttgagct gttcactgat caccgcggag agcaggagcg    170460
     cggtcagccc cagggtcccg ttgaacgcct ggagcttcat catcgtctcg atgtcggtca    170520
     gcttcccgaa ggagccggcc tcctgccggg ccacgacggt ggccgtcacc gacacgaaca    170580
     gggcgcacgg gatgccgccc gccagctgga agcgcagcgc cgaccagatc aggatcgggt    170640
     aggcgaggaa cagcacgctg accgagctgt acatgatcag cggtaccagg acgcacacga    170700
     ccgcggtgag cccggcggcc tcgggccagc gcgcggacgg gggcggcagg cgggcgcggt    170760
     acagcaggag cagcagcggg gtgaccagga cgacccccat ggcatcaccg acccaccagg    170820
     ccagccagac gatcccgagg tggtcggtgg ggagtttgcc cgacagcagg agcatgccga    170880
     tgcccgtgca cgaactgatc agcatcgcgg ccagcgcccc caggaagacg agcgccagtc    170940
     cgtcgcgcag tcggctcagg ctcaaccgga accccaccgc gcgcagcagc agccaggcgc    171000
     agacgggggc ggcggtgttg cccaccacga tgcccgcggc ctcgggcccg ggggctccca    171060
     gggagacgat gaccagcagc gcgccgaggg cgatgcccgg cacgcaccac ggtccgaaca    171120
     ggagcaggca ggccaccgcg agaccggtgg gcggccagat gggcgtgacg accgaaccgt    171180
     cggcggtcag ctgctgcgac agcccgagcc gccccgccgc gtagtagcag ccggcgagca    171240
     gcagcgtcgc gcaggtgagg acgaccggtc gaggccacgc acggataccc accacagcag    171300
     ccatcagaca ccggtgccgc cgggtcggcg aggcgagggg cgccccgtga cgccctacgg    171360
     cgtaacgcca cgtgcgaggc cgcgcgtggc gccgcgcccg tcatggccga cgacgagcac    171420
     ggccgcgtcg tcctcgtgac cgatcagctc ggcgttcttc agcacggcgg ccgccagcgc    171480
     gtccgcctcc atgccgacgg ccgcggcgag gctcgccagt cgcaccaccc ggtccaggcc    171540
     ctcgtcgacg ctcagcgagg gcccctccac cacgccgtcc gtgaccagga cgaacactcc    171600
     gccggtggcg agccggtacc gggtcaccgg gtactcggtg ccctccagga cgcccagcgg    171660
     gggtccgccc tcgtcccggc agacctccgc cctgccgtcc gccgtggccc gcacgcaggg    171720
     gatgtggccg gcccgggcgc tctccagcag gccggtcgcc gggtcgtagc gcatgaaggt    171780
     gcaggtggcg aacaggtcct tattgaggga caggagcagt tcgttcgtgc aggccagcag    171840
     gtcgccgggc tcgctggtca cggaggccag cgcccgcagg ccgacccgga cctggcccat    171900
     gaaggcggcc gcgtcgatgg cgtggccctg gacgtcgccg acggagaggc cgatgcggcc    171960
     gtcggggagg gcgaaggcgt cgtaccagtc gccgcccacg ttgagcccgg cgtacgcggg    172020
     cgagtagcac gcggccaggt ggatgccggg gacggcgggc aggtccgcgg ggagcatgtc    172080
     gcgctgcagg gcgatcgcca gctccacctg cgaccgtcgc agttcggcga gctccttcgc    172140
     ccgtgtggtc agtgaggcca gccgggcgag cagctcttca ccgtcaggtg cgggacgctt    172200
     gcggaacatc gaccactccc ggccaggccg cctctcccgg caggagcctc acggccccct    172260
     ggacagtgca agtctgtcac ccgggacgga aaaggtcatg ccggggcggt ccgggcgcgg    172320
     tggcgggcgg gtggcggcgg cgctccgcga gcgggcggcg tcggtgtgcg ccccgtcacg    172380
     ccggggaccg cggcgcgttc cgtacccttg ccgcatgcgc atgcgcccca ctctgagctg    172440
     gaccccggga gcggacctgc cgccgggcac cacggacctg gcgcccgtcg ccgacgcgct    172500
     gcgggccggc ggggtgctgg tgctcagcgg ggcgggcatc tccacggagt cgggcatccc    172560
     cgactaccgg ggcgagggcg gcagcctgag ccggcacacc ccgatgacct accaagactt    172620
     caccgcccac cccgaggccc gccgccggta ctgggcgcgc agccacctcg gctggcgcac    172680
     cttcggccgc gcccggccca acgcgggaca ccggtcggtg gcggcgttcg ggcggcacgg    172740
     cctgctcacc ggcgtgatca cccagaacgt cgacggtctg caccaggccg cgggcagcga    172800
     gggcgtggtg gaactgcacg gcagcctgga ccgggtcgtc tgtctgtcct gcggtgtcct    172860
     cagcccgcgc cgtgaactcg cccggcgcct ggaggaggcc aacgccggct tctcgccggt    172920
     ggccgccggg atcaacccgg acggcgacgc cgacctcacc gacgagcagg tcggggactt    172980
     ccgggtggtg ccctgcgcgg tgtgcggcgg cgtcctcaaa ccggacgtgg tgttcttcgg    173040
     cgagaacgta ccgccgcgcc gcgtcgagca ctgccgcgag ctggtgcgcg gtgcgtcctc    173100
     gctgctggtc ctcggctcct cgctgacggt gatgtccggg ctccgcttcg tccgccaggc    173160
     ggccgaggcg ggcaagccgg tcctgatcgt caaccgcgac gccacccgcg gcgaccgcct    173220
     ggccgtcacc agggtcgcgc tcccgctggg accggccctg accaccgtgg cggaccggct    173280
     cggcctccgt gtgggggacg cggcgacggc ctgaccaggc agcccgcgtc gcgcacggga    173340
     ccggaaatct ccccgtgcca cccccttgac cgtggtcccg ccactccata cagtcctcgc    173400
     acctcacgag gtacatcgat taaccaatcg ttaaccgctt ggttggagac cacccctgtg    173460
     cgctcatcgc tgacacggcg cgaactgctc gccgccggtt ccggtctggc cgcggccgct    173520
     gccctgcccg ctctgtccgg ctgctcgtcg ctggcgtcgg cggactccga cccggacacc    173580
     ctcgtcgtcc acacccagct cggcaccacc gcgccgggct cccccacgta tctcgcggcc    173640
     gtggaccgct tccgcgagga gaacccgggg gtgaagatca agaacctcgt caacggcgac    173700
     gacctcgccc aggtctacga gacctcacgg ctggcccgca aggaggccga cgtcgtgatg    173760
     gtcaacctgt acgacaagac gctggcctgg acggacgtcg gcgcgaccgt cgacgtcaag    173820
     ccctatctcg acgactgggg gctgcgcggg cgcgtcctgc ccgccgcgct ggccgactgg    173880
     acggacgacg agggccgggt ccgggccttt ccctacttcg ccaccaactg gcccgtcgcc    173940
     tacaaccgcg ccctgctcga ccgggccggg gtcgacgcga tccccaccac gggggaccag    174000
     ctgatcgccg cggcccgcaa gctccgcgcc aagggcatcg ccccggtgac cgtgggcggc    174060
     aacgactgga ccggccagaa gctgctggcg cagatcatcc agacgttcct ctcccaggac    174120
     gaggcccggc acgtctactc cacgggggac ttcggcgttc gcggcgcacg cctgggcatc    174180
     gagtacttcg cgcacctgcg cgacgccggt gtgttcgcgg acaaggccca gggcctcacg    174240
     tccgactcga tgaccacgca gttcaacacc gaggaggcgg ccgtccagtc ggcgatgtcc    174300
     tccgccctgg ccaaggtgcc cgagaaggtg gccgggcaca cggaggtcgg cggctggccg    174360
     ctggccgacg gggcggcgca cgacggtccc accgtcatcc gcgcctacac cctcatcggc    174420
     ttctggatca gccccaacgg cgtccgcaag atcgagcagg tcgagaagtt cctgcggttc    174480
     atgtaccgcc cggacgtcgt ggcgcggttc gtgacggaga gcgggcggga catggccctg    174540
     cgcacggacg ccgtctccac cggcttcccg ctggtcgggg cggcccagcg gctgggctcc    174600
     gaggtgagcc aggtgctgct gcccgacgtg tacgtgccgc ccgccgccgc gcagccgctg    174660
     atcaccgcga ccagcacctc gttcacccgg ggcaccagcc cggcccgggt gcgcgccgct    174720
     ctcgagtccg cgtaccggtc cgtatgaccc gcccggacac cgacggctcc gccgcccggc    174780
     tctccctcgt ccccctcacc ctccctctcc ccctcccccg ttccacccgt tccccgggag    174840
     tcaccgcatg acgacgctca cgacgacgcc ggacgggagc gcggcccgca ggtccgttcc    174900
     gccgccctcc cccgccccgg ccgcgggccg gcgccggcag ggcggcaccg tcctcgcggt    174960
     gcccgcgctg gtctggtacc tggtcttcat ggtcgggccg ctgctcgcga tcttcgtgat    175020
     cgcggccctg cactggcccg gcatgctcca gccggtgtcc ttcgccggtc tcgacaacgc    175080
     ccgggtggtg ctggacgacc cggtgttctg ggacgcggtc cgcaacaccg ccgtacaact    175140
     ggccgttgcc gtcccggtga tgatcgtctg cgcgttcatg ctggggtact acgtggccca    175200
     gcgcccgccc ggtcaccggg tcatccggta cctgctcttc atcccggggc tgatctcgac    175260
     gcccgcgaag gcgatggtgt tctacgcggc gctgtcgccg gacggcctgc tcaacggcgg    175320
     gctggagagc gtcggcctcg gctccctggc cgacgcctgg ctggcctcgc cgtcgacggc    175380
     cctggcgtgt ctgatcgccc tggacatctg ggccggcatc ggcttcaccg ccgtcctgtt    175440
     cgccgcccgg ctgggcagtg tgccggacga gctcggggag gccgcgcagc tcgacggggc    175500
     ggggcactgg cggacgatgt ggtcggtcca cttccccgtc atccgcgact acgtgggcgt    175560
     ggtgacgatg ctgcagttcc tgtggacgct gttcggctcc gcgcagcacg tgctgctgct    175620
     cacgcagggc ggccccggca cgtcgtccac cacgctgtcc ttcctcgtct accagaaggc    175680
     gttcatcgcc gcggacctcg gctacagcca gaccgtcggc gtcctcctct tcctcgccgg    175740
     actcgtcggg ctgctgacga tccgccgcgt cttccgccag aactactgat cggagcagca    175800
     ctgatgaagc tcggcaagcg ctggctcccg gcccacatcc tggtgtggac gtacgcggtg    175860
     ctgctcgtcg tcccgctgta ctacttcctc gcctcggcgt tcaagtcgaa cgacgagatc    175920
     ttcgcgcacc ccttcgcgcc gccgtcctcc ctggggctcg gcaacttccg gaccgcgttc    175980
     gagagcgccg acctcgggct cgcggtcgtc aactcggcgc tggtgacggt cttctcgctg    176040
     gcgctgaccc tgctgctggc gatcccggcc tcgttcgcgc tggcgcgttc gaccgggcgg    176100
     ctggcgggcg tggtcgagaa ggtcttctcg ctcggcttcc tgatcccgac gttcgcggcg    176160
     ctcttcccca ccttcctgct cgcggcggcc acggggctgt tccacacccg gatcttcatg    176220
     gtgctgttcc tgcccgcgac ggcgctgccg ctgtcggtgg tgatcctggt gcagttcatg    176280
     cgcaccatcc cgccggagat ggaggaggcc gcccggctgg acggggcgtc caccttcgcg    176340
     gtgctgcggc acgtgtacac gccgatgtgc ctgccgggca tcgccacggt gctgctgctg    176400
     aacttcctga ccttctggaa cgagtacctg tactcgctgg tcatcatcgg cccggacccg    176460
     gcgcagcgca cggtccaggt ggccctgccc acgctgaagt cgatcaccgg cacggactac    176520
     ggcgtactga cggcgggcac ggtgctgacc ctggttccgg tgtggctcgt ctacaccctg    176580
     ctccaaaagc gcatgcagca ggccctggtc agcggggcgg tgaagatgtg agcatctcca    176640
     ccgagcgggc cggacgacgg cccacgatca aggcggtcgc ggcggccgcc ggggtgtcga    176700
     ccgccgccgt gtcccaggcc ttcaacaaca agggccggct ctccgaggcg acccgccgcc    176760
     ggatcctgga cgccgcgctg gagctgggct ggtcgcccag tgcctccgcc gcggcgctgc    176820
     gcaacgcccg cacccgcagt ctggccctcg tggtgcggcg tcccacggac gtgctgggct    176880
     ccgacccgca cttcagcgag ctgatcaccg gcatagaggg cgagctggcg ccgcgcggct    176940
     acggactgct gctgcacctg gtcagcggtc accgggagga gaacgcgctg tacgagcggc    177000
     tcgcggccga aggccgggtg gacggcgccg tgctcaccga cgcccgcgac gacgacgccc    177060
     gtcccgcgct gctcgcccgc ctgggacttc ccgcggtgct gctcggatcg cccgacgaca    177120
     cggccgtcgt cccgcgtgtc ggactgcgtg accagggcgc ggggatcgcc gaggccgtcg    177180
     cccacctgct gggcctcggc caccggcgcg tcgcctacgt cagcgggccg cccgagctgc    177240
     agcacacgcg ggtgcgcagg gcggccttcg aaggtgccct gcgcgaggcg ggcctgcgcc    177300
     cgttcgcggt gctgcccacc gacttcagcg agcggcgcgc cgtcggtgcc accgaggcac    177360
     tcctcgactc cgccgacggg cccaccgcga tcgtgtacgc caacgactcg atggcggtct    177420
     gcggcatcgg caccgcgcag cgcgccggac tggccgttcc cagggacgtg tccgtcgtcg    177480
     gctacgacaa cctgccgctc ggttcctggc tccatccccg gctgaccacg gtcgaccagc    177540
     aggtgcagcg ggtgggcgcg gcggccgcgc gcatgctgct cgccctgtgc ggcgaggagg    177600
     tcgaggacac cgccctcgcc gaacggccgc gcctggtcgt acgcgagtcc acggggcccg    177660
     cccccaccta aagcaccacc cggccgcggc agcccgcggc cacgcaccat ccgcaccccc    177720
     accacccgag aaggaccatg cgacgccaca gcgcccagct catccaccag cccgacgtcc    177780
     tgccctggct cggcgccaac ttctggtccc gcaccggcgg cccgctgatg tggcggaact    177840
     acgaccccgc cgtcgtccgc gaagaactgc gtgtgctcgc cggccacggc ctcaacacga    177900
     cccgttcctt cttctactgg ccggacttcc atccggagcc cgaccgcgtc gacgacgaac    177960
     tgtgcgcgtg gttcgaggat ttcctcgacg cccatgtgga gacggggatg gggaccatac    178020
     cgacgttcat cgtcggccac atgtccgggg agaactggga ccccgtctgg cgcggcgacc    178080
     gcgacctgta cgaggacgtg tggatggtgg gccgccaggc ctggttcgtc tcccgcatgg    178140
     cgcgccgctt caaggaccac ccggcggtca cgggctggct gatcaccaac gagatgcccg    178200
     gctacgggcg gatctaccag gtcgacccgc cctccaccga cgtggtgacg gcgtgggccc    178260
     aggccatgtg caacgcggtc cgggcgaccg gcgcgacgca gccggtgtcg ctgggcgacg    178320
     gggcctgggg catcgaggtg accggccgcg acaacggctt ctcgctgcgg gagacggccg    178380
     agtacgtcga cttcgtgggt ccgcacgtgt accgctcgga cacggaccgg ccgcgccagc    178440
     actaccgggc cgccttcgag tgcgagctgg cctcggtgac cggacagccc gtcgtgctgg    178500
     aggagttcgg gctgtccacc gacacggtct cggccgccaa cgcggggatc ttctaccgtc    178560
     agacgctgca caactcgctg ctgggcgggg cgaccggctg gctcgcctgg aacaacaccg    178620
     attacgacga cctgtgggac cggtccccct acgaccacca ccccttcgag atgcacttcg    178680
     gcatcaccga ctccaccggg gcgcccaagg agcccctgcg ggaactggcc gccttcgcgg    178740
     gggtgctgaa ggcggtggac ttcccgcgct gctcccggac cgacgcggac gccgccctcg    178800
     tcgtccccgc cttcctcgaa cggggctacc cctacagccg tcccgccgac cggccgctca    178860
     tcttcacgtc cctgcaccag ggttacgtca ccgcgcgcgc cgccgacctg ccggtggcgc    178920
     tcacccgcga ggccgacggg atgccgggcg aggcatcgct ctacctgctg cccgccaccc    178980
     ggcagctcac cacccgcacc cgcagggagc tggcccgccg ggccgccgag ggcgccaccg    179040
     tgtacctgtc gttctgctcc ggcgaacacc cggtcacccg cggtccctgg ttcgacgacc    179100
     tcgacgggct cttcggcgtg gagctgcagt tgtcctacgg cgtcgccgag ccgatcgagg    179160
     acgacgtgct ggagctgacg ttcaccgagg acttcggcga cctgcgggcc ggcgaagtgc    179220
     tgcgtttccc ggtggccggc aacgaggaca gccgcgccta cctgcccgtc gaaccgcgtg    179280
     cggggcgggt cgtcgcggtg gacgcccacg ggcggccggc cctggtcgtc cacgagacgg    179340
     gggcgggccg gacggtgctg tccacctatc cgctggagca catggcggcc cgcacggcgc    179400
     gcgtcaaccc cgatgtcacg cagcgtctct acggcgcgct ggcacagctg gcgggggtgc    179460
     ggcggcccgt cacggtcgcc gacccgcacg tgtcggcgga cgtcctggtc cacgccgacg    179520
     gccgccgttt cgtgtggctg gtcagccaga gtcccgaccc gctggtggtc cgtccggccg    179580
     ccgaggggaa gctgcacgac ctggccgacg gcgccccggt gcaggacgtg gcgctcgacg    179640
     cgtacggcgt ggccgtgctg gagctgcgat gaccctcccg ctctaccgcg acccggccgc    179700
     gccggtgccg gaccgggtcc gggacctgct gggccgcatg acgctcgcgg agaaggtcgg    179760
     ccaggtcaac cagcgcatgt acggctggga cgcctacgag cgcgccgggg acggacaccg    179820
     cctcaccgac gccttccgcg ccgaggtcgc cgccttcgac ggcatgggcg cgctgtacgg    179880
     gttgcagcgg gccgacgcct ggtccggcgt cggcttcgcg gacggcctgg acgcacggga    179940
     cggggcgcgg acggcggcgg ccgtgcagcg gtacgtcatg gatcacaccc ggctgggcat    180000
     ccccgtcctg ctggtcgagg agatgccgca cggccaccag gcgctggacg ggacggtgct    180060
     gccggtgaac ctcgcggtcg gcgccacctg ggatccggac ctgtacgccg acgcggtggc    180120
     gggggcggcc gccgaactgc gggcgcgcgg cgcgcacatc gcgctggtct ccgcgctcga    180180
     cctggtgcgc gacccgcgct ggggacgcag cgaggagtgc ttctcggagg atccgtacct    180240
     cgccgcgcgg atgaccgagg cgctggtcga gggtgcgcgg cgggcggggg tggcggtggt    180300
     cctcaagcac ttcgccgggc agggcgccac ggtcggcggc cgcaacagcg cggcgacgga    180360
     gctggggccg cgcgaactgc acgaggtgca cctggcggcg gcccgggccg gggtggccgc    180420
     cggtgcggcc ggggtgatgg ccgcctacaa cgagttcgac ggcctgccct gcgtcgccaa    180480
     ccggtacctg ctgaccgacc tgctccgtac cgagtggggt ttcgagggtg tcgtcatggc    180540
     ggacggcacg gcggtggacc ggctggtgcg actgaccggc gatccggtgt cggccggggc    180600
     gctcgccctg gacgccgggt gcgacctgag cctctgggac gcctcgttca cgcggctggg    180660
     cgaggcggtg gaacgcggtc tggtgtccga gtcggcgctg gacgccgcgg tggcgcgggt    180720
     cctcacgctg aagttccgcc tgggcctgtt cgaacagccc ctgcctccgg cccggtccga    180780
     gaccgtggag ctcccggacc ccgccgagct gggcgagcgg atcgcccgtg cgtcggtgac    180840
     cctgctcgcc cacgagggcg gcgtgctccc cctgtcccgc gcggtgcggc ggatcgcggt    180900
     gctcggcccg aacgccgact ccgtggcgca gcagatcggc gactacacgg cgccgcagcg    180960
     gccaggcggc gggatcaccg tcctggaggg catccgggcg gcggtggcgg ccggcaccga    181020
     ggtggtccac gaccgggggt gcgccctggt gggtgacgac gtgtcgggcg ttcccgccgc    181080
     cgtcgccctg gcggccggct ccgacgtggc cgtgctggtg ctgggcggct ccagcgcccg    181140
     ctccccggac acggtcttcg acgcgaacgg ggcggccgtc accggtaccg ggacgccgtc    181200
     cggcatgacc tgcggcgagg gggtcgacct ggcggacctg gcactgccgc ccgggcaacg    181260
     agccctgctg acggcggtgt cggcgaccgg gaccccggtc gtggtggtgc tggtccaggg    181320
     ccggccgcac gccctgaccg agctggacgc gcccgcggcg gcggtgctga gcgcctggta    181380
     tcccgggccg cggggcgggc gtgccgtggc cgaggtgctg ttcggcgacg ccgagccgcg    181440
     cggccggctg ccggtctccg tgccccggtc ggccgcccaa ctgcccgtct actacaacgg    181500
     gaaggaccac cgctaccgcg gatatgccga ccagagtgcc gggccgctgc atgccttcgg    181560
     acacggtctg tcgtacacga gcgtcgtgta cggggcaccg cgcctgtcgc aggcccgggt    181620
     cggcacccgc gcaccgcgcc tgacctgtcg ggtcacggtt cgcaacacgg ggtcccggcc    181680
     cgccgaggag acggtccagc tctacgtgcg tcggctgtcc gggggttcgt cctggccgcg    181740
     cgtgcgcgag ctgcggggct tcgtccgcct gaccatcgca cccggcgagg aggccgaggc    181800
     cgttttcgag gtggaccgtg acacgctggc ctcggtcggg cgcgacctgc ggctcgccgt    181860
     ggagccgggg ctggtcgagc tggagacggg ccccgcgtcc gaccggacga cgggcgtccg    181920
     cctggagatc acggactcgg aatcgaacgc aacttaggct agccttgcct tcatggcgaa    181980
     ggttcggcgg ctcacgcccc agcatccgga gatgttccgc gcccgcgtcg tgcggacccg    182040
     gcgggtctcc ccgtccatgc agcgcgtcac ggtcaccggg ccggggctcg gcggctttcc    182100
     gtggctgggg tacgaccact ggttccgcct gttcctccag ctcccccacc aacgggacct    182160
     gcgcctgccg gagttcacgg gctcgcagtg gtggcagccg tacctcgcca tccccgagga    182220
     cgagcggccg cactgcgcca actactccgt ggccgactac cgccgcgccg cggccgagct    182280
     ggacatcgac ttcgtcgtcc accgcggccc caccggcgag gtcgagggca gggccgcgat    182340
     ctgggcctgc ggcgcccggc ccggggacgc gctcgccctg ctcgaccagg gcgtcctctt    182400
     cgactgcccg cgcgacgcct ccgaggtcac cgtggtggcc gacgagaccg gcctgcccgc    182460
     caccgcgagc atcatgcgtt cactccccga gggcaccgtg ggacggctca tccaggagat    182520
     ccccaccgac gccgaccgcc gcgagctgaa cgccccggcc ggggtgacgg tctcctgggt    182580
     ggtgcggcgg gacggcacct cggtccccgg tgccgccgcc ctccgcgagc tgcgccggct    182640
     gacccgcgcc gacgcgtcgg ggtacgcctt cgtcgtcggc gagtcgaccc tggccaccga    182700
     gggacgcagg cacctgcacc ggctgggact gccgaaggag cgcatcacct tctcgggctt    182760
     ctggaagcac gaggcgatgg cggcggcctg acgcccggcc ccgctacacc tacgcctggg    182820
     gccccttggc gcgctggtag tgccgccggg ccttcatccg gttcccgcac tcggccatgg    182880
     agcaccagcg ggcgctgttg ggcttgctcc ggtccagcag gaagcgccgg cactccgggt    182940
     tgccgcacgg cttgagccgt cccggcctgg cctcctcgac gtgcgcccag gtcagcacca    183000
     gctcgacggc caggcgatgc gcgtcgggga cctgaagcac ccatcgcagt ccgccgtcct    183060
     cgatgaccgg cagcctgctg acgccgtgga ggaacccgcc caggcaggcg gggtcccgcc    183120
     ggccccggac gacgtcctgg agagcgtcgc gcacggcgac cagatgggcc gcctcctcgt    183180
     ccgacccggt gcccccgtgg ccacgcgccc acgcgcggcc ttcggcaggc gtccccaggg    183240
     cgtcgctcac cgagccccgt acgacgggag tcgtgttgag cagctccagg aggacgtcct    183300
     ccgcggccct gtcggtcacc gccgtcaccc cctaaccgtt tcatcgacat tggaaggtta    183360
     caacaacctg acctaacccc ttaagtgcgc ttgacaggtt atctccggag tgctggactc    183420
     tacctaacca ctaaaagcga ccaaaggggt ttgccatgag cgtcgccgtg caccacagga    183480
     ccgccaccgt cgacggcctg gacgtcttct accgggaggc cggtgacccg cgggcaccgg    183540
     ccgtcgtgct gctgcacggc ttcccgacca gcagccacat gttccgcggc ctgatcccga    183600
     agctcgcgga cacctaccac gtgatcgcac ccgacatgat cggcttcggg tactcggcca    183660
     tgcccacggt cgacgcgttc gactacagct tcgactccct cacggacgtg accgtcggcc    183720
     tgctggacca gctcggggtg gagcgcttcg cggtgtacgt gcaggactac ggcgccccgg    183780
     tggcgtggcg gatcgccacc cggaccccgc accgcgtcac cgcgatcgtc acgcagaacg    183840
     gcaacggcta caccgacggc ttcgtcaagg acttctggga cgggctgttc gcctacaccg    183900
     acgacccgac ccccgagacc gaggctcccg cccgggccgc gctgagcccc gggatggtcc    183960
     gctggcagta cctgaacggg gtccgcgacc ggagcctggt cagccccgac acctggtccc    184020
     tggacctggc cctgctggac cggccgggca acgacgccgt ccagctcacg ctgttccgcg    184080
     actatccgac caacgtcggc ctctacccgc ggctccagca gtacttccgt gacacccgcg    184140
     tgccgctgct ggcggtgtgg ggagcgaacg acgagatctt cggccccgac ggcgcccgcg    184200
     ccttccggcg cgacctgccc gacgccgaga tccacctcct cgacaccggg cacttcgccc    184260
     tggagaccca cctggaggag atcaccggtc acatgcggga cttcctcgcc cgggccggga    184320
     agtagacctc cgcgcggtca cgacccggcc ggccggccga ggacgtacgg agcgaggatg    184380
     tcggccaccg tccggttgcg cggcacgggc acgtccagcc ggtcggcgag gtccaccact    184440
     cccccgctga gccagggcag ttcgaggcgg ttgcccttct ccaggtcgtt gtgcatggag    184500
     gaggtcatgg ccgcgggaag ggtgtcgcag aaggcgagcc ggtcctcggc gaagccgctg    184560
     tccagccgca ctccggacgc ctgcgccacg gccaccgtct cggccatgac ctcgtacagg    184620
     aggcgcctgc tccgctcgtt ggcgcggacg actcccacgg gctgtcggac ggtcgccgtg    184680
     gtggccgaca ggcccaccag gaacacgaac ttctcccaga tcgcccgctc gatgtcgtcg    184740
     ctgccctccg cgtcgatccc ggcgtcgcgg aacgcggcca gcacggcccg gacggtcgcc    184800
     gtcgagccgg accggtacgg gccgagcacg accttctgca aggggccgtt gtgccggacc    184860
     actccgggtt cctcgatgaa cgcggagatg aagcagaccc cgcccaggac ctgttcgtcc    184920
     gtcagccggc cgcgcaggac gtcgtccttg tggacgccgt tctgcaggga cagcaccggc    184980
     gccccgtgcg ccggcgaggt ccgcagctcc tcggccacgg cctgggtgtc ccacagcttc    185040
     acggcgacca ggaccagatc cgtggggccc agctccgaga tgctcgccac gaccgagtcg    185100
     ggcgaggtac gcagctcccc cagggggctg tggacgacca gcccggaccg gcgtatggcc    185160
     gccaggtgcc cgccgcgggc cacgaaggtg acctcgttcc ccgcggcggc caaccgcgcc    185220
     ccgaagtagc ctccgacgcc gcccgccccg atcaccgcga tacgcatgac tccgcccccg    185280
     ccctcttggt aaccatcaga acggttacta tagaaccatg gacgccgtgc agcaccagcc    185340
     gccccgcaca agggtcaccg cccaactgcg ggcgctccgc ttcgacgccg gaacgctgtg    185400
     cctgaacctg gtggccaccg tgggccgcag gcccggggtt cccgtcgagc ggatgggcga    185460
     cgccgaacgc ctcgaagcct ggtgccgggg cgtggggttg acgctggcgg acgggtacga    185520
     cccccgggac gtcctgtcgt cgctgcacgc actgcgcgcg gccgcccacg acatcgcctc    185580
     cggtgccctc gacgcgcacc ggcctcggca ggagtcggtg gacctggtca atctcctcgc    185640
     gcggcccgca cctccggctc cccggctgga ggtgacggcc gatggtgcgt gggtggcgga    185700
     ggggcgccgg gcactgagca aggaggccct gctgtcgctg gtcgcacggg acctgatcga    185760
     tctcatgacc gacgaggcac gccggtcccg gctggccgcc tgcgcctccg aggtgtgccg    185820
     gatgctctgc ctcgactccg gtggcggccg accgcgcaag tggtgctcca tgcgacgctg    185880
     cggcaaccgg gccaaggcgg ccggccgccg gctgcgggag tcggcgccct gaggggtccc    185940
     gagggcccca cgcggcccgg cgaggcactc gctcacaggc cccgggccag cagcagggtg    186000
     acgtcgtcgg gcgggggcgt ggcgggcagg gtgccgatca ccgccgtgcc caggtcctcc    186060
     agggaggagg cgccgcgggt cagggcgcgc cccacccgtc gcagcccgac ctcgatgtcc    186120
     tggtcgcgct cctcgacgag cccgtcggtg aacagggcga gcaggctgcc cgcgggcagt    186180
     tccagctccg cggtggggaa gggcagcagg ccgaccccga gcggcaggcc gtgcggaagg    186240
     tcggggaacg agcagtcacc gccccggtgc acgacggcgg gcggcggatg cccggccagg    186300
     gccagcgcgc aggtccgggt cgcggggtcg tagaccgcgt agacacaggt ggcgctcatg    186360
     gtcgcgacct ccccgccgcc ctcctcctcg tcctcggtca gccggatgaa ggtccggtcc    186420
     agcctggtca gcacctcgcc cggcggcagg tcgaggtcgg cgagcgtgcg gatggccatg    186480
     cccaggcgcc ccatggtggc cgcggcgttc acgccgtgtc cgaccacgtc gcccaccacg    186540
     agggcgagcc gtccgcccgg cagcccgatg acgtcgaacc agtcgccgcc gacgccttcc    186600
     tccgcgtccg ccggcagata gcgggcggcc acctccatgg ccgttccacc gtgcacccgg    186660
     cgcggcagca ggctgcgttg gagggcgaga gcggtgttgt gctcccgggt gtaacggcgg    186720
     gcgttgtcca ggctcagcgc ggcccgcgcc accaactcct cggccagcag ccggtcgttg    186780
     tcgtcgaacg gcgtcgggtt cgaggtgcgg acgaagaccg cgacgcccag caggacgccc    186840
     cgggcgtgga tcggcaggat cagcagcgag tgcatgccga actcgcggat ctttgcggcc    186900
     ctcgccgggt cgtcggccag ccaggcctcg tgggaggggt cgagcacggg gtgcaggagg    186960
     gggcgtcccg aggacagcac ctgcatgaac ggcgaggtct cggggacgta gacgacctcg    187020
     ccgttcagcc acagggactc cggtgagccg gcgtggaccg aggccctgcc cgcgcgccgg    187080
     aacttgggga cgcgcccctg ggagcggccc agccggtcga gcggctcctc gccgagccgc    187140
     accgcctccg tcaggtcgac ggtgacgtag tcggcgatca acggcacggt gaagtcggcc    187200
     agttcctgtg ccgtgcgcat cacgtccagg gtggtgccga cccgggtgcc ggcctcgctg    187260
     accacggcca gccggtcgcc ggcccaccgc cggtcggtga cgaccagcat cagcatgcac    187320
     acaccgagga tgtggccgcc gtcgtcgtgc aggcgcacga aggaggccga gaaggcgcgg    187380
     tcgcggcggc tgtccggcgc cgtcggaacc cggtactcgc ggccggtgac acaccggccg    187440
     gtggccagca cccgccgtac gagcgcctcc agttcgccgg tgtccccggt cagcgactcc    187500
     cgcgggcggc gccccagccg ccgctcacgg gcgattccgt cgtagcgttc gagggcgtcg    187560
     ttgacccaga cgcaccgcag gccggtgtcc cacacggcga gtccgacgac cgagtccgtc    187620
     agcagggcac gcagggccgc accggcctcg ccctccggaa tcccgctcac gaccgcaccg    187680
     gtgctacgac ttcacgaagg ccaggaggtc ggggttgagg acctccggat gggtcgagag    187740
     catgccgtgc ggaagccctt cgtacgactt cagggtggcg ttcgtcagga gttcggccga    187800
     cttcggcgcc gcgtccgcgt agggcacgac ctggtcgtcc gtgccgtgcg cgaccaggac    187860
     ggggacgtcg atccgcttga ggtcgtcggt gaagtcggtc tccgagaacg ccgcgatgca    187920
     ttcgtagtgg gcgttggccg cgcccatcat cccctggagc caccagtggt cgatcagccc    187980
     ctgggagacc gtcgcgccct cccggttgaa gccgtagaag ggaccggacg gcacgtcgat    188040
     gtagaactgc gcgcgattgg cggcgagagc ggcgcggaac ccgtcgaaga cctcgagcgg    188100
     caggccgtcc gggttggtgt cggacttcac catcaccggc gggacggcgc tgacgagtac    188160
     ggccttggcg acccggcccg gctcggcgcg cgccacgtag cgcgcgacct cgccgccgcc    188220
     ggtggagtgc ccgatgtgga cggcgccccg caggtcgagc gcctcggtca gggccgcgac    188280
     gtcggcggcg taggtgtcca tgtcgtggcc ggtcgagggc tggtccgagc ggccgtggcc    188340
     acggcggtcg tgggcgatca cgcgatagcc gtgggagagg aagaacagca tctggttgtc    188400
     ccagtcgtcg gcactgagcg gccagccgtg gtggaagacc accggcaggc cgtcgcgcgg    188460
     gccccagtcc ttgtagaaga tgttcgtgcc gtcggaggtc gtgacggtgc ccatgactga    188520
     tccttccgcg taggtgactg atccgcgcca gccaccttac gccggaaacc ggcatacctc    188580
     atttttcacc cataatgact agatcacgac gaagcggatg gcggaggaag caatgacggc    188640
     gggaccgcac agggtggtcg tcctcgtgtt cgacggcatg aagctgctcg acctgtccgg    188700
     tccggcggag gtcttcagcg aggccaaccg gttcggggcc gactaccggc tgagcatcgt    188760
     ctcggcggac gggtcgccgg tgcgctcgtc catcggcatg ctggtgccgg cggacacgga    188820
     cgcgcgggcc gccgccgccc acgacacgct ggtcgtcgtc ggcggcgacg cgctgcccgg    188880
     ctcccccgtg gaccccgtcc tcggggcggc cgcgaaggag ctggcggaac gggcggggcg    188940
     cgtcgcctcg gtgtgcaccg gcgccttcgt gctcggcgcc gcgggcctgc tggagggccg    189000
     gcgggcgacg acgcactggc agcacaccgc gacgctggcc cgccggtgtc cgtcgacgcg    189060
     ggtcgaggcc gacgcgctgt tcgtgaagga cggcagcaca tacacgtccg ccggggtgac    189120
     cgccggcatc gacctcgccc tcgccctgct ggaggaggac cacggccccg gcctggcccg    189180
     tcaggtcgcc cgctcactgg tggtgtacat gcagcgggcc ggcggccagt cgcagttctc    189240
     cgcctcgctc cagggcccgg ctccccgcac gccggtgctg cggctggtcc aggaggcggt    189300
     gcagggcgat ccgacggcgg accacggcct ggaggcgctg gccgcccggg tgcgggtcag    189360
     cccgcggcac ctgacgcgca tgttccgggc cgagctggac acgacgccga tgaagtacgt    189420
     ggagctgatc cgcttcgaca tggccaaggc cctgctcgac gccgggcaca acgccaccga    189480
     ggccgccacc cgatcgggct tttcgagcta cgagagtctg cgccgggcct tcgcccggca    189540
     cctgggactg tcccccatcc ggtaccagca gcgcttcgcc accacctccc gggagtcgtg    189600
     aagcgcggaa gtcatgaccg gttccgaggg gttcgtggcc atcgggcagc ggacacggtc    189660
     cggccgcccg gcgcagggtg gaaccgacac gacaggcaac cgtcccggga ggaccaccat    189720
     gacggagacc atcgccggaa tcggcatccc cgacagctcg ctggcgcggg aggcgaccga    189780
     actcgtccgt gacaccacac cgccgctgat cttccaccac tcgcggcgcg tctacctgtt    189840
     cggcagcctc caggccgccg ccctgggcct gcggccggat ccggagctgc tgtacgtcgc    189900
     cgcgctcttc cacgacaccg gtctggtgcc gccctaccgc ggcgacgacc agcgcttcga    189960
     gatggacggc gcggaccagg cacgggcgtt cctgctggcc cacggcgtgc ccgaggccga    190020
     cgcggacacc gtgtggacgg ccgtcgcgct gcacaccacc ccggaggtcc cctacaagct    190080
     ggcgccggag atcgcggcga ccaccgcggg cgtcgagacg gacgtgctcg gtctgcacct    190140
     ggcccgcatc acccgggcgg agatcgacgc ggtcaccgcc gcccaccccc gcccggactt    190200
     caagaagcag atcctccagg cgttcaccga cggcttcggg caccgtccgc agaccacctt    190260
     cggcacggtg aacgcggacg tcctggagca cttcctgccg ggcttccggc gcacggactt    190320
     cgtcgaggtg atcgagaact ccgcctggcc ggagtgactc ctcgcggggc tcctacggcc    190380
     tcgggttcct gcgcggggag agtgtggcgt tggggagcgc gggcgccggg aggcggtcgc    190440
     cggggtagcc ctcgacccgg ccgaagcgct ccgcctcgtt ctcccagtcc gctctggcgg    190500
     ccgcgatctc gtcgtgggtg cgtccgacga agttccacca catgacgatc tcctccggga    190560
     agggcggacc gcccagcacc accagccggg cggcgccgga tgccgcattg gtcagtgcga    190620
     gggtccttcg tcccggtgcg gcgtaggcca gttcggcggg gcgcacgacc gtgccgtcga    190680
     ggcgtacgtc gccgctgtcg acgaggactc cgtgctcgaa gccggggtcg acgtcgaggg    190740
     tcacggtggc gcccggggcc agggtcacct cggcgccgag caggggcgtg aaggtgccga    190800
     ccggtgaggt gtcccccgcg agcgagccga ggaagacgcg cgcctcgccg ccgtccaggg    190860
     ccaccggggc ggggacgtgg tgctggaagg ccggagcggt gtcgcggtgc tccgagggca    190920
     gcgccaccca gagctggacg ccgtgcagga ccgtggtgtc cggggtggac acctcggagt    190980
     ggctgatgcc gtgaccgccc gtcatgaggt tcacctcgcc cggtctgacg agcgcgtggc    191040
     tgcccacgct gtcccggtgc tcgatctccc cgctgaacag ccagctgacc gtctggaggc    191100
     cgatgtgcgg gtggggggcc acgtccatgc cgccggaccg cgagacctcg tcgggaccgt    191160
     agtggtcggc gaagcaccag gctccgatca gcgtccgggc ccgctgcggc agggtgcggc    191220
     gcaccgtcat cgcgcgcggt ccgccgagcg ggacgtcccg cgccgtcagg atctccacgc    191280
     cggcggcggg cgccccttcc tcccctgccc cgcacctgac ttcggcgggg tgcgtctccg    191340
     tgttgctcac cgctcggccc tcccactcgc ccctgaaagt ttcagtttca acttctatgg    191400
     ttcgatgata ggacgtgaga aacggtatcg cgcgacggag gacaccccac atgacacaga    191460
     cgcctgtacg cgccgacgca ggcgcccctg gtagcaccgg cagcaccggc gaacgacgtg    191520
     tgttcgtcga caagcagagc ccggaggcct acgcggcact gcgtgccacg gcggaggcgg    191580
     tccggggcgt cgccgaggcg gccgggctcg accggatcct cgtggaactg gtcaacatcc    191640
     gcgtctccca gctcaacgcc tgtgcctact gcctcaacgc gcacaccagg gccgcgctgc    191700
     gcggcggcga gaccacccag cggctcggcg tgctgccggc ctggcgcgac accgagctgt    191760
     tctcgcccag ggaacgcgcc gcgctggccc tcgcggaggc caccacgcat cccgccgacg    191820
     cgggcgcgca gagtaccgcg tacgccgagg cgcggggtgt cctgtcggac gacgagatct    191880
     ccgccgtgat ctgggtggcg atcagcatca acgccttcaa ccgggtctcc gtactgagca    191940
     agcatccggt gcgcggcgcc ccgcgcgcct gacccccggc gggtgcggcc ggagccgctg    192000
     gagcggggac attcgtacaa gacccgtgtc cggcaccggg cgcacccttg cggcatgagt    192060
     cagtacgacg cccgtttccc gcacggcatg cacgtggtcg acgacggccc gccgcaggcg    192120
     ccgccggtcc ttctcatcca cggttccggc gcctccggcg cgtcgtggaa ccgggtggtc    192180
     ccggcgctgg ccgagcagcg tcgcgtcctg cgcgtcgacc tcccgggctg cggcaagtcg    192240
     ccgcccaccc cgtcgtacga cgtgccgttg caggcgggcc ggttggcagc gctcctggac    192300
     gacctcggcc tgcgttccgt gaccgtggcc ggccactcca gcggcggcta tgtcgccacg    192360
     gcgctcgcgg agcggcgtcc cgacctggtg ggcgccctcg ccctggtgag cacgggcccg    192420
     aatccggacg cgctccttcc gcagccgatg atcctccggc tgctgctggc cccgcccttc    192480
     ggcccgctcc tgtggccgcg gcgcacggac gcgatgctcc gcaaggcgat cgccgcgacg    192540
     gccgccggcc ccgtggaggt cccggccgag atggtcgacg acgtgcgggg catctcgtac    192600
     cgctccttcc ggacggtggc ccgcgggaac acggcctacc tcgccgagcg cggcgtgccc    192660
     gaacgcctcg ccgccctcac cgtcccggtg ctggtgctct tcggtgccgc cgacccgcgc    192720
     tgggacccgt cttcggcgca ccggtacgaa gccgtaccga acgcgcggct cgagctgctg    192780
     ccgggcgtcg ggcacctgcc gccgctggag gcgcccgggc cgaccggcga gttgctgctc    192840
     ggcctcaccg cccggggcgc ggacctcccg gccgccggcc ccgagaccta gagtggcggc    192900
     gtgctgtcca ccgagacacc gaccgaccca tcggcccccg cacctgccgt cgcaccgacc    192960
     ggggcgccgc cggactggtc gatcgtggac gtcgcggtcc cgcggccctc ggtccggctc    193020
     gcgggggtcg ccatggccgg gttcagtcag cacgtgtccg ccttcgtgga catggccatg    193080
     gtcgcgcatc cgtccgtcac cctgctcatc gacctgagcg acggcgacgg catcctgtac    193140
     agcgcccggg accggcacgg gcacggcagc ttcgtcgtcg ggctcgcccc gggcgacctc    193200
     agggcggcgg gccgcgtcgg cacgtgcctg cagatccggc tggaaccggc ggtggcggcc    193260
     gcggtgctcg gcccgtcggc gggcctcggc gggcgggtgg agtcgttcga ggacgtctgg    193320
     ggccgtgagg cggggcgggt ccaggacgag ctgcgcaccg ccgggtcttg ggacgagcgg    193380
     ttcgcggtcg cggcggacgt cctccgccgc cgcacggcgg accggcctcc ggtcgatccg    193440
     gaggtcgccc acacctggcg cacgacgctc gcgggccggg ggcgcgtacg ggtcgagggg    193500
     ctggccgagg aggtcggctg gagccgcaag cggctgtcgg cccgcttcca cgcccagctc    193560
     ggcatcacgc ccaagcgggc cgcccggctg gtgcggttcg accacgccgc ccacctgctc    193620
     gcggccggcc tggccccggc ctcggtcgcc ttcgagagcg gctacgccga ccagtcccac    193680
     ctgcaccggg aggtcaaggc gttcaccggc ctcactccca cggccgtggc cggcgcgccg    193740
     tggctcgcga tcgacgacgt cgcctggccg ggctcgtcgc ccgcgcggtc cgtgagcgcc    193800
     gcggggtccg ccccgcgccg aatggcacgg cccggccgtg cgtggaatcg tggtcggacg    193860
     gcatggacgg atgcgcactg acaccgaacg cgcaccgatc ggacgtcttc cgaaggaggc    193920
     acgcatgtcc tcgaagcgac gccggaagaa gaaggcacgc cgcaatcacc cggccaacca    193980
     cggacggcgg ccccagtcct agggcggctg ttcggtgcgt ccccccggcc cgcggtgccg    194040
     gggggacgcg cccgtcagtg gcccgcgacc gttccggaca gctcgttggt gccctgcggc    194100
     agggtcaccg aggttcgctt ccggccggat tcgaggtcga tggcgtgcac ggccttcttg    194160
     cccggttcgg acacgtaggc ggtgtggccg cggacgaaca gggtgggccg ggcctgctgc    194220
     cagtccaggg gttcctgcca ctgacccacg gcggggatct tcttctcgac cgtgcccttg    194280
     tccggatcga tgacgtggat ggcgccgtcg gtcccgagga cgagcgcctc gccgtgcggt    194340
     ccacgggcga gggagcggaa cgagtagctg gtgcccagct cgaccaggcg cagcttcgcc    194400
     gtcccggtgt cgatcaggga gatgcgggtc ggccgttcca gctcggcgtc cgggtcggac    194460
     ttgtagtcgc cgaggagcac gggggacgcg tcgctgcccg cctggttgcc ggtgcggccg    194520
     tagtcgtcgg gggcgtcgac cttggtgaac cggccgtcct tgtagatcag gacgccgtcc    194580
     tcgcagccca gggcgatcgc ctcgccgcgg gcggccgcct cgccgtggac gcccgggcag    194640
     ttctcgctgc gggcgatctc cttgccgtcc ttgtccacca ccagggcgcc ggtgcgtttc    194700
     tcctcgtccc cgagggtggt gaggagccgg ccgtcgctca gctcgatggc gacgccgtgg    194760
     tgggcctcgg ccgacctgta ggtgcgcccg tccggcttct cgccggtgcc caggtcgccc    194820
     ggcgcgaaaa cgttgacctc accggtgccg tcggtgaaga gcacggtctt cccggcgtgg    194880
     cggacgacgt ggccgggctt cgcgcccttg tactcgatgt cggtgagggc ctgccgggtg    194940
     gcgttcagca ggcggaagcc gcggtcggtg gagacgacca cgtggtcctt gtcccccgcc    195000
     gggttgacgc ggttgaagcc gggaaggtcg atggtcctgg tgagttcgag gctcttgccg    195060
     tcgaggatgt agaggccgcc gtcgaaggtg gccaccaggg gatcctgcac cgaggccgcg    195120
     ggcgtcgccg acggggtgct cccgccgccc ttggacgtgg cgtccgacga ggaggtgtcg    195180
     ccgccgcacg cggtgaggac cgcggacacc gccagggcga gtgccgtccc cgtgacggcc    195240
     ctgttgcgta tggacgtgtt caactgtgcg ttcctttcgg gctgccgacg gtcagtccgt    195300
     cggtcagggc ggtggtgttg gcgcgcatca tctgcaggta ggtggcggcg ccctcgttct    195360
     cggcggtgag ggactcggag tacagctcca cgacccgtac gccgtcgccg agttcggtac    195420
     tcaggacctc ggcgagccgc ttgggccggg aggagtcggc gaagaccgtc cggacccccg    195480
     cccgctccat ggcccgggtg agcgagcgca ggtcggagga gctgggggag gccagcgtcg    195540
     tgccgctggg gatcaccgcg ccgatgacgc ggaagccgaa gcggtcggcg aggtagccga    195600
     agacgtggtg gttggtcacc aggttgcgcc ggtcctcggg cacccggtcg aaggacttct    195660
     ccatgaaggc ggtgaggtcg gcgagttgct cgtcgtactc ggcggcgttg gcccggatcg    195720
     cgtcgtggtc cacgcccgtc acgtgctcgc tcacgcggtc ggtgatgagt ccggcggccg    195780
     tgcgcacgcg gtcggggtcg gtccagaagt gcgggtcggg ccggcccgac tccccctcgg    195840
     gtcccccgtc gtcaccggag tggaaggtga gcgggtcgac cgccctgccg acctcgaagg    195900
     tcgccacacc cgcctcacgg gcggcgtcca cgtgccgcag gacgttctcc tccaggccga    195960
     gtccgttgaa gacgacgagg tccgcgcgtt ccagctgggc ggcctgcacg gccgacagtc    196020
     cgaaggagtg cgggtccgcg ttgggcttca tcaggaccgt gacctccgcc tggtcgccca    196080
     cgacctggcg ggtgatgtcg cccaggatgt tggtggtcac gacgatgcgg ggttgttcgt    196140
     ccgtggcgga gcaggccgtg gcggtggcgg ccgtgaccag ggcgagcagt cccaccagga    196200
     ggcggcgcag ccgtgccacc cggatgcgtg tgcgtaccgt ccccctcatc ggccggtctc    196260
     cgccatcagc cccggtgcga tgtcgaggtc gaaggagcgc gcgacgcgca gggcgtcgtt    196320
     gtagtcgatc tcgtacacgc gtttaccggt gcggtcgttg acgtaggcgc ggctgcggtc    196380
     gacctcgacg accggtgctg ccgcgccggc gggggtcttc gcggttctgg tcaggagggg    196440
     ctcggtccga gccgtgtgcc tgccggtggc gatgtcgtag ccgtgcagtg cgccgtcgct    196500
     ctccaggacg aggagcggtg agccctcgcc ggcggtgttg gccgccagga ccgggccggt    196560
     cgtcctcacc cgggtccagt cgcggtcggt gacgtccagg acccacacgg cccgctcgcc    196620
     ggcgggtgcg gtcagcgtgt cgctgccggc ccggtggcga aaggccgtgg cccgttcctt    196680
     ctcgggcacg tcctgtccgt acggaatcct ctcggccgtg aacgtcccgt cctcggcgct    196740
     cacgagcagg gccccgtcgg cgcacccgag gacgacgccg cggcgggtga cggcgtcgcc    196800
     cgcgggccgc tcgcacgtcg cgtcgggcga ggcgacccgg cggcccgagc ggtcgtacac    196860
     ggcgacctcg gcggactcgt cgtccccggc gagcgcgacc aggtgctcct cgtacgggac    196920
     gacggcgccg gcgtgcacac cgtcgagcgt ccgggccggc ccgacctcgc ccttctccag    196980
     cgccgtccgg tcgtacagcg tcgtccggcc ctccgggtcg gtcgccgcgg tcaccgcggc    197040
     gtcgctgcgg atctcggcgc cgcggccgcc cggcaggtcg ccgacgtggc gtatcgccgc    197100
     ccggtagtag tgcacgtggt cgccgtggtc caccgtccag gcaccgccgt cgaccacgtg    197160
     cgtgccgcgg tcggtgtgga agaagccgaa gcggccgtcc gtgctcagcc cgtcggcgcc    197220
     ggtcaccggc tcgctctcgt gcaccttgcc ggtgacgagg tcgagcaccc ggctcgcgcc    197280
     ggtgccgggg tcgccgagga tcagccggga ctgctcctcg gccgcttccc gcgctccttc    197340
     gacgtagccg tgcggggtgc cggacgactc ggtcgccgcg ggttcccgcc cgtcgtccga    197400
     ctgctccgaa cagcccgtgg cgagcagtgc ggcggtgagg acgagtgcgg tcgggagccg    197460
     gcgggtcggg tgtgtgcgga cggtcggttc catcgcctcg gattccttca gtcgactgtc    197520
     gggtgggggg tggcggggcg cgtacggagg tgccgcaggc cggacgccgt gtgggagagg    197580
     aagaacaggg ccaccgcgac ggccgagacg gtcgcgccgg cggcggtgct caggtgccag    197640
     gacaggagca gtccgccgaa cgtggcggtg acgccgagga gtgccgcgag ggccatgacg    197700
     ccgcggacgc cgcgcgccca gggcagggcc gcggccggcg gtgcgatgag caggccgagg    197760
     acgaggagcg tgccgacgat gtggaaggag gccacgatcg cgaggcccag caggacgagg    197820
     agcaccgcgt gggcgagccg cgggcgcagt ccgagggtgt gggccttgcg cgggtcgaac    197880
     gcgagggcga ggaaggcccg gtggccgagc acggagacga gcagcgccac cagcagtgcc    197940
     ccgcccagta cgagcaggtc ctgctcgcgg acggcgagga cgtcgccgaa caggatgccg    198000
     gtcaggtcca cggcgaagga ctgcgaacgc gacacgatga tcacaccgat cgagagcatg    198060
     ccgacgaaga gcaggccgat gccggtgtcc tgggagagtc tcggggtgcg cccgagcgcg    198120
     gtgacgcccg cggccatgac ggcagcgctg gccaccgctc ccagcagcag gttgccgccg    198180
     agcagggcgg ccagcgccac cccgggcagc agtccgtgcg acatggcgtc gcccaggaag    198240
     gccatccccc tgagcacgac ccaggtgccg gccagggcgc agatggcgga taccaggatg    198300
     ccgccccaca aggctctttg cacaaacgtc acttcgaacg gggccgtcaa ccaatccatg    198360
     cggaggacac tacaatgaaa atcatgttca acaaatcccg cccctcaccc cccgccgtgc    198420
     ccggacgggc gtcaggagta cgtctgaccg agctgtgcgc cggctacccg ggacgaccgg    198480
     tcctgaggca actcacctgc gagataccgg cattggccgt cacggctctg gtcgggccga    198540
     acggcagcgg caagtcgaca ctcctcggcg tgctggccgg tgtgatccgc ccgacatcgg    198600
     gagacctgca ccgggacggc gagcggccgc ccgccttcgt accgcagcgt ggcgccgtcg    198660
     cggacgccct gccgctgacc gtccggcaga ccgtggagat ggggcggtgg gccgagcgcg    198720
     gcccctggcg ccggctgaac cgccgagacc ggctgatcgt ggactcggcc ctggaccggc    198780
     tcggcatcgc ggacctcgcg ccgcgtcagc tcggggagct gtcgggcgga cagcggcagc    198840
     gcgccctcgt cgcccaggga ctcgcccagc agtccgacct gctcctcctg gacgaaccga    198900
     ccaccggcct cgacccggag gccagacagc gcatcaccgc tctcctgacg gacctggtgg    198960
     ccgacggcgt gacggtcgtg cacgccaccc acgacctgga ggccgcgcgc tcggccgagg    199020
     cctgtctcct gctccgcgcg ggcaccctgg cgggacaggg ccggcccggc cgggtgctca    199080
     ccgcctcggc cctggccgag gtctgggccg ttgccggaca cgcgggccct tgataggcag    199140
     gtgatgtccc ggagggtccg gagagtcagc agggttccgg cccgcccgag cacctcgtga    199200
     cccgaccgcc cggaacccac gcaccggaga tgaccccatg aagatcaacc tcaccagcgt    199260
     cttcgtcgac gatcaggcgc acgcgctgcg cttctacacc gagaccctgg gcttcctgaa    199320
     gaagcacgac gtgccggtgg gggcgggtgg ggaccggtgg ctgaccgtgg tctcgcccga    199380
     ggctcccgac gggaccgagc tgctgctcga accgtccggt caccccgcgg tggcgccgta    199440
     ccggacggcg ctggcccagg acggcatccc ggccgcctcc ttcgccgtgg acgacgtacg    199500
     ggcggagcac gaccggctgc gctcgctcgg ggtgcacttc acccaggagc cgatggagat    199560
     gggcgcggtc accacggcgg tcctcgacga cacctgcgga aacctgatcc agatcatgca    199620
     ggtccggtag ccggtggggc gtgccctgcc gcgcgggccg gctcggctcg ggccgtccgg    199680
     cgtcacgcgc ccggcgggcg gaactggggg ccgtaggtgc cccggccgcc cgggatgccg    199740
     gtttccatca gctccacggc ggggccctcc agtgcgcgca tcgtccggac ggccgagccc    199800
     agggtgcgtg cgtcgccgtg ggcccaggcc gcctcgaggg tgccgaggac cttggcgtag    199860
     gcggtgtcga aacggtcgag gaggtccccg acccgctgcg agggaccggg ccagccaccg    199920
     gccgggaccc gggccatggg gcgcgcgtcg gggaagggca cgggtgcgcc ggtgaaccgc    199980
     cagccgtcgt cctcccggcg cagttgccgg ccgtggtaga tctcgccgaa ggcgtagtag    200040
     tgggccgggt agtcgtcgcc gaaggcgtct tcgggagagc tggcggtgcc ctctccctgt    200100
     tccttgatga tctcaacagc ccgctcgacg ccgtcgaggt cggtcacggg ttccaggacg    200160
     tcggagccga tgcgctggga caactgcccg ccggccgaca gtggcggtgc cgtggccctg    200220
     aaggcgcgca gcaggccgtc gtagaagtgg ccgatgccgg gcgagttgtt cgcgccgcgg    200280
     gccaggggga cctccggggc ttcgatggcc atcatcacgt cgcgcacgaa gggcctgttg    200340
     aggcccgaga gatagacgtt cacctcctcg cgcacgccgc cgggcagcgg gccggggtag    200400
     gcgagggcgg cgtccgtgat ccgcggccgg ccgcccaccg ccaccagcag gttgcagacg    200460
     acgcccatgt ggtacatctc gtcgccgatg atgcgccgga tcagccgtgc gacgtggctc    200520
     gtgcggtcgc ccacggacca ccatccgcac aggtagggcg ggatggtggc gagttcgagt    200580
     gctacggcga cctgaagggc ctccctgagc cagtcgacac cgcgcccgct ctccgggacc    200640
     gcgagcaggt gcgccacgga ccggcagccc ggcgcggcgg cctccggcag cccggccgca    200700
     agggcgggtg cggcggccgg gacggacgcg gcggccgcca cgacggccga cgccatgaag    200760
     gtcctccgcc cgaacggggc acccgtctcc gacgcttcct cgcgcacacc agtcacccgt    200820
     actccctccg caggcggcgc ccgcatccga ccgggacgtc cgcattcgtc cgacggctgg    200880
     cgaaactagc agcggtgagg tcgtttcccg ggcgggcggc accgaagggg gcatcctcta    200940
     cccggtcggc cctaccgggg acggccctca cgtatcagcg acagcaacag cgcgtgcgtc    201000
     ccggcgtcgg cggccgccac gagaccgcgg ccgacgggtc cgacgggctc gccgtcgact    201060
     ccggtgacga cgcagcccgc cgcccggcac agcgcgatgc cggccgcgaa gtgcacgctt    201120
     tcggtcaggc cggtgccgtc ggtgacgtag gcggcgcgct tcccggccgc gacccaggcc    201180
     agggccaggg tcgtggacag gacccgcggc cgcaggcgcc gcacgaagcc ggggtgggcg    201240
     atcaggtcga ccgcccggaa cgcgggcgcg cccgggaagg gcgggtccag gttcacgtcg    201300
     accagccggg tggccgcact gggcgccagc ggtgtgtcgt ggccgtcgcg ccggacccgg    201360
     gcggtctcgc cgtcggtgaa gaggacctcg ccgccgaagg ggtcggccac ggccgccggg    201420
     ccgccgcgca gcgccacgtt gacggccacc gccatggtgc ccgcggcgta gttgagcgtg    201480
     ccgcacaggg gatccaccag ccactggcgt gccgcgtcgg ccgctccccg ccgcccgccc    201540
     tcctcaccgc atatcgcgtc gtggggccgc gcggcacgga tgacgccgag gatcgcctcc    201600
     tcggcggcca cgtccgcgtc ggtggcgaag tccccgccgc ccttgtcgaa ccgggtcagc    201660
     cgccgtccgt agcgggcgcg cacggtctcg gcgccggccc gcgcggcggc gatcgcgact    201720
     tcggtgtcgt cgtgacgcgc accggtttcg tcatggggca caggcaagtt gatcacggtg    201780
     tgcagggtaa cggccgaagc tttccgggcc tccggtccac cgggcctccc gacctcccga    201840
     cctcccgacc tcccggcctc ccggcctccg gtccgacgac gccgggggac ccggggagag    201900
     gtgccggtct gcttcaggag gtccctcagg agatcccggc gcggcagggc cggccggtgc    201960
     ggaggttccc cgtggcgccg gtgatgacgg agtccggccg gccccgggtg ccgaccggtt    202020
     cggcgatgcg gccctcgaca cgctcccgct cgatggacaa ccggtcgagc agttcgggcg    202080
     tggcccggcc gccggccgcg tacggcacga gtccgacgat ggtcctgctc tacaggcccg    202140
     gcgcggcctg gacggccgat ccgtacgtcc tgagccccgg ccggaggagc cccctcaccc    202200
     tcttcgcagc ggaacacttc ctcggcggga tctccggcta cgaggccgcg gagaccaccg    202260
     acgagaaccc cgccgcccac gtcgccgtgg tccgacgggt gcccctggcc cacctccgcc    202320
     acaccctcgg cgtcgacagc accgactgga cggcggcgcg caggaccctg gccggaacgg    202380
     cccatcccct cggccgactc gaagccgagt gagcccactc cgcgagacaa cccccgcaac    202440
     cccgcgcgac ggacaccgcc gttgacacac tcttgacacg gtcacgtcga ccgcttgtat    202500
     ggtctagtcc aacagaactc gccgctccgt ttacggagtt gagccctgcc gggggtccca    202560
     cgccccggcg gggacggtga gtgcgcgtca ccttcgcgcc tcctggcccc acccacgaga    202620
     ggccgtactc ggcgtgcgcg cggtcccccc acacacggcc gcgcgtgccc tgggacggcc    202680
     ggatgtgaag gagttcccat gcacgcacgt cggaagaccg ctgccctgat cggcgcggtc    202740
     ctcgcccctg tcgtggccgt gagcctgccc gcctcctcgg cgagcgcgca cggctacatc    202800
     tccgacccgc ccagccgcca ggcccagtgc gccgcgggca cggtgtcctg cggcgacatc    202860
     acgtacgagc cccagagcgt cgagggcccc aagggcctga ccagttgcag tggcggcaac    202920
     agccgcttcg cggagctgga cgacgacagc aagggctggc aggtcacccc ggtgtcgaag    202980
     accacgacgt tctcgtggcg gctcaccgcg cagcacgcca ccagcacttg ggagtactac    203040
     gtcggaggtc agcggatcgc actgttcgac gacggcggcg cgaagccggg ctcggtcgtg    203100
     aaccaccagg tcgacttcgg cggactcacc ggacagcaga aggtcctggc cgtgtggaac    203160
     gtcgccgaca cgtccaacgc gttctacgcc tgcatcgacg tcaacgtcgg cggctgacgg    203220
     gccggtcgga gcggtccggg gagcggtcgc accctcttcg agggtgcacg gccgctcccc    203280
     ctccgcccgc cgcctccgcc ctccccccga ccctccctac catcgagcag gagcagatac    203340
     cgtgcagcac cgcaagctcg cgctgctggc cgccaccggt gcggccgccg ccctgtgcac    203400
     gctgaccatg gcgccgtcgg ccgtcgccga gaagtccgac acccggaccg ccgccgccga    203460
     attcgtggtc agcgaagccc agttcgacca aatgttcccg agccggaact ccttctacac    203520
     ctacagcggc ctcaccgccg cgctcagcgc ctacccgggg ttctcgaaca ccggcagcga    203580
     caccgtgaag aagcaggagg ccgccgcctt cctcgccaac gtcggccacg agaccggcgg    203640
     gctggtgtac gtggtggagc agaacaccgc caactacccg cactactgcg acgcgtccca    203700
     gccgtacggc tgcccggccg gcaacgacaa gtactacggg cgcgggcccg tccagctgag    203760
     ctggaacttc aactacaagg ccgccgggga cgccctcggc atcgatctgc tcaacaaccc    203820
     cgacctggtc cagaacgact cggccgtggc ctggaagacg ggcctgtggt actggaacac    203880
     ccagaccgga cccggcacca tgaccccgca cgacgccatg gtcaacggcg ccgggttcgg    203940
     cgagaccatc cggtccatca acggcagcct ggagtgcgac gggggcaatc ccgggcaggt    204000
     ccagagccgg atcgacaact acgagcgctt cacccagctc ctcggtgtcg agcccggcgg    204060
     caacctgagc tgttaggacc cgtccggccc gcccgccccc tcgtgcccac cggagtgccc    204120
     ggtcgcgagg gggccgcgcc ggcggcggaa ccagcgggcc cggccgcgtc gggaccggct    204180
     agaaccgcgg ctggccgtcc ggcccgcctc cgcaccggtc ccgtccggcg cggcgggagc    204240
     ccatcgccag tcgtcgggcg acagcagcgg ggacctgcgt tccgcctggg cgcggatctc    204300
     gacgtgggag gcgtacgccg tggtgcggaa cgcctcctcg taggaggcga gggccgcgcc    204360
     catcgccccg cccgccaggc cccggcggcg cacgcgcgac gccagccagg tgaagctgcc    204420
     gaggaccgcg gcgaggccac cggcgaggag cacgaacggc aggagcgcat ccatgggctc    204480
     gaccctaccg gccgggcggg ccccgctccc cgggcaggca cagcggtccg ggcccgcgtc    204540
     actcgccggg tccgccgtcc gctccgggcg caccgagccg cgcgaggtct tcggcgtccg    204600
     gctcctccag caggaagccg gcaccgccct cgagcatgcc ggcgatctcg gccgagcgcg    204660
     gaagcatcgt cttctcgtag gtgcgcacgg catcgtcgac ggtggcggac gccgcgaggg    204720
     cgagcgcgag ttccgcgccg tcgagcatgg cgaggttgac tccgacgccg agcgggggca    204780
     tgaggtgcgc ggcgtcgccc agcagggtca cgcccggcgt gggccgccag gtgtgcggca    204840
     ccggcagggc gaagagcgga cggtcgacgt acgggccgtc gttctcggtg atcatccgga    204900
     gtatccgggg tgaccagccg gcgtactcgg cgaggagccg ggcccggatg ccgtcggtgt    204960
     cgtccggacg cagcccgctc gccgtcatcc agtccagggc gaccctccgc atgacgtaga    205020
     cgcgcatgtg cccaccgctg ttccgctgcg cgaacaggcc ccgctgtccg tcggccacgt    205080
     gggcgctgcc ccggccgacc agttcggaca gctccgggtg cgcggattcc atgtcgtcga    205140
     accaggcctc gaggaagccg accccggtgt agcgcggtac cgcgtcggac accgccgcgc    205200
     ggacgcggga gaaggcgccg tccgctccga tcacgaggtc cgtctccacg gtgctcccgt    205260
     cggtgaaggt gagcgtccgc ggaccttcgg caggcccgct caccgattcc aggccgtgtc    205320
     cccaccgcac cgtcccggcg tccagagatt ccagcaggag tccccggagc tggccgcggt    205380
     cgatctccgg gcgggccgtc tcgccctcgt ccggcagccg gcgcccgagg agccgccccg    205440
     cggtgtcgaa gcggcgctcc tcctggctct cgcacctggc gagcgcgaag aactcctcca    205500
     gcaggcccgc ttcgcggagc gcgagctgac cgtcctcctc gtgcaggtcg agcgagcctc    205560
     cctggtcgcg ggaggcggcg tccggatcgc ggtcgtacac cgtcaccgcg atgccgtgcc    205620
     ggcgcagcac acgtgcgcag gtgagccctc ccgggcccgc accgatgatg ctgatccgcg    205680
     cggcggcggg tgtcggagag ttcatggtgg cttccttccg ttggcgggtc ccccgtggaa    205740
     accaccaaag cagaaacgag tgagaaactg caactgttcc agttttttag tcactgcact    205800
     tacggttcgg gttcagttcc tgtgtcgttc cagtcgtgcg ttagagtggc gccatgcccg    205860
     actcaccgac cccaggccgc cgcgagcgca agaaggcggc gaccaggcag gccatcgccg    205920
     acgccgccct gcagctgttc ctggagcacg gtttcgaccg ggtcagcgtc cgcgacgtcg    205980
     ccgagcgggc cgatgtctcg acgacgaccc tcttcgcgca ctttccgagc aaggagtcgc    206040
     tggtcttcga ccgcgagcag gaagtcgacg ccgcgctggc cgccgccgtg cgggaacggc    206100
     ccgacggcca gggcgtggtc gaggcactcc gggcacacgc cctggagtcc tgggtgccga    206160
     tcgtgaccga tccgcgccgg gcgcgcttca ccgccctggt cagcgacacg ccggcgctcc    206220
     gcgagtactc ggagcgcatg tggatgcgac acgccgacac tctgagcacc gtgatcgcgg    206280
     aggaactcga ccgggagccg gacgattcgg cgtgcgcggc gctggcccgg ttcgtcctgg    206340
     agatccccgc cctgaccacg ggacggcacg atccccgggc gaccgtggag acggtgttcg    206400
     acctgctcct gcacggctgg cggtcacagg cgggtccgcg tccccctcag gcggacggcc    206460
     ggtagtcggg cagttccagg gaggagtggg cggcgcgccc ttcccgggcg ctcgtggtca    206520
     ccatggcccg cgccgccgcc tccggatcgc gcagcagggc gttgcgcgct tccaactcct    206580
     gccgtgtcgc cggggtgacc gccgagccgc cgctggtggc cagcgcctgg ttgcgctcgg    206640
     cgaagggacg catcctgcgc tcgtaggcgg cgaaggcctc cgtgtggtcc gcgtgcgcgg    206700
     ccagttcgcc ggccaggacg tacgcaccga cgagcgcgac gctcgacccc tggccggaga    206760
     tgaacgacgt ggcgtgcgcg gcgtcgccgg cgaggacgac acgcccgtgg gaccaggtgc    206820
     gcaggtggat ctggctcacg atgtcgaaga agaggtcgtc ggcctcgcgc atgccctcga    206880
     ccagccgcgg caggtgccag acccgctcgg ggaagcgcgc cgccaccagg tcccgctggg    206940
     cgcgggggtc acggaaggcg tcgaagggcg gggcttcgcg ggtgaaggtg aggaagccgt    207000
     gcagccggcc ggcgggctcg tgggcgtaga ggacggcgct gcgccccggt tcgttccaga    207060
     tgacggcctc gtgtgcgagt ccgaactcgt tcggcagcgt gaagcccgcg aagacgtgtc    207120
     cgaggtagcg gtggaacggc tcctcgggcc cgaagaccag cctgcgcgtg ttcgagtgca    207180
     gtccgtccgc gccgaccacg aggtcgaagg tgcggcgcag gccgctgtcg aagacgacgt    207240
     gcacggcgtc gccggtgtcg tcgagggtgg cgatcgagtc ctcgaagagg aactcgaccc    207300
     gatcccgcag cggggcgtag agcgcgtcgg ccaggtcgcc gcgccggacc tcgaggtcga    207360
     cccccgcctc tcccccggtc agctgctcgg gctggagcga gccgaccgtc tcccccgccg    207420
     cgtccacgaa ggtgatccgc tgactgtcga cgtgcgcctc ggtcagcgcc ggcagcagac    207480
     ccatgcggtc gacggcctcg cgggccgtgc cgcgcacgtc gatcgcgtag ccgcccccgc    207540
     ggacggcggc cgccttctcg acgacggtca cctcgaagcc gtaccggtcg agccagtgcg    207600
     cgagcgcggg gcccgcgata cttgccccgg agatcagtac gcggcgagcg ggacgggatg    207660
     tgtggaccat ggcttctcac ccttccaccg ggacgaaacc cgggaagacg gaggcacgtg    207720
     tcgcgcgagc gacatacata cgtaccttag gtatctttat ggcggccata cggcgccctc    207780
     ccggacaccg gccacccccc acgatataga tacctaagtc aggtatgcaa atggagacct    207840
     catgaccccc gaagccgccg aacccgccgg accggacgat ccgcacgacg acctgctcac    207900
     cgtgctgccc cgactcaccc agctcagtgc cgcgttcaac aaggggcggc tcacggaacg    207960
     cgccgccgag gcggccggac tcgccctgga ccgccccgcc atgggcgtgc tggtgaccct    208020
     gcgcgcggcc gaccagccgc tgcggatcgg cgagatcgcc gaccggatgc aggtagtggg    208080
     cccgcacgtc acccgccagg tgcaggcgct ggagaagcgc ggtctggtac gccgggtcgc    208140
     cgatccccac gaccgccgcg cgagcctcat cgaaccgacc ggggacgggc tggacgccgc    208200
     caaccggtac atgacgtccc tgctcggctg gttcgccgag gcgctcgccg actggccgcc    208260
     gcaggaccgc gaggacctca cgcgtctgct cacccgtctc gcggacgacg tgacggcacg    208320
     gctggcccgg ctcgacgcgg aggactgagc gctcggcaac cgtcgtcaca tcccttgatg    208380
     cggtccacag cgggtgcata ggatcgtgaa gcgagcggtt gaaacgtttc aagcgcaaag    208440
     gcggacccac atgagcgagg aaacaaccga gggatcaacc gagggatcga ccggggagtc    208500
     caccgggaac ggaaccgagg ggtggaaccg gagagtcttc ctccgcggca ccgtgacgac    208560
     cgcgggtgtc gcgggcgtca cggcgctgac cggccgcggt gcggtcgcgg cggccggctc    208620
     cggaacggga gacggcccgg cgaagacggg gacgaccggg accggtctgc gcgtcgtgcg    208680
     gaccggcgtc gagtacacgg agaacctgct cggcacggac gtcgaacgcc cgcggctctc    208740
     ctgggagctg gccgcccccg ggcacggtgc ccggcagacc gcctaccacg tccgggtcac    208800
     ccggggctcc ggtggccggg gcccgcgcac ccgcacggtg tgggactccg gcaaggtcgc    208860
     ctccgaccgc agcgtcggca tcccctacgg cgggcccgcg ctgctccccc gcacccgcta    208920
     ccactggcag gtccgggtct gggacgccgc cggacgccgt tcccgctgga gcgagacccg    208980
     ctggtgggag acctcgctgc cggccgacgg ctggcgggcg cgctggatcg gcgccgagga    209040
     acccccttcg ccgccgtccc tggagggcgc atcctggatc tggtcccccg gcgcgaccgc    209100
     ctcggacgcc ccggagggcg aacgccggtt ccgcgccacg ctcaccctgc ccgcgggctc    209160
     cgtggtgaag cgtgcggtgg tgagtgccac ggccgacgac gacttcaccc tctacgtcgg    209220
     cgggcaacag gtgctccacg caccgttgca gaccgacggc tggcgcaccg gccgcaccgc    209280
     tgacgtgacc gagcaggcac gctccgccga cggcgcgatc ctcgtcgccg ccctcgccac    209340
     caaccggccc ggggccagtg tgaaccccgg cggtttcctc gcccgcctcc tggtcgagac    209400
     ggaggacgga cgcacccgtg aactgcgcac cggcgacggc tggcggacca gcggcacggc    209460
     gcaagagggc tgggaacggc ccgggttcga cgacggcgac tgggaaccgg ccgccgtact    209520
     ggccccctac ggccaggggc cctggggtgg caacgtcacc gtcaccggcc ccgaggcgcc    209580
     ggccccgctg ctgcgccgcg acttcaccgt ccacggccgc gtcgcacgcg cacgcctgca    209640
     catcagcggg ctcgcctact acgaggcgga gatcaacggt cggcgcgtcg gcgaccaggt    209700
     cctcgacccc ggattcaccg actacgacga gacggtgctg tacgccgtcc acgacgtgac    209760
     ggagctgttg cggagcggcg agaacgccat cggggtcgcc gtcgggcgcg gcttctacgg    209820
     catgacgacg cccaacgtct ggaactggca ccgcgcgccg tggcacggcg agccccggct    209880
     gctcgcgcag ttggagatcg accacccgga cgggacccgc accaccgtcg ccacggacgg    209940
     cgagtggcgc atcaccgagg ggccgaccct gtccaactcc ctgtacgcag gggagaccta    210000
     cgacgcccgg cgggcacccg agggctggtc ccgggccggg ttcgacgact cggggtggcg    210060
     gtcggccgga gtgcgcgagg cgccgggcgg cacgctccgc gcgcagccgc acgacccgat    210120
     cgggatcgtc gacaccgtcc gcccgaaggc cgtcggggaa ctgcgcgacg gcgtgtacgt    210180
     cgtggacatg ggccgcacca tggccggctg gacccggctg accgtgcgcg gggccgccga    210240
     gggcacggtg gtccggctcg tccacggcga gaagctcgag gacgacggca gtgtgcacgc    210300
     cgagaccggg cacgtgccgg gccgcttcca gaccgacgag tacgtgtgcg ccggccggga    210360
     cgaggaggtg tgggagccca gcttctcgta caagggcttc cggtacgtcg aggtccacgg    210420
     cctgcacgcg cggcccgccc cggaggacgt actgggacgg ctggtgcact cccgcgtgga    210480
     cgaggtcagc tcgttctcct gctcggagcc gttctacgag tggctcgacc gggccatgcg    210540
     gcgcaccgtc ctgaacaacc tgcacggcat ccccaccgac acgccgatgt acgagaagaa    210600
     cggctggacg ggcgacgccc agctgggcac gccggtcatg acgtacgcct tcgggatgca    210660
     gcgcttcctg tccaagtggc tcggcgacct cgccgacagc cagaacgacg acggacagct    210720
     ccccgtgatc gtgcccagcg gcggctgggg ctacggcgac ctcgggccct cgcccgagtg    210780
     gacgaccgtg tatcccttcg tggtgcgcga gttgtaccgg gtgtacgggg acgagcgcgc    210840
     ggcccgggag cactgggaga ccctcacccg ctatctggac tgggaactcg gccggctgcg    210900
     ggacggcctg gccgtcaccg ccctcggtga ctacctggca cccggctacg gcggcaaccc    210960
     gcccgaggac acccggctga ccgcgacggc gtacctgtac cgggcgctgc tgcacacggc    211020
     ggagctgggc gaggcgctga ccgggctgcc cggcgacaac gatgtccccg gccgctaccg    211080
     ggccgccgcc gaggaactgc ggaaggcgtt caacgaggcg ttcctcggac cggacgggca    211140
     ctaccgcacg gccaaggacc cggactaccg gcagacgtcc aacgcgatac cgctggcgtt    211200
     cgggctggtg ccgccaggag cgcgggccac ggtactggag agcctggtcg ccgacatcga    211260
     ggagcgcggc aaccacctca acaccggcgc cctgggcacg agcgtgctgc tgcgggtcct    211320
     gtgcgcccac ggccgcccgg acgtcgccca tgccgtggcc acccgacgca cgtaccccgg    211380
     ttggggctac tggcacgaca acggtgccga caccatgtgg gagatgtggc cgctggactc    211440
     ccgctcgcgc gaccactact tccagggcac cgtggcccag tggctgtacg agaacgtggc    211500
     cgggctcagg ccgggcgacg cggggtggcg caccttcacc gtacgccccg acgcccgtac    211560
     gggggtggag tgggcgcgca cctcgatccg caccgtgcgc ggggaggcgg ccgtggcgtg    211620
     gtccgccgtc gacgggaggc tgcggctgac ggtccgcgtg cccgtcgggt cgcgggcgga    211680
     ggtccacgtc ccggtgtccg agggcggacg cgcgaccgtc cctcgcgggg cggagttcgt    211740
     gcggtcggtg cccggcttcg acatcctccg ggccggccac ggcagttggg agttcacggg    211800
     cgacgcttga cggggctcgg cctcaggcgt ccgcggtccg ggcgagggaa cgtgggcgca    211860
     ggtcggtcca gttggcctcg acgtaggcca ggcaggcgtc ccgggtgttc tcctcgaaca    211920
     cggtcgtcca tccgcccggc accgccgcga aggccggcca gagcgagtgc tggccctcgt    211980
     cgttcaccag gaccagaaag cggccgtcgg cgtcgtcgaa ggggttggtg ctcatacccg    212040
     gtacctccca gtggattagg ttaggctcgc ctaatgagcg atgagcttag tcttccggat    212100
     ttccgctcca caaggggacg ttcatgaggt gggcgggggc ggacgccttc gccgcgttcg    212160
     ggctgaccgc cgtgcccggc accgacgcct tctgggacgg tctgacgaca ccgcggtcga    212220
     tacccgacgg cgacgggtgg acgaccctgt tcctgcggcg cggaccgcgg gcggcgagca    212280
     tcgtcttcga gagctggtcg gcgccggtgc ccctgcggcg ctggcgcgac acggactgct    212340
     ggtacgccga ggtgcgcatg ccgccgcggc tgcgggtgac gtaccggttc gtcgtgggcg    212400
     aggaggcgta cgccgacccg tacaaccccg cgggcgcggg cggcgagcgc tccgtcgccg    212460
     cgaccccgga cgccccggcc cagccgcact ggcccctggt cggcgccggc gacgtcctgc    212520
     ccctgccccg cgtccggctg cgctggacca gcgagcggct cggcgggcgg cgcaccgtgc    212580
     gggtccatcc ggtgggcggg ggcgggccgg tggtcctgct gctcgacggg gacgactggc    212640
     tgtacctgca cccggcgacg tccgccttcg actcggccgt cgcgagcggc gagatgcctc    212700
     cggtcaccct ggtcttcctc ccggccgggg accgcggcgc cgagttcggg tgccggcccg    212760
     cgctgtggga ggcggtgcgg gacgagttgc ttcccctggt ggccgggagc ggcgtgcggg    212820
     ccgaccccgg ccggacggtg gtcgcggggc agagcctcgg gggtctgagc gcgctgtacg    212880
     cggcgctgga gttcccggag ctggtgtcgc gtgtcgcctg tcagtcggcg tcgctgtggt    212940
     ggacgcccgg cgccgcggat ctgccggacc cgctgggtgg cccggtcggc ggggcgatcg    213000
     cggcgcggct gcgtgcgcgt cccgacctgt ccgggctgcg gatcgcgttc gacgtggggg    213060
     aacacgagcg gcggatgctc ccccactgcg ccctcgtcga gtccctgacg gaacaggccg    213120
     gtgcgaccgt gcgggtctcc aggtcggcct cgggccacga ccgcgcgggc tggcggcacg    213180
     cgttgctgcg ggacgtggcc tgggccctcg cataggggcg gccgcgaccg gcccggcggg    213240
     ccccggtccg cccgatcccg gtccgcccga tcccggtccc gcccggtccc ggtcggcccg    213300
     gtcaccgcgt caccgccacg cagtacgcct cgtcggtggc gaggaggttg cggtgcgtgt    213360
     cctcggcggt gatgacgccc tcgtccagga cgaggacgcg gtcggcggcg tccagcaggg    213420
     cggggctgct ggtgatcacc agggtggtgc ggtcccggcg cagcttggcg acgccccgcg    213480
     cgatgagctg ttcggtgacc gcgtccacgg ccgtcgtcgg gtcgcgcagt accaggacct    213540
     cgctgtcggc ggccagggcg cgggccaggg acagccgttg gcgctgcccg ccggagaggt    213600
     tggcgccgcg gtcgcggacg gcgtagtcga gtccctcgcg gtgcagggcg acgacgtcgg    213660
     tcagcatcga ggcctcgacg gcttcgggga cggtccggct ggtgcccgag gggtcgatgt    213720
     tggaacggag ggtgcccgcg aagatctcgc cgtcgtaggg gttgaccagc aggtgctcgc    213780
     ggacctcctc gaccgccagt tccgcgaggt cccgtccgcc gacccggacc gtcccctcgt    213840
     aggtgtcggg cgggacgttc agtgccagga ccgcggcgag atcggccgcc gcgagcggct    213900
     ggtacgccgc gacggccacg aactcgccgg cacggacccg gaaccgcacc ttgcgcagtg    213960
     ccccgtgccg cacgccgtcg acctccaggt ccccgcccgc ggccggtcgc tccgtccccg    214020
     gtgtcgtcac cggcggcgcg gcgaggacga gcgccatccg ttcggccgag gcacgcgcga    214080
     tcatcacgta cttgggcatc tccgagaaca gcttcagcgg ttccatgacg aactgcgcga    214140
     ggcccacggc catgaccagc tcgccgatgc cgatccggcc ccggaaggcc agccagcccg    214200
     ccgtgagggt gaccgcggcg gcgagcaccg cgttgagggc gagcgcggtg cccgcgtaga    214260
     cgccgctcac ccgcgcgacg gtgacggact ggcgcttcgc ctccgtgctg atctcgcggt    214320
     aggagcggaa cgccgcgtgg ttgccgccga agccgtgcag cgggcgcagg ccgatgatga    214380
     ggtcggcgac cttggcgccg gcccgggcca cccgggcctg ctgctcgcgg gtgctggagc    214440
     cgatgcgcct ggacatcacg ctgaggacgg acaggatcgc gacggtgccc acgatgacca    214500
     gcagtccgag ccggacgtcg gccagcccca gcgccaccgc cgcgatcacc accgccacca    214560
     gcgagctgat cagcagcggc accacctcga tgatgtcggc ggtctggtcg gcgtcctcgg    214620
     tggcgatggt cagcacctcg ccggacttga ggtcgacgtc cctggccacc ggctggagtc    214680
     cgcggcccgc gacccggacc cgccagcggt gcgcctccgt ggtgttggcc ttctgcagga    214740
     tccgcatccc gaaccgccag gacagggaca ccgtcgtgat gatcacggcc agggcggcga    214800
     cggagacgcc gagcgcctgc gggctccggt cccgcatggt gtgctcgacg atcaggccga    214860
     gcgcgatggg gaaggcggtc tcaccggcct ggtagagacc catgaggagg gtgccccacg    214920
     ccatcgcgcc gacgttgcgc cgcagggcgg tgcggaggat gtgggacccc gcgcggggcc    214980
     gctgtgtgtc aggagtggtc atcgaggtga cgggcaatcg cttccggggt tcgcagggtg    215040
     aacagatctc ggatggtgat cactggaccg tactcccggc ggagcagccc ggtcagccgc    215100
     accgccagca tggagtggcc gccgagggcc acgaagtcgc tcacggcgct cacctcgtcg    215160
     tcgtccaggt ccagggcctc ggcgaagagt tcgcacaccg tcgtctcggt ctccgtccgc    215220
     ggcgcgcgct cccccgccgt ggtcagcgcg cccagcggcc tggcctccgg gagcgccttg    215280
     gtgtcggcct tcccgttcac ggtcagcggg atgcggtcga cctgggcgta gtgggtggga    215340
     cgcaggaagt ccggcagcgc ggcgcccacc tgggcggcga cctcggccag atcggcaccg    215400
     tccagcacga ggtaggcggc cagccggtgg gcgccgtcga cctgcgggtc gggctgggcg    215460
     acggcggcca cgaaccgcac cgcggggtgg gcggcgaacg cggcctcgac ctcgccgggt    215520
     tcgacccggt ggccgcggat cttgacctgc tggtcggtgc ggccgaggta catcagattg    215580
     ccgtcggggc gtcgcaccac caggtcaccg gtgcggtaca tgcgctcgcc gggtgcgccg    215640
     aacgggcagg cgacgaagcg gtgcgcggtc tgggcgggct gcccgagata accgcgcgcg    215700
     atgcccaccc ccgcgacgta cagctcgccg ggcacgccgt cgggcagcgg ccgcagccac    215760
     gggtccagca cgtacacgtc ggtgttgtcg atcgcgacgc ccaccaccgg gtccgggcac    215820
     tcgaaggtgc cgaccccaag ggtgttgatg gtgtattcgg tggggccgta caggttgtag    215880
     ccgacggtgc cctcggtcgc ggccagccgc gtccacagtg cgggggtgac cgcctcgccg    215940
     cccagcagca ccagcgcggg ccggcgggcc gggtcgtcga gcaggccctc ggcgagcagt    216000
     tgctgcgcgt aggtcggggt gacgttgacg acgtcgatcc cgtgctccag gcagtacgcg    216060
     accagccggg gtgcgtcgcg gcgcaactcc tcgtcgcaga cgtgcacttc gtggccgtcg    216120
     gcgagccaca gcagctcctc ccacgacatg tcgaaggcga aggacacggt gtgggcgacg    216180
     cggaaggtgc ggtgaccgtg ccgcgccagg accggttcga agatccggcg ccggtggttg    216240
     acgagcatgt tggtgagtcc ggcgtactcg gtcaccacgc ccttgggccg gccggtcgag    216300
     ccggaggtgt agatcgtgta cgcggggtgc cgcagccggt cggggtcgtc cggcgcgaag    216360
     gtcacgcacg gctcggcgtc cggcagcggc cggtccagct cgatcaggtc cgggccgccg    216420
     gtgagccggg gcgtcacggc gctcaccgtg agtacggcgt cggggcgggc gtccgcgacg    216480
     acggcggcga tccgctcgtc ggggtggtcc agttccagcg gcacataggc ggcgccggtg    216540
     cgcagtacgg cgaagagcgc cacgatcgag tccagggagc gcgggagggc gaggcccacc    216600
     gtcgccccgg ggccgatgcc gcgccgggcc agcacacccg ccacggcccg gctgcggtcc    216660
     cgcaggtgcg cgaaggtcat ggtggagccg tgggcgacca gcgccgtccg gtccggttcc    216720
     cggtcggccg cccggtcgaa gcggtccacg acggtgtccg tgccgatccc ggtgcgcggc    216780
     gcgggctcgg gggcgggggc caggccgggc agggcgccga tcggcgcgcg ggactcggcg    216840
     gccccgctgc gtccggccag gtcgtcgagc acccggaggt agtcgtcgag gagggcccgg    216900
     gcgtggccgg tgtcgtggtc gcggtactcc agtttgacgg tgagccggtc gccgggggtg    216960
     accacccagg tgaagggata gtgggtggag tcgtcggccc gcaccgaggt gatgccgtgc    217020
     cgggcgttca tctcggcgaa ggcgtccagg tccaggaagt tctggaggac gaacaggttg    217080
     tcgaacagtg tgtcgtggcc gctggcccgc tggatctcgc cgagcccgag gtgttcgtgc    217140
     tccatggcgt cgaccctggc ctcctgcacg gccgtgaggt aggcgcggac ggtgtcgtgc    217200
     ggccgggccc gggtccacat gggcacggtg ttgagcagta cgccgacgat gtcggccagc    217260
     ccttcgccct cgcggccgga gacggtcacg ccgaagacgg cgtccgctcg gccggtgcgg    217320
     gcgcccagga ggaggccgaa ggcgcccgtc agcaccgagt tcagcgtgac gccgtacgtc    217380
     ctggcggccg ccctcagcgc gtccgaccgt tcggcagtca gcgtgtgcgc gagtgcgcgc    217440
     ggcaggtcgt cggggagggc gggcgccggt ccggcgagca gggtggggcc ggacaggccg    217500
     gccaggtgcc gtgcccagaa gcgttccgag ggggccgggt ccctggcggc cagggcccgg    217560
     gcgtggtcct cgaagcccgg cgcggcgggc ccggggtcga ggggctcgcc cgccaggacg    217620
     gcacggtagg cgtcgaacag gtcgcgcagc acgatctcgc gcgaccatcc gtcccacagc    217680
     agcaggtggt agctgagcag caggccgtcg cggtcgtcgg gcaggcgcac cacggtcagg    217740
     cggatcagcg gcggctcggc ggggtcgaat ccgcgttccc ggtccccgag gcgcagggcg    217800
     tcgacctcgg cgtccgtcgc cgcctcgacc gtgtggacgt cgatgcggcg gcccgcggcg    217860
     aggacctgga cggggttgcc gtcctcgtcc gtggtgaagc ccgcgccggt ggccgggtgc    217920
     cgggcgagca cacaggccgc cgcccgggac aacgcgtccg gttccaggcg ccgttcgaag    217980
     gtgaagtagc tctgggcgac gtagtgtccg gccgggcccg tcagctgggc ctggaagtac    218040
     aggccccgtt ggaggggact gacgggtgcc gtgcgctcgg ccgtcgcggc ggcatcggcg    218100
     atccgttcca gtgcgcggtg ccagtgctcg gtgatctcgt ccgggacgcc ctcggcgagg    218160
     gtgaaggccg cgtgcaggcc gccggtggcc gcgtcggtcc aggcgttcac ctcgacggcg    218220
     tacgggctgc ccgcgtcggc gccggtgaga cgcggtgcgt ccgactcggc accgcggccc    218280
     aggtagttga acagcgcttg cggccgggcg gtgccgagca gcggcgcggt ctgcgggttg    218340
     aggtacctga ggccgccgta ggccacgtgc gcgtgctcgt ccggccggcg tgcggtgacc    218400
     tcgcgcgccg cggcgacggg gtcggtgtgc gcggtgagcc gtacgggcgc gatggcggtg    218460
     aaccagccga cggtgcgggt gtagtcgtgg tggtcgagag ccgggacccg gccgtgccgt    218520
     tccaggtcga tcgcgagatc ggtgggcgtc cgctggacgc gggtcagcgc ggtgcgcagc    218580
     gcgccgcaca gcagctcggt gaggccgagg cccagtgcgg cgggtgcggt gcgggtcacg    218640
     cggtcgctca cgccgggggc gaggacgact gtcgtctcgc gccgcttccc ggcggcgggc    218700
     agcggtgcgg gggcgccgag cgtgctgatc cagtggtcca ggccgtcggt ctgctgtgcg    218760
     gcccggtgcg tgagcgcccg tgcgtactcg gcgtagggcg tggtcggcgg tgccgggacc    218820
     gccccgcgca tcgcggcggc caggtcgtcc agcaggatca gccaggacac ggcgtcgacg    218880
     gcgaggtggt gtacggcgac caccagggtg cggctggtct ccagccaggt gaacgcgacg    218940
     atgtcgccgt tctccggatc gagccgcccg gccgcctcgt cggccgtctg cgtcacgtcg    219000
     gttccggacc cgcgggtcac cgcgacctcg cgggcgggtt ccgtgctcag cgaccacacc    219060
     ccgtgctcga cgcggagccg cagccgcagg gccgggtggg cgccgacgac ggcgcgcgcg    219120
     gcgcgttccg cgtcggcgaa accggttcct tcgggtgcgg ccagcgtcct ggcctgggcg    219180
     aaccgggcga gtgatccgcc cagttcgcgt tggcgcagca tgatcggtgt cggtggcagc    219240
     gggccgtcct ggtggccggt gggcgcgggg gaagcctcgg gcggcggtgt gcgcgtcgcc    219300
     aggtgctccg cgagcgcgcg gggtgtccgg agcaggaaca cgtcgcgggg tgcgacgggc    219360
     aggccggccg ccctggcccg gttgatcacg gtgatggcga cgatgctgtc gcctccggct    219420
     gcgaagaagt cggtgtcggc gtccggtgcg gagccgggca gcgtctcggc gaagagaccg    219480
     acgagtgtgg cgagtacgga gtcgttcccg ccgtgcggtg cgggctccgc gctcggcgtg    219540
     cgtgtcgcgc gctcggccag tgccctgcgg tcgagcttgc cgttgaccgt cagcggcagg    219600
     gcgtccacgg gcagcacccg gccgggcacc atgtgcgcgg gcagcttcgc cgacaggagt    219660
     ccggtgaggt ccgcgggcac ccggcccacg acgtgcgcga ccaggtggtc gtcggtgtcc    219720
     gccacggtga cggcggcgtc caccacgccg tcgaggtcgc ggatcgcgga ctccacctcg    219780
     cccggttcga tgcggaagcc cttgagctgc acctggtcgt cggcgcggcc ggcgaactcc    219840
     agctgcccgt cgagggtgcg gcgggcgagg tcgccggtgt ggtacatccg ggatccgtcg    219900
     gccgtgaacg ggttcgccac gaaccggccg gcggtgagcc cgggcctgcc gaggtagccg    219960
     agcgacacct ggtcgccggc gacgtagatg gcgcccaccc ggcccggcgg caccgggcgg    220020
     agccggtcgt cgagcaggtg ggtgacgagg ccgggtaccg ggccgccgat cgggctggcg    220080
     gcacggtcgc cgggggcgaa gtcggcggcg gtcagcacac ggtgggtgac gtggacggtg    220140
     gtctcggtga tgccgtacat gttgaccagt tccggcgact cggtgccgtg ccgcgccacc    220200
     cagtcgcgca gccgtgcgag gtccagtccc tcgccgccga agatgatcct gcgcagtgcg    220260
     ggcagcggct cgcccgcgtg ccggtcggcc tcggcgaacc ggtggaaggc cgacggggtc    220320
     tggttgagca ccgtgacccc gcgctcgcgg accaggcggt ggaagtcgac cggggaacgg    220380
     gtcagaccgt agtccggcac cagcagctca ccgccgtgcg tgagagcgcc ccacagctcc    220440
     cagacggcga agtcgaagga gaaggagtgg aactggaccc acacgtcgtc cgggccgaag    220500
     ttcatgacgg gccgggtgtt ggcgagcagc gtcaccacgc tggagtgggg gacgacgacg    220560
     cccttgggcc ggccggtcga tccggaggtg tagatcacgt acgcggggtc gtgccagcgg    220620
     gccgcgggtc cgggctccgc ggcggtgggc gggggctcct cccccaatac gagcaggcgg    220680
     gccggcacgt tcgcgcggtc cagcagccgc gcgaaccggt cgcgctgctc cggggtcacg    220740
     aggacgacct gcggggcgga gtcggcgagg acgtactcca gtcgctcgtc ggggtacgcc    220800
     aggtccagtg gtacgtaggc gccgcccgcg ccgacgacgg cgaccagggc gacgacctgc    220860
     tcgacggagc gcggcacggc gacggcgacc cgcttgccgg gaccgacccc ggccgcccgc    220920
     aggacggcgg ccaactcgtc cttggccagg gacagttcac cgtaggtcag ggagcgggtg    220980
     gcgccgtcga gggcgcactg ggtgacggcg gcggcggccg ggccgcggcg cgccgcggcg    221040
     tcgaacagtt cgcccagggt ggccggcggg accggctcga cccgcccggt gccctcggac    221100
     gccaggccgc cgaccggtgc ctccggccgg gtgagcagat gggtcagggt ccgggtgaag    221160
     gtgcgcagga tctcgcggac ctcgggttcc cgcagcagct cggcgtcatg gatcaggttg    221220
     aagcgcgggc ggccgtccgg tgtgcgctcg accaccagcg tcagcgggta gtgcggggcg    221280
     ccctcgttga cgatgccggt gacggcgagg gggtcgccgg gccgccgcag tccggccacg    221340
     tcggtcgcca cgtcgaacac cacgagggtg tcgaaaagcg ctccggcccc ggcccggcgg    221400
     gcgatgcgcg ccagcgagac gtgctggtgc ggcagcaccg cggcctggtg cgccctgacg    221460
     gcggtcagga gttctcgcgc ggtcgtggtg tcggcccagc gggcgcgcag ggggatcgtg    221520
     ttgatgaaca ggcccaccat gtccccgatg ccgggcacgt ccgcgtcgcg cccggacacc    221580
     gtggagccga acaccacgtc gtcgcggtgc aggatgccgc ccagggtgag ggcccaggcg    221640
     ccgtgcacgg cgacgctcag cggcacaccg gccgcccggg cggccgcgtc gacgtcggtg    221700
     tccgccgtcg tcgcggtgtc ggcgaagtgc gcggagggcg ggtgcccctc ggcgatcagc    221760
     gacgggccgg ggaggtccgc cagttgctcg tcccacaccc ggtcgctcgc ggcgccgtcg    221820
     cgtgcggcga gccggcgcac gtgctcgggg aagccgccga gcgcgtgtcc ggagcccggt    221880
     gcccggtatt cggccagcag ggtgcgcagc atgggcggca cggaccagcc gtcggcgacg    221940
     atgtggtgca ccgtctgcac caggacgtgt ctgcggggtc ccgagcggat gagggtgtag    222000
     cgcatcggcg ggccggtggc caggtcgaat ccggcgcggc ggtcgtgctc cgcgtgggca    222060
     cggatctcgt cgtcggtgat gccggggcgg tccaggacgg tgaagggcgc ctcgcgtccg    222120
     ctctccagta cggagaccac acggccgtcg gccaggggca cgaagcgggc ggccaggttc    222180
     gggtggaggg tcagcaggcg ggtggccgcc gcggccagtc ggccggggtc cacctcgccc    222240
     tccagggtga gcagttgctg ctcgacgtag ctgccggtgg cgtcgccgtc gtagaccgag    222300
     tggaagtaca ggccctcctg caacggggtc agcgggagga tgtcccgcag cgccgggccg    222360
     tccagggcgt cgacgtccgc ctgggtgagc ggcagtgggt ggaagtcgct gggcgagtgg    222420
     ccgccgttct ccagggcggc cagccccgtg agcgcctcga cgtagtacgc gccgagggtg    222480
     gtgatgtccg tgtcggtgaa catgccgtcc ggccaggaga tcgcggtgac cagtgtgtac    222540
     gcgccggtgg cgtcgggttc ggcgatcgcg ttgaattcca gggcccgggg cagtcgcatg    222600
     cgcgggtccc gctgctcgcc caactgtccg ttgacactgg cgagttgcca gtcgcccgac    222660
     gagcccgcgt cgaagcggcc cagatagttg aagagcacct ggggggcggg tgcgtcgaag    222720
     gcgacccggg ccagatggcg cagcgcgccg taggagacac cgtggtccgg tacgcgtgcg    222780
     aggtcctcct tgaccgcctt cagcgcggcg gacaggtacg cgggtgcggt cgggtccggg    222840
     gcggtgccgg ggtcgacggt caccgggaag agggtcgtga accagcccac ggtcctggag    222900
     agttccggct cgaagccggc ggagggggcg acgaacgcgg cctcgcggcc gtggccctcg    222960
     agttcgatgt gcgcgaaggt ctgggtctgg ccgagatcgt ggcgccgtcg ggcgagggcg    223020
     acggcgagcg cggtcaccag gacgtcgttg atccccgtgt ggaacttcgc gggtgtgtcg    223080
     cccaggagcg cggccgtggc cgtggcgccg atcgacacgg tccggatccg ctcgcgggcc    223140
     acggtgtcgt ccgcgcgcag ggggcgaccg cccaacggct cgtcgggccc cggcagggcg    223200
     cggcggtagt aggcgctgtc cgcgtcgaac gccgcgcgtt ccagcagttg ggtccagcgc    223260
     cggaacgacg ttccgcccga cgggagttcc accgccgtgc ccgaggtgaa ctgccgccac    223320
     gccgtggcca ggtcgtccat cagcacccgc caggacacgc cgtcgatcac cacgtggtgg    223380
     acgacgaggg ccagttgccg ggcctcgcgg cgccagacgg cgcgcagcat cgcgccgccc    223440
     accgggtcca gttccccggt ggcgagggcg aggcacgcgt cgagcggctg gtcgctctcc    223500
     cgccagagcg ccacggccgg tacggcctcc gcctccggga tgtcgaatcc ccagcgctcg    223560
     ccgcgcacca gcctggcccg cagcatgggg tgccggcgga ccacggcggc gaggatcagg    223620
     tcgagggcgt cggcggtcag gtccgccggg gtgttgagca cgaccgactg gacgaacccg    223680
     tcgatggcgt ccgtggtctc gccgagccac tgcacgacgg gcgaccccac gacgcttccg    223740
     gtgggcacgt cacggtggtc cacgacggtg gtgtcctcgc ggctcgccac cgccgccagt    223800
     gctcccaccg tgctgtgggt gaagatctgc cgggccgtga cgtagagtcc cgcgtcgcgc    223860
     agcctgccga gcagcgagat ggccaggatg ctgtcgccgc cgagctggaa gaagtcctgg    223920
     tcgacgccga cccggtcgag ttggagcagc gccgcgaccg ccgcgcacac cgtccgctcc    223980
     tcgtcggtgg tgggcggggc ggacgagccc gcggggatca cgggctcggg cagcgcgttc    224040
     cggtcgagct tgccgttcgc ggtgagcggg aactccgtca tcacgaccac gtgggtgggc    224100
     accatgtact ccaccatgtg ctcgccggcc caggccttga cctcgtccgc ccgcaggtcc    224160
     tcgtgtccgg cggccgggat gacgtatccc accaggtagg tgccgcccgc cgtgttcttc    224220
     ctcgcgacga cgcaggtgtg gcgcacgcgg gggtgttcgg cgaggccgac ctcgacgtcc    224280
     tcgatctcca ggcgcatgcc ccggatcttg acctggttgt ccgcgcggcc gaggaagtcg    224340
     agcgagccgt cgggggcgaa gcgtgcgagg tcgccggtcc ggtagagcct ggagccgtcg    224400
     tcggcgaagg ggttcgccac gaacctggac gcggtcaggc cgggcgcgtt cacgtagccg    224460
     cggcccagca gcagcccccc ggcgtacagt tcgccgccga cgccgaccgg gacggggcgc    224520
     agttcgtcgt ccaggacgta cagccgggtg ttggggttgg cccggccgat cgacgtcgac    224580
     agacgctccg ccgcgccccg gtagacgacg tgcgacacgc cgatcgtcgt ctcggcgggt    224640
     ccgtagccgt ggtagagggg gatgtcgagc cgggtgcgga agcgctcgta gagttcgggc    224700
     gtgagcacct cgccgccgca ccagacgtga cggaggctgt cgaggcgccc cgagtcgccg    224760
     gccatctcca gcagcacgtc cagcatggac gagaccaggt aggtgaaggt gacgcgctgt    224820
     tcgtcgatca cgctcagcag atggtgcggg tcgcgttcgc cgccgggccg caggacgacg    224880
     agtctgccgc cgctgacgag gggcaggaag atctcgttga tggagatgtc gaaggacagc    224940
     ggcgccttga acagggacgc gtcgtcgtgg ccgaagccca ggatctcgtg gatctgccag    225000
     agcaggcgct cgctgatcgc ctcgtgccgg atcatggcgc ccttgggacg cccggtcgag    225060
     cccgaggtga agatgacgta ggccagggcg tcgccgggga cggtgactcc ggtgtcctcg    225120
     gtgggacggt cgccgaaccg ccagtcgccg aggtcgacgg ccacggcttc cggttcgccc    225180
     ggggcgggct cgcccgaggc gtcgagctgc acgacgaccc cggcgtcctc gatgacgacg    225240
     gcccggcgct cggcgggcca gtgcgggtcg agcgggacga acgcgccgcc cgcccggagg    225300
     acggcgagca gtccgatcac catctcggcg gagcgttcca gggagatgcc gacgacgtct    225360
     tcgacggcga gccctcgcgc gagcaactgg tgggccaact gggccgacag cttctccacc    225420
     tgacggtaag tcagagtacg gcgctcgtcg acgacggcca cggcgtccgg cctggcgcgc    225480
     gcctgttcgc ggaacatctc caccaggccg ggacgggccc ggtcggcgtc ggtgtcgttc    225540
     cacccggcga ggagctccag ccgctccgcc gggccacagg ggccgacggt gccgagcggg    225600
     cggtccggga agtcggccag gtcgtcgagc gcgagctgcg cctcgtgggg cacgacgccg    225660
     cccgggacgg tgacggtccc cgcgtcggcg ccccaaccgg tgggcgcggt accgccgctg    225720
     tcggcccagc cgagcacgtc ggtgaacagg gtgcccgggg cgaggtcgag tccggcgggg    225780
     ccgcgcccct cggcccagta cgccagtgcg acggcgcacg cctcggtgat gacctggtcg    225840
     gagaagtcgc cggtgcggcg gcgcaggccg gccagctgcg cgggagaaag ccgtacgaga    225900
     gaagcggtcg gttccatcat cgaagactca acgccccttc caaggaatga aggcaggcta    225960
     acctaactta ggcatgccta acaccccgcc cggccgccct cccgccaggc ccgccacagc    226020
     cgtgcgtagc ggccgcccag agccaccaac tccgcgtgcg tgccctcctc gacgacccgt    226080
     ccggcgtcca ggacggcgat ccggtccgcc gccatcgcct gggtcaggcg gtgggccacg    226140
     aacagcgtgg tgcgtcccgc gcacgcggcg agcacggcac gttccagctc cgcggcgccc    226200
     tcgctgcccg cctcggcggt cgactcgtcc aggaccacca cgggcgcccg gccgagcacc    226260
     agccgggcca gcgcgatctg ggcgaccttg gtcacgtcga ggcgctcgcc gccctcaccg    226320
     acgggtgtgt ccagcccgtc gggcagcgcg tccacccact gaccggcgcc gacggtgcgc    226380
     agggcgtcca ggagttcggc gtcggtggcc tccggcgcgg ccagtcgcag gtcgtcggcg    226440
     agcggaccgg agaacacgtg cgtctcctgg gtcaggatgc tcaccagggc ccgcgccccg    226500
     gcctcgtcca gctccgccag gtcggccggc ccgacacgca ccgaccccgc ctgcggggtg    226560
     ccgatgcccg cgaccagcgc ggccagcgtc gacttgcccg cgcccgtcgc ccccacgagg    226620
     gcgagcgagc cccctgccgg gatcgtcagg tcgacgtccc tgaggaccgg ttcgtcggcg    226680
     cccggatagg tgaaggtcag cccccgcacg gtcaccgggt acgctccggc cgccgccgtc    226740
     ccgacggacg cgtcgccgac cagtcggtcc gccgcgtcct cccccagcac gccgaccagc    226800
     cgggtcaggc tcgcgcccga cttctgcgcc tcgtcgaagg tgaacatgat ggcgcccagg    226860
     ggggtgaaca gccggtggaa gagcagcggt gccgcggaca cctcgcccag ggtggccgcg    226920
     tccgcctcca gcagcgcgta gcccaccacg atgatgagcg tcagcccgat gaactcggcg    226980
     cggttctccc ggccgacgaa ccggccgaag aaccggaaca cctcgatgcc gagctcgcgc    227040
     acccgccacg actcccgggt gacccgctcc cggaaggcgc cctcgagccg gtaggcccgg    227100
     acggtgtcga tgccgttcag gccgctgatc agagcctgcg cccggtcggc ctgggccacc    227160
     cgctgcttcc ggtacagcgg ggcggacctc ggcaggtacc agcgcagggc cagcgcgtac    227220
     gcgggcagcg caccggctcc cgccagaccg agccgccagt cgagcccgaa catgccggcg    227280
     gtggctatgg cgacgaggac cccggccgag aacaccgtgg ggacggcggt gcggattccc    227340
     ttggagatca cggcgacgtc gtcgccgacc cgggacagca cgtcgccgcg gcccacctgt    227400
     tcgacccgcg cgctgggcat cgccaggacg gcgcgcacgg cgccctcccg cagccgggcg    227460
     agcaggtcgg cgccgagccg tccgatcaga caggtcgaca ccgcggtcgc caccgcgccg    227520
     agcagcgccg cggcgaccat cagaatcccg atcgtgacca ggacgtcctg cgactcgcct    227580
     cccgccaccg cgtcgaccac ccggccgagc agcagtacgg ggagcacctg gagtgccgct    227640
     ccggccaccg tggtgagcac cgtggcggcc gtcagccacg gcacctcgcg gcagtgtgcc    227700
     gcgacccacc ggccggactc gcctccggtc gcggtgcgca ggacggccgg ggccgtggcg    227760
     acgcgggtgt cggtggcgct cacacctacc cggccgactt gacgagttcg tcgacggcgt    227820
     acggcatgga cagcagggtg ccctgggaga tggccgcgcc gaccgccggg ccctcgctgt    227880
     ccagcaggta cgacaccttg ccgttcttga cggcgtccag gttggtgaac agctcgaact    227940
     tcttcaacgc gtcctggtcc gccttgtcgt tgatgacgaa gacacggtcc acgtcgacca    228000
     ggtcgacgcg ttcgggcgag agcgtggtgt agaagtcgcc gccggcgacc ttgtcgatct    228060
     cggtctcgta cttgaagccg atgccggtca cgagccgtcc gcgcacgtcg gtggaggtga    228120
     acggggccac cgagtccttg taccaggaca gcacgaccgc ggtcttgtcc gcgaattcgg    228180
     ggtgcgcctg cttggccgcg tccagcttgc cctggatgtc ggccaccatc ttctcgccct    228240
     cctcggcctt gccgagcgcc ttggcgatgt gcagcgcgtt gtcctgccag ggagcgctga    228300
     acggctcctt ctcgcccttg gtgcggccca ccgtgggcgc gatcttggag agcttgtcgt    228360
     aggcggcctg gtcgatctcg gagtagaccg cgacgatcag gtcggggcgc agcgcggcga    228420
     tcttctcgaa gttggggccc gtgtccccgt tcttcatgac gacctcgggc ttggtgtcgc    228480
     cccacttgtc cttcacccag ggccactggg tgttgatgtc ggggctctgg ccggccgggt    228540
     tcgggtactg gtcgaccatg ccgacgggct tgatgccgaa ggccaggacg gtctggtcgt    228600
     cggtgtagcc gacggagacg acccgctcgg gcgccttgtc gatcttcgtc gttccgaacg    228660
     cgtgctccac ggtgaccggg aaggcgccgg ccgcggccgg ggtgccgccg cccgcctcgt    228720
     ccgccgggtc gtccgagtcg gatccgcacc ccgcgaggag tccgacgccg agcgcggcgg    228780
     cggacagggc cgccgcgagt cgtcgccagg gcttcgtacg cgttgttctg aggagcatcc    228840
     cgggcatccc tttgctgtcg cgccaaccag tgtgaggtaa gcctaccctc acttcaacaa    228900
     ctcgggcgcg gatcggtcga gttcgacatg ggtgcgcccg atcggcacga tgagcgggcg    228960
     gtccccgacc gggtcgtcga tcaccttggc gcgcagcccg aacgcctcgt gcagcaggcc    229020
     ggcggtgatg acgtcgcgcg ggtgcccctg cgccaggatc gcgccctccc gcatgacgac    229080
     gaggttgtcg ctgtagcgcg cggccaggtt gaggtcgtgc agcaccatga ccacggtgcg    229140
     cccggactcg tgcaggtcgt cgacgaggtc gagcacgtcg accgcgtgcg cgagatccag    229200
     ataggtggtc ggctcgtcca gcagcagcag gtcggtgccc tgggcgaggg tcatcgagat    229260
     ccacacccgc tggcgctggc caccggacag cgagtcgacg ggccggtccg cgaggtcgga    229320
     cacgccggtc atggccagcg cctgccgtac gacgtcggcg tcgtccgagg accactgccg    229380
     cagccagctc tggtgcgggt ggcggccgcg ggcgaccagg tcggacaccg tcagcccctc    229440
     cggggccacc ggtgcctggg gcagcaggcc gagcttcttc gccacgtcgc gggtccggag    229500
     cgcggcgatg tcctcgccgt ccagcacgac cgttccgccg gtcggcctga gcagccggga    229560
     cagggtgcgc agcagggtcg acttgccgca gccgttcggt ccgatgatgg tggtgatcac    229620
     cccgggcggg atcgccacgt cgaggccgtc gatgacggac cgggtcccgt acccgacggt    229680
     gacgccccgg gccgccagcc gtgaggcgcc gtcaacttcc gtctcggtcc cggtgatgga    229740
     ctgaacgacc acaaggcccc ctcgattagg ctcaccttac tttgtaccag ctatctgcgg    229800
     ttcgcccgca ccagcagata gaccaggaag ggtccgccga tggcggcggt gaccacgccg    229860
     accggcagcg agacgggcag ggcggtgcgc gcgagaaggt cggagccggt cagcagcagc    229920
     gcccccacca ggccggaggc caccagcggc ggggtcgggc accgggccag ccgcatcgcc    229980
     acctgcggag ccaccagcgc gacgaacggc accggtcccg ccgcgctcac cgccacaccg    230040
     gccagcagca ccgcgcacag cagcaggacc gcgcgcaccg tcccgtaccg gacgccgagc    230100
     ccggcggcga cgtcgtcgcc gaagtgcagc ggcttgaact ggaaggcgac cgaggccacg    230160
     acgaccagca ggacgagcgt gcaccacagc gcgacgtgca cctcgcccca ggaccggttg    230220
     tccagcgagc ccaccagcca cgcctgggcc cgggccacgt ccctgatgtc ggcggtgacc    230280
     agcagccatg tcgtgatcgc ctgcatcacg gcgttcaccg agatgccgat gaggatgagc    230340
     cggaagccgt cgatcccgcg gcgccacgcc atgaagtaca ccagcagccc cgtgccgaga    230400
     ccgcccgcca gggccgccgc cgacaggccc acggagtcgg ccacggccgt ggcggcgccg    230460
     ccggacaccg tcaccaggaa caccgcgacc gcgccggcgc cgctggtgat gccgaggacg    230520
     tccgggctgg ccagcggatt gcgggcgatc gactgggtga gggcgccgga caccccgagc    230580
     gcgacgccca cgacgagccc ggcgagcgcg cggggcatcc gcaggtccat gatcacgaac    230640
     cggtcgacct gctcgccccc gccgaagacg gtggcgacga cccggggcag ggcgatgggg    230700
     aagtcgccga ccccgatgga caggcagaac accaggaagc cggccaccgc cagcagcagg    230760
     gtgacgcccg cgacccaggg ccgccacacg aacgacaggc cgccgaaccg cacgccgggc    230820
     gccaccgaag tccgcacgtc cgccttcacg tccaccgccg catccgcccc gtccgccctc    230880
     atgtccgtac cgttcacgcg ctcttgaact tcccgcgcca caccaggacg gcgaagaacg    230940
     gtgcgccgag gagcgagacg acgaccccgg cgtccagttc ccccggccgt acgaccaggc    231000
     gccccacgat gtcgcagacc agcagcacca cggccccgag cagaccggcg tacgggacca    231060
     gccagcggta gtccgggccg gtcaggtacc gggccacgtg ggccaccatg agaccgagga    231120
     aggcgatggg gccgcaggcc gccgtcgccg ccccggccag cagggtgatg gcgacgatgc    231180
     cgacggtgcg ggtcagcgcg atgttcaccc cgagtccccg cgccacgtcg tcgcccaggt    231240
     tgagcaggtt gaccgagggc agcgtggtca gcgccagcag cagcccggcg gcgatgaagg    231300
     ccgacacggg cccgatgacg tcgaagccga ccccggtcag cgagcccgcg ttccagaacc    231360
     gcagagcgtt cagcgaggcc ttgtccgtca gcgcgacggc cgtggtcatc gccgccagga    231420
     acaccgtgac cccctgcccg gccagtgcga gcgtcagcgg gttgcccgct ccccggccga    231480
     tgctcgacag cccgaacacc acgacaccgg cgaccgcagc gcccgcgaag ccgaaccaga    231540
     cgtactggaa cgggctggtg aagccgaagg cggcgatccc cgacaccacg gcgaacgagg    231600
     caccggagtt caccccgagg agacccgtgt cggcgatggg gttgcgcgtg tacccctgga    231660
     tcagcgcccc tgcgacgccc agcgcgatgc ccgccacgac ggcgaggacc gtgcggggca    231720
     cccgcacggt ctgcacgatg agcctgatct cggtgagccg ctggtcggac tcgggcgccg    231780
     cgaacagtcc gtgccagacc tcggcggggc tgagcgcacg cgcgccgacg gccagtgagg    231840
     ccgccgcggc gacgaggagg agcgccgcga gcagccccag accggcaacg cggcgccggc    231900
     gcgcctctgt cgggcctcgg ggagtgggcg cgggacgctc cacctcggtc gtggtcatag    231960
     cgccgtacat taacgcgcgc cggtgccggt cccgtcggcg accgtgcgga cctcgtcgga    232020
     agcggactcg aggccccggt cgaggagcga ctcgaggatc tcgccgaccc ggacggcggt    232080
     gttggagagc agcgacgagg tgatgccgtg cgtgtgctcc gtgccgccct gaaggtagat    232140
     tccgcagcgc agggcggggt cggtggtgac gcggtagtcg cgctcgacgc gcacccggcc    232200
     ctcgtcgtcg cgcaggcagc ggtccgcgac ctcgccgagc aggccgaggg ggtcggcggg    232260
     cccgtagccg gtggcgagga ccacgacgtc ggcgtccagg tggctctcct cgccggtgac    232320
     cagcgacgtc acggtggcgc gcacccggtc cggcgtctcc ttgacgtcgg agagccggga    232380
     cacgttgagg aagcgcagcc gctcggtgcc gaggaccttc tcccggtaca tctgccggta    232440
     caggtcgtcg atcaggtcga tgtccaccac ggagtagttg gtgttgccgt ggtagtccat    232500
     cagccgctgt ttgacgccgt cgggcgcggt gaagtagtcg tcgaccgccg ccgggtcgaa    232560
     gatccggttg gcgaacgcgc tgtcgtcggc ggggctgtag ccgtagcggg cgaagaccgc    232620
     gcagatctcc gccgagggga agcgtcggtg caggtaggcg acgttctcgg cggcgctctg    232680
     gccggcgccg acgacgacga accgggaggg cgaggtgccc tccaacgtgt cgaccctgga    232740
     cagcagttcg gagttgtgcc agacgcggtc gccgcgctcc acgccctccg gcacgagggg    232800
     gcgcagcccg gtgccgacga cgaggttgcg cgcccggtgg acctcgagcc cctcccccga    232860
     acgcaccgtc acctccaggt ggtccaccac gccgtcccgc acgacgggtg cgacgccgac    232920
     gacctcgtgg ccgtaggaga ccatgtcgtc gaccttggcg gccgcccact cgaagtagtc    232980
     gtggaactcg acccggagcg ggaagaggtt cttgtggttg atgaagtcga tcagcctccc    233040
     cctgctctgc aggtagcaga ggaagctgta ccgactggcc ggattgcgca gggtcaccag    233100
     gtccttgagg aaggacacct gcatggtcgc gtcgtcgatc agcatgccgc ggtgccagcc    233160
     gaagcgcggc tgctgctcga agaagcgggc gtcgagctcc tcctgcccgc cggcctgtgc    233220
     gttgtgttcg cggatcgcga tcgccatggc gacattggac ggtccgaagc cgataccaat    233280
     gaggtcgtgg accagcgttg agtcagcagg aagaacctgt gacatgtcac tcccatcgtg    233340
     cgccggaaac ttaggtgagc ctaagctaat gagatacggc tgtcgatagg gcgcaccagg    233400
     ggccgattcg agccaactcg ggacctgcga ggcggtgttg cgcactaagg taagccttgc    233460
     ttaactgccc gggtcagccc ctgccctgag gaggaacccc atgcgggtcg tcatgttcgg    233520
     ctaccagacc tggggccacc gcaccctgcg agccctgctg gactccgaac acgacgtggt    233580
     cctcgtggtc acgcatccca ggagcgagca cgcgtacgag aagatctgga gcgactccgt    233640
     cgccgacctc gccgaggagc acggcgtccc ggtgctgatc cgcaaccgcc cggacgacga    233700
     cgagctgttc gagcgcctca aggacgccga tccggacatc atcgtcgcca acaactggcg    233760
     gacctggatc cccccgcgca tcttcggcct cccgcgccac ggcacgctca acgtgcacga    233820
     ctcgctgctg ccgaagtacg ccgggttctc cccgctgatc tgggcgctga tcaacggcga    233880
     gaccgaggtg ggcgtcaccg cgcacatgat gaacgacgag ctggacgccg gtgacatcgt    233940
     ccgccaggag gccgtgccgg tgggcccggc cgacaccgcc acggacctgt tccacaagac    234000
     cgtggacctc atcgccccgg tcaccgtcgg cgccctcggg ctcatcgcct ccgggcagac    234060
     ggagttcacc aagcaggacc ggtcccgggc gagcttcttc cacaagcggt ccgccgagga    234120
     catccgcatc gactggaact ggccggccga ggacctggag cgtctggtcc gggcccagtc    234180
     cgagccgtac cccagcgcct tcaccttcca ccgcggcagg cggctggaga tcctcgccgc    234240
     cgtggtctcc gaggcccggt acggcggcac gcccggccgg atcttctacc gcgagggcga    234300
     ggacgtggtg atcgtcgccg gggccgacgc gcgccggggc cgcaaccacg gcctcgccat    234360
     cacgcgcgta cggaccgagg acggccggga gttggccgcg accgagtact tcacctcgat    234420
     gggcggctac ctgaccgccc gcccctgagc gccgcgaccg gacacccatg acgggcaggg    234480
     cccgaccgtg ccgtcacggt cgggccctgc cgggttgcgg gtcctgcgcg gcctcagccg    234540
     ctcttgcgcc ggaacgaccg ctggctggcg gccggaccgt gggtgccccg gatcttcgcc    234600
     acgtcggcgt tggcggcgag ggcggcggcc tccgcctgtt tgccgcgctt gcgctccagc    234660
     gcctcgcgga atttgtcctt caggttgtac tgaccgtcgg catcgggtgt cagggcggtg    234720
     ccctcggcct ccgccggttc cgaacctgtt tgcgatgaag actcttcagt catggcgacc    234780
     tcctgggctc ggacaacagg agcacagctt gtcacgaccg gccgcccgga accaccgaga    234840
     atgttcccgg cccggccggc aggctcaccg tgtactgacg cagatacgtg tccaggtacg    234900
     gcgaccggtc acctgcggtg gcgacgtcgt ccgccggatt gtccagcgcc agcccgagcc    234960
     tggccccctt gacctcgacg gtctcgccgg aaggcgtgtc gcgccaggag ccggtctgga    235020
     tggagccgat ctccaccgcc aggacgtgcc cggcggcgag ggtccagtcg gtcgccttca    235080
     ggtcgacgct catccggccg gacttcacca gggagacctg ctcgtcgaac atgaccgcgg    235140
     tgccgtcggg ggcgacgtcg tacagcttga gcatgacgtt gcccgcgccg cgggccgtca    235200
     gggacacccg cggggtgccg gtgacgcgcg tggtgctctt cagcggcttc gaccacacga    235260
     agaagctgga ggcgacctca ccggcgcgct gacgcttcgc cagttccgcg gccagccccg    235320
     ccggggcggg ctgctcggtc gcgggcgcgt tctccatgtc ccacctgccg gccggctgcg    235380
     gcggagcctt cggcgccggg ctgccggacg cggtcagggc cgcacgggcg gatgccccgc    235440
     cgtcgtccac gtaggagccg ccgccgagcg gcagcgtgac cgtccgttcg gtgacgggcc    235500
     aggtgcgctg ggcccgccag gcaccggtgg agtcctcgac ggcgtaggcc gggtaacgca    235560
     ccgtcggcct ggtccccttc aggtactggt cgtagaagga gagggtctcg tcgtaccagc    235620
     ccgcccggcc catcgccagg cgtccgtcct cgacccggtc gccgccgcgc acgtggtccc    235680
     actggccgag ccagccgcgc tcggggccgc ggtggttgtc gaggtactcc tccatctcct    235740
     cgggcttggt gttgttctcg acgaagccct gcgtgacgaa gagcggggtg tcgctgcccc    235800
     gggccatcct cgcgaggtca cgggaggtcc agtgcgggtc ccgctggtcg gatatccggt    235860
     agccggccga gttctccgtg aggcactccg ggtggctctc ctcgtaacgg gcggcggcct    235920
     ggtaccgcgg gtcgtcgtcg gccatcgggg gcatcgaggc gatggagttg tacgcaccgg    235980
     cggtgcccgt cacgttcggg cggggcactc cgttggagta gatgtactgg tacatgtccc    236040
     acaccggctc ctgggcgacc acggccctga gcgcgcgctg gtccaggttg ttgccgatga    236100
     ggcccgtgac ggcgtcgtag gacttgccgt acatgccgac cgcgccggtg gaccacggct    236160
     gcttcgccgc ccagtcgatc gcggccttca cgtccgcctg ttcgccgggt ccgccccagt    236220
     ccagacagcc ggtggagccc ccgaagccac gcaggtccac catgacgaag gcgtacccct    236280
     cgtcgaacag gtcggtgccc tcgatgaagt cctggaagcg ggcggagggg ccggtgcggg    236340
     accagccctc ggggccggtc tggcccgcgt gcgcgaagta cgggccgatc gacaggatga    236400
     ccggcacctt ctccttccgc ttcagccctt cgggcagcag gacgtcggcg tgcagccggg    236460
     tgccggagcg gtcggcggac gggaagtagt gctgggtcca gaccgagccc tcggggacgc    236520
     ggtcgttctc ctcgtgggtg acggaaccgg tcccggtggt ggccggcccg gcctccgcct    236580
     cgtgcgccgc gacggcgggg cccccgaggc cgacggtgag ggcgagggcg gcgacgagtg    236640
     ccgaggcggt ccgggcgacc gcgcgacgtg gtctcacatg ctcctccttg gaaggcgggt    236700
     gcaggtggta cgggtggtgc aggtctagca gcgaagtccc tgcccgtcga tggggcgcaa    236760
     tcacaacgtc cccggccaca tcgggcgttg acggacgcga ccggccaccc gcctcacgcc    236820
     gggcccgcgg ggcgacggca cccggccctc gcctgccgcg cctccggctc cgcgtccggg    236880
     gccgctcctg aatcgcccgc accccgatcc ctgcctaggc tgagcacgcc gacggaaccg    236940
     gagtccttgc cgaccgcagg agagtggggc gccatggcgc ggggtgtcga gtcgatccgg    237000
     cgcaccgccc tgggtgccct cggtgccgtc ctgctgctga tcggcgtggc gctgctggtg    237060
     ctgcccggtc cgggcctgct gctcgtcttc gccggcgtgg tgctgctggc gcgcgccgtt    237120
     ccggcactgg accggttcgt cgccccggtc cgcgtccggg cgatgcgtgc cgccgaggag    237180
     agcgtctcgt cccgatggcg catcgccggc tccgtgctcg tgggcctgtt cctcctcgcc    237240
     gccggtgcgg cctggggtct cgtgcccgag ctgccgtact ccggatgggc caccggggcg    237300
     agtctgatca tctcgggctt cgtgctgttc gccctgctcg ggtggagcca ccgccgggtg    237360
     cgggcggcgc ggcgcgggtc gccgccggcc tcggaaggca cgcgttgacc aaacgggaca    237420
     gcgttccgta tatttaaccg ggacagcgtc ccgctttttt cgcgccgacg cgtcgcctcc    237480
     cgcacggctt cgccgtctcc gccgtcgact catcgaacgg acatccgcag catgagcgca    237540
     cagacccacc cgaccgactt cgttcccgcg tccgctcccg tcctctccgt cgccccggtc    237600
     gtgctcccgg ccccgggacg ccccgtggac ctccggctgc gggtctccgc gcccgtgacc    237660
     gggaccggcc tcccggtgat cctgctctcc cacggccagg gctactcgaa ccacctctcc    237720
     tccctggacg gctacgcgcc gctggccacc tactgggcgg cacacggctt cgtcgtgatc    237780
     cagccgaccc atctcagctc gcggacgctg gctctcgatc ccgggacccc cggagcgccc    237840
     ctgttctggc ggtcgcgcgc cgaggacatg acgcgtgtcc tcgacgggct cgacctcctg    237900
     gagaaggccg tcccacagct ctccggccgg ctggaccgga gcagggtcgc ggtcgccggg    237960
     cactcgatgg gcggacacac cgcgagcctg ctgctcggcg cccggctcac cgatccggac    238020
     gacggcacgg aggtggacct gaccgagccc cggatcgggg cgggcgtcct gctggccgct    238080
     cccggccggg gcggcgacgc cctcagcgag tccgccgccg agagcatgcc cttcttcctg    238140
     agcacggact tctcccgcat gaccacgccc gcactcgtcg tcgccggcga ccgggacgac    238200
     tccgcccacc tcacggtgtc cggccccgag tggcacacgg acccgtactc gctctccccc    238260
     ggccccaagt cgctgctgac cctgttcggc gcggagcacg ggctcggcgg ggtggccgga    238320
     tacgacgtcg cggagaccac cgacgaggac cccggccgag tcgccgcggt gcagcggctc    238380
     acctgggcct acctgcgttc cacgctgtat ccgggggaca ccgcctggca ggtggcacgg    238440
     gacgcactgg actccgggcc ggatccgctg ggccgggtcg agtccaagca ggccccgcac    238500
     cctcggccgt gaggcggggg aacgcccgct ggtaaaatgg gcccacgctt cgaggcgccc    238560
     gggtccgtac cgaggggtac gggcccggtc gcgttccggg cgcctgatca gaaaggtctc    238620
     ccatgaacgc gaagccgacc gcatccttcg acggcctcgg actgccgccc gtgctggtgg    238680
     agacgatgac ctccctcggg gtgacacgtc cgttcccgat ccaggcggcg accctgcccg    238740
     aggcgctggc cggtcgcgac gtcctcggcc gggcgcggac cggctccggc aagacgctgg    238800
     ccttcggtct cgccctgctc gccgggaccg ccggccggcg cgcggagccg aagcggccgc    238860
     tggccctcgt cctggtgtcg acccgggaac tggcccagca ggtgagcgac gcgctggcgc    238920
     cgtacgcgcg ggcgctgggc gtgcgcctga ccacggtcgt cggcgggctg tcgatcaacc    238980
     ggcagaccca ggcgctgcgc gacggcgccg aagtggtcgt cgccacgccg ggccgcctga    239040
     ccgacctggt ctcccgccgg gactgccacc tgaaccaggt gcggatcacg gtgctggacg    239100
     aggcggacca gatgtgcgac ctgggcttcc tgccgcaggt ctccggcatc ctggaccagg    239160
     tcccctccga cgggcagcgg ctcctgttct cggccaccct cgacggcgac gtcgaccaac    239220
     tggtgcggga ccacctccac gacccggtcc ccgtgtcggt cgacccggcg tcggcctcgg    239280
     tgagcacgat ggagcaccac gtactgaccg tccacccggc cgacaagtac gcgaccgcga    239340
     ccgagatcgc cgcccgcgac ggccgggtgc tgatgttcct cgacaccaag gccggggtcg    239400
     accggttcac ccgggagctg cgggccgccg gggtgtccgc gggcgccctg cacagcggga    239460
     agtcgcagcc gcagcgcacc cacaccctcg cccggttcgt cgagggcggg gtcaccgtgc    239520
     tggtggccac caacgtcgcc gcgcggggca tccacgtcga cgacctcgac ctcgtcgtca    239580
     acgtcgaccc gccggccgac gccaaggact acctgcaccg cggcgggcgt acggcgcggg    239640
     ccggccgggc ggggagcgtg gtcacgctcg tcaccccgga ccagcggcgc gaggtgaacc    239700
     ggatgatgtc cgaggccggg atccggccga cggtgacccc ggtgcggtcg ggcgagcaga    239760
     agctgacgga cctcaccggc gcgaagcgcc cgccggccgg gcggggcaag gagagcggca    239820
     acgccccctt ccgcgggatg ggcacccgtc ccgccggtgc cgccaagggg tcccgcaagg    239880
     ccgtcgaggc gcgcagggcc gcggaggcgc gcgcggcggc ccgggtgcgc aagggccgct    239940
     gagccgacgg tcgaacgcgc cacccggggc ggggacttga cgccgggaac tttgaacaca    240000
     ccgatgacaa agtatggaca cgtcgagcgg aagtctccta ccttggcggc ggaacgtccg    240060
     tcacaccgca caagaccgga gcgatatccg gcacggtccg gtccccacca cccggaggac    240120
     caatgcaccc acggctgttc tcgcgtgccc gaagacacct catcctcctg ctgacctcgg    240180
     ccgtcgcgct cggcggcgcc tgggccgccc cggcgtcctc ggcggccccc gccgacatcc    240240
     cgccgcagga acccggcgtc acgctgcgcg tgttcgacgt ccagacgccg ctgaacgagc    240300
     tgtgcaccct caagccgggt cagaccccca accacgacaa gctgatgccg acggtcgact    240360
     ggtccaccac cgccgacttc ggcggcatcg ccgacaactt cgtctcccag gcgtccggtt    240420
     atctggtcgc ccctcgtgac ggcacctatg tgttccggct cgtcagcgac gacggctccc    240480
     ggctggccct cgacggcgcc acggtgatcg accacgacgg gctgcacggc gcggagccca    240540
     aggacggcac ggtcgaactc accgcgggag cgcacccgct gcgcatcgac cacttcgacc    240600
     gcggcggcgg ccagcaggtg cagctgtcct ggatgccgcc gggcgagagc gggttcaccg    240660
     tcgtccccac cgaggcgctg agcaccgacg ccggggtcgt ccgggtgacg gcgccgggcc    240720
     gcaaggagtg cgaggccggg cgcgacaccc ccggcgacgg tctgccgctc acctccgtgc    240780
     gccccgacct cgacctcacc gacctgcgcc ccgaaggctt cgagccgcag gtcaccggca    240840
     tggactggct tcccgacggc cgcctggcca tcagcacctg gggcggcacc gacaacgttg    240900
     ccggagaggt gtacctcctg gacaacgtca ccggtgagac cagccgcgac aaggtcaccg    240960
     tcgagaaggt ggcgagcggg ctgcgcgagc cgatgggcat caagtacgtg gacggctcgc    241020
     tctacgtctc gcagaagcac gagctgaccc gcctggtcga cagcgacggc gacgacgtga    241080
     ccgacgagta ccgcacggtc gccacctggc cctacggcgg caacttccac gagttcgcgt    241140
     tcggcctgct ctaccgggac ggctacttct acgtgaacct ctccgtcgcc atcgacctcg    241200
     gcggcgcgac caccaacccg cagcccgcgc ccaaccgcgg cacgacgtac aagatcagca    241260
     agaagaccgg gaagatcagt ccgatcgcgg gcgggctgcg cacgcccaac ggcatcggct    241320
     ggggaccggg cggcagtctg ttcgccaccg acaaccaggg cggctggctg cccgcctcga    241380
     agctcgtcca gatcaagcag gaccgcttct tcaaccacta caccgagccc gccgggccct    241440
     tcgaggactc gcccgtcacc gagccggtgc tgtggctgcc gcagaacgag atcggcaact    241500
     cgccctccac cccgctgtac ctcaccaagg gcaggttcgc gggccagctg ctgatcggcg    241560
     acgtcaccta cggcggcctc cagcgcgcct acctggagaa ggtcaagggc cagtaccagg    241620
     gcgccgtctt ccgctacacg cagggcctgg aggcgggcgt caaccgggtc tccatgggcc    241680
     ccgacggcgc gatctacacc ggcggcctgg gcgccgacgg caactggggg caggagggca    241740
     agctcaagtt cggcctgcag aagctgacgc cgaacggggg caacaccttc gacgtccaga    241800
     agatgcgggc cgtgcccggc ggcttcgacc tgacgtacac ccagccggtg tccgaggcga    241860
     cggccgcgga gctggcgtcc cgctacgagg ccgagcagtg gcgctacacg ccgaccggcg    241920
     actacggcgg cccgaagatc gccgaggagg agctggccgt gcggtccgcg acgctctcgg    241980
     acgacggccg caccgtgcgg ctgcggctgg acggcctgaa gccggaccgc gtcgtgcacg    242040
     tgcgctcccc gcgccccttc acctcggcct ccggtgagac gctctggagc accgaggcct    242100
     ggtacaccct caacgagatg cccggcaagc agccgcccgc ggccaccctg tacgaggccg    242160
     aggaggcgcg tctgacgggg aaggcgggca tcaacaccga ccacatcggc tactccggca    242220
     gcggcttcgt cgaccgctac gccaccgagg gcgacgtcac cacgacgttc gacgtgaccg    242280
     tcccgagggc cggcacctac gacgtgggcc tgcgctactc caacggcccg gaccccttcg    242340
     agggcaccaa gtcgctgtcc ctgtacgcgg gcgggaagaa ggtgcgccag acacagctcc    242400
     cgtccaccgg ggactgggac acctggtcca cccgcaccga gagcgtgcgg ctgcgggccg    242460
     gccacaacac ggtctcctac cgctacgacc ccggcgacac cggtcacgtc aacctcgacc    242520
     tgatcaccgt gcgcccgcac ggcgcgcggg tcgccctgtt cgacggcacc gcggcctctc    242580
     aggagcagtg gcagcacacg gacgggagga aggcggcctg gccgctggcc gaggagcggt    242640
     cgatggaggt gtgctgcggc gacatccgca ccaaggacgc ctaccaggac ttcaaactgc    242700
     acgtggagtt ccgcgtcccg ctgctgccgg acgacgtgac cggccaggac cgcggcaaca    242760
     gcggcatcta cctccaggac cgctacgagc tgcagatcct cgactcctac ggcgacacca    242820
     ccctggacac caacgaggcc ggggcgatct atctgaagaa ggcacccgac accaacgcgg    242880
     cgacggctcc ggagacctgg cagacgtacg acatcgtctt ccgtgccgcc cgcttcgacg    242940
     agaacggcgc caagaccgcc gacgcgcggg tgacggtggt gtggaacgga gagacggtcc    243000
     acgacgacgt cgccctcgac ggtcccaccg cggcgggccg ggccgagacc ccggccgccg    243060
     gggcgatccg gctgcaggac cacgggaaca aggtccggtt ccgcgacatc cgggtcgaac    243120
     cgctgaactg acccgtagcc gtgcggggcg gttcctgacg gccgccccgc acctcccgct    243180
     ccacggatcc ggtgggcgga ccggtgctcc ggccgcctct gggtagggtg aatcgaggaa    243240
     caccctgccc gtcgaacaag gagcggaatt gagcgagccg gcgtccatcg ccctgcagaa    243300
     ggagatcgtc cgggaactgg aggtcgccga gaccttcgac gccgaacggg agatcgagcg    243360
     ccgggtggcc ttcctcgccg agcggctgac ctccacgggt ctgcgtgcgc tcgtgctcgg    243420
     gatcagcggc ggggtcgact cgaccaccgc gggcaggctg tgccagctgg ccgtggagcg    243480
     ggcccgcgcc gcgggacacg aggcgctctt ctacgcgatg cggctgccgc acggggtcca    243540
     ggccgacgag gacgacgccc agcaggcact ctccttcatc cggcccgacc gggtgctgac    243600
     ggtggacatc aagcccgcga gcgacgcggc gctcgacgcc ctgctcgccg ccgacgtggc    243660
     cttccgggac ccccaccacc aggacttcgt gcacggcaac atcaaggccc ggcagcgcat    243720
     gatcgcgcag tacgcggtgg ccggggcgca cggcggcctg gtggtcggca ccgaccacgc    243780
     ggccgaggcg gtctccggct tcttcaccaa gttcggcgac ggcgccgccg acgtcgtacc    243840
     gctgacgggc ctcaccaagc gccgggtgcg cgcggtcggg gacgcgctgg gcgcgcccgc    243900
     cgcgctggtc cggaaggtcc cgacggccga cctggagaca ctcgaccccg gcaaggccga    243960
     cgaggacgcc ctcggcgtca cctacgagga gatcgacgac ttcctggagg gcaagccggt    244020
     gacggagcag gtcttcgaga cgatcgtcac ccgctaccgg cagaccgacc acaagcggcg    244080
     gctgccgatc gctccttgac ctgctccgtc gcgcggtctc agccggtcgc cggtcccggc    244140
     gggaacccca cgccggtgag ccgctccgac aactcccaca ggctgcggcc ggtggcggcg    244200
     tcggccgccg ccggtgacag ccggacccgt ttcggtccgc cccgcagctc gcccgggccg    244260
     tccgggccga tgaacccgcc gccgcgcacg ccggggtcgg ccgccgcgta cagccgcggc    244320
     agggctcccc gttcggcgga ccgggcgagc ggccgcggta cgcggccgaa cagcatccgc    244380
     accatgccgg ccggtgcgct cgtctgcggg ccggtggcgc tgtagccggg gtgtgcgagc    244440
     gcgctgcgca ccgggctgcc ggtctcggcc agccgtcggt ggagttcctg tccgaagacg    244500
     gcgttcgcga acttcgactg gttgcagaac gccatgggtg agtagtggcg ctcgccggtg    244560
     aggtcgtcgg ggaagaggtc accaccgacg agatcgcgtc cgccgcgggg gtgtccaaga    244620
     ggacgttctt ccgctacttc gcctcgaagg aggacgtggt cgtccggttc ctgacggaca    244680
     tgggcgccgg catccaccgg gagctcgcgg cccgccccgc cggggaacga ccctccttgg    244740
     ccctgcggag cgtcctctcc ggccccctcg cggcctgcgc ggatcactcc gacagagcac    244800
     tgcgggtggt ccggctgatt ctgcgcactc ccgccctgca cgcgcgtctc ctggagcggc    244860
     agggacggtg gcgcgagggc ctcgcggcgg agctggcccg ccgcccggac ctcggccccg    244920
     accacgagct gtaccccgag ctggccgccg gcatggcact gaccgcgttc aacacggtgc    244980
     tgcaccgctg gagcgacagc gacggcacgg cggaccccga ggcactgacc gaacaggctt    245040
     tcgccctcat cgccccggcc ctcgacggca cccgccggca gacctgagcg gcgcatgtcc    245100
     tttatgtgcg gtcggccgcg agtcgcctta atctgaccga ggggggtgct cgggcagtcg    245160
     acggccggtc acgccggcgg aatgtgagct tccatggcgg acttcatcgg tgcggtggac    245220
     cagggaacca ccagcacccg gttcatgatc ttcgaccacg gtggcaacga ggtcgcgaag    245280
     caccagctgg agcacgagca gatcctcccg cgctccggat gggtcgagca cgacccggtg    245340
     gagatctggg agcgcaccaa ctcggtgatg cagaacgcgc tgcgcaacgg cggcctgtcg    245400
     gggacggacc tggcggccat cggcatcacc aaccagcggg agaccacggt ggtctgggac    245460
     ccgcgcaccg gccgccccta ctacaacgcc atcgtgtggc aggacacccg caccgacgcc    245520
     atcgcggcga acctggagcg gtcgggccgg ggcgacgtca tccgccgcaa ggccggcctg    245580
     ccgcccgcga cgtacttctc cggcgggaag atccagtgga tcctggagaa cgtcgacggc    245640
     gtccgcgagg ccgcggagca gggacacgcg gtgttcggca acaccgactc ctgggtcctg    245700
     tggaacctca ccggcggccc cgacggcggc atccacgcca ccgacgtgac caacgcgagc    245760
     cgcaccatgc tgatgaacct ggagacgctc gactgggacg acgagctgct gggcttcttc    245820
     ggcatcccgc gcggcatgct gcccaccatc aacccctcct cgcaccccga ggcgttcggc    245880
     acgacccgga cctcccggcc gctgcgtgcc gccgtgccca tcacgggagt gctgggcgac    245940
     cagcacgcgg cgaccgtcgg acaggtctgc ttctcgcccg gcgaggccaa gaacacgtac    246000
     ggcaccggca acttcctggt cctcaacacc ggcacggaac tggtccgctc ccagcacggc    246060
     ctgctgacca ccgtggccta ccagttcggc gacaacccgc cggtctacgc gctggagggc    246120
     tccatcgcgg tgaccgggtc cgcggtgcag tggctgcgcg accagatgaa gatcatcaag    246180
     accgcggccg agagcgagga actcgcccgc accgtcgagg acaacggcgg gatgtacttc    246240
     gtccccgcgt tctccggcct gttcgccccg tactggcgct ccgacgcgcg gggcgccatc    246300
     gtcggcctcg cccggtacaa cgacaacgcg cacctggccc gggcgacgct ggaggccatc    246360
     tgctaccaga gccgcgacgt cgtcgtggcc atggagcagg actcctcggt ccacctggac    246420
     gtgctcaggg tcgacggcgg ggtgaccgcg aacgacctgt gcatgcagat ccaggcggac    246480
     atcctcggcg tccccgtcag ccgcccggtc gtcgccgaga ccaccgccct cggcgcggcc    246540
     tacgcggcgg gactggcgac cggcttctgg cggcacaccg acgaactgcg cacccactgg    246600
     agcgagtcca ggcgctggga gccccagtgg tccgaggagc ggcgcgcgca ggggtacgcg    246660
     ggctggaaga tggcggtgga gcgcacgctc gactgggtca aggtcccgga gagctgacac    246720
     cggggcggat caccggccga cggttccggc ggcgtactcc cacagacggc ccgcggcgtg    246780
     cgggtcgagc gcgtgcggag ctacgccgcc cgcctgttcc ccgtccccgc cggcgaccgc    246840
     ccgcgcttcc cggccgtcct cgaagcagcg ccccgtgacg ccctccacca gtggggacgc    246900
     ggccggcagc acggaggtcg cggcgtcctg gaggggcgtc tcgcaggagg gccgctcgat    246960
     gacgttcccg tcgtcgtcca ccgccccagg acccgcatcg tcgcggcgtc gaggtgccgc    247020
     tggaggctgg tgccgatcca gcggggttga gcgagttggc ggcgatgcgg tcggcgaccc    247080
     agtggcgggc gtccacggcg aacaggacgt cggcggtcgt ggactgggcg caggcggccc    247140
     agcggtcgga gcctgccgcc cgcggctgcc ttcacacggg tcaccggcac ctcttcgcgc    247200
     gcgtaccgcc accggcaccg tacgggctga ccgaactctt ttctggactt gccagtccat    247260
     tttattcgcc gcacagtggc atccgcgccc cggccgtcgg ccggggacga cggagaagca    247320
     cacggctgag acggcaggcg aggagcagga catgtcgatg cggcttgcgg acaggaccgc    247380
     gctggtgacc ggggcgacca gcaacatcgg acgggccatc gcggaggcct tcgcggccga    247440
     gggggcccat gtggtcgtct ccgggcgcag cgccgaacgg ggcagggagg tcgtcgacgg    247500
     catccgcgcc gccggcggcc gggccgactt cgtccacgcc gacctggacg gcagcgcggc    247560
     cgcctcacgg gcgctggccc gcgaggcgac ccgcgtgctg ggcggacgcg tggacgtgct    247620
     ggtcaacaac gccgggatct atccgcccgg caccacgacc gacaccgacg aggagacctt    247680
     cgaccgggtc tacgccgtga acgtcaaggc cccgttcttc ctcaccgcgg tcctggcacc    247740
     cgccatggtc cgggccgggg gcgggacggt catcaacctg ggctcctgga tcgcgcgcct    247800
     gggcgtcccg gtcggcgcgc tctacagctc caccaagggt gccgtggaga ccctgacgcg    247860
     ggcgtgggcg gcggagttcg gggcgcgagg cgtacgggtg aacgccatct cgccgggggt    247920
     ggtgcagacg cccccgcccg gcgaggtcca tcccgccgag gtcatgatga ggggcacgcc    247980
     ggcgggacgg atgggcacgc ccgaggcgat cgcgagcgcg gccgtctacc tggccggcga    248040
     cgagtcctcg ttcgtgcacg gcaccgtgct cgacgtcgac ggcgggcgca ccgcggcggc    248100
     cgtcatcgcc gcctgacacg cggcgggtgc cgcgtcaccg cgcggcggca cccgcccgcc    248160
     ggaggtccgc gatcccctgg tcgagagcgg cccgcagatg ggtcgaccgc cccgtcgaga    248220
     gcaggatgga cacaccgccc tgaatggccg tcagcagggc ggccgccctg gtctccacat    248280
     cgagatcggc ggggagcgca ccggccccct ggagcgacct gatgcccgcc gccaggctct    248340
     cctgccactg acgcagcagc tcgaccacga tcgcacgcgt gcccggggtg gagcggccga    248400
     tctgcaggaa cagcgacccg agcgggcact ggtcgccctg cgtctcgtag cgctcgatca    248460
     cgacgtcccg ccattcccgc cacgcctccc acgagtccag gcggccgagc tggggctgct    248520
     ggtcctccag cacctggtcc gcctcgaacc gggccacttc gacgagcagt tcgtccttgc    248580
     ccgcggggaa gtagtggaac aactggctct tgctggtggc ggtccgcgcc atgatgtcgt    248640
     ccagggtcgt cgaggcgacg ccccgctccc gcagcaccgc cgcggcgccc tcgacgatgc    248700
     ggcgccgtgt cgccctgccc ttggccgtca actcaccgcg cacgccgcac acctcgaaaa    248760
     tattggaccg acgggtccat cgtacgggcg cccccttagg gtgatcccat gtctgccgga    248820
     ttgagcgcgg cgaaaacccg ggccgcgctg cgcaccagcg cgcgcgtctc gggcgagctg    248880
     ctgctgatac tcgtcatgct cgcagtgacc ctgtgggtcc tcggccgtat gtggtcggtg    248940
     gtgtggccgc tgctcgtcgg cctgctcctg accacgttga cgtggccccc cgcccgcttc    249000
     ctgcggcggc acgggtggcg tccggcactg gccgccacgg tggtgacggt ggccttcctg    249060
     ctggtcgtcc tgggcatcgt ggcactgatc gccgtgccga tgtcctccca gaccgacgag    249120
     ttgaccgacg gcgtggtcga gggcatccag cggctgcgcg agtgggcggc ggggccgccg    249180
     ctgaacatcg gtgacgacga gatcaccggt gcgatggact cggcggtggc acgcatccag    249240
     gacagcgtcg gcagcatcac gaccgcggtg gcgacggggg tgggcgcggt ggtcaacggc    249300
     ctgatcaccg ccgtcctggg cgtgttcctg atgttcttct tcctcaagga cggaccgcgg    249360
     ttcctgccct ggctggcccg tcagttgccc ggccggctgg ccaccgacgt cccggtcgtc    249420
     gccctgcggg gctgggagac cctgggctcc ttcgtccggt cgcaggccct ggtggggctg    249480
     ctcgacgccg tgttcatcgg cctcggcctg tggatcctgg gcgtaccgct ggtgctgccg    249540
     ctggcggtcc tgaccttcgt gtccgcgttc gtgcccatcg tgggcgcgct gttcgcgggc    249600
     ttcgtggccg tgctgatcgc cctggtgtcg aacggcctga cggacgcgct catcgtgctc    249660
     gcgatcatcg tggtggtgca gcagttggag ggcaacgtct tccagcccat cctccagagc    249720
     cggggcctcg gtctgcacgc ggcggtgatc ctcctggccg tgacgctggg cggcagcctg    249780
     tccgggatcg tgggcagcct gctcgccgta cctttcgccg cgctgatcgc ggtggtgtgg    249840
     acctacgtgc gcgagcagtt gagcgagcgg cccgaggcga ccgcgaccgc cgacggctga    249900
     gccgacggac acgtctcccg cgcgaatcgg gtcgcggccg ggcgggcggt ggtgttggct    249960
     gtcgggcgtg gatctcttct cccgttcctg gtcggccctg ctcgccgcgg tcgccggcct    250020
     ctgtgacgag gacttcgccc ggccgtccgg gtgcgccggc tggctcgtcc gggacctggt    250080
     gtgccatctg gtcgtcgacg cccaggacgt cctgatcacc ctggccaccc cgacggccga    250140
     cgagccgacc cgggacgcgg tgacctactg gcaggtcgtc gagcccccga ccggggacga    250200
     cccgctcgac gcgctgatcg tccgcctggc cgccgcctac gagcagccgg ggctgctcaa    250260
     gttccacctg gccgacgtcg gttccgcggc cgggcgcgcc gccgcgctcg cggaccccgc    250320
     gagccgggtc ggcacacagg gccaggtact cacggcgggc gactacctct ccgcgtacgt    250380
     actggagtgc tccctgcacc acctcgacct gatcgcacac ctcccggagg cggcgccccc    250440
     gcccgcggcg gggctcaggc gctcgcggga gctgctggag agggtcgtcg gtacggcgtt    250500
     ccccaccgtg ttcgccgacc gggacgcgct gctgatcggc accggacggc gggcgccgac    250560
     cccggcggag gaggccgcgc tgggcgagtt ggcggcgcgg ctcccctttc cggtcggctg    250620
     acccgcacgt ccgggtccag ccgccgaagg gggaccgggg agtcgtccgg cgggtcgtcc    250680
     gatcggacga caaggccgtc gtccgtccgg cgggcgggga ggagccggtg cgtcgactcc    250740
     tgccggcgcc tcgcgggtcc aggcttgagg aacacgtccc cgacaccgtg gagccgtccc    250800
     accatgaccg ccaagccacc caccccctgc cgacctcgcc ctgtcggacg ccgttcgccg    250860
     cggcgacgcc gatgccgccc gggccgcgct gcgggccggc gccgaccggg aactgcgcga    250920
     cgaacagggc cgcacgccgc tgctcctggc ggccctggcc gaccgggtcg cggtcgccga    250980
     ggtcctggtc gcggccggcg cggacgtcaa cgcgcaggac gcgcgggacg acagcgcgtg    251040
     gctggtcacc ggggtcacgg gcagcgtccc gatgatgcgg gcgctgctgc ccggcggccc    251100
     ggacgtcacg ctgaccaacc ggttcggcgg cgtctcggtc atcccggcga gcgaacgcgg    251160
     gcacgtggcc tacgtacgcg ccgtgctcgc cgagacggac atcgacgtcg accacgtcaa    251220
     ccggctcggc tggacggcgc tcctcgaagc cgtcgtcctc ggcgacggcg accgcgcgca    251280
     ccaggacgtc gtggtggcgc tcctcgccgc cggcgccgat ccctcgctgc cggacggcga    251340
     cggtgtcacg gcccgtgccc acgcggagcg cagggggttc gaggccatcg cggacctgct    251400
     gcggcgggcc gagtcgcggg gcggcgacgg ccctcgcgcg ccgggtgtcc ggcggtgaac    251460
     cggcgttccc tcgcgggccg actcgccgcg ctggccgccg tcaccgcgac gctgggcgga    251520
     tgcgcgccgg acggcggtga cgacggggcc gcctccccgg tgtccgcccc gcccggcagc    251580
     acggcccagc gcacacccgg ctccggcggc acctcggcac gcacacccca aggcaccctg    251640
     ctggtcacgg acttcggcgc ggacaccgtc accttcgtcg accccgccgg tcggggcgcg    251700
     gcggccgacc tgggctcggt acgggtcggg acggcgccgt acggaatcgc gctcggcgag    251760
     gacggcaccg cgtgggtggc gaccgcggag ggcgtggccg ccgtggacac ccgtacgcgc    251820
     gtgcgcaccg ccctcgtccc ccaccggacg gacacgggcc cggtgacgac cggcgagtac    251880
     cggggcggcg gcatgggcat cgccctgtcc cccgacggca gccgtgtcta cgtcggggtc    251940
     aacgtccccg gcggcaaggg caccttggag gtcgtcgaca cggaacggcg ggaggtgacg    252000
     cgggtggtcc cggtcggtcg ccgtcccttc gacgtcgacg tctcgcgcga cggccggcag    252060
     gtctacgcga ccaaccacga ctcgttcgac gtgagcgtcg tcgacaccgg cgactggacg    252120
     gcgcgccgca tcgaggtcgc cccgtacggc accgagggcg gcctcggctc ctggctcaag    252180
     ccgcactacg ccgccgtacg cccctccgac ggggccctgc tgctgccctt cgagggcgag    252240
     cgcctggcgg tggtcgaccc cggcaccggg cgggtccgga ccgaggacat gaccgccaac    252300
     acccaccagc acggcgtcac ggcgggcgcc gacggcacgc tctacgtggt gggcaccggc    252360
     ccgatcgacc cgtccgagga cgacggcccg tccctgaccg tccgcacgcc cgagggcgac    252420
     gaacgggtcg tcccgctgga cggcccgcac gagaccgtcg ccctctcggc cgacggccgc    252480
     accgcctacg tctcgggcgg cttcacccgc gacggctact ggaacggcct gagtgccgtc    252540
     gacgtcgcga ccggccgggt gacccggctc ccggtgggcg agcggcccct ggccgtcgcg    252600
     gtcctcggcg gccaggggac cggcgcgggc tgagcgccgg gggcgaacca gggccggccg    252660
     gcccgtgccg ggaccgaccg gcccttggtg tcccggccgg ccgacgggac gctcggatcg    252720
     acagcccctg gcgtgccccc gaagggaacg gcgagaggcg gccggacgag cggcggtccc    252780
     ggaccgtcgg gccgaccgtc ccgccgagcg gtcccccctc cgtccgtccg cggtgaccgc    252840
     acgaatggag ccggagcggt acctctggca ccaccctgtc cgcggccctc cacggcgacc    252900
     accgcgagcg ccccgtgcgg gtcgtgcggg tcgcgcggga ggtccgcgtc gcggagggca    252960
     cccgcctctt cgaggaaggc cggcgtgccg aactgttccg gatcgtccgg acccggacgg    253020
     tcggcctcga cctgcgtgtc cccggccgcc ggtccccggt cgtcgagaca ccggggcacg    253080
     gggaactcgt cggctggtgc tggcacttcc cgccggcggc ggatacgact accggggcac    253140
     ggtgtcggtc tggttccgcg gcctgttcgc gctcgggccc cggccggagg tgatcgccta    253200
     cgccccgctg ctcttccggc cgcacgcgcc gagcgcctgc ctgctcttcg ccgcccggcc    253260
     gttcacccgg ctggtgcacg tctggagcgc accggtcgga tacctggtcc gcccctgttc    253320
     ggtccaccgg cgccgcgcca cccccgcacg ggcctcacgg acccgctcga cgaccgggag    253380
     gtggtccggt gacgacgacg ggctagtcct gtgcggtggg acggaccacg atgtcgccca    253440
     cgtcgacgcc gtcgggctgc tcgacggcga aggcgaccgc gcgggccacg gcctgcggcg    253500
     ggatggcgac ccggtccctg gtgtcgagga tttgggccct ggccccggcg tccgggatgc    253560
     cgtccgcgaa gtccgtgtgg acgaaccccg gtgagaccac ggtgacccgc aggctgtcac    253620
     cggcctcctg gcgcagcccc tccgacacgg tgcgcaccgc gttcttcgtc ccggcgtaga    253680
     ccgacatgag cgggctgatg cgcagtccgg cggtggagac gatgttgacg aagtggccgg    253740
     aaccctgttc ccggaagacg ggcagggcct cggcgatgcc gtacaggaca cccttcaggt    253800
     tgacgtcgat catccgctcc cagtcctcga cgcggagttc gtccaggggt gagatcaggc    253860
     cgacgccggc gttgccgacg aggacgtcga gccggccgaa acgttcgcgg gccagggcga    253920
     cgagtgcggc gacgtcctcg cggcgggtca cgtccgtacg gatccaggcc gcctcccctc    253980
     cgctcctgcc gatgcgcagg gccaggtccg ccagacgctc cggacggcgc gccccgagca    254040
     cgaccttggc tccgcgctcg gcgagcagga gggcgctcgc ctcgccgatg ccgccactgg    254100
     caccggtgat cgccacgacc ttgccttcga ttcccgacat gttgggcagt ccttccggac    254160
     ggggacatgg gcagagctgt gtcgtgccct agagtgaaag tggaggcgcc gccacttcca    254220
     tcacagtaag cgggggcgcc tccacttagc aaccggcgac gaggagaggg ccgctcatgt    254280
     ccgacgccac gaaacggccg ctgagggccg acgcacagcg caaccgggac aagatcctgg    254340
     ccgccgccgt gcgggtgttc agcgaggagg ggctggacgc gcacctcgag cgcatcgcca    254400
     gggaggcagg cgtcggcagc ggcaccctct accggaattt ccccacccgt gaggccctga    254460
     tcgaggcggc gtaccgcaac gaggtggcgc gactgtgcga ctccgtgccc ggtctgctgg    254520
     cggagctgcc cccggccgag gcgctgcgcg cgtggacccg ccgcttcatc gactacgcca    254580
     ccgcgaagtt ggggatggcg gacgcgctgc gggccgtcgt cgcctcgggc ggcgatccct    254640
     acggcgacag ccggcagctg atccagtccg ccctgacggc cctcatggac gccgccgcgg    254700
     cggccggtga gatccggtcc gacatcaggt cgaccgacat gttcgccgcc ctcgcgggca    254760
     tcgccctcac ctcgtcccgc cccgatcagc gcgcgcaggc cgaacgcctt ctcgacctcg    254820
     tcctggacgg cctgcgcccc acggcaccgc gtcccgcatg acagcgcctg ccctcacgta    254880
     gactccgcgc catgggtcga tgggagccga acgcgcgcgg ccgcctggag caggcggcgc    254940
     tggagctgta cgtggagcgc ggctacgagc agaccccggt ggccgagatc accaagcgtg    255000
     cggggctgac ggagcggacg ttcttccggc acttcaccga caagcgggag gtcctcttcg    255060
     ccgggtccgg caggctggag gagctgtgcg tggcagccgt cgcggcggcg cccacgacgg    255120
     cgagtccgat ggaggcggtg gccgccgcac tcgacgccgc ggcgggcgcc ttcgaggagc    255180
     gcggtgacct ggtgggcctg cggcagggcg tcatcgactc caacgcggag ctgcgggagc    255240
     gggagctgat caagctcgcg tccctgtccg gcgcgctcgc cgacgcgctg cgcgggcgcg    255300
     gcgtggccga accggcggcg gagctgaccg ccgagtcggc gatcgccgtg ctcaaggtcg    255360
     ccttccggcg ctggatcgac gggggccggg agcgaccgct gcggcccctg ctcgccgagt    255420
     gcttcgacgt gctccgcacc ctgtccgcac ggggcgccgc gagcgccggt tagccacccg    255480
     ggccgccctc ccgcacgccg gagtccccgc acgccggcgt ccccgcgcgc cctcctcccc    255540
     gcgcgccggg catgccgccg acgaggcgga acagccgtgt ccgcagtcgc cgtcccgcgt    255600
     tgccggggtg tgccgcaccc aggcggggag cgtcctggtc cgtccccgat gtcccgtaca    255660
     gactcggcgc agcagatgcg gaccatccat cggaaggaca tcgtcatgac gcagacctcc    255720
     aaggtcgtcc tggtgaccgg cgcgagcagc gggatcggtg aggccacggc cctgcgcctg    255780
     gccgccgacg gccaccgggt gttcctcggc gcgcgccgca ccgagcgcct ggagaagctg    255840
     gccgcgcgga tcgccgagga cggcggcacc gcgggctacc ggcggctcga cgtcaccgac    255900
     gccgccgacg tacgggcgtt cgtgtcggcc gcggtggagc gctggggacg gctggacgtc    255960
     atcgtcaaca acgcgggcgt gatgccgctc tcgccgctct cggaactgaa ggtggccgag    256020
     tgggaccgga tgctcgacgt caacgtccgc ggagtactgc acggcatcgc ggccgccctg    256080
     ccggtcatgc gggcgcaggg cggcgggcac gtcgtgaaca tcgcgtcggt cggcgcgtac    256140
     gaggtggtgc cgaccgccgc cgtctactgc gcgaccaagt tcgccgtgcg cgccctgtcc    256200
     gaggggctgc gccaggagtc ggccggggac atccgggtca gcgtggtctc cccgggcgtc    256260
     accgagtcgg agctggccga ctccatctcc gacccgcggg cgcgcgagga catgaagacc    256320
     taccgctcgg tggccgttcc ggcatccgcg atcgccgacg ccatcgcctt cgccgtctcc    256380
     cggcccgccg aggtggacgt gaacgagatc gtggtgcgcc cggccgccag tgcgcagtag    256440
     gcgacccgcg cgccacccgg cacgtcgcta gccggcgtcc aacggccgtt cgaagaaggt    256500
     ctccaggacc accgtcgcct gggtcccgct caccccgtcg atcgcgtaga ggcggcgcag    256560
     cacgtcctgg agccgctcgg tggtggccgt gcgcaccttc acgaggacgg ccgcgctgcc    256620
     cgcgatgacg tgcgcctcct ggatctccgg cacggcggcg aagtcctcgg cccggtcgcc    256680
     catccacgcc gtcgagtcga ccagcacgaa ggcgaggaca ccgcggtcga gcgcctcggg    256740
     gtcgacgtcg accgtggtcg accggatgac gcgctgctcg cgcagtttgc ggacgcgctc    256800
     gtgggcggcg cccgcggaca gacccacctc cccgcccagt gcggcgtacg gccgggtcgc    256860
     gtcctgctgg agcaacgcga tcagtcgccg gtcgatctca tccactgatt tcattcgtgg    256920
     accatatctg gttcggcaat gtggatgcta cgttgaacga gatactgatc accgcgctga    256980
     gaggacacca tgtccaccga cggcccgtac gagatcctgg acgaccgctt ccgcaccgga    257040
     cgctgtgcga acggagacaa caggctggag gtcctgtatg acggctgccg ctgggccgag    257100
     ggcccgctgt acctccccgc ctggcgtcag ctggtctgga gcgacatccc caacgaccgc    257160
     atcctgcgct gggacgaggc caccggctcg gtcggcgtct tccgcgctcc cgcgggccac    257220
     agcaacggca acaccctcga ccggcagggc cgcctggtca cctgcgagca gggcaaccgg    257280
     cgcgtcaccc gtaccgaacc cgacgggagg gtgaccgtcc tggccgagcg cttcgacggc    257340
     aggcggctga acagtccgaa cgactccgtc gtccgctccg acggcaccat ctggttctcc    257400
     gacccggact tcggcatcac cagcgactac gagggtcatc gcgccgagtc cgagatcggc    257460
     gcgtgcaacg tgtaccggat cgacccggtg tccgggcagg tgcggctcgc cgccgacggt    257520
     ttcgacgggc ccaacggcgt gatccttacc cccgacgagc ggcggctgtt cgtctccgac    257580
     tcgcgggccg cccggatcca cgcgttcgac atccgggagg acggcacgct ctccgacggg    257640
     aaggtcttcg ccgagggccg gggggacgtg cacttcgaca acatccgctt cgacgacgag    257700
     ggccgcctgt gggccgccgc cctgcacgac ggtgtccact gctacgaccc cgacggcacg    257760
     ctcatcggcc gtctgcgcgt gcccgagccc gtctccaacg tcgccttcgg cggccccaag    257820
     aacaaccgcc tgttcatcac ggccaccacg tccctgtact ccctggtgat gtcggtgacg    257880
     ggggcaccgc gcctctgagg accgccaccg tcccgacggc accccggtcg cgtccgggcc    257940
     cgtcggttaa ccggtgtaca gaaaggggcc gttgcgacgt aggttgtggg caagcaccca    258000
     cgcctcggct gaaagacgga ccgcacccat gagcgacccc tcgacgactc ccggccacac    258060
     cgcgcagcag aagatcgaca cgtccgtgcc gcactcggcg cggatctgga actactggct    258120
     gggcgggaag gacaactacc cggtcgacga gcaggccggc gacgcgtaca ccgccgtctt    258180
     ccccggcatc gtcaccgtcg cccgcagcag ccgcgccttc ctgcgccgca acatcaccca    258240
     tctggtcgcc gaggcgggca tccggcagtt cctcgacatc ggcaccggtc tgccgaccgc    258300
     cgacaacacc cacgaggtcg cccagcgcat cgcgcccgag agccggatcg tctacgtcga    258360
     caacgacccg atggtcctcg cccacgcccg cgcgctgctg tactccacgc ccgagggtgc    258420
     gacctcgtac atcgactccg acgtgctcga ccccgacacg gtcctcgagg cggccgcccg    258480
     gacgctggac ttcgaccggc ccatcgcgct gatcctcagc aacatcctgg ggcacatccc    258540
     cgactacgac caggcacgtt ccgtcgccgc ccggctcgtc gacgcactgc cgtccgggag    258600
     ctacctctcg atcaacgacg gctcgcgcgg catcgacccg gagttcgacc gggcccagga    258660
     cggctacaac gagagcggtg ccgcgccgta catcctgcgc accgtcgacc agatcacggc    258720
     gttcttcgac gggctggagc tggtggagcc cggcgtggtg ccggtgaccc ggtggcgccc    258780
     ggacgcggac accgaggacc ccgggctgat cggcgagcac ggcggactcg cccgcaagcc    258840
     gtgacgtcct gacccgcgcc ggagcgagag gaacccgcac catgtcggca tggccgttgc    258900
     ccgaggcgtt caccggcggt tcgggcaccg tccgctggaa ccggctgggc gccccggacg    258960
     gtcgccccct ggtcctgctg cacggcacgc ccttctcgtc gtacgtctgg cgtgcggtgg    259020
     cccgctcgct ggggcgcgac caccaggtgt tcgtctggga catgcccggc tacggggtgt    259080
     cggagaagag cgccgggcag gacgtgtccc tggccgcgca gggcagggtc ttcacggagt    259140
     tgctggagca ctgggggctc gaggagcccc tggtggccgc ccacgacttc gggggtgccg    259200
     tggccctgcg ggcgcatctg ctgcacggtg cccggtacgg ggcgctcgcc ctggtcgacc    259260
     cggtcgcgct ggcgccctgg gggtcgccgt tcttccggct ggtccgcgac cacgccgagg    259320
     tcttcgagca gctgcccgaa gcgctgcacc gggcgctggt gcgcgagtac gtcggttcca    259380
     ccggcggtcc ggggctgcac ccggcggtcc tggaccggct ggtcgagccc tggctgggcg    259440
     aaacggggca gccggccttc tatcggcaga tcgcccaggc ggaccagcgg tacacggacg    259500
     agatccagga ccggtacacc ggaatcgacg tccccacatt gatctgctgg ggcgaggacg    259560
     acgcctggat ccccgtggcc aagggacgcg aactggccgg tctcgtcccc ggttcccgat    259620
     gggagccgat cgcccacgcg ggccacctgg tccaggagga cgcgcccgcc gagctgacgg    259680
     ccgccctgct cgacttcttc cgccgcgtcc cctgagggcc tggccttcgt cccgcgggac    259740
     gacatgccac agggcggggc cccgggaaac tggcgttccc cgcagccccg ccctgcgcgg    259800
     cgatctcccg atcaggcggg ggtgatgttc tccgcctgcg ggcccttctg gccctgggtg    259860
     atgtcgaagg tcacggcctg gccttcctgc agctcgcggt agccctgagc gttgatgttg    259920
     gagtagtgcg cgaagacgtc ggggccgccg ccgtcctgcg cgatgaagcc gaagcccttt    259980
     tcagagttga accacttgac agttccgctg gccatgcctt ttgcctttca gccgttatcg    260040
     gattcgcacc gcgcgaaccc ggaggtggtc gtcctggtcc tccggcattg cacagcaaac    260100
     cgcccgcact cctgggcggg cggtctgggc gaaccacgac atctgctgct gacgctacac    260160
     ggcatgtccg agcctcacca gtgagtaagg ggtgtgagcg ggaaccttgt tgccgacccg    260220
     agtcctcggc caccgccgtg cgggtccccg ctgcgccatc cgggggagac cgcgaggcgg    260280
     ccgcacaacc cggttccgga agtggtctag ctatgaagag tccacccacg gagtcggaga    260340
     tcgatatgac cgtcaggaaa gcgctggccc tggtgatcgg cgctgtcatg tgcaccggcg    260400
     tgctggccac cggctgcgcc cgggagcacg cgggcgcctc ttcccaggac gcgcacgcac    260460
     ccgggagttc cgcggccccg cgcccggctc ccccgcgctc cttcccccgc ccgctgcccg    260520
     gggtcgggcc ggtcatgcgg gaccgcctcc cggacggcac ccggcaggcc ctggtggtca    260580
     ccggcgagac cgagagctcc tctcaggcgc aggtggtgct ctacgagcag tacccggccg    260640
     agggctggcg cgcggtcgcc ggtccctggc ccgcgcacaa cggcctgcgc ggctggaccg    260700
     acgaccacga ggcgggcgac ctgcacacgc ccatcggcgt cttcggcctc agtgacgccg    260760
     gcggcagact gcccgacccg ggcaccctgc tcccctacga cgaggacccg gagttctccg    260820
     tgtcgggcac cgggtacctg ggcgagcccc tggaggggtc gttcgactac gtggtcgcca    260880
     tcgactacaa ccgggtgccc ggcaccaccc cgctggacaa ggcccgcccc ctgggcgagg    260940
     acaagggggg cggggtctgg atccacgtgg accacgacgg gccgaccaac gcctgcgtgt    261000
     ccctgagcga ggagcacatg cgcgcgctgc tgaccgccct ggacccggac aaggagccgg    261060
     tggtcgtcat gggcccgcgg gaggtcctga tgcggtaggg gggtgccggg gcccggacgg    261120
     ccgtgctcag ccggccggcg gcatgtcggt gggcgccgag tccaggcccg gcctgcgctc    261180
     acgccaggca ccccgggtga agtcgggtat ctcgaccggg cggccgcccc gggccagcga    261240
     cgtgacgctg agcgggacgg gcgagcacca ggcggccgag tcgtacacgt cgatgtccgg    261300
     taccagcccc gcgcgcatca gctggacggt gcgccactgc aggacgtagt ccatgccgcc    261360
     gtggccgccg ttgttcgcgg cgtcgtcgcc caccttctgc cacagccagt ggtcgtactc    261420
     cttgcggtag gtctcgaagt cgcgccaggt gtggccgccg tggtcgggtt cgacgtagat    261480
     gcgggcgccg gtcggggcgg atccggcgta gtcctcgacg atgccgcggc tgccggcgag    261540
     ggtgttgatc cggctgtagg gccggggcga actcacgtcg tgctccgccc ggacggtcct    261600
     gcccttcgcc gtctcgatca tgcaggtgac caggtcaccg ttgatgtagg tctccttcca    261660
     ggacgggtgg tcccggggga cgaagcgggc ccggtagtcg gccagcccct tcggggccgt    261720
     cgtggtggcg cgcagggtgg tcatgcggtc gccgcggttg acgtccatgg ccgccgcgat    261780
     cggggcgaga ccgtgcatcg ggtagaagga ggcggtgctg cgggtgtgcc acaaccgccg    261840
     ccaggagtcg gtgtagtagg tgtccgagaa gaggagttcg cgcaggtcgt gcaggtagcc    261900
     gccgtggccg ttggtgaggt ccccgaacag gccgtcgtgc gccgccttca gcatggccag    261960
     ttcgttgcgc ccgtagttgc agttctcgga caggagcagg tgcctgcggg tgcgctcgga    262020
     ggtgtcgacg aggtcccaca gctggcgcag ctccgtcgcg acgggcagtt ccacgacggc    262080
     gtgccggccg ctgagcagcg cggcccggcc gtgctcgtag tggaactccc agggcgtggc    262140
     gatgtacacg aggtcgatgt cgtcgcggcg gagcatccgg gcgtaggagt cggccgagcc    262200
     gccgtactcg gcggggcgcg ggttgccctt gctctccagt cggtcggcgg cgcgctcggc    262260
     ccggtccgcg cggatgtcgc agacggcggt cacggtgcag ccgggcacgg ccgcccagcc    262320
     ggtgatcatg ccgccgcccc ggttgccgag gccgatgacc gcgacgcgga cggttgggtg    262380
     ggcggcgaag ggcacgccga tcatcgactt ctggccgggc ctgcggcggg gcgcctgctc    262440
     ggccgccgcg acgggggcgg cggacccgat gccggtcgcg agggcgccgg tggcggcggc    262500
     ggaacccagg agcagtcggc gtgagacagc gggcgtttgg gacatgacgg caacactcct    262560
     cgtggcggtt cgcatcacgg tcggggcgcg gtcgggcaac gtcgggctgt cgaacacttt    262620
     cggggcatga ctctgcgacg tcagccgtga catgtcaatg cgtgctcgat acaaagccgt    262680
     tccgagcact tccgcgcagt ctcacgcagt tccgcgcacc tgaggtgccg ctacatgccg    262740
     ccctgcacga ctccgcgcgt ggagagcgtg acgggatcct tggtggcgaa gtccccgggc    262800
     gggatgcccg ggtggtgacc ctcgcccggg ggtggcgcct ggtcgcgggg gcccagggtg    262860
     agccgggaga cgatccggta gcggtcgccc cggtagaggg agtgcacgta ctccacgggg    262920
     cggccccggg tgtcggtggt caggcgctcg aagagcagcg ccggggagag ttcgggcacg    262980
     tcgagcaggt cggcctccgc gcgggtgacc acggtgggtt cgatggactg cacggcctcg    263040
     ctgacccgga cgtcgtgccg ctcgcccagg tgctcgtaca gatcgccctg ctccagttcc    263100
     tcactggtca ggtccgagac gaggtcggcc ggtacgtgca ggtactcgat ggccatgggc    263160
     gagccgtcga ccagtcgaag acgtgccacg tagtggatct gcgccgccgg cgacatgcgc    263220
     agcttgcgcc ccacccgggc gcccgcgggc agggtgcgga cctccaggag cctgctggtc    263280
     caggcgccgg ccgcctgcgg gaggctgaag gcccggcggt cggagagcag ttcctgggtg    263340
     atcttctcgg cggccacgaa catgccccgg ccgtgctcgc gcaccagcag tccggcgacc    263400
     acgagttcgt cgatcgccgc ccgcaacgtc ggtcgggaca cgccgagttc ggcgcacagg    263460
     gtgcgctccg aggggatcgc gtccccgggg cgccggtcct cgatgagttc caggacggcg    263520
     tcgcggacgc gctcccgctt gagcaccgca ccggaagcgg cggcgtcgat ctccatgcag    263580
     tactcccgtg actggtctgc tggtcaaccg agcttacctg tccacctggg gcgcgaacca    263640
     gccactctcc gcgaacgaca ggcctgaatc ccatacatac gtgaggggtt gacgccctca    263700
     ttggtccatg ccaccttcga ccaacgccga ctggtaagtc ctgcgcccct tactggtcaa    263760
     gtgcgggtgc ggcgtccctt ccagctctcc cagaggtgaa ccgtgaagta ccgttcgctc    263820
     gccctgctct ccacgctggt gctcggcgcc gggctcgccg cctgctcctc gtccggcggt    263880
     tccgccgacg gcgccgggga cggcaggacc gccctcgacg tctggctcat gcgtgacagc    263940
     gtctcggccc agttccagaa ggagttcgag acgggcttcg agaaggccca ccccgagatc    264000
     gacgtgaaga tccagatcca ggagtgggag ggcataggcg agaaggtgac cgccgccctg    264060
     gccagcaacg acgccccgga cgtcatcgag gtcggcaaca cccaggtcgc ccagtacgcc    264120
     cagagcggcg gcctcaccga cttctcgggc cgcgtcgccg aactgggcgg cggcgactgg    264180
     ctggaggggc tcgcggagcc cggggcgtac gacggcaggc agtacggcat tccctactac    264240
     gcggccaacc gggtggtcat ccaccgcacc gacctgttcg agaaggccgg gatcgatccc    264300
     tcgcggatca ggaccaggga ccagtggatc gccgccaccc gcaagctgaa cacgggcggg    264360
     acccagggca tctacctgcc ggggcagaac tggtatgtgc tgtccggttt cgtctgggac    264420
     gagggcggcg acctggccgt gcagtccggc ggcggctgga agggcggtct cgacagcccc    264480
     ggggcgctgc gggccatgga cttctaccgg cgcctccagg ccctgggcaa gggccccaag    264540
     gactcggacg aggcccagcc gccgcaggcg gaggtgatgg cgaaggggca ggtcgcccag    264600
     atcatcgccg tgccgggcgg agccaaggtc atcgaggaga agaacccgga actcaaggga    264660
     aagctcggct tcttcccggt acccggcaag tccgccgacg ggccgggggc cgtcttcacc    264720
     ggcggctccg acctggtcgt cccggccgtc gccgcgcacc aggaggaggc gttcaccctc    264780
     atccgcgaac tgaccggtga cgcctggcag aagaagctcg ccgtcgccat gagctacgta    264840
     ccgaacaaga ccaccctggc gggcgcggtc gccgacgacc cgggcaccgc ggccatggcg    264900
     gccggcgccg tgaacggaca cgccacgccc aacacgcccc agtgggcggc ggtcgaggcc    264960
     aagaacccga tcaaggagta catgacggcc gtgctcaccg gcgaggacgc cgggtccgct    265020
     gcggccgagg cctcccggac catcaccgag acgctgggcg gcgactcctg accccccgcc    265080
     gtccccggcc ccacgaccac gagaccagga ggcgacgtgt cgaccgtccg tgagcggagc    265140
     gtgccgcccg gcgcggcggg ccggggcacc ctctggccgt acctgctgat cgcgcccgcc    265200
     gtgctgggca tgctgtacct gctgctctat ccgctggccc gcgccgtgct catctccttc    265260
     caggacttcc ggctgcgtca gctcatcctg ggggacgccg acttcgtcgg cctgcgcaac    265320
     taccggaccc tgctcggcga cccggagttc tgggaggtgg tgcgccggac cttcgtgttc    265380
     atggcggtcg gcgtcgtcgc gatcatggtg ctgtccaccc tggtcgcgct gatgaccgag    265440
     cggctgggcc gggcggccag gaccgtggtg ctcagctccc tggtcctggt ctgggcggtg    265500
     ccggtggtcg cggccaccac cgtcttccag tggctgttcc actccgagtt cggcatcgtc    265560
     aacgagaccc tcaccggcct cgggttcgag tcgtacgagg gctatccctg gttcgcgcac    265620
     ggcggggccg cgttcggcat cgtggtggtg ctgatcgtct ggcagtccgt gccgttcgcc    265680
     gcgatcacgc tctactcggc gctggtcacg gtgccggccg aactgtacga gtcggcccgc    265740
     atggacggcg cgggagccgc ccgcgtcttc cggtcggtca ccttcccgct gatccggccg    265800
     atcttcatgc tggtgctgtc cctcgaggtg atctggacgt tcaaggcgtt cgtgcagatc    265860
     tgggtgatga cccgcggcgg accgggcgag gccaccacca tcctgccggt gtacgccgtg    265920
     cagaccgcgc tggccgggca gcgctacgac ctgggctccg ccgcctcgat gctcacggtc    265980
     ctgctgatga gcggcgtcct ggtcctctac ttccgccaac tgttccgtca ggagggcgag    266040
     cagccgtgag caccccgcgt ccccgtcccc cggtacgccg cgcgctgcgc cgcctcccgc    266100
     tgaacgccgc cgccgcgctc actgtggtgg tctgcctgtt cccggtgtac tggatggtca    266160
     cgaccgcgtt caagccgtcg acggacatcc agtcctacga tccccggctg gtgcccggcg    266220
     cctggacgtt ggagcacttc cggaaggcgg tcggcgccga cggcttcgcg ctgttctggc    266280
     gcaacagcct cctggtcacc ctgagtgccg tcctgctcgc cctgctggtc gccctgggcg    266340
     ccgcctacgc cgtggcccgc atgcgctggc gcgggcgccg gcagttcatg ctggcggtgt    266400
     tcgtcgcgca gatggcgccc tgggagtcac tgatcatccc gatctacatc atctcccgcg    266460
     acaccgggat gctcgaccgg ctcccgacgc tgaccctgat ctacttcatg atcacgctgc    266520
     cgttcacggt ggtcgtgctg cgcggcttca tcgcgggcat cccgccggag ctggaggagg    266580
     cggcccaggt cgacggctgc acccgggccg gggcgttccg cagggtggcg ttcccgctgc    266640
     tggcccccgg gctcatggcc acctcgctgt tcggcttcat caccgcctgg aacgagttca    266700
     cctacgccaa cttcctcatc atcaagcagc aggacagccg cacgctcccg gtgtggctct    266760
     cctcgttcca gtcgaccttc ggcaccgact ggggggccac catggcggcc gccacgctct    266820
     tcgcactccc cgcgctggtc atcttcctcg ccctgcaacg gcacgtgacg gccgggctgg    266880
     cctcgggagg cgtcaagggc tgaccgggaa cgcccgcccc gcccctccta cccccgctcc    266940
     ttcgcactct cttcctcctc cccctcgacg tcgccgtcgc gcaccgccga ccaccggagc    267000
     cgccccgtgg acctgccacg ccccgaactg gccctagtcc cccgcccccg ccgcctctcc    267060
     gcccgttccg gccgcttccg gctcgaccgc acgacccggc tgcgggtcac ccccggggcc    267120
     ggtcccgccg cggtcctgct gcgcaccctc ctcgccccgg ccaccggact gcccctggac    267180
     tccgccgccg acggggcctt cgtcctcgcc ctcgaccccg ccctgaccgg cctcggcgac    267240
     gaggggtacg gcctgaccgt gagcccccag ggcgtcctgc tgcgggccgc ccgcccggcc    267300
     ggactgctgc gcggagtgca gacggtgcgg caactcctgc cctacgaggc cctgtccggg    267360
     cagccggtgc gcggggtgcc gtgggagctg ccggccgtgg agatcaccga cgtaccccgc    267420
     catgcctggc gcggctccat gctcgacgtg gcccggcact tccagccggt gtcctatctg    267480
     cagcgctacg tcgacctgct ggcgctgcac aagctgaacg tcttccacct ccacctcacc    267540
     gacgaccagg gctggcggat gccggtggcg gcccaccccc ggctgaccga ggtcggcggc    267600
     cggcgcgcgg agtcgatggt gggccccgcg ggcagcgacc ggttcgacgg cgtgccgcac    267660
     ggcggttcct acacccgtgc ggaactgcgc ggcctggtcg cgtacgcggc ggagcgcggc    267720
     gtgagcgtac tgccggagac cggtgtaccg gggcacgtcc gcgccgccct ggccgcgtac    267780
     cccgagctgg gcaccgaccc cgcccgccga ctggacgtgt ggacgcactg gggcgtgtgc    267840
     gagaacgtcc tgggcaccgg ggagaacgtc ctggacttct tccgcaccgt cctggacgag    267900
     gtgatggacg tcttcccctc gccgtacgtg cacatcggcg gggacgaggt ccccaccacg    267960
     gagtgggagc tgagcccggc ggcgcgggcc cgtgccgccc gtgaggggct ggcggggccc    268020
     cgcgcgctgc atccctggtt catcgcccgg ctggccgagc acctggtgcg cgcgggccgc    268080
     aggccggtcg tctgggccga gagcggcgtc gccctccccc tcgactgcac ggtgatgagc    268140
     tggcgcgatc cggcgcacgc ccgggcggcg gcactgcgcg ggcaccaggt cgtgcacgcc    268200
     gaccaccgcg cgacctactt cgactacccg cgcggcgccg gtcccgggga accgcccgcg    268260
     cagcccgggg tggtggtcga cctgcgcgcc gtccacgagg tggacctcgc gccgccgact    268320
     ccgcaggcgg cgtcccgggt gctgggcgcc cagggccagt tgtggacgga gttcgtgcgc    268380
     accccggagc acatcgagta cctcaccttc ccgcggctgt gcgcgctcgc cgaacgggtc    268440
     tgggacggca cgtcgggctg gcgggacttc acggcccggc tggccggaca ccgggcccgg    268500
     ctggacgccc tggacgtccc gcacgccgca ccgccgcccg gtccccccgt gtcgttcccc    268560
     cacaccccgc accacccgtc gacgctcccg ctcgggcggg agtcgtaccg aaaggatccc    268620
     gcatgagaaa ccgacccacc gccggccgcg cccgcctggc gctcgccctg tccgttctgc    268680
     tgggcggcgg tgccctgacc gccctccccg cccaggccgc tcccgccgcc gacggtctca    268740
     ccgtccagta ccgcaccagc gcgagcgggg ccaccgcgga ccagacggaa ccctggttca    268800
     aggtccgcaa caccggctcc tccatcgtgc agttgagcca ggtgaagatc cgctactact    268860
     tcaaggcgga ctccccgaac gcctcctacc gcttcgcgtg ctcctgggcg gtgcgcggct    268920
     gcgccgcggt caccggcacg ttcggcaccc tggccaaccc gacggcggcg gccgatcggt    268980
     acctggagat cggcttcacc tcggcggcgg gcaccctggc gcccggcgcg gacaccggcg    269040
     acctgcagct gcgcttctac cagagcaact ggcagccgct gcggcagagc gacgactact    269100
     ccttcggcgg cggccagacc tcgtacgcga cctgggacaa ggtcaccgcc caactggccg    269160
     gtgccaccgt ctggggcacg gctcccgagg gcaacgaccc cacggacccg accgacccga    269220
     ccgatccgcc cggcggcggt cagaccctgt tcgacgactt cgactacagc tcgcacacgg    269280
     atcccgcgat cgcggcccac ggctggagcg tgcgctccaa ctccggcggg cccggcgtcc    269340
     ccggagccac gtgggacccg tcgaaggtca ccttcgtctc cgccggcggc aactcggtga    269400
     tgaacctgga gacgtccacg gccggcaccg gcgcgtccac cacgcagacc gaggtcctga    269460
     ccaagtcggt gaagttcaag gacggcacgt acgcggcgcg ggtcaagttc gccgacaccc    269520
     cgaagtccgg gcccgacggg gaccatctgg tgcagacctt cttcaccatc aacgacctca    269580
     aggcgccgat ggccgacgac tacgccgagt acgacttcga gtacctgccg aacggagggt    269640
     ggggcgaacc gtcgaacatc ctctacacga cgtcctggga gacctacaac cccgatccct    269700
     ggcaggccgt caaccagcac tccgagcagc gcagcagtta cgccggctgg cacgacctgg    269760
     tggtgacgat cgacgccggc gccatcacct actacgtgga cgggcagccg ttcggcacgc    269820
     atgacgcgca gtacctgccg gagcggccga tgtcgatcaa cttcaaccag tggctgatcg    269880
     acctgaacgg ccagacgtcg acgacgccgc gctcctacga ccagcaggtc gactacgtcc    269940
     tgcacgtcaa ggaccaggtg ctcaccccgg ccgaggtcgc ggccaaggtc gccgggtacc    270000
     gcgccgccgg taccgggttc gtggacgagg tgcccgccgc gtgagccccg gcggggacgg    270060
     tcagaacagc ggctcctgac cgggcgcggg ccgtccccgc cggctgcgcg gccgggtgcc    270120
     gggtgccggt gccgtctcgc cgaacagggg ggcggtgccg tactcgtcgg gctcggcggg    270180
     gacggtggcg gggccggtgc ccacgttgag gaccagtggg gcgtcccggt cgaagtcgcc    270240
     cggcgtcatc gccacccagt cacggtcctg ccgctctccc acgcaccgac acctctctcg    270300
     cgccgcccgc cgcgaccacg cgacgctacc agccccgcgg cggcgccgtg atcacggctc    270360
     ccgcccggcc cgcatccatc gttcccgggt accggggaac cgacgcctga tgattgtttc    270420
     tgcactcttg gagccccttt cgatcatctt catgcatcgc ctctctcgtt tcgaaccctt    270480
     gacagggcct atatccggtc gatttactcc cgatcaacgc cgatgccgtg tgatcggcgg    270540
     cagaggtacg cccagccggt agctggcttc gcgccaggag cccggactga gtcgccagga    270600
     cggccacgcg cgtccgaggc ggggacgtgc ccaccatcct ccggagctcg aaccatgagc    270660
     cgtacacagg tgcacacccc caggaagccg gtactggccg gcataggtgc caccgccgtc    270720
     ctcgtcaccg ccgcggcgct cgtcccgggc agcaccccgg ccgaggcggc cacctacagc    270780
     cccccacccg cccacgcggg cttcgactac cagatcggcg gcgcctacac cccgccggcc    270840
     ggtgtcgagg tggtcagccg cgaccacacg gcctcccccg cgccgggcct gtacaacatc    270900
     tgctacgtca acgccttcca ggcccagccc ggcgccgagg gcgactggga cgacgacctg    270960
     ctgctgcgcg acgcgaacgg cgacgtcgtc tacgacaccg actggggcga ggcgttcctc    271020
     gacatccgca ccgccggcaa gcgcgagcgc atcgccgagc aggtcggcac ctggatcgac    271080
     ggctgcgcgg acaagggctt ccaggccgtc gagccggaca actacgacag ctacacccgc    271140
     gcgggcgacc tgctggacgc cgccgacgcg cagggcctga tcaagctgct ggcggagcgc    271200
     gctcacgccg acgggctggc catcgggcag aagaacaccg tcgagctggc cccgaaccgc    271260
     aaggcgaacg ggctggactt cgcggtcgcc gaggagtgcg gcgagtggga cgagtgcggc    271320
     gactacacgg acgcgttcgg cgaccgggtg atcgtcatcg agtacaccgc caagggcctg    271380
     tcgaaggcgt gcgcgggctt cggcgacgag ctgagcatcg tccggcgcga cctggacgtg    271440
     tcgccgaagg gcagcagcgg ctacgtccgt gagacctgct gacacccccc gacggccagt    271500
     gaagtccttg gaggtacaga tggatgcggt ccgacgtgcc gcgcgcccct cgcgccgggg    271560
     tgtgctgcgg gccggcgggg gtgccgcgct cgcggcggcc gcgggcaccg cggtgaccgg    271620
     ctgcggggca ggtgcggacg acggcgtcgc ggccgacggc acggtcaccg tcgagatgtg    271680
     gcacggccag gcggacaccg cgaagaaggt cctggaaggg ctcgtcgccg acttcgagcg    271740
     ggcccacccg aagatcaggg tgaagctggg cggcggtgtg ctgtccgacg tgatgctgca    271800
     gaaggtgacg gccgccctcg ccgccggttc ctaccccgac atcgcctaca tcttcgggtc    271860
     ggacctggcc cgggtggccc gcagcccgca ggtggtggac ctgaccgaca tggtggggtc    271920
     ggggcccgtg ccgtggaaga actactgggc ggcctccagg gacgccgtca cgctcaacgg    271980
     cagggtcagg gccgcccccg cggtgctcga ctcgctcgcc gtggtctgca acaggaagct    272040
     gttccgcgag gccgggctgg acctgccgaa ggccggctgg acctggcagg acttcgtctc    272100
     ctcggcccgc acgctcaccg agtcgggccg gggccggttc ggcaccggct ggccgggcac    272160
     gggcgacgag gacaccgtgt ggcggctgtg gccgctgatc tgggacctgg gcggcgacgt    272220
     cgtcgacggc ggcggcaagg gcatcggctt cgccgacacc ggcgcgcggg cgctggaggt    272280
     ggtggccgac ctggcccgcg acaagagcgt gtacgtcgat cccaagcccg gcagcgagca    272340
     gatgtaccag gtcttccagt ccggccggat gggcatggtg gtcaccgggc cgtggcagct    272400
     gcccgacatc gagaccgccg gcatcgacta ccacgtcgct ccgctgccct ccttcagcgg    272460
     acgcccggtc accatctcgg gaccggacac ctggacggtg ttcgacaacg gcgaggcccg    272520
     gtcgaaggcc gcccggacct tcctgacctg gctggcccgg cccgagcagg acgtgcgctg    272580
     ggacatcgag gccggcagcc tcccgctcag ccgccgcacc gaggccctgc ccgcctggca    272640
     ggacaaggtc gcccgcaccg agggcctgaa cgtgttcacc acggcgttgg agacggcgcg    272700
     ggtgcgtccg gtccacccgg cgtacccgga ggtctcgcag gcgctggggc aggcgatcgt    272760
     cgccgtgctc ctggggcgca gcagtccgaa gaaggcgctg cgtgcctgcg ccgacgaagc    272820
     caacgccgcc ctgctcattc cgcgttgagg agccacaccg ccatgccgcg cctcccccgc    272880
     cccatcaccg tcgagggtcc gccgccggac ccacggccac tgcgccgcaa gcgccgccgc    272940
     gagaccggca ccgcctgggc gttcgtctca ccggccgtcc tgatcgtcct cggtctgagc    273000
     atcgtcccgg tcgtctggtc gctgctgctg tccttccagg ccagcgacct ggtgacgccc    273060
     agccgctggg tgggcctgga caactaccgc gccctcgccc aggacccgaa cttcagccag    273120
     gcggtccgca acaccctgct ctacacggtg ctgtacgtgc cgctgagcct gctgttcggc    273180
     ctggccctcg ccatggtcct gaaccggcgc atccgcttcg tcggcctcta ccgcaccctg    273240
     atcttcgtgc cgttcgtgct gtcggcgacc gcgcagggcg tgctgttctc gttcatcctg    273300
     gatccggagt tcggcgccgc caactcggtg ctgcaccgcc tcggcgtctc gtcgcagggc    273360
     tttttgtccg acccctccca ggccctgctc gtgctggtcg cgatcaccct gtggagcggc    273420
     accggattct gcgtcgtggt ctacctcgcc gccctccagg acgtgccgca gtccctgatc    273480
     gaggcggccc gcctcgacgg cgccggacgc cggcacctgc tgcgccacgt cacgatgccc    273540
     acgctcaccc cggtcaccgt tttcctggtg ctgtggcagg ccatccagtc cctccaggtc    273600
     ttcgacctgg tgtacgtcac caccaagggc ggtccgctcg gctcgaccac ggtgatcgtc    273660
     tacttcatct gggagcaggc cttcaagaac gccacggcgg gatacggggc ctcggccgcc    273720
     tatgtcctgg ccgtcgcgct cggtctggtc gccggggccg tccgcatcgt ccggcgtcgg    273780
     ggacgccacc gtctcgaagg ggcccgatca tgacggcgac ctccgcccgg cccgacaccg    273840
     ccgtcggcgc ccaccacctc gcgaaggcgc ccgccgccgg tgaacggcgc cgcccgcggc    273900
     tcccgttcag cccctggcac ctgctgctgg cgccgctcgc cctcgtcttc gccgtgccgc    273960
     tggtctggct ggtgctcagc tccgtgatga gcaacgcgga gatcaaccgg ttcccgccgg    274020
     cgctgtggcc gtccggcatc gacctcggcg gctaccggta cgtgctgggc aacgcgatgt    274080
     tcccccgctg gttcgtcaac tcgctgatcg tctccgccgt caccgtcgcc gcgaacctgg    274140
     tcttcgggtc gctcgccggg tacgcgttcg cccggatgcg gttcgcgggt tcccgggtgc    274200
     tgatggggct gatgctggcc accatggcgg tgccgttcca gctgaccatg atcccgacgt    274260
     tcctggtgat gaagaagctc ggcctcatcg acaccctggg cgcgctgatc gtgccgtcgc    274320
     tggtcacgcc gttcgcggtg ttcctgctgc ggcagttctt cctctcgctg cccagggagc    274380
     tggaggaggc cgcctggatc gacggctgct cccggctgcg ggtgctgtgg cggatcgtgc    274440
     tgccgctgtc ccgtccggcg ctggccacgg tggccgtgct gaccttcctg accacgtgga    274500
     acgacctgac ctggccgctg atcgccatca accacgacac gcagtacacg ctgcaactgg    274560
     gcctgacgac gttccagggg cagcaccaca cccagtgggc ggccgtgatg gcgggcaacg    274620
     tcatcaccgt gctgccggtc ctgctcgcct tcctcggcgc gcagaagacc ttcatccagt    274680
     cgatcacctc cagcggactc aagggctgac cacccgccct ccgtccgccg ccacccgcaa    274740
     cggaaagaac cccgcatgag caccgcccac ccgtccgcac ccaagatcac cttcgtcgga    274800
     gccggcagcg tcgtcttcac ccagggtctg ctcgccgacc tcttcgcctt cgacgagctg    274860
     aagtccgcgc acatcgcgct gcacgacatc gacgcggagc gcctggccac cgcgcgggcc    274920
     gccgccgagt acatcgccgc cgaacgcggc gcccggccgc gcgtcaccgc gcacgccgac    274980
     cgtcgcgagg ccctggccgg cgccgacttc gtcatcaaca tcgtgcaggt cggcatgggc    275040
     gaggcgaccc gtaccgactt cgaggtcccg gcccgctacg ggctgcgcca gaccatcggc    275100
     gacaccctcg gcgtcggcgg catcttccgc gccctgcgca ccttcccgct gctcaaggcg    275160
     ctcggcgagg acatcgccga ggtctgcccg gacgcctggc tgctcaacta caccaacccg    275220
     atggcgatga acgtccagta cctcgccgag gcgaccggcc tgacgcgcgt ggtgggactg    275280
     tgccactccg tgtactggac ggtccagggt ctgtgcgagc tgctgaaggt cccctacgag    275340
     gaggtcacct accaggccgc gggcgtcaac caccaggcgt gggtgctgcg tctggagcac    275400
     ggcggcgagg atctccaccc gcgcctggac gcgctgatcg ccgaggaccc gcagctgcgg    275460
     cgccgggtcc gcatggacat gtaccggcgg ctcggccact acccgacgga gaccagcgag    275520
     cactcctccg agtacgtgcc ctggtacctg caccacgaca gcgaggtcga gcggctgcgg    275580
     ctgcccgtcg gtgcctatct gggcatcgtg gacgagaacg tggccgagta cgagcggacc    275640
     cgcgacgcgc tggcgtgcgg cgcgccgctc accgtcgagg gcaccatgga gtacgcgccg    275700
     cagatcatcc acagcatggt gaccggcacg ccccgcacgg tctacggcaa cgtgccgaac    275760
     cacggtctga tcgagaacct gcccgcccgg ggcaccgtcg aggtgccgtg cctggtcgac    275820
     tccgcgggcc tccagcccac ccgcgtcggt gcgctgcccc cgcagctcgc cgccctcaac    275880
     cgggcctacc tcagcaccac cgacctggtg gtgcgggcgg cgacggagga cgacccgcgg    275940
     cacatccggc acgcggcgat ggccgacccg gcgacggcgg cgaccttgcg ggtcgaggag    276000
     atctggcagc tgtgcgacga catggtccgg gctcacgggg accggctgca gccggggctg    276060
     cggggcgtac tcgccccctg agccgccgcc cggccgtgct ggtgcggccc cgcgtacggg    276120
     ggagaacgcg gggccgcacc agcaagctat cggagtaatc ggccgcctgc cagacccggc    276180
     gcgtcccccg gccggtacga gccccccgta cccggccgtc accggcgggc tccgccccgg    276240
     gctcgcaccg ggtgccgtca cccggccggc ggacaggagc gtcgccggga gcgggaagcg    276300
     cggcgacggc gcgcgctgcg gggcgggccg tgcggcaaca cactggggtc atggtttgcc    276360
     ccgatccgcc ggcggcggtg tcacggcgtt tccccgacgg gccggcaagc gcggcggcgg    276420
     cccgccggtt cgtgcgcacc gcgctggacg gtgccgcccg tgacctggtg gacacggccc    276480
     agctcctggt cagcgagctg gtcaccaacg cggtgctgca cgcgcgcacc gaggtcgagg    276540
     tgagcgttgc gcgtctggag ggccgggtgc gcgtaggggt cggggaccgg cggccgggcc    276600
     gcggcctcgt accgcagcgc tgctcgccgt acgccggtac ggggcagggt ctcgtactgg    276660
     tggagcagct ggcctcgcct ttcggggcgg acggcggcga cgggggcaag acggtgtggt    276720
     tcgagctgtg gcacgacggt ccggcgccgc cgtccgccgg gtgggagacc gccgtgccgc    276780
     cgcggcccgc cgaacggacc gtgacgctgg tcgacatgcc gaccgccctg gagtccgcgt    276840
     tccggcagca ccggcacgcg gtgctgcgcg agctgaccct cgccgcgtcc gcgggagacc    276900
     tcctcggggt gccgcccgag gacctcgtcg cggccaacga cgtcaacaac gtgatcagcg    276960
     ccggtgtgtc ggccgcgccg gcgggacctg cctccgagtc cggtctgcgc accctgcccc    277020
     tcccgctgtc ggccgacgcc ctgccggcgg tgcgggcgct gcgccgcgta ctggacctgg    277080
     ccgaggcccg ggccggggag gaacggctgc tcacgcttcc ggccctgccc cgcggccggg    277140
     ccttccagaa ctggctcttc gacgagatcg ccgggcagct ggccggggac cggcccaccg    277200
     cgtggaccgt ggtcccccgc gcgcccgagg tcagctccgc cgagctcgtc ccgtgggacg    277260
     tcggccaggt gcgggccagc aggatgccga ccgtcgccgc cgacgagggc aaccggatcg    277320
     tggcgaccaa cggggccgcg gcggacctgc tgggctggga cccggaccag ctcgtcggac    277380
     gccgtctcac caccctcgtc cccgagcacc tgcgcgagcg gcacacggcg gcgttcacct    277440
     cgatgctgct caccggccgc acccgcatcg tggggcgctc ggtgccgctt ccggcgctgc    277500
     accgtgacgg ccggctcatt ccggtgcggc tgtacatcca gacgcaggag acggccgacg    277560
     gccgcaccgt cttcgtcgca cagctcgtcc cgagggcgac gacgttcctc gacgggccga    277620
     ggactcccgg caggatccgg aaggcggcgg tcggggagcc cgacgggggc cggtcgccca    277680
     ccgtgccgcc ggcgggggcc gggacgcccg gtgcccgggg cggtatgtcg gcgctggacc    277740
     ggctcaccct cctggccgaa ctgggggcgc agctcaacaa caccctggag ctggacgagg    277800
     gcctccagcg cgccggccgg ctgctgacgc ggcggctggc cgactggtgc gtggtggacc    277860
     tgttcaccgc cgacgcccgg gtggaccggg cgtgtgtcgt ccaccgcgat ccccgggccc    277920
     tgcgcccggg ggcgtacgag ggcctgctcc ccggggtctc cgaggagtcg cgcggcccgc    277980
     tggcccgggt gctgcgcggc gccgggcccc tcctgctcac cggcgccccg cagccggggc    278040
     agaccgggag cgcgctggac cgggcctatg ccggcctgtt ccgggagttg ggggcgggca    278100
     gcgccgtcgt cgccccgctg cgggcccgcc gcaagatctt cggtgccctg accctcgccc    278160
     gcgcgccccg cggacggccg ttcacggagg aggatctgac gctggtcgac gacctggtgc    278220
     acagcctcgc gctcggggtg gacaacgccc gtctgtacca ggacacccgc tccatcgccg    278280
     aacggctcca gcgctcgctg ctgccggtgc tgccgaaggt cgagggcctg cgtctggccg    278340
     cccggtacgc cgcctcctcg accaccgcgc aggtcggcgg ggactggtac gacagcttcg    278400
     tcctgcccgg cgggaacacc gcgctggtca tcggcgacgt cacggggcac gacctcgacg    278460
     cggccatcgc gatgagccag ttgcgcagca tgctgcgcgg catcgcggtg gaccgcgagg    278520
     agccgcccgc ggaggtgctg cgccggctgg acctggcgaa ccacagtctc catcgggagg    278580
     cgaccggcac ctgcgtctac ggcctgatca agggtccccc ggagggcccc tgggagctga    278640
     cgcactcctc cgcgggccat ctgccgccgc tgctcaccac ccgggacggc cggacccgct    278700
     acctcgacgg cggtgccggc ctgctgctcg gcatggaccc cgacgcctcc cgcggcacgg    278760
     cccgtgacgt gctgccggcc cactcgacac tgctgctgta cacggacggc ctcgtcgagc    278820
     gccgcgacga agccctcgac ggggccctcg accggctgcg ccggcacgcc gccgacctgg    278880
     cccgcgagcc cctcgacacg ttctgcgacg agctgctgat cggcctgggg gcggacagcg    278940
     cggacgacat cgcggtcctc gccgtccggc cctcgccgcc ctgacacggg tgcccgttcg    279000
     ggcatctcct tctgcctcgg cggctcgtga cgccggcaca ggggtggcga tagcgtcgcc    279060
     tggtgagcaa cacgtcccgg cgagcggcca gatgaacgac gagcggctga ccgtggcgcc    279120
     gacggccgac gacacggacg acccacggca ggaaccggag cgggcggaag gctccgagcg    279180
     cggccccggg cgaaagcgcc gcggaccggg ccccgtcacc ctgttgctgc tgccggctct    279240
     cgtgaccgtc accggtgtgg ccgccttcct cgcgctgggc gggctgccgg acccgtggcc    279300
     cgacgactcg gacgccaagg cgtcgaccgc ggccgacatc gacccctcct acgtcccgtg    279360
     gctgcgcaag gccgcctcgg cctgcaccgt cctggagccg tcggtgctcg ccgcgcagat    279420
     cgaccagctc tcgggctgga gcgacgactc ggacgacctc tcgggccaga agggcatcgc    279480
     cgcgttcacc gacagcgagt ggcgggcctg gggcaaggac gacgacggca acgggcacgc    279540
     ctcgccccgc gatccggcgg acgccatcat ggcgctgggc cggcgggact gttcgctggc    279600
     cgagaaggtg accgggctgc gcaccgaggg gcgggtcaac ggcgacctcg tggagctgac    279660
     cctcgcggcg tacgccgtgg ggccggacgc cgtgaccggg gcggggcggg tacccgcggc    279720
     ggccaagacg tacctcgccg aggtccaggc cctggtgccg cggtacgagg cgctggaccg    279780
     ggaggactcc gccgacggct cgggcgggcc ggccggtgcc ctgctgaccg cgccggtgag    279840
     cccgctcacc atcacctcgc ccttcgggtc gcggcagcac ccgctgaccg gggtgaccaa    279900
     gctgcacacc ggcgtggact tcgccgcgcc gcagggcgcg caggtcgtgg cggcacggcg    279960
     gggccgcgtc gtgttcgccg cgctcaccag cgcgtacggc aaccgcatcg tgatcgacca    280020
     cgggaccatc cagggcaagc gggtggagac gacctacagc cacctctccg ccctggagac    280080
     gtcggtgggg cagaccgtgg aggccggggc cccgatcgga cgggtcggct ccaccggcct    280140
     gtcgaccggc ccgcacctgc atttcgaggt catcctcgac gggtactaca ccgatccgcg    280200
     cccctgggtc gtggcgaacg gggtttgatc cggcggatcg tgtcgagaac ctcaacatga    280260
     cccagtcgaa gcgcgagacg gaacggaagt acgagccgcc cgccggtggc ctcgccgggc    280320
     tgcctgacct caccggcgtc ggacccgtcg cgtcggtcac cgcggccggg cccgaggagc    280380
     tcgacgccgt gtaccacgac acggtggatc tgcggctcgc cgggtcctcg gccaccctgc    280440
     gccgccgtac gggcggcccc gacgcgggct ggcacctgaa gctgccgctc accggggaca    280500
     cccgcgagga ggtgtgggcc ccgctgtcgg acgacgtgcc cgcggcgctg cgcgagctgg    280560
     tgctgtcccg cacgcggggc gccccgctgc gtccggtggt gcggatccgg tccacccggg    280620
     ccgtgcggcg gctgcacgac gccgagggcg gggtgctggc cgagctgagc ctcgacgagg    280680
     tgcgggcgga cgcgacggcg gcgggcggcg ggcgcggcga gtggggcgag ctggaggtcg    280740
     aactcgccga gggcgtccat gccggactgc tcgacgccgt ggagaagaag ctccgcaaga    280800
     aggggatcgt ccggtccgac agtccgtcga agctcgcccg ggcgctgcgg gacaccggcg    280860
     tgggcggcgc gggcgtgccc cggacgcccg acggagtggt cgccggctcc tccggttcgt    280920
     acgtgctctc ctacctgcgc gagcaggtcg gcgtcctggt gggcctggac ccggcggtgc    280980
     gccgcgagct gcccgacgcg gtgcaccgga tgcgcgtcac gtgccgccgg ctgcgcagtt    281040
     gcctgcgttc gtaccggtcg gtgctggacc ggcgggtcac cgatcccgtg gccgcggaac    281100
     tccggtggct ggcgggcgag ctgggcgccg cgcgggacca ggaggtgctg cgcgaacgca    281160
     tcggcgccgc gctggacggg ctccccgacg agctggtgct cggccccgtc gccgcccggc    281220
     tgcgggtgtg ggacgtgtcc cgggacgagg acgtgcggtc ccggacgcgg atggccctgg    281280
     gcagcccgcg ccatctgcgc ctcctggacg cgctggacga gctggtccgg cacccgccgc    281340
     tgcgctccgg ggccgggcgg aagccggccc ggacgatggc ccgggcggtg ctcaaggagt    281400
     acgcccgtct cgccgggcgc atggacctcg cgctcgcgcg gccgtccggc cggtcccggg    281460
     agacggagct gcacgaggcg cgcaaggcgg ccaagcggct gcgctacgcg gccgaggtcg    281520
     cgcgtcccgc gctcggcaaa cccgtcgccc ggctcggcaa acaggccaag gcggtgcagc    281580
     agttgctcgg cgagcaccag gacgccgtgg tcgcccagga caccctgcgc cggctggcgg    281640
     tggccgccca cggggcgggc gagtcggcgt tcacgtgggg ggtgctgcac ggccgggaac    281700
     gggcgggcgc ggaagcccgg cagcgggagc tgcccgggct gtggcgggcc gcgtcggatc    281760
     ccgcgctgcg ggccccgctc gaacactgat cggcgacaac tcctgtgcgg agtcttgccg    281820
     gatcgaagcc tcaccactta aatcacacct tgaactaagc cgctgcgctc agcggttggt    281880
     cggtcctgtc cgcacccgca gaaagctcac gcatgagact gagatccatg ggtgtcgcgc    281940
     tcgtcgccac ggcggcgctc gtcaccctcc ccgctccgat cacggccacc gcggccgaca    282000
     ctcccctctc ccagggccgg acggccacgt cgtcctcggc cgagaacgcc ggcacgccgt    282060
     cgcagaacgc cgtcgacggc gacacggcca cccggtggtc gtcggccgcg agcgacgacc    282120
     agtggctcca ggtcgacctc ggtgccaccg cctccgtcac ccgggtcgtg ctcgactggg    282180
     aggcggccta cggcaaggac tacaagatcc agctctccca ggacgggagc acctggaccg    282240
     acgcgaagac ggtcaccggc ggcgacggcg gcaccgacac cctcgacgtg tcgggccagg    282300
     gccgctacgt ccgtatgcag ggcgtccacc gggccacccc ctggggctac tcgctgtggg    282360
     agttccaggt cttcggcacc accggcggca ccgccccggg cggctcctgc gacaccgcca    282420
     acgccgcgca gggcaggccc gccaccgcct cctccgtcga gaacgccgga acaccggcca    282480
     ccgcggcctt cgacggcgac accggcaccc gctggtccag ccaggcctcc gacccgcagt    282540
     gggtgcgggt cgacctgggc gccgtgcagg acctgtgcaa ggtggacctg aactgggagg    282600
     ccgcctacgc caaggacttc cgcatcgagg cctccgcgga cgggcagagc tggcagacgc    282660
     tgaagagcgt cacgggcgcc accgggggca aggcctccta cgacgtcagc ggttcgggcc    282720
     gctacgtccg cgtccacggc acggcccgcg ccaccggcta cggctactcc ctgtgggagg    282780
     tcgccgtgca caccggcacc accggcgctc cgcccgtcga gggcggcggc gacctggggc    282840
     cgaacgtcat cgtcgtggac ccgtccacgc cgaacctcca gcagaagttc gaccaggtct    282900
     tcgcccagca ggagtccaat cagttcggcg gcggccgcta ccagttcctg ctgaagccgg    282960
     gcacctacaa cggcatcaac gcccaactgg gcttctacac ctccgtctcc ggtctcggcc    283020
     tcaacccgga cgacacgcag atcaacggtg acatcaccgt ggacgcgggc tggttcaacg    283080
     gcaacgccac gcagaacttc tggcgttcgg ccgagaacct cgccatcacc ccgtccaacg    283140
     gcaccgaccg ctgggccgtc gcccaggccg ccccgttccg gcgcatccac gtcaagggcg    283200
     ggctcaacct ggcccccaac ggctacggct gggcctccgg cggctacatc gccgactcga    283260
     agatcgacgg caccgtcggc ccctactccc agcagcagtg gtacacccgg gacagctcgg    283320
     tcggcggctg gaccaacggc gtctggaaca tgacgttcac gggcgtcgag ggcgctcccg    283380
     gcagcaactt cgagaccggc ccgtacacca cgctcgacac cacccccatc tcgcgcgaga    283440
     agccgttcct gtacctggac ggcaacgagt acaaggtgcg ggtccccgcc aagcgcacca    283500
     acgcgcgcgg cgtctcctgg cccgccaacg ccggtggcac ctcgctgccg ctcagccagt    283560
     tctacgtcgt caagcccggc gcgacggcgg cgaccatcaa cgccgcgctc gaccaggggc    283620
     tcaacctgct gttcacgccc ggcgtttacc acatcgacca gaccatcgag gtcgaccgcg    283680
     ccaacaccgt cgtactcggc ctcggtctgg ccaccatcat tccggacggg ggcgtcgacg    283740
     ccatgcacgt ggccgacgtc gacggcgtgc ggctcgcggg cttcctcatc gacgcagggc    283800
     cggtgaactc cgacacgctg ctgcggatcg ggacgccggg cggcaacgcc gaccatgccg    283860
     ccaaccccac caccatgcag gacgtgttca tccgcgtcgg cggcgcgggg cccggcaagg    283920
     ccaccgactc cgtcgtggtc gagagcgacg acgtgatcat cgaccacacc tggatctggc    283980
     gggccgacca cggcgagggc gtcggctggg agaccaaccg cgccgactac ggcctgcggg    284040
     tcaacggcga cgacgtcctc gcgaccggac tgttcgtcga gcacttcaac aagtacgacg    284100
     tctactggag cggagagcgc ggccggacga tcttcttcca gaacgagaag gcctacgacg    284160
     ccccgaacga ggccgccatc acccacgacg gcatcgtcgg ctacgcggcc tacaaggtcg    284220
     ccgactcggt gaacgtgcac gacgcggtgg cgctgggcag ctactgcaac ttcaccgccg    284280
     acccgggcat cgtccagcac cacgggttcc aggtaccggt caagccgggg gtcaggatgc    284340
     gcaacctcca ggtgatctcg ctgggcggca tgggccagta ccgccatgtc gtcaacgaca    284400
     ccggcgcggg cacgtcgggg acggacaccg tgccgtccaa ggtcgtccag ttcccgtgag    284460
     cgacgacgcg ccccgcagcg gtgcggggcg cgtcacccgt ccgggccgga agtccgcgcc    284520
     cctcaggcga gttggacgag aagatcgccg ccctcgacct gctggatgcg gttgatggcg    284580
     agcctggtca ccgtgccgga cttcggggcc gtgatcgacg cctccatctt catcgcctcg    284640
     atggtggcca cggtggcccc ggcctccacc tcgtcgccct cggcgacggc gagggtcacc    284700
     acaccggcga acggcgccgc gacgtggccg gggttcgccc ggtcggcctt ctccgtcacc    284760
     gggacgtcgg tggcggccga ccggtcgcgg acctggatgg ggcggagctg tccgttcagg    284820
     gaggacatca cggtgcgcat gccgcgctcg tcggcgtcgc cgaccgcctg gagttcgatg    284880
     agcagccgga cgccggggtc gaggtcgacc gtgtactcct tgcccgggcg cagcccgtag    284940
     aagaagtcct tgctgtcgag gatgctggtg tcgccgtacg aggcgcggtg ggtgtcgaac    285000
     tcgcgggccg gtcccgggaa cagcagccgg ttgagcgtcg cccggcggtc cttgccgagg    285060
     ccgtcgcggt cgtcctcgga cagctcggcg agcggcctgg cctcggcgcg gccgcgcagc    285120
     gccttgctgc ggaacggctc gggccagccg ccgggcgggg tgcccagctc gccgcgcagg    285180
     aagccgacca cggagtccgg gatgtcgaac cggtcggggt cctgctcgaa gtccgccggg    285240
     gagacaccgg cgcccaccag atgcagggcc aggtcgccga ccaccttgga ggacggggtg    285300
     accttcacca ggcggcccag catccggtcg gcggcggcgt acatggcctc gatgtcctcg    285360
     aagcggtcgc cgaggccgag cgcgacggcc tgggtgcgca ggttggagag ctggccgccg    285420
     ggaatctcgt ggtggtagac ccggccggtc ggggaggcca ggccggcctc gaacggggcg    285480
     tagaccttgc ggacgctctc ccagtacggc tccaggtcgc cgacggcctg gaggtcgagg    285540
     ccggtgggcc gctcggtgtg gtcggtggcg gccacgatcg ccgacagcga cggctgcgaa    285600
     gtggtgcccg ccatggacgc caccgcaccg tcgacggcgt ccgcgcccgc ctggatcgcg    285660
     gccaggtagg tggcgagctg gccgccggtg gtgtcgtggg tgtgcaggtg caccggcagg    285720
     tcgaactccc ggcgcagcgc ggacaccagg gtcgcggcgg ccggtgcgcg cagcagcccg    285780
     gccatgtcct tgacggccag cacgtgcgct ccggcgttca cgatctgctc ggcgagccgc    285840
     aggtagtagt cgagggtgta gagccgctcg gaggggtcgg acaggtcggc ggtgtagcag    285900
     agcgcgacct cggcgacggc gctgccggtc tgccgtacgg cctcgatggc gggccgcatc    285960
     tgctcgacgt cgttgagggc gtcgaagatg cggaagatgt cgatgccggt ggcggcggcc    286020
     tcctgcacga aggcgtcggt cacctcggtc gggtacgggg tgtagcccac ggtgttgcgg    286080
     ccgcgcagca gcatctggag gcagaggttg ggcaccgcct cgcgcagcgc ggctagccgc    286140
     tcccaggggt cctcggcgag gaagcgcagg gcgacgtcgt aggtggcgcc gccccagcac    286200
     tccagggaca gcagctgggg cagggtgcgg gcgacgacgg gcgccacggc gagcatgtcc    286260
     ttggtgcgca cccgggtggc gagcagcgac tggtgggcgt cgcggaaggt ggtgtcggtg    286320
     acgccgatgg tggacgactc gcgcagtcgg cgggcgaacc cctccggccc cagctcggcc    286380
     agcaactggc gggacccggc gggcggttca ccggcggacg ccgtcggcag cttggtcagc    286440
     gggtcgacca gctcggggcg ctcgccgtgc ggcttgttca ccgtgacgtc ggcgaggtag    286500
     gtcagcagct tggtgccgcg gtcggcggag tgccgggcgg tcagcaggtg cgggcgctgt    286560
     tcgatgaacg aggtggtgac ccggccggcc tggaagtcgg ggtcgtccag gaccgcctgg    286620
     aggaagggga tgttggtggc gacgccgcgg atgcggaact cggcgaccgc acgccgggcg    286680
     cggttcaccg cggtggtgaa gtcccgtccc cggcaggaga gcttgaccag catcgagtcg    286740
     aagtgcgcgc tgatctccgt accggcgtgg gtggtaccgc cgtcgagccg gatgccggag    286800
     ccgcccggcg aacggtaggc gctgatctgc ccggtgtccg ggcggaagcc gttggccggg    286860
     tcctcggtgg tgatgcggca ctggagtgcg gcaccgcgca gggtgatgtt ctcctgggcg    286920
     agtccgaggt cggccagcgt ctggccggcg gcgatgcgca gctgggactg gaccaggtcg    286980
     acgtcggtga cctcctcggt gaccgtgtgc tcgacctgga tgcgcgggtt catctcgatg    287040
     aagacgtggt tgccgtcccg gtcgacgagg aactcgacgg tgcccgcgtt gcggtagccg    287100
     atctgccggg cgaagttcac ggcgtcggcg cagatccgct cccgcagggc cgggtcgagg    287160
     ttgggcgcgg gcgccagctc gatcaccttc tggtggcggc gctgcaccga gcagtcccgc    287220
     tcgaagaggt ggatgacgtc gccctcgccg tcggcgagga tctgcacctc gatgtggcgg    287280
     ggttcgacga ccgccttctc caggaagacg gtggagtcgc cgaaggcgga cgcggcctcg    287340
     cgggaggcgg cctcgatggc ctcgcgcagc tgggcgggtt cctcgacgcg gcgcatgccg    287400
     cgcccgccgc cgcccgcgac cgccttgacg aacacgggga agccgacgtc gtcggcggcg    287460
     cgtacgagtt cgtccacgtc ggtggagggc gccgaggagc cgagcacggg tactccggcc    287520
     tcgcgggcgg cggccacggc ccgtgccttg ttgccggtca gttccaggat ccgggcgctg    287580
     ggaccgacga aggtgatccc ggcctcctcg caggcgcggg cgagttcggg gttctcggac    287640
     aggaagccgt agcccgggta gacggcgtcg gcccccgcac ggcgggcggc gcgcacgatc    287700
     tcctccacgg agaggtacgc gcggacggga tgcccctgct ccccgatctc gtaggcctcg    287760
     tcggccttga gccggtgcag cgaattgcgg tcctcgtgcg ggaagacggc gacggtgcgc    287820
     gcgccgagct cgtagcccgc ccgaaacgca cggatcgcga tctcaccgcg gttggcgacc    287880
     agcaccttgc ggaacattct tgatcccttc agcctgccgg gtgacgagac catggtgtcg    287940
     gcgccgccct ccgtacgcca tgtgagccgg gccactcccg gccgcgtcac cgcagggcgg    288000
     cggtcaggcg caggcggatg cggtcgaggc cggccggtgt gcgggagggg gcggcggtga    288060
     tgcagccggg caggccggcc cgggccaggg tgctcagcag cgcccggggg ccgctgtcga    288120
     ggtaggtggt gaatccggcc aggcgcagcg cgcacagcgt ccggtggaag gcgagcggct    288180
     cggagaggtg ggcggccgcc accgtgcgca gctgggccgg ggtgcgggcg ggccccggcg    288240
     cggcggccgt gtacacgggg agcgtgggcg gggcgacggg ctgggcgcgc aggaggcgcc    288300
     ggaaggcccg ctgcacctcg gcgagcaggg ggtggtggta ggcggtgcgg ctggtcagcg    288360
     gggtggcgcg gcggccgagc gcccgggccg cgctccggac ggcggccaac tggtcgtcgg    288420
     gtcccgcaag gacggtctgg ccgggggcgt tgcgggcggc gatccgcacc tgcggcaggc    288480
     cctcggcgcg cagcaggtcg gccgccggct cggcactcag gtcggtggcc agcaggcccg    288540
     ccgccggcag tgcggcgtcg cgcagcagcc ggtcgcggac gtgcagcagc cgcacgccct    288600
     gttcgatcgt gatgaccccg gccacggtga gcgccgcgag gtcgcccacg ctgtggccga    288660
     gcaccgcgtg gacgggcggc gtcgcgagat cgagcaggac ggcggcggag gcgaccacgg    288720
     cggcgtaggt ggccaggtcg aaggcgaggg ggtcggtgcg caggagcagg tcggggtcgg    288780
     gcgcggcgct gtcggtgagg aggcggccga cgggggtgcg ggtggagccg agtgcggtgc    288840
     cgtgggcgtc gaccgtcccc agcacccgcg agaccgacgg gaccccgctc aggtgacgca    288900
     gggcgccggg gaggtaggcc ccctggccgg ggcacatcag cacggtgcgc ggtgtgccgc    288960
     cggtgggggc cggacggtcg tccgtcatga ggcgtcggcg aaggcgagcg cgacgttgtg    289020
     cccgccgaag cccatgctcg tgctgacggc cgcgaggggc ccgcagggca gtgtcgccgg    289080
     gtcgcggccg acgacgttca ggccgatctc ggggtcgacc cgttcgaggc tgcaggccgg    289140
     cggtgccgtt ctgtcccgca gggcgaggac ggtgaggacg gcctcgatgg ctccggcggc    289200
     accgagggtg tgtccgaagg cccccttggt ggcgctgacc gtgacgtcgt ccacgccctt    289260
     ggcgaagacg ctgtgcagcg cctgcgcctc gccgaggtcg ccgagcggtg tggcggtggc    289320
     gtgggcgttg acgtgctgga tctgctccgg cacgagcccc gcgtcgcgca gtgcggcgtc    289380
     gacggccgcc gcgcagcccg gaccgccggg cgccggctgg gccacgtggt ggctgtcgtt    289440
     ggtgatgccc gccccggtga gccggccgtg gacgcgggcg ccgcgggcgg cggcgtgcgc    289500
     ggcgctctcg accacgagca tgccggcgcc ctcccccatc acgaagccgt cccggtcggc    289560
     gtcgaagggc ctggaggccc ccttgggatc gtcgtggcgc cgggagaggg cccgcagccg    289620
     cgcgaacccg gccaggacca gcggatgcag cgcggcctcg gtgccgcccg cgaccacgat    289680
     gtccgcgcgg ccgtcccgga tcatgccgag ggcctgggcg agggcctcgg caccggcggc    289740
     gcaggcactg acgggcgcgt gcaccccggc cttcgcgccc accatgagcc ccacttcggc    289800
     ggccgcgtgg ttgggcagca tgaccgggat ggtgcgcggg ctcacccgcc ccgcgccctg    289860
     cgtccgcagg cggtggtcct gctccaggac gctggtgagg ccgcccagcc ccaccccgac    289920
     gaccacggcc acccgcgacc cgtccccggc gagcgcggac gggtcgggga accccgcgtc    289980
     gcgaacggcc tcgcgggcgg ccacgagggc gaactgcgcc gagcggtcgc agtgcgccgc    290040
     cttggcggac gacaggaccg tcccggggtc gaccgcggcc ggggccgcga ggtacacctg    290100
     tgcgggcccg gccggctcgc cgaagtcgac gcgttcgacg ccgcacccgc cgtccagcag    290160
     ggcccgccag gtggagggga cgtcgccgcc cagcgaggtg gtcagcccca gccccgtgac    290220
     gacggcggcc cgctccccgg gggccgggcc ggccgcgtgt cgtggactca cgcggtgccg    290280
     ccggcggggg cggcgacggc ctcggcgagg tgggcggcga tctgccgcac cgtcgtgagc    290340
     cggtccgcct gctcctgggg gacctcgatc tgccagcggt cctcgatcgc ggcgaccagt    290400
     tccagccggg ccagcgagtc gacgcccagg tcgtcctgga gcgaggagtc ggggccgatc    290460
     tcctccacgg tcaggtcctc gaccgtggcg gcgagcaggt cacgcagctc gtcgagcagc    290520
     tgtcgttcgt cggcggtgga cggcatgtcc ggtacctcct cggtcggtgc acggcgcgcc    290580
     cggaggcggt gggcgggagg acccgttccc cgggcgcgcc ggtggtgtcc ggcgacctgc    290640
     cggtgcacgc ggacaggctg tccggccgtg cggcacggta agcgccgggg gcggagggac    290700
     ggcggagcat cgggagcacg ggacgggctc ctgcgagcac ccgtgtcccc ccttcacctt    290760
     gaagcgcccc ggcgccgacc gagggtggcg ggctgcgggc gcgtaaggga ccggacgggg    290820
     cgaaacgggg cgccgggcat cctcaacgga ctttggcggc tcttttaagg ctttctgaag    290880
     atgaccttcg aacgggcgtt tccacgccgg tcgcgtccta ggctctcgaa caccccccac    290940
     agtcccggtg ggcgcggtcg cgtccaccgg gtacgggggt tccgccagcc gaccgacaag    291000
//

If you have problems or comments...

PBIL Back to PBIL home page