(data stored in ACNUC1104 zone)

EMBL: AL939122

ID   AL939122; SV 1; linear; genomic DNA; STD; PRO; 311000 BP.
XX
AC   AL939122; AL356813; AL359214; AL390968; AL390975; AL391751; AL391754;
AC   AL451182; AL512667; AL590942; AL591857; AL593842; AL596043;
XX
DT   25-OCT-2002 (Rel. 73, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Streptomyces coelicolor A3(2) complete genome; segment 19/29
XX
KW   .
XX
OS   Streptomyces coelicolor
OC   Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
OC   Streptomyces; Streptomyces albidoflavus group.
XX
RN   [1]
RP   1-311000
RA   Bentley S.D.;
RT   ;
RL   Submitted (09-MAY-2002) to the INSDC.
RL   Submitted on behalf of the Streptomyces sequencing team, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail:
RL   sdb@sanger.ac.uk
XX
RN   [2]
RX   DOI; 10.1038/417141a.
RX   PUBMED; 12000953.
RA   Bentley S.D., Chater K.F., Cerdeno-Tarraga A.M., Challis G.L.,
RA   Thomson N.R., James K.D., Harris D.E., Quail M.A., Kieser H., Harper D.,
RA   Bateman A., Brown S., Chandra G., Chen C.W., Collins M., Cronin A.,
RA   Fraser A., Goble A., Hidalgo J., Hornsby T., Howarth S., Huang C.H.,
RA   Kieser T., Larke L., Murphy L., Oliver K., O'Neil S., Rabbinowitsch E.,
RA   Rajandream M.A., Rutherford K., Rutter S., Seeger K., Saunders D.,
RA   Sharp S., Squares R., Squares S., Taylor K., Warren T., Wietzorrek A.,
RA   Woodward J., Barrell B.G., Parkhill J., Hopwood D.A.;
RT   "Complete genome sequence of the model actinomycete Streptomyces coelicolor
RT   A3(2)";
RL   Nature 417(6885):141-147(2002).
XX
DR   MD5; a67c9bb43468dd794322a0c04aab80af.
DR   ENA-CON; AL645882.
DR   BioSample; SAMEA1705940.
DR   RFAM; RF00005; tRNA.
DR   StrainInfo; 166217; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..311000
FT                   /organism="Streptomyces coelicolor"
FT                   /strain="A3(2)"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1902"
FT   CDS_pept        69..1559
FT                   /transl_table=11
FT                   /gene="SCO4935"
FT                   /gene_synonym="SCK13.27"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK13.27, possible integral membrane protein, len:
FT                   496 aa; C-terminal region similar to C-terminal region of
FT                   similar to TR:Q9UX75 (EMBL:Y18930) Sulfolobus solfataricus
FT                   hypothetical 43.0 kDa protein ORF-C10_044, 418 aa; fasta
FT                   scores: opt: 332 z-score: 303.7 E(): 2.2e-09; 27.1%
FT                   identity in 325 aa overlap. Contains 4 possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9AD76"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AD76"
FT                   /protein_id="CAD30925.1"
FT                   /translation="MFFTYLRRELRRRRKAALVVASGLALGIALVIVVDSVSSGMGRAQ
FT                   DKVLQSLYGLGTDMTVTKAAEASSASTAERPRFRFDAQDDGSEEEQSTDRVMVQGFQTL
FT                   ASSTVGKVAGQSGVADAVGGLSLQVVKVSGEFSRGQFTQDASGGAAGGTGQGGGPGGGQ
FT                   SPQGRVQGGGADFDVNSYSVYGTDVTEPALGPLTTSTITSGRTFEESETDARVAVADSA
FT                   YAKEKKLKAGSTVTVKDTKFEIVGIATADSGDAAASLYVPLKQAQTLGDAKDEVTTIYV
FT                   KATDSQRIDGVKSAIQKNISGTTVTTSADLADTVSGSLSTASSLATGVGKWLSIVVLVA
FT                   AFLVAGLLTSSAVSRRVREFGTLKALGWRSGRVTRQVIGEAVVNGLVGGALGIALGLAG
FT                   AYAVTAVSPTLQAQLGGGAGGGGGAGGSGGGFGGGGLGGPGRQAAAKTLDIALTAPVSL
FT                   TTIALAVGLAVAGGLVAGGFGGWRASRLRPADALRRVE"
FT   misc_feature    1311..1388
FT                   /note="glycine amino acids residues rich region. Also high
FT                   in G+C content (88.46%)"
FT   regulatory      1581..1585
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1593..2276
FT                   /transl_table=11
FT                   /gene="SCO4936"
FT                   /gene_synonym="SCK13.28"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="SCK13.28, possible ABC transporter ATP-binding
FT                   protein, len: 227 aa; similar to TR:Q9KRR8 (EMBL:AE004234)
FT                   Vibrio cholerae ABC transporter, ATP-binding protein
FT                   VC1568, 233 aa; fasta scores: opt: 746 z-score: 833.1 E():
FT                   0; 51.1% identity in 223 aa overlap. Contains Pfam match to
FT                   entry PF00005 ABC_tran, ABC transporter and matches to
FT                   Prosite entries PS00017 ATP/GTP-binding site motif A
FT                   (P-loop) and PS00211 ABC transporters family signature"
FT                   /db_xref="GOA:Q9ADK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK4"
FT                   /protein_id="CAC18704.3"
FT                   /translation="MYELSGVTKHYTRGKTTVHALDGVDLTIADGDRLVIQGPTGGGKS
FT                   TLLQMLGALDRPSSGRIVLDGTDLATLPEARLTRVRSESIGFVFQSFNLIPTLTAQENV
FT                   ETALVPLGVKAKERREQAAEALASVGLGERLGHLPGEMSGGQQQRVAIARALVKQPKVL
FT                   LADEPTGNLDESTRDEIMDVLDRMWKELGLTFVMVTHDSAIARKAPRVATIRKGRITVK
FT                   ENASA"
FT   misc_feature    1683..2243
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 194.50, E-value 1.6e-54"
FT   misc_feature    1704..1727
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    2016..2060
FT                   /note="PS00211 ABC transporters family signature"
FT   CDS_pept        complement(2301..2819)
FT                   /transl_table=11
FT                   /gene="SCO4937"
FT                   /gene_synonym="SCK13.29c"
FT                   /product="hypothetical protein"
FT                   /note="SCK13.29c, hypothetical protein, len: 172 aa;
FT                   similar to TR:CAC04235 (EMBL:AL391515) Streptomyces
FT                   coelicolor conserved hypothetical protein SC4B10.30c, 156
FT                   aa; fasta scores: opt: 215 z-score: 274.7 E(): 9.2e-08;
FT                   30.9% identity in 139 aa overlap"
FT                   /db_xref="GOA:Q7ZAI8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ZAI8"
FT                   /protein_id="CAD30926.1"
FT                   /translation="MTTTTDTTTTAEQDGTRSRLPDPTGLYPELTALSAAVQKALRNGP
FT                   VPQATLALTRLRTAQVIGSTYHGVAATDALRKAGEEERRITAVATWQSAPCFTAPERAA
FT                   LELAEAVLTPNPFGDRVSDDLFARLSRHYDTDGIWHLTMALGHFSLFTPVALVGKPVPG
FT                   RPPGKNYTD"
FT   misc_feature    complement(2790..2816)
FT                   /note="high concentration in threonine amino acid residues"
FT   regulatory      complement(2830..2835)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      3001..3006
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3018..3932
FT                   /transl_table=11
FT                   /gene="SCO4938"
FT                   /gene_synonym="SCK13.30"
FT                   /product="putative ECF-sigma factor"
FT                   /note="SCK13.30, possible ECF-sigma factor, len: 304 aa;
FT                   similar to TR:Q9RJS2 (EMBL:AL132707) Streptomyces
FT                   coelicolor putative RNA polymerase sigma factor SCF51.13c,
FT                   298 aa; fasta scores: opt: 1110 z-score: 1299.2 E(): 0;
FT                   58.4% identity in 296 aa overlap. Contains Pfam match to
FT                   entry PF00776 Sigma70_ECF, Sigma-70 factor (ECF subfamily)
FT                   and possible helix-turn-helix motif at residues 144..165
FT                   (+2.59 SD)"
FT                   /db_xref="GOA:Q9EWW4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWW4"
FT                   /protein_id="CAD30927.1"
FT                   /translation="MTTRSAPVTGERRQLINVAYRMLGSLTDAEDAVQEAYARWYAMPA
FT                   DRREAVGSPGAWLTTVVSRVCLNHLRSARVRRELYVGQWLPEPLADPAERTAARTPGIA
FT                   SDPADLITLDESVGMAFLVVLDSMSPAQRVAFVLHDVFRYPFPEVARIVGRTPAACRRL
FT                   ASTARRGIRTAQESAATSTAQDAVVVRDLKRAWETNDVDALIRLLDPEVTAVGDGGGVV
FT                   RTLEHPLRGREPIVRGLLRFGPRQSGQTLLERTVNGRPGLVGCQDGTVVTVYSFGVSDH
FT                   RVRHLWAMRNPEKLRSWATAPAA"
FT   misc_feature    3066..3236
FT                   /note="Pfam match to entry PF00776 Sigma70_ECF, Sigma-70
FT                   factor (ECF subfamily), score 11.30, E-value 0.006"
FT   CDS_pept        complement(3976..4758)
FT                   /transl_table=11
FT                   /gene="SCO4939"
FT                   /gene_synonym="SCK13.31c"
FT                   /product="hypothetical protein SCK31.31c"
FT                   /note="SCK13.31c, unknown, len: 260 aa"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AD74"
FT                   /protein_id="CAD30928.1"
FT                   /translation="MRVRRLGWAGLEIEAGGERMVIDYVRDLSPLFTGWKPGENVAVPG
FT                   GRASAALVTHLHRDHTDASALSEVLTQGAPVLRPAPGHGDDVDNVTTLLAERELVRHRL
FT                   AVEVVDVWSTRDLGPFRVTAVPAVDGLGDPQLNWVVEADGQRILHGGDTMFHGFWWLVA
FT                   RRFSPFDAVFLPANGAVVDAPHLQPPSPVPAALDPRQAAAAAEILDARFAVPIHYEPEQ
FT                   PDKIAGYVEVADPEAEFRAHAGRRAHVLAVGEWLDLAT"
FT   regulatory      complement(4765..4771)
FT                   /regulatory_class="ribosome_binding_site"
FT   stem_loop       complement(4804..4849)
FT                   /note="possible stem loop. Score 60: 20/20 (100%) matches,
FT                   0 gaps"
FT   CDS_pept        4860..5462
FT                   /transl_table=11
FT                   /gene="SCO4940"
FT                   /gene_synonym="SCK13.32"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SCK13.32, possible tetR-family transcriptional
FT                   regulator, len: 200 aa; similar to TR:Q9KZX2
FT                   (EMBL:AL353815) Streptomyces coelicolor putative
FT                   transcriptional regulator SCD6.32c, 200 aa; fasta scores:
FT                   opt: 183 z-score: 230.1 E(): 2.8e-05; 28.3% identity in 159
FT                   aa overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 33..54 (+4.53 SD)"
FT                   /db_xref="GOA:Q8CJS4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:2HYJ"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CJS4"
FT                   /protein_id="CAD55220.1"
FT                   /translation="MSPRRSAAEAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMS
FT                   KSGVHKHFGTKETLQISTLDKAFVDFWHRVVEPALAEPPGLRRLRAVCANSVGYLEEPL
FT                   LPGGCLLTAALSEYDGRPGRVRDAVAEVWSRWREQLRADLTAAVDKGELPAGFDVEQAL
FT                   FEIVAAGLALNAAMQLQHDRTAADRARRAIERALAQS"
FT   misc_feature    4908..5036
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 34.50, E-value
FT                   3.1e-07"
FT   CDS_pept        complement(5466..5783)
FT                   /transl_table=11
FT                   /gene="SCO4941"
FT                   /gene_synonym="2SCK31.01c"
FT                   /product="hypothetical protein"
FT                   /note="2SCK31.01c, hypothetical protein, len: 105 aa;
FT                   similar to TR:Q9KZT7 (EMBL:AL353832) Streptomyces
FT                   coelicolor hypothetical 20.2 kDa protein (fragment)
FT                   SCE6.01c, 183 aa; fasta scores: opt: 191 z-score: 223.2
FT                   E(): 6.8e-05; 41.5% identity in 82 aa overlap"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EWW3"
FT                   /protein_id="CAC21613.2"
FT                   /translation="MTEALTHVIDHEGQGTPATVRLTVLPSGHTRVGVTDPDPRVPPLL
FT                   PGPAGVTDESGRGLALLDAPAPRWGVEQRGDRRAVRCEPAGEPPLDDVRTPAAPAVRSG
FT                   R"
FT   CDS_pept        complement(5964..6644)
FT                   /transl_table=11
FT                   /gene="SCO4942"
FT                   /gene_synonym="2SCK31.02c"
FT                   /product="putative regulatory protein"
FT                   /note="2SCK31.02c, possible regulatory protein, len: 226
FT                   aa; similar to TR:Q9KXX1 (EMBL:AL357432) Streptomyces
FT                   coelicolor putative transcriptional regulator SCD95A.03c,
FT                   199 aa; fasta scores: opt: 414 z-score: 464.7 E(): 2.4e-18;
FT                   38.2% identity in 204 aa overlap. Contains Pfam match to
FT                   entry PF00440 tetR, Bacterial regulatory proteins, tetR
FT                   family"
FT                   /db_xref="GOA:Q9EWE9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041467"
FT                   /db_xref="PDB:2PZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWE9"
FT                   /protein_id="CAD30929.1"
FT                   /translation="MVAYPGPMPRSPSPGQTPDAPTSGGGSTDSTRQRIVAAAKEEFAR
FT                   HGIAGARVDRIAKQARTSKERVYAYFRSKEALYAHVAERETTALIEATQLDPADLPGYA
FT                   GILFDHFAARPDHYRLITWGRLELAESADNTSGPLQATIAGKLDKLRDAQRIGLLDPAW
FT                   DPVDVLALINQIAMTWAGQPEIAAAAADQAVDPSVTARRAALVTAVEHMFPRPDRDQRP
FT                   NRLT"
FT   misc_feature    complement(6402..6542)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 49.20, E-value
FT                   4.1e-11"
FT   regulatory      6753..6757
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6765..7757
FT                   /transl_table=11
FT                   /gene="SCO4943"
FT                   /gene_synonym="2SCK31.03"
FT                   /product="putative oxidoreductase"
FT                   /note="2SCK31.03, probable oxidoreductase, len: 330 aa;
FT                   similar to TR:AAG05923 (EMBL:AE004681) Pseudomonas
FT                   aeruginosa probable oxidoreductase PA2535, 331 aa; fasta
FT                   scores: opt: 1001 z-score: 1136.6 E(): 0; 48.2% identity in
FT                   328 aa overlap. Contains Pfam match to entry PF00248
FT                   aldo_ket_red, Aldo/keto reductase family"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWV3"
FT                   /protein_id="CAC21631.2"
FT                   /translation="MQHRTLGQQGLRVSALGLGVMGMSLAYGPSNDEDGISTIHRAHEL
FT                   GVDFFDTAELYGQGTGSNETLLGNAVNDFRDEVVLATKFGFDMTSKSLGSGVNSRPENI
FT                   REVAENSLRYLRTDRIDLFYQHISDPDVPAEEVAGTVGDLITEGKVRYFGLSNVGPRYI
FT                   RRAHAVTPVTALQYEYSIFEREVEDEILPVVRELGIGLVPYSPLGRGFLSGVVRPAGEY
FT                   PEDDMRRWDERWQGENYAYNLNAAEQLRKLAATKGITPAQLALAWLLAQGEDVVPIPGT
FT                   RSAARLEENVGAIDAELTEADLARIREVIPQGSAGSRYPASMMAGFRTD"
FT   misc_feature    7374..7682
FT                   /note="Pfam match to entry PF00248 aldo_ket_red, Aldo/keto
FT                   reductase family, score 21.20, E-value 4.9e-05"
FT   CDS_pept        complement(7855..8730)
FT                   /transl_table=11
FT                   /gene="SCO4944"
FT                   /gene_synonym="2SCK31.04c"
FT                   /product="putative DNA-binding protein"
FT                   /note="2SCK31.04c, possible DNA-binding protein, len: 314
FT                   aa; similar to TR:Q9RI67 (EMBL:AL109949) Streptomyces
FT                   coelicolor putative DNA-binding protein SCJ11.39c, 279 aa;
FT                   fasta scores: opt: 544 z-score: 640.7 E(): 3.8e-28; 40.2%
FT                   identity in 249 aa overlap. Contains Pfam match to entry
FT                   PF01381 HTH_3, Helix-turn-helix and possible
FT                   helix-turn-helix motif at residues 64..85 (+4.67 SD)"
FT                   /db_xref="GOA:Q9ADL0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADL0"
FT                   /protein_id="CAD30930.1"
FT                   /translation="MDGQLDRRAELSEFLRTRRARLKPEDVGLESYGRQRRVPGLRREE
FT                   LAQLAGVSVAYYTRLEQGNGQNVSAEVLDAIARALRLTDAEQAHLTHLARPKQQRRRAG
FT                   AARGKQPVRVALLQLLDSIDTVPAYVSGRRSEILAWNRMAAALFGDWGKLPAAERNWAR
FT                   LVFLNPDYRELFVDWDQKAYDMVSFLRMDAGRHPDDPRLSALVGELSVKSEEFRRLWAT
FT                   HDVKEKSYGVKRMRHPLVGDLTLSFETFRLVDDDEQAFITYHAEPGSPSADALRLLASW
FT                   GTDAAASLPA"
FT   misc_feature    complement(8470..8643)
FT                   /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix,
FT                   score 25.50, E-value 0.0012"
FT   regulatory      complement(8733..8737)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      8887..8890
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8899..9939
FT                   /transl_table=11
FT                   /gene="SCO4945"
FT                   /gene_synonym="2SCK31.05"
FT                   /product="putative dehydrogenase"
FT                   /note="2SCK31.05, probable dehydrogenase, len: 346 aa;
FT                   highly similar to SW:ADH_MYCTU (EMBL:AL021287)
FT                   Mycobacterium bovis NADP-dependent alcohol dehydrogenase
FT                   AdhC, 346 aa; fasta scores: opt: 1508 z-score: 1698.9 E():
FT                   0; 64.5% identity in 346 aa overlap. Contains Pfam match to
FT                   entry PF00107 adh_zinc, Zinc-binding dehydrogenases and
FT                   matches to Prosite entries PS00059 Zinc-containing alcohol
FT                   dehydrogenases signature and PS00017 ATP/GTP-binding site
FT                   motif A (P-loop)"
FT                   /db_xref="GOA:Q9EWF1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF1"
FT                   /protein_id="CAD30931.1"
FT                   /translation="MTTVAAYAAPAAKAPLERTTIERREVREHDVLIDIKFAGICHSDI
FT                   HQAREGWGEAIFPMVPGHEIAGIVSEVGPGVTRFKVGDRVGVGCMVDSCRECENCKAGR
FT                   EQYCTSGNTGTYNAVGRDGEVTYGGYSEKVVVDENFVLGIPEGIALDEAAPLLCAGITT
FT                   YSPLKRWNAGPGKKVAVVGLGGLGHMAVKLAHALGAEVTVLSQSLRKKDDGLKLGADHY
FT                   YATSDPATFEELSGTFDLIVSTVSAPLDLGAYLGLLKTEGTLANVGAPEEPVSLNLFAL
FT                   LGGGKSLSGSMIGGIAETQEMLDFCAEHGIGAEIELIAASEINEAYERVLSSDVRYRFV
FT                   IDTATI"
FT   misc_feature    8941..9927
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenases, score 372.20, E-value 5.2e-108"
FT   misc_feature    9082..9126
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature"
FT   misc_feature    9736..9759
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   regulatory      10103..10106
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        10116..10907
FT                   /transl_table=11
FT                   /gene="SCO4946"
FT                   /gene_synonym="2SCK31.06"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.06, hypothetical protein, len: 263 aa; highly
FT                   similar to TR:Q9L114 (EMBL:AL159139) Streptomyces
FT                   coelicolor hypothetical 27.0 kDa protein SCL6.02, 255 aa;
FT                   fasta scores: opt: 711 z-score: 830.9 E(): 0; 49.4%
FT                   identity in 253 aa overlap"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF2"
FT                   /protein_id="CAD30932.1"
FT                   /translation="MTYHASTPSTPLLVTGGTGTLGGHVVPLLREAGHDVRVLTRRTRP
FT                   ATGNGITYVTGDLRTGEGVEAAVDGVHTVLHLAGGPKGDDEATRTLVRAAARADVRHLA
FT                   YISVVGADRVPLAWLRTKLESERAIADSGLGWTVLRAAQFHELTLTMIEKMTRLPVLPV
FT                   PGGLRLQPVAAREVAVRLAELTLAEPSGRVPDMTGPEVLDLATLAHSYLDLRGGRRRPK
FT                   LPVRIPGKAGRAYRSGQNLTLEDALVGKVTWTEFLAERAAV"
FT   CDS_pept        11148..14831
FT                   /transl_table=11
FT                   /gene="SCO4947"
FT                   /gene_synonym="narG3"
FT                   /gene_synonym="2SCK31.07"
FT                   /product="nitrate reductase alpha chain NarG3"
FT                   /note="2SCK31.07, narG3, nitrate reductase alpha chain,
FT                   len: 1227 aa; highly similar to SW:NARG_BACSU (EMBL:Z49884)
FT                   Bacillus subtilis nitrate reductase alpha chain (EC
FT                   1.7.99.4)NarG, 1228 aa; fasta scores: opt: 4080 z-score:
FT                   4618.0 E(): 0; 49.5% identity in 1206 aa overlap and to
FT                   TR:O86717 (EMBL:AL031515) Streptomyces coelicolor NarG,
FT                   putative nitrate reductase alpha chain SC5C7.20, 1231 aa;
FT                   fasta scores: opt: 5648 z-score: 5294.1 E(): 0; 66.6%
FT                   identity in 1232 aa overlap. Contains Pfam matches to
FT                   entries PF00384 molybdopterin, Prokaryotic molybdopterin
FT                   oxidoreductases and PF01568 Molydop_binding, Molydopterin
FT                   dinucleotide binding domain and matches to Prosite entries
FT                   PS00551 Prokaryotic molybdopterin oxidoreductases signature
FT                   1 and PS00490 Prokaryotic molybdopterin oxidoreductases
FT                   signature 2"
FT                   /db_xref="GOA:Q9EWF3"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF3"
FT                   /protein_id="CAD30933.1"
FT                   /translation="MADAADRLLKAGQLLRRSPTTLDLRAVYRTDQNVNDRPYRERWAH
FT                   DKVVRSTHGVNCTGSCSWKVYVKDGLITWETQQTDYPSVGPDRPEYEPRGCPRGASFSW
FT                   YTYSPTRVRHPLARGVLVEMYRDAKRRHGGDPVAAWAELTSDPEKRRRYQSARGRGGFV
FT                   RVDWDEALEIAAAAQVHTIAEYGPDRVAGFSPIPAMSMASHAVGARYHSLIGAPMISFY
FT                   DWYADLPIASPQVFGDQTDVPESGDWWDAAYLMLWGSNVPVTRTPDAHWMAEARYRGQK
FT                   VVVVSPDYADATKFADEWLHPHPGTDGALAMAMGHVLLTEFFVRRQVPYFTDYVKRFTD
FT                   LPFLVALDEHAAGRWTPGKFVTAADLGLGRHADAGARAWMPVLIDADTDDVVVPNGTLG
FT                   DRWGKGGEGRWNLDLGGTDPLLTLHGHTGGRGDNGVEVVLPRFDEPGATVVRGVPAREI
FT                   GGRLVTTVYDLLLAQYAVARPGLAGHWPTGYDDAEQPCTPAWQERLTSVPAEAAVRAAR
FT                   EFARTAEQTRGRCMIVMGAGTNHWFHSDTIYRSFLSLLILTGCQGVNGGGWAHYVGQEK
FT                   VRPYTGWQQLSTAADWVRPSRQMAGTPYWYLHTGQWRYESHAADALASPTAPGTLAGLH
FT                   TADLVAQSARLGWMPSYPTFDANPLDLGRRARESGQEPGDWIAEQLGSGAVDFACEDPD
FT                   APRNWPRVLTVWRANLIGSSAKGNEYFLRHLLGARDGATSSEAPPEHRPRSVAWRDDAP
FT                   EGKLDLLLSLDFRMTSTTLFSDLVLPAATWYEKHDLSSTDMHPFVHAFSPAINPPWQAR
FT                   TDFEIFHSLARRLSELAAGRLGTAHDLVATALQHDTPGETAQPGGRVTDWRDGRTPIEP
FT                   GRNAPQVSLVERDYTAVADRLAAFGPLAEEHGMTVKGVTVNPHEESRWLAARCGTAPAG
FT                   PARGRPLLDTDVKFCEAILALSGTTNGRLAAEGFDRLADRVGPGAGLAELAASVGERRV
FT                   VFSDTQERPVQVGASFEWSGKEAPDRRYSPFTVNTEHKKPWHTLTGRQHFYVDHDWMAE
FT                   LGEQLPVYRPPLNLAELGDAPIPTGDGRAVTVRYLTPHAKWSIHSEYQENLLMQTLARG
FT                   GPVVWMSPADADAIGAADNDWVEAVNAHGVVVARAIVSHRVPDGTVLMYHVQERLVNVP
FT                   KSEANGRRGGVHNSLTKLLVKPTHLIGGYGQLSFAPNYYGPTGNQRDAVTTIRRRSQEV
FT                   TY"
FT   misc_feature    11298..11354
FT                   /note="PS00551 Prokaryotic molybdopterin oxidoreductases
FT                   signature 1"
FT   misc_feature    13422..13613
FT                   /note="Pfam match to entry PF00384 molybdopterin,
FT                   Prokaryotic molybdopterin oxidoreductases, score 97.30,
FT                   E-value 9e-31"
FT   misc_feature    13449..13502
FT                   /note="PS00490 Prokaryotic molybdopterin oxidoreductases
FT                   signature 2"
FT   misc_feature    14385..14750
FT                   /note="Pfam match to entry PF01568 Molydop_binding,
FT                   Molydopterin dinucleotide binding domain, score 118.70,
FT                   E-value 1.1e-31"
FT   CDS_pept        14840..16486
FT                   /transl_table=11
FT                   /gene="SCO4948"
FT                   /gene_synonym="narH3"
FT                   /gene_synonym="2SCK31.08"
FT                   /product="nitrate reductase beta chain NarH3"
FT                   /note="2SCK31.08, narH3, nitrate reductase beta chain, len:
FT                   548 aa; highly similar to SW:NARH_BACSU (EMBL:Z49884)
FT                   Bacillus subtilis nitrate reductase beta chain NarH, 487
FT                   aa; fasta scores: opt: 2088 z-score: 2047.9 E(): 0; 58.2%
FT                   identity in 483 aa overlap and to TR:O86716 (EMBL:AL031515)
FT                   Streptomyces coelicolor NarH, putative nitrate reductase
FT                   beta chain SC5C7.19, 531 aa; fasta scores: opt: 2542
FT                   z-score: 2343.2 E(): 0; 71.6% identity in 503 aa overlap"
FT                   /db_xref="GOA:Q9EWF4"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF4"
FT                   /protein_id="CAD30934.1"
FT                   /translation="MAQVAMVMNLDKCIGCHTCSVTCKQTWTNRTGTEYVWFNNVETRP
FT                   GQGYPRGHEDQEKWKGGWHLKGGRLVPRTGGRARRLARLFANPELPTLDDYYQPWTYDY
FT                   ENLTTAPLGDDIPTAPPRSAIDGRPTEITWGPNWDDDLGGGPAQLAADPLLARMSEQVR
FT                   LDYERAFMFYLPRICEHCLNPSCVAVCPSGALYKRVEDGIVLVDQDRCRGWRMCVSGCP
FT                   YKKVYFNHSTGKAEKCTFCYPRIEAGDPTVCSETCVGRLRYLGVMLYDPDKVGAAASVT
FT                   DEKDLYEAQLGCFLDPDDPEVARAAQASGIPHDWVEAARRSPVHALITRYRVALPLHPE
FT                   YRTMPMVWYVPPLSPVVDALTGTGHDGEDPAALFGAIDTLRIPLGYLAELFTAGDPGPV
FT                   EAALCRLAAMRSHMRRVNLGEEQDPRIAEAVGLDEPGILELYRLLALAKYDERYVIPTA
FT                   YTGSVPDPGGTGAGCSLDGVGGPGMMPEGAGGGPGFGEFDPEAFHAPPTAGSGTSSALR
FT                   GRVNLLNWNGKGRPNGLFPRARGAVRTEPEL"
FT   regulatory      16471..16474
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        16483..17145
FT                   /transl_table=11
FT                   /gene="SCO4949"
FT                   /gene_synonym="narJ3"
FT                   /gene_synonym="2SCK31.09"
FT                   /product="nitrate reductase delta chain NarJ3"
FT                   /note="2SCK31.09, narJ3, nitrate reductase delta chain,
FT                   len: 237 aa; similar to SW:NARJ_BACSU (EMBL:Z49884)
FT                   Bacillus subtilis nitrate reductase delta chain (EC
FT                   1.7.99.4) NarJ, 184 aa; fasta scores: opt: 332 z-score:
FT                   411.9 E(): 2.1e-15; 35.0% identity in 163 aa overlap and to
FT                   TR:Q9RI30 (EMBL:AL109989) Streptomyces coelicolor NarJ2
FT                   SCJ12.30 , 267 aa; fasta scores: opt: 436 z-score: 447.2
FT                   E(): 3.3e-19; 41.7% identity in 204 aa overlap"
FT                   /db_xref="GOA:Q9EWF5"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF5"
FT                   /protein_id="CAD30935.1"
FT                   /translation="MSRSLGRAATTTNAPVVFQAAALLLAYPDRDWPRRPHTVRDTVAA
FT                   LPGPEIQLLLSFCDRAEREDPLAVAARYVATFDRSRRRCLYLTYYTDGDTRRRGAALAR
FT                   IKSVYRTHGWLPPDDELPDFLPLMLEFAARTPEAGTALLTEHRAAIEVLRYALEAHRSP
FT                   YAALLQAVGRCLPGRAPASREEALRLTRTGPPTEAVGLDVLGPFPAQPRPHDDGARR"
FT   regulatory      17131..17134
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17142..17855
FT                   /transl_table=11
FT                   /gene="SCO4950"
FT                   /gene_synonym="narI3"
FT                   /gene_synonym="2SCK31.10"
FT                   /product="nitrate reductase gamma chain NarI3"
FT                   /note="2SCK31.10, narI3, nitrate reductase gamma chain,
FT                   len: 237 aa; highly similar to SW:NARI_BACSU (EMBL:Z49884)
FT                   Bacillus subtilis nitrate reductase gamma chain (EC
FT                   1.7.99.4) NarI, 223 aa; fasta scores: opt: 792 z-score:
FT                   991.9 E(): 0; 49.6% identity in 234 aa overlap and to
FT                   TR:Q9RI29 (EMBL:109989) Streptomyces coelicolor putative
FT                   nitrate reductase delta chain NarI2 SCJ12.31, 256 aa; fasta
FT                   scores: opt: 813 z-score: 891.7 E(): 0; 54.3% identity in
FT                   230 aa overlap. Contains possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q9EWF6"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF6"
FT                   /protein_id="CAD30936.1"
FT                   /translation="MRHLHTALWGVLPYLTLVVLVAGTAWRYRYDRFGFTTRSSQLHES
FT                   RLLRIAGPLFHYGLLFVIAGHVAGLLVPESLTDRLHVSEHLYHANALIAGGTAGLATLA
FT                   GLALLLYRRLRTPAIRAATSRSDRVVYPLLLTVVLAGLTATASGATAASTYDYRLGVSV
FT                   WFRSLFALDPDVTAMAQAPLVYRLHALLAMALFALWPYTRLIHAFTAPLGYLVRPYVVY
FT                   RYRGRGEVGAGRPGR"
FT   CDS_pept        complement(17898..18935)
FT                   /transl_table=11
FT                   /gene="SCO4951"
FT                   /gene_synonym="2SCK31.11c"
FT                   /product="putative aldoketoreductase"
FT                   /note="2SCK31.11c, probable aldoketoreductase, len: 345 aa;
FT                   similar to TR:Q9XC70 (EMBL:AF147704) Streptomyces fradiae
FT                   NDP-hexose 2,3-enoyl reductase TylCII, 329 aa; fasta
FT                   scores: opt: 726 z-score: 830.3 E(): 0; 41.3% identity in
FT                   320 aa overlap. Contains 2x Pfam matches to entry PF00248
FT                   aldo_ket_red, Aldo/keto reductase family"
FT                   /db_xref="GOA:Q9ADK9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK9"
FT                   /protein_id="CAD30937.1"
FT                   /translation="MQYRTLGRTGVQVSSLALGAMNFGSIGRTTQDEATAIVDAALEGG
FT                   INLIDTADMYGRGESEEMVGKAIAGRRDDIVLATKANMPMSDEPNHQGSSRRWLVTALD
FT                   NSLRRLGVDHVDLYQIHRWDPATSDEETLSALTDLQRAGKIRYFGSSTFPAYRIVEAQW
FT                   AAREHRLSRYVTEQPSYSLLQRGIESHVLPVTEQYGLGVLVWSPLASGWLSGAVRAGRE
FT                   AATHRSAVLPERFDTALPANRARLDAVEKLAAVADEAGLTLIQLALGFVTAHPAVTAAL
FT                   VGPRTLNHLHSQLAAADTVLSDDVLDAVDAVVAPGTDLAAHEKFDATPALLDPALRRRR
FT                   RPAAG"
FT   misc_feature    complement(18573..18632)
FT                   /note="Pfam match to entry PF00248 aldo_ket_red, Aldo/keto
FT                   reductase family, score 11.80, E-value 0.024"
FT   misc_feature    complement(18711..18854)
FT                   /note="Pfam match to entry PF00248 aldo_ket_red, Aldo/keto
FT                   reductase family, score 1.20, E-value 25"
FT   regulatory      complement(18943..18947)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19080..19676
FT                   /transl_table=11
FT                   /gene="SCO4952"
FT                   /gene_synonym="2SCK31.12"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="2SCK31.12, probable tetR-family transcriptional
FT                   regulator, len: 198 aa; similar to TR:Q9RJL5
FT                   (EMBL:AL121849) Streptomyces coelicolor putative
FT                   tetR-family transcriptional regulator SCF6.16, 194 aa;
FT                   fasta scores: opt: 355 z-score: 451.5 E(): 1.3e-17; 35.1%
FT                   identity in 185 aa overlap. Contains Pfam match to entry
FT                   PF00440 tetR, Bacterial regulatory proteins, tetR family
FT                   and possible helix-turn-helix motif at residues 42..63
FT                   (+4.18 SD)"
FT                   /db_xref="GOA:Q9ADK8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK8"
FT                   /protein_id="CAD30938.1"
FT                   /translation="MKDGEAATGQAASRPKRADARRNEKNLLDAAAAVFVRSGVEAPVR
FT                   DIAAEAGVGTATIYRHFPTRADLIIGVYRHQVEACAEAGPALLASSPTPYAALAGWIDL
FT                   FVDFLVTKHGLAAVLQSDSAGFETLHAYFLDRLVPVCTDLLAAATDSGEIDTDVPPLAL
FT                   MRGVGNLCIGAETPNPSYDARQLVRILIAGLRAAD"
FT   misc_feature    19158..19295
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 54.40, E-value
FT                   1.8e-12"
FT   CDS_pept        19724..19918
FT                   /transl_table=11
FT                   /gene="SCO4953"
FT                   /gene_synonym="2SCK31.13"
FT                   /product="hypothetical protein 2SCK31.13"
FT                   /note="2SCK31.13, unknown, len: 64 aa"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK7"
FT                   /protein_id="CAD30939.1"
FT                   /translation="MLDKFPALTELGQLRVSDGRPHETALVLGSFRRRSNGDWDFVVGG
FT                   KGYSGGLEELLRDFGVEVD"
FT   CDS_pept        complement(19941..20534)
FT                   /transl_table=11
FT                   /gene="SCO4954"
FT                   /gene_synonym="2SCK31.14c"
FT                   /product="hypothetical protein 2SCK31.14c"
FT                   /note="2SCK31.14c, unknown, len: 197 aa"
FT                   /db_xref="InterPro:IPR025633"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK6"
FT                   /protein_id="CAD30940.1"
FT                   /translation="MQQPQREVRAVHTASTVTVYQAYSPEIGLPAIREGRFPAAWKRDR
FT                   MTWIKPSFLWMMYRCGWAAKAGQETVLAVEIGREGFEWALRHACLSSYQPGVHPDRATW
FT                   QREVKRSPTRVQWDPERDLRLQPLPYRSLQLGLAGEAARRYADEWTVAIRDVTPLAHEI
FT                   HGLVRDGDLDAARRLLPREQPYPAAEELLSNLRP"
FT   CDS_pept        complement(20665..21852)
FT                   /transl_table=11
FT                   /gene="SCO4955"
FT                   /gene_synonym="2SCK31.15c"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="2SCK31.15c, hypothetical protein, len: 395 aa;
FT                   similar to TR:Q9X8V7 (EMBL:AL078610) Streptomyces
FT                   coelicolor hypothetical 43.9 kDa protein SCH35.49c, 410 aa;
FT                   fasta scores: opt: 1788 z-score: 1973.1 E(): 0; 63.8%
FT                   identity in 398 aa overlap. Contains match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK5"
FT                   /protein_id="CAD30941.1"
FT                   /translation="MGLALAGAGLATVGTAPAAAGSYDCPSGYFCGWTGESANGSMWKT
FT                   NKSVADLGGWDNKIRSYVNRTTSVACVYEDKNYTPWGGYWAQEPNSPGEYNGDPVATTS
FT                   SVKFVRTERECSQPAYPSWSSETSPKALGFGDLNGDRRADVVTRDEAGRLWFSPGDTTG
FT                   RLIGTGGWNAMSALTRHGDFSRDGREDLIAREASTGKLWLYPGTGTGSLGSRKLIGKSG
FT                   WNAMNRVTAFGDLTGDGRSDLIAVEKATARLWLYPGTSTGTLGARKLIGKSGWNAMNAL
FT                   IGMGDVTGDGRPDLYAREASTGKLWLYPGTSTGTLGSRTLVGTGGWNAMAHFLPVGDFS
FT                   GDGVPDLATVTNEKYVLDGYPGNLGWLVTYRGRGNGFLTSGVPTHGEWWGLNGFV"
FT   misc_feature    complement(21034..21057)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   regulatory      21999..22003
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        22010..22528
FT                   /transl_table=11
FT                   /gene="SCO4956"
FT                   /gene_synonym="2SCK31.16"
FT                   /product="putative peptide methionine sulfoxide reductase"
FT                   /note="2SCK31.16, probable peptide methionine sulfoxide
FT                   reductase, len: 172 aa; similar to SW:PMSR_ECOLI
FT                   (EMBL:M89992) Escherichia coli peptide methionine sulfoxide
FT                   reductase MsrA, 211 aa; fasta scores: opt: 437 z-score:
FT                   538.0 E(): 2e-22; 44.2% identity in 165 aa overlap.
FT                   Contains Pfam match to entry PF01625 PMSR, Peptide
FT                   methionine sulfoxide reductase"
FT                   /db_xref="GOA:Q9EWF7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EWF7"
FT                   /protein_id="CAD30942.1"
FT                   /translation="MAAQTQRAVLAGGCFWGMEELIRRLPGVTATRVGYTGGDVPNATY
FT                   RNHGTHAEAIEILFDPEATDYRALLEFFFQIHDPSTKNRQGNDIGLSYRSAIYYVDDEQ
FT                   KRIAEDTIADVDASGLWPGKVVTEVEPVGPFWEAEPEHQDYLQRYPDGYTCHFPRPGWR
FT                   LPARSGSEG"
FT   misc_feature    22025..22486
FT                   /note="Pfam match to entry PF01625 PMSR, Peptide methionine
FT                   sulfoxide reductase, score 322.70, E-value 4.3e-93"
FT   CDS_pept        complement(22632..23750)
FT                   /transl_table=11
FT                   /gene="SCO4957"
FT                   /gene_synonym="2SCK31.17c"
FT                   /product="putative membrane protein"
FT                   /note="2SCK31.17c, putative membrane protein, len: 372 aa;
FT                   similar to TR:Q9S2T3 (EMBL:AL096884) Streptomyces
FT                   coelicolor hypothetical 40.5 kDa protein SC4G6.25, 376 aa;
FT                   fasta scores: opt: 334 z-score: 393.9 E(): 2.1e-14 34.3%
FT                   identity in 324 aa overlap. Contains possible hydrophobic
FT                   membrane spanning region"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF8"
FT                   /protein_id="CAD30943.1"
FT                   /translation="MEILWVLMALVMLGFVLLQVSRRRRGAVGLVEPGHPDAADPANYG
FT                   FAREEELDIRMPGPDQDLLDVLDLVQRTQDYRGAMQLLAGTEAEGERRWQRVQAFAGAA
FT                   SLELRQRPGGVGETPGGQWLRVWRAEAPKDAGGAAVHAEFLVQQAWRTSTPGSDDFRII
FT                   MEEARAACGEAALLAPGDPVPYIVELSVARGLGYSREEFEQLWLKILDRAPNHMGAHLA
FT                   ALQYWCEKWHGSRQLAYSFAEAAAARAPRGSLLAAMPLFAVFEHLPEVNLVSGFYQSEV
FT                   VTKAVHGALHAVHSARPDDPMQAHVRHLLVFFLVRGERWAEAMNQLTVIDGHVGALPWT
FT                   LSTDPAAEFAVYRALAVAGYEANGGSPATLPH"
FT   CDS_pept        23841..25001
FT                   /transl_table=11
FT                   /gene="SCO4958"
FT                   /gene_synonym="metB"
FT                   /gene_synonym="2SCK31.18"
FT                   /product="cystathionine gamma-synthase"
FT                   /note="2SCK31.18, metB, cystathionine gamma-synthase, len:
FT                   386 aa; highly similar to TR:Q9RQ97 (EMBL:AF126953)
FT                   Corynebacterium glutamicum cystathionine gamma-synthase
FT                   MetB, 396 aa; fasta scores: opt: 1497 z-score: 1715.4 E():
FT                   0; 59.2% identity in 377 aa overlap. Contains Pfam match to
FT                   entry PF01053 Cys_Met_Meta_PP, Cys/Met metabolism
FT                   PLP-dependent enzyme and match to Prosite entry PS00179
FT                   Aminoacyl-transfer RNA synthetases class-II signature 1"
FT                   /db_xref="GOA:Q9EWF9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWF9"
FT                   /protein_id="CAD30944.1"
FT                   /translation="MPMSDRHISQHFETLAIHAGNTADPLTGAVVPPIYQVSTYKQDGV
FT                   GGLRGGYEYSRSANPTRTALEENLAALEGGRRGLAFASGLAAEDCLLRTLLRPGDHVVI
FT                   PNDAYGGTFRLFAKVATRWGVEWSVADTSDAAAVRAALTPKTKAVWVETPSNPLLGITD
FT                   IAQVAQVARDAGARLVVDNTFATPYLQQPLALGADVVVHSLTKYMGGHSDVVGGALIVG
FT                   DQELGEELAFHQNAMGAVAGPFDSWLVLRGTKTLAVRMDRHSENATKVADMLSRHARVT
FT                   SVLYPGLPEHPGHEVAAKQMKAFGGMVSFRVEGGEQAAVEVCNRAKVFTLGESLGGVES
FT                   LIEHPGRMTHASAAGSALEVPADLVRLSVGIENADDLLADLQQALG"
FT   misc_feature    23877..24998
FT                   /note="Pfam match to entry PF01053 Cys_Met_Meta_PP, Cys/Met
FT                   metabolism PLP-dependent enzyme, score 745.00, E-value
FT                   3.3e-220"
FT   misc_feature    24768..24839
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1"
FT   CDS_pept        complement(25012..25269)
FT                   /transl_table=11
FT                   /gene="SCO4959"
FT                   /gene_synonym="2SCK31.19c"
FT                   /product="putative membrane protein"
FT                   /note="2SCK31.19c, possible membrane protein, len: 85 aa.
FT                   Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q9EWG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG0"
FT                   /protein_id="CAD30945.1"
FT                   /translation="MNRPRREAAARRIMEQSPPRVPADLYAEAVRRGGRMLRRRTAARR
FT                   LMWLLLGAAAVAFTVWALTVQPWVEPPSETTPPVTGWEGW"
FT   regulatory      complement(25275..25279)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(25316..25822)
FT                   /transl_table=11
FT                   /gene="SCO4960"
FT                   /gene_synonym="2SCK31.20c"
FT                   /product="putative sigma factor"
FT                   /note="2SCK31.20c, possible sigma factor, len: 168 aa;
FT                   similar to SW:RPOE_STRCO (EMBL:L29636) Streptomyces
FT                   coelicolor RNA polymerase sigma-E factor SigE, 176 aa;
FT                   fasta scores: opt: 108 z-score: 140.1 E(): 2.9; 30.8%
FT                   identity in 156 aa overlap"
FT                   /db_xref="GOA:Q9EWG1"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG1"
FT                   /protein_id="CAD30946.1"
FT                   /translation="MRERHASRNARRAREFEAFVAGAAGRLLHAATLLTAEAPDANPRA
FT                   RRLLALSLAHTYADWDRLHGEDPYDRARQHLATRFARAAWHRYGALGRTRRHPAGPLGG
FT                   LAPQERLLLVLRLYEGVAEEQTAALLGLPVERVRTICDRATAALLRPPPSPARPVTADA
FT                   RAATP"
FT   regulatory      complement(25827..25831)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(26005..26505)
FT                   /transl_table=11
FT                   /gene="SCO4961"
FT                   /gene_synonym="2SCK31.21c"
FT                   /product="putative marR-family transcriptional regulator"
FT                   /note="2SCK31.21c possible marR-family transcriptional
FT                   regulator, len: 166 aa; similar to SW:YXAD_BACSU
FT                   (EMBL:AB005554) Bacillus subtilis hypothetical
FT                   transcriptional regulator in AsnH-GntR intergenic region
FT                   YxaD, 143 aa; fasta scores: opt: 268 z-score: 338.9 E():
FT                   2.4e-11; 35.0% identity in 137 aa overlap. Contains Pfam
FT                   match to entry PF01047 MarR, MarR family and possible
FT                   helix-turn-helix motif at residues 58..79 (+2.70 SD)"
FT                   /db_xref="GOA:Q9EWG2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG2"
FT                   /protein_id="CAD30947.1"
FT                   /translation="MDMTTAGDTGLLETLQHEVALFARRAEQTRLGGVGQVRNSMDRAA
FT                   YLLLNRLDKEGPMGVKALAASMGIDSSTVTRQVAPLVDTGLVKRTSHPEDGRAVVLQLS
FT                   PRGVARLEEVRSSRRQLMAELTHDWAPQERETFCALLARFNGALSARMAPSGVSPTDAP
FT                   SGS"
FT   misc_feature    complement(26074..26385)
FT                   /note="Pfam match to entry PF01047 MarR, MarR family, score
FT                   96.00, E-value 7.4e-25"
FT   regulatory      26668..26671
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        26674..27903
FT                   /transl_table=11
FT                   /gene="SCO4962"
FT                   /gene_synonym="2SCK31.22"
FT                   /product="putative amino acid deaminase"
FT                   /note="2SCK31.22, probable amino acid deaminase, len: 416
FT                   aa; similar to SW:THD2_ECOLI (EMBL:M21312) Escherichia coli
FT                   threonine deaminase TdcB, 409 aa; fasta scores: opt: 899
FT                   z-score: 948.9 E(): 0; 46.0% identity in 309 aa overlap.
FT                   Contains Pfam match to entry PF00291 PALP,
FT                   Pyridoxal-phosphate dependent enzyme and match to Prosite
FT                   entry PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site"
FT                   /db_xref="GOA:Q9EWG3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG3"
FT                   /protein_id="CAD30948.1"
FT                   /translation="MSYSTASCVAPVTLDDVRGAQKMLSGVARVTAMEGSRHLSQLVGS
FT                   PVHLKCENLQRTGSFKLRGAYVRIAGLLPEQRAAGVVAASAGNHAQGVALASSLLGVRS
FT                   TVFMPQGAPLPKISATRDYGAEVRLHGQVVDETLAAAQEYAERTGAVFIHPFDHPDVIA
FT                   GQGTVGLEILEQCPEVRTVVVGIGGGGLAAGIAVAVKALRPDVRIVGVQAEGAAAYPPS
FT                   LAAGRPVAVQNPATMADGIKVGRPGDVPFGIVGELVDEVRTVSEDALSTALLLCLERAK
FT                   LVVEPAGASPVAALLSEPDAFEGPVVAVLSGGNVDPVLMQGVLRHGMAAQGRYLAVRLR
FT                   LTDRPGALATLLGVLSVVDANVLDVSHVRTHPRLGLTEAEVELHLETKGPEHCTEVGRV
FT                   LREAGYTVIA"
FT   misc_feature    26743..27612
FT                   /note="Pfam match to entry PF00291 PALP,
FT                   Pyridoxal-phosphate dependent enzyme, score 254.90, E-value
FT                   1.1e-72"
FT   misc_feature    26827..26868
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site"
FT   regulatory      28054..28057
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28064..29071
FT                   /transl_table=11
FT                   /gene="SCO4963"
FT                   /gene_synonym="2SCK31.23"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="2SCK31.23, possible ABC transporter ATP-binding
FT                   protein, len: 335 aa; similar to TR:CAC08315
FT                   (EMBL:AL392149) Streptomyces coelicolor putative ABC
FT                   transport system ATP-binding protein SCD19A.14, 336 aa;
FT                   fasta scores: opt: 1211 z-score: 1254.5 E(): 0; 58.2%
FT                   identity in 330 aa overlap. Contains Pfam match to entry
FT                   PF00005 ABC_tran, ABC transporter and match to Prosite
FT                   entry PS00017 ATP/GTP-binding site motif A (P-loop) and
FT                   PS00211 ABC transporters family signature"
FT                   /db_xref="GOA:Q9AD75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AD75"
FT                   /protein_id="CAC21637.3"
FT                   /translation="MPGAIYAEGLVKTFGDVRALDGVDLDVPEGTVLGLLGPNGAGKTT
FT                   AVRCLTTLLRPDSGKAVVAGIDVLRQPNEVRRSIGLSGQFAAVDEYLTGRENLHMVGQL
FT                   YQMKGKAAKARAAELLDQFHLSDAADRPTKTYSGGMRRRLDLAAALVVSPPVMFMDEPT
FT                   TGLDPRNRQELWEVIKQLVAGGTTLLLTTQYLEEADHLAHDIAVVDHGRVIARGTSDQL
FT                   KARTGGERVEVVVHDRGRMATASDVLAGFGKGSTTVEEHTRKLTVPVTGGAKLLAEVIR
FT                   ELDVRGIEIDDIGLRRPTLDDVFLSLTGHVAEAADETNGSADDADHEQEKETAK"
FT   misc_feature    28151..28696
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 194.70, E-value 1.4e-54"
FT   misc_feature    28172..28195
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    28469..28513
FT                   /note="PS00211 ABC transporters family signature"
FT   regulatory      29054..29059
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        29068..29925
FT                   /transl_table=11
FT                   /gene="SCO4964"
FT                   /gene_synonym="2SCK31.24"
FT                   /product="putative integral membrane transport protein"
FT                   /note="2SCK31.24, probable integral membrane transport
FT                   protein, len: 285 aa; similar to TR:AAG32069
FT                   (EMBL:AF317791) Streptomyces viridochromogenes hydrophobic
FT                   transmembrane protein AviABCII, 265 aa; fasta scores: opt:
FT                   677 z-score: 786.2 E(): 0; 39.7% identity in 262 aa
FT                   overlap. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q9ADK3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK3"
FT                   /protein_id="CAD30949.1"
FT                   /translation="MSAATDAAPVTASANPIGQSVRDSLVIARRNLIRMTRIPEMVLFG
FT                   IIQPVMFVILFTYVFGGSIKVGSTTDSDVYKDFLMAGIFAQTVTFATAGSAAGIADDMQ
FT                   KGLVDRFRSLPMARGAVLTGRTVADLVQTSITLLVLAIVALLVGWRTGSAEPTNIGRVL
FT                   AGFGLLLLLGYAFTWIGALIGLSVRTPEAATSGGIIWLFPVTFVSNAFVDPTQMTPWLR
FT                   HVAEWNPFSAVVQACRELFGNPGVVQSDAWPMQHPVWATLTYSIVIVLIFRTLAVRKYR
FT                   RAAG"
FT   stem_loop       complement(29968..30014)
FT                   /note="possible stem loop. Score 56: 20/21 (95%) matches, 0
FT                   gaps"
FT   CDS_pept        complement(30027..30524)
FT                   /transl_table=11
FT                   /gene="SCO4965"
FT                   /gene_synonym="2SCK31.25c"
FT                   /product="putative transcription elongation factor"
FT                   /note="2SCK31.25c, probable transcription elongation
FT                   factor, len: 165 aa; similar to SW:GREA_ECOLI (EMBL:X54718)
FT                   Escherichia coli transcription elongation factor GreA
FT                   (transcript cleavage factor), 158 aa; fasta scores: opt:
FT                   265 z-score: 326.5 E(): 1.2e-10; 34.0% identity in 153 aa
FT                   overlap. Contains Pfam match to entry PF01272 GreA_GreB,
FT                   Prokaryotic transcription elongation factor, GreA/GreB and
FT                   match to Prosite entry PS00830 Prokaryotic transcription
FT                   elongation factors signature 2"
FT                   /db_xref="GOA:Q9ADK2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ADK2"
FT                   /protein_id="CAD30950.1"
FT                   /translation="MTQTSENVTWLTQEAYNKLKEELEYLTGPARTEISAKIAAAREEG
FT                   DLRENGGYHAAKEEQGKQELRVRQLTQLLESAKVGEAPAADGVVAPGMVVTIAFDGDED
FT                   DTLTFLLASREYASSDIETYSPQSPLGSGVLGHKVGDDAQYELPNGKPASVRILKAEPY
FT                   NG"
FT   misc_feature    complement(30036..30509)
FT                   /note="Pfam match to entry PF01272 GreA_GreB, Prokaryotic
FT                   transcription elongation factor, GreA/GreB, score 171.50,
FT                   E-value 1.4e-47"
FT   misc_feature    complement(30102..30152)
FT                   /note="PS00830 Prokaryotic transcription elongation factors
FT                   signature 2"
FT   regulatory      complement(30532..30535)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(30705..31103)
FT                   /transl_table=11
FT                   /gene="SCO4966"
FT                   /gene_synonym="2SCK31.26c"
FT                   /product="putative membrane protein"
FT                   /note="2SCK31.26c, possible membrane protein, len: 132 aa;
FT                   similar to TR:O53429 (EMBL:AL021897) Mycobacterium
FT                   tuberculosis hypothetical 15.4 kDa protein MTV017.34c, 144
FT                   aa; fasta scores: opt: 186 z-score: 240.5 E(): 7.4e-06;
FT                   27.9% identity in 136 aa overlap. Contains possible
FT                   hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q9ADK1"
FT                   /db_xref="InterPro:IPR025443"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADK1"
FT                   /protein_id="CAD30951.1"
FT                   /translation="MSTASTRTPQGRYGRSSDEQADRTLKIVGAVLGALLLALIGWFGY
FT                   HYVGQNKISGELIGFELAEDSVQVHLEVRKDAGVTGYCTVRSQAEDGDEVGRADFRFDG
FT                   DDTRIDKVVTLRTKAAGTTAELLGCHPE"
FT   regulatory      complement(31110..31113)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      31222..31225
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        31234..32115
FT                   /transl_table=11
FT                   /gene="SCO4967"
FT                   /gene_synonym="2SCK31.27"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.27, conserved hypothetical protein, len: 293
FT                   aa; highly similar to TR:O53430 (EMBL:AL021897)
FT                   Mycobacterium tuberculosis hypothetical 32.7 kDa protein
FT                   MTV017.35, 288 aa; fasta scores: opt: 992 z-score: 1173.4
FT                   E(): 0; 52.3% identity in 287 aa overlap"
FT                   /db_xref="GOA:Q9ADK0"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017811"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ADK0"
FT                   /protein_id="CAD30952.1"
FT                   /translation="MTDQLRLMAVHAHPDDESSKGAATMAKYVSEGVDVLVVTCTGGER
FT                   GSILNPKLQGDAYIEENIHEVRRKEMDEAREILGVGQEWLGFVDSGLPEGDPLPPLPEG
FT                   CFALEDVDKAAGELVRKIRSFRPQVITTYDENGGYPHPDHIMTHKITMVAFEGAADTEK
FT                   YPESEYGTAYQPLKVYYNQGFNRPRTEALHHALLDRGLESPYEDWLKRWSEFERKERTL
FT                   TTHVPCADFFEIRDKALIAHATQIDPEGGWFRVPMEIQKEVWPTEEYELAKSLVETSLP
FT                   EDDLFAGIRDNA"
FT   CDS_pept        32117..32344
FT                   /transl_table=11
FT                   /gene="SCO4968"
FT                   /gene_synonym="2SCK31.28"
FT                   /product="putative membrane protein"
FT                   /note="2SCK31.28, possible membrane protein, len: 75 aa.
FT                   Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q9EWG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG4"
FT                   /protein_id="CAD30953.1"
FT                   /translation="MSASASLAMTHLVTLAELDEDKVTPGVLGFIVFAVMALAVWGLMK
FT                   SMNRHMGKVDFKEPAEQDASAGPEAKPQRG"
FT   CDS_pept        complement(32381..35884)
FT                   /transl_table=11
FT                   /gene="SCO4969"
FT                   /gene_synonym="2SCK31.29c"
FT                   /product="putative regulatory protein"
FT                   /note="2SCK31.29c, possible regulatory protein, len: 1167
FT                   aa; similar in its middle domain to SW:AFSR_STRCO
FT                   (EMBL:D90155) Streptomyces coelicolor regulatory protein
FT                   AfsR, 993 aa; fasta scores: opt: 298 z-score: 279.4 E():
FT                   5e-08; 28.9% identity in 806 aa overlap. Contains 5x Pfam
FT                   matches to entry PF00515 TPR, TPR Domain"
FT                   /db_xref="GOA:Q9EWG5"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG5"
FT                   /protein_id="CAD30954.1"
FT                   /translation="MGLLPSQISGCGHRGQERNSSIFPAGADPPPQGLLVAGHLTRAQP
FT                   GKDPGMGRKGPWDAWGHGGARGDPAGHRCRRRGRDMRDSHRAEAEGLLRRAVEEEVRRS
FT                   GGRTDGNVLLSRARAALDAMAGTAGEEYSAYTHALDEAAAGQLTFRQRYAREGAGTPLL
FT                   VAAVAAVAAAVADVALGTGTGTAVGAGVTVGVVGAAATVVKVVGAHVPAAHHRAGAVSQ
FT                   PGGPEQLRLQWLTALEVRGIRPFLDQQRMLAASTGPAKTGPKLRGADKSAAARGRSALE
FT                   QSFGQLPEPGDAFAGRRAEMARLRQWVQAARASTETKPTVVVLHGAPGSGRTTLAVRAV
FT                   HELRDYFRGACLVDLRGAGSAAGGSTAGGGGSGGPGPAGSVEGGESPLSTRDALLHLLN
FT                   RLGAPREQLLFRERSSADQQVKRLSELYHQHLTGVPVTVVLDDASDPEQVCTLVPERSD
FT                   SLVLVTARQALRLPPDLPARVYDLPVEALDAAGAEELLGAAAEDASGPYDAESSEQIRQ
FT                   LCGGLPLALRVAGSSLGPRSPRALATDLAAYGPVEPVERALWLRYTDQSEPARRLLRRL
FT                   ALAGRTSLGAAAAAALLATDETEANRQLAALSRAGLLDHVRGSRYRLHDVVRAFARARL
FT                   ADEEEPGERTAAQERLIANYAELADSVLRLVDGNMSTRSNQFGQYGFTSLDEALRWLDD
FT                   ESSFITATLRHAEGVDQGTVLNLLGALCDYCLLRGDLYRLGEISELAQSVDQGLLVRSV
FT                   QWRTGIAARQLGELDKARTTLASVVDLYRDAHHDAGAARALCSLGITLHHQGNLTDAAA
FT                   KLQEALGLQAAPELATDRAWTLHALAAVQRDRARLAEALELLTESLVLHRAGESVHGQA
FT                   WAHFQLGQLHLRMGDVPGAESDLRVALDLYGRTQDARGEAWALTQLARARLVDGDVSAA
FT                   VEGLRRAETRHRENADARGKAWSIYYLGQALEETGALDQSVRALERSRTMFSRMRDVYG
FT                   LACARHHSARVTRDQRAAQTGSLRNSGFARQLLVDARADFQRIGVGHGEAWTCLELAVV
FT                   DAGNARTPQALALCDEAAALFAGYGDRRGEDWARFLRCTLLPYAAPGGVEIGTAVAQEE
FT                   LTQLSRARHPARDTKLDDYVDAYQLLLERGVQLEAGWQAWRLGMVPGRQAREVMGVAVT
FT                   A"
FT   misc_feature    complement(32933..33034)
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   5.30, E-value 13"
FT   misc_feature    complement(33053..33154)
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   7.10, E-value 8.3"
FT   misc_feature    complement(33173..33274)
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   13.90, E-value 1.5"
FT   misc_feature    complement(33293..33394)
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   3.40, E-value 20"
FT   misc_feature    complement(33413..33514)
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   17.00, E-value 0.45"
FT   misc_feature    complement(34732..34820)
FT                   /note="High G+C content region (89.88%)"
FT   CDS_pept        complement(35887..36039)
FT                   /transl_table=11
FT                   /gene="SCO4970"
FT                   /gene_synonym="2SCK31.30c"
FT                   /product="hypothetical protein 2SCK31.30c"
FT                   /note="2SCK31.30c, unknown, len: 50 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG6"
FT                   /protein_id="CAD30955.1"
FT                   /translation="MKEKPGMCHTGAQRNGVSAAVRDPARNPHGAAGEATQVRVGAHLP
FT                   VASCR"
FT   CDS_pept        36195..37688
FT                   /transl_table=11
FT                   /gene="SCO4971"
FT                   /gene_synonym="2SCK31.31"
FT                   /product="putative dehydrogenase"
FT                   /note="2SCK31.31, possible dehydrogenase, len: 497 aa;
FT                   similar to N-terminal domain of SW:XDH_MOUSE (EMBL:X75129)
FT                   Mus musculus xanthine dehydrogenase/oxidase Xdh, 1335 aa;
FT                   fasta scores: opt: 345 z-score: 361.7 E(): 1.3e-12 31.5%
FT                   identity in 483 aa overlap and to TR:O54050 (EMBL:AJ001013)
FT                   Rhodobacter capsulatus xanthine dehydrogenase (EC
FT                   1.1.1.204) XdhA, 462 aa; fasta scores: opt: 631 z-score:
FT                   669.1 E(): 9.8e-30; 38.2% identity in 495 aa overlap.
FT                   Contains Pfam matches to entries PF00111 fer2, 2Fe-2S
FT                   iron-sulfur cluster binding domains, PF01799 fer2_2,
FT                   [2Fe-2S] binding domain and PF00941 dehydrog_molyb,
FT                   Molybdopterin binding domain in dehydrogenase and match to
FT                   Prosite entry PS00197 2Fe-2S ferredoxins, iron-sulfur
FT                   binding region signature"
FT                   /db_xref="GOA:Q9EWG7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG7"
FT                   /protein_id="CAD30956.1"
FT                   /translation="MVTARITVNGKESPIAPAAPHTTVLDFLRERGLTGTKEGCAEGEC
FT                   GACSVLVARPGVNKPTDWVPVNACLVPVAALDGQEVVTSEGLATVEAPGTPPVLHPVQE
FT                   EMAVRGGSQCGYCTPGFVCSMAAEYYRPDRCAHADPGPDATAAADGAEGGDAEHGPNGF
FT                   DLHALSGNLCRCTGYRPIRDAAFAVGTPTDEDPLARRREQDPPAPVATEYRQDDSAFLR
FT                   RSTLAETLRLLRERPQAVVVAGSTDWGVEVNIRSRRADCVVAVDRLPELRDLRVESDHV
FT                   EIGAALTLTEIERRLDGSVPLLAQLFPQFASRLIRNGATLGGNLGTGSPIGDSPPVLLA
FT                   LEASLVLADADGEREVPLADYFTGYRQSVRRPGELIRAVRVPLPLSPVTAFHKIAKRRF
FT                   DDISSLAVAFALDVEGGTVRKARIGLGGVAATPVRALATEAALEGRPWTTGTAEAAAEV
FT                   LRGEGTPMSDHRASARYRAAMLGQSLLKLYAQTTEAVPS"
FT   misc_feature    36204..36419
FT                   /note="Pfam match to entry PF00111 fer2, 2Fe-2S iron-sulfur
FT                   cluster binding domains, score 37.80, E-value 2.6e-07"
FT   misc_feature    36312..36338
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature"
FT   misc_feature    36441..36755
FT                   /note="Pfam match to entry PF01799 fer2_2, [2Fe-2S] binding
FT                   domain, score 80.70, E-value 3.1e-20"
FT   misc_feature    36834..37682
FT                   /note="Pfam match to entry PF00941 dehydrog_molyb,
FT                   Molybdopterin binding domain in dehydrogenase, score
FT                   220.00, E-value 3.6e-62"
FT   regulatory      37671..37674
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        37685..40105
FT                   /transl_table=11
FT                   /gene="SCO4972"
FT                   /gene_synonym="2SCK31.32"
FT                   /product="putative dehydrogenase"
FT                   /note="2SCK31.32, possible dehydrogenase, len: 806 aa;
FT                   similar to the C-terminal region of SW:XDH_MOUSE
FT                   (EMBL:X75129) Mus musculus xanthine dehydrogenase/oxidase
FT                   Xdh, 1335 aa; fasta scores: opt: 1456 z-score: 1610.8 E():
FT                   0; 43.3% identity in 767 aa overlap. Contains Pfam match to
FT                   entry PF01315 Ald_Xan_dh_C, Aldehyde oxidase and xanthine
FT                   dehydrogenase, C terminus"
FT                   /db_xref="GOA:Q9EWG8"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG8"
FT                   /protein_id="CAD30957.1"
FT                   /translation="MSHLSERPEKPVVGVSMPHESAVQHVTGAALYTDDLVQRTKDVLH
FT                   AYPVQVMKARGRVTALRTGAALAVPGVVRVLTGADVPGVNDAGMKHDEPLFPDEVMFHG
FT                   HAVAWVLGETLEAARIGAAAVEVDLEELPSVITLQDAIAADSYHGARPVMTHGDVDAGF
FT                   ADSAHVFTGEFQFSGQEHFYLETHAALAQVDENGQVFIQSSTQHPSETQEIVSHVLGVP
FT                   AHEVTVQCLRMGGGFGGKEMQPHGFAAIAALGAKLTGRPVRFRLNRTQDLTMSGKRHGF
FT                   HATWKIGFDTEGRIQALDATLTADGGWSLDLSEPVLARALCHIDNTYWIPNARVAGRIA
FT                   RTNTVSNTAFRGFGGPQGMLVIEDILGRCAPRLGVDAKELRERNFYRPGQGQTTPYGQP
FT                   VTQPERIAAVWQQVQDNGHIADREREIAAFNAAHPHTKRALAVTGVKFGISFNLTAFNQ
FT                   GGALVLIYKDGSVLINHGGTEMGQGLHTKMLQVAATTLGIPLHKVRLAPTRTDKVPNTS
FT                   ATAASSGADLNGGAVKNACEQLRERLLRVAASQLGTNASDVRIVEGVARSLGSDQELAW
FT                   DDLVRTAYFQRVQLSAAGYYRTEGLHWDAKSFRGSPFKYFAIGAAATEVEVDGFTGAYR
FT                   IRRVDIVHDVGDSLSPLIDIGQVEGGFVQGAGWLTLEDLRWDTGDGPNRGRLLTQAAST
FT                   YKLPSFSEMPEEFNVTLLENATEEGAVFGSKAVGEPPLMLAFSVREALRQAAAAFGPRG
FT                   TAVELASPATPEAVYWAIESARQGGTAGDGRTHGAAASDAVAVRTGVEALSGA"
FT   misc_feature    37763..39796
FT                   /note="Pfam match to entry PF01315 Ald_Xan_dh_C, Aldehyde
FT                   oxidase and xanthine dehydrogenase, C terminus, score
FT                   826.40, E-value 2.5e-249"
FT   CDS_pept        40107..40928
FT                   /transl_table=11
FT                   /gene="SCO4973"
FT                   /gene_synonym="2SCK31.33"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.33, conserved hypothetical protein, len: 273
FT                   aa; similar to TR:Q9RYX5 (EMBL:AE001862) Deinococcus
FT                   radiodurans conserved hypothetical protein DRA0179, 274 aa;
FT                   fasta scores: opt: 888 z-score: 1076.8 E(): 0; 52.4%
FT                   identity in 271 aa overlap"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWG9"
FT                   /protein_id="CAD30958.1"
FT                   /translation="MTWIAAVARLRARREPGVLVTVATVRGHAPRDAGAKLVVGRTGTW
FT                   GSIGGGNVEAVAVDRAREMIAAAAPEPEMLDFALNDKVTNRHGVQCCGGTVAVLLEPLP
FT                   VVRAVAVFGVGHVGLELARILARQDIDLHLVDSRAELLTEERLGVLSDAVAQVHTHHTP
FT                   LLPEEVLAELPPGTHVLIMTHDHAEDAALCDAALRTDHLGSIGLIGSAAKWARFRKRLA
FT                   GEGDHDDALIDRIKTPIGLADITGKEPATIAVSVAADLLRTFEADFEADRP"
FT   regulatory      41110..41115
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41121..41624
FT                   /transl_table=11
FT                   /gene="SCO4974"
FT                   /gene_synonym="2SCK31.34"
FT                   /product="putative deaminase"
FT                   /note="2SCK31.34, possible deaminase, len: 167 aa; similar
FT                   to TR:AAG05887 (EMBL:AE004677) Pseudomonas aeruginosa
FT                   probable deaminase PA2499, 151 aa; fasta scores: opt: 299
FT                   z-score: 372.9 E(): 3.1e-13; 36.6% identity in 123 aa
FT                   overlap. Contains Pfam match to entry PF00383
FT                   dCMP_cyt_deam, Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /db_xref="GOA:Q9ADJ9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADJ9"
FT                   /protein_id="CAD30959.1"
FT                   /translation="MTTDTLETGIREFERAWMDKAIELATTSVRNGGGPFGALIAKGGE
FT                   IVALGNNQVTAGLDPTAHAEVSAIRAACKALDTFSLEGCTLVTSCEPCPMCLSSALWAR
FT                   VDRLVFSADRHDAAVAGFDDRKFYDLFEKRPQANWPMTVEHLDLPHRTQPFDAWIAKTD
FT                   RVDY"
FT   misc_feature    41205..41444
FT                   /note="Pfam match to entry PF00383 dCMP_cyt_deam, Cytidine
FT                   and deoxycytidylate deaminase zinc-binding region, score
FT                   92.90, E-value 6.4e-24"
FT   CDS_pept        41702..43762
FT                   /transl_table=11
FT                   /gene="SCO4975"
FT                   /gene_synonym="2SCK31.35"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.35, conserved hypothetical protein, len: 680
FT                   aa; similar to SW:YYAL_BACSU (EMBL:D26185) Bacillus
FT                   subtilis hypothetical 78.8 kDa protein in TetB-ExoA
FT                   intergenic region YyaL, 689 aa; fasta scores: opt: 1541
FT                   z-score: 1751.9 E(): 0; 39.2% identity in 683 aa overlap.
FT                   Contains match to Prosite entry PS00133 Zinc
FT                   carboxypeptidases, zinc-binding region 2 signature"
FT                   /db_xref="GOA:Q9EWH0"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWH0"
FT                   /protein_id="CAD30960.1"
FT                   /translation="MRKDGGMPNRLAQATSPYLLQHAENPVDWWPWEAEAFEEARRRGV
FT                   PVLLSVGYSACHWCHVMAHESFEDGPTAEYLNSHFVSVKVDREERPDVDAVYMEAVQAA
FT                   TGQGGWPMTVFLTPDAEPFYFGTYFPPEPRHGMPSFRQVLQGVQQAWAERRDEVDEVAG
FT                   KIVRDLAGREISYGDAEAPGEEQLGQALLGLTREYDERRGGFGGAPKFPPSMVIEFLLR
FT                   HHARTGAEGALQMAADTCERMARGGIYDQLGGGFARYSVDREWVVPHFEKMLYDNALLC
FT                   RVYAHLWRATGSDLARRVALETADFMVRELRTAEGGFASALDADSDDGTGKHVEGAHYV
FT                   WTPAQLTEVLGAEDAELAAQYFGVTQEGTFEHGASVLQLPQQESVFDAARIASVRERLL
FT                   AARDGRPAPGRDDKVVAAWNGLAVAALAETGAYFERPDLVEAAVAAADLLVRLHLDEQV
FT                   RLTRTSKDGRAGANAGVLEDYADVAEGFLALASVTGEGVWLDFAGFLLDHVLTRFTDES
FT                   GSLYDTAADAERLIRRPQDPTDNATPSGWSAAAGALLSYAAHTGSAPHRAAAERALGVV
FT                   KALGPRVPRFIGWGLAAAEALLDGPREVAVVAPDPADPAARGLHRTALLGTAPGAVVAF
FT                   GTEGSDEFPLLADRPLVGGAPAAYVCRNFTCDAPTTDPDRLRTALGVAPTG"
FT   regulatory      41714..41718
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    41765..41797
FT                   /note="PS00133 Zinc carboxypeptidases, zinc-binding region
FT                   2 signature"
FT   CDS_pept        complement(43773..44501)
FT                   /transl_table=11
FT                   /gene="SCO4976"
FT                   /gene_synonym="2SCK31.36c"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK31.36c, conserved hypothetical protein, len: 242
FT                   aa; similar to TR:O53776 (EMBL:AL021942) Mycobacterium
FT                   tuberculosis hypothetical 28.5 kDa protein MTV039.17, 252
FT                   aa; fasta scores: opt: 509 z-score: 573.9 E(): 2e-24; 42.3%
FT                   identity in 241 aa overlap. Contains Pfam match to entry
FT                   PF01927 DUF82, Protein of unknown function DUF82"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWH1"
FT                   /protein_id="CAD30961.1"
FT                   /translation="MNGPEIHVEFAPELHLFVPRARPTGVASAATDGVSTLGHLVESLG
FT                   VPLTEVGALLVDGREVPPGHIPAGGESVRVRPVRHPQRVPGAPLRFLLDVHLGTLARRL
FT                   RLLGVDTAYESTDLGDPALAALSAAEKRVLLSRDRGLLRRRELWAGAYVYSTRPEEQLQ
FT                   EVLDRFRPALSPWTRCTACNGLLRTATKEEVAEQLEGGTRRSYDVFAQCTACGRAYWRG
FT                   AHHEQLEAIVERAVSSTRDA"
FT   misc_feature    complement(43791..44237)
FT                   /note="Pfam match to entry PF01927 DUF82, Protein of
FT                   unknown function DUF82, score 137.90, E-value 1.9e-37"
FT   CDS_pept        complement(44535..45242)
FT                   /transl_table=11
FT                   /gene="SCO4977"
FT                   /gene_synonym="2SCK31.37c"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="2SCK31.37c, probable tetR-family transcriptional
FT                   regulator, len: 235 aa; similar to SW:TCMR_STRGA
FT                   (EMBL:M80674) Streptomyces glaucescens tetracenomycin C
FT                   transcriptional repressor TcmR, 226 aa; fasta scores: opt:
FT                   304 z-score: 354.3 E(): 3.4e-12; 37.2% identity in 218 aa
FT                   overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 46..67 (+5.26 SD)"
FT                   /db_xref="GOA:Q9EWH2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="PDB:2OF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EWH2"
FT                   /protein_id="CAD30962.1"
FT                   /translation="MTAARSAPSPAGAPRPGLRERKKTRTREAIRAATYGLIRQQGYEA
FT                   TTVEQIAERAEVSPSTVLRYFPTREDIVLTDEYDPVMAAELAARPAGEPWSDSLRHVLR
FT                   KALGLGAGEEAELIRLRTRLLAEVPAVRARMLENMSDTGRMLARAIADRTGLDPDGLEV
FT                   RIVSMSLVGGLMEVSRYWAEHDHEESLAELVDRALDALENGLPALRESDRESDREGDRG
FT                   GHREDRREGPRKD"
FT   misc_feature    complement(45021..45155)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 53.00, E-value
FT                   3.9e-12"
FT   CDS_pept        complement(45297..46001)
FT                   /transl_table=11
FT                   /gene="SCO4978"
FT                   /gene_synonym="2SCK36.01c"
FT                   /product="putative integral membrane protein"
FT                   /note="2SCK36.01c, conserved hypothetical membrane protein,
FT                   len: 234 aa; similar to SW:YA85_MYCTU (EMBL:AL021897)
FT                   Mycobacterium tuberculosis hypothetical 26.0 kDa protein
FT                   RV1085c or MTV017.38c, 242 aa; fasta scores: opt: 563
FT                   Z-score: 653.6 bits: 128.3 E(): 8.6e-29; 39.524% identity
FT                   in 210 aa overlap. Contains possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q93JL6"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL6"
FT                   /protein_id="CAC40591.1"
FT                   /translation="MTASVPDAPRDLPAGGRGPVTLSLPHPVKPKLRGWLHLGMFPAVL
FT                   VAGLVLTALAETSEARIACGVYVLTACLLFGVSALYHRGDWSPRMDGVLRRLDHANIFL
FT                   IIAGTYTPLTMLLLPGAKGEWLLWGIWAAAAAGIVFRVFWVGAPRWLYTPCYLAMGWAA
FT                   VFYLPEFMRAGGVAVLVLVIVGGLLYSAGGVIYGLKRPNPSPRWFGFHEVFHSFTLAAF
FT                   IAHYVGISLVAY"
FT   regulatory      46278..46282
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        46288..48117
FT                   /transl_table=11
FT                   /gene="SCO4979"
FT                   /gene_synonym="2SCK36.02"
FT                   /product="putative phosphoenolpyruvate carboxykinase"
FT                   /note="2SCK36.02, probable phosphoenolpyruvate
FT                   carboxykinase, len: 609 aa; similar to SW:PPCK_CHLLI
FT                   (EMBL:S56812) Chlorobium limicola phosphoenolpyruvate
FT                   carboxykinase [GTP] (EC 4.1.1.32) PckA, 646 aa; fasta
FT                   scores: opt: 2400 Z-score: 2689.0 bits: 507.7 E():
FT                   3.6e-142; 58.361% identity in 598 aa overlap. Contains Pfam
FT                   match to entry PF00821 PEPCK, Phosphoenolpyruvate
FT                   carboxykinase and match to Prosite entry PS00505
FT                   Phosphoenolpyruvate carboxykinase (GTP) signature"
FT                   /db_xref="GOA:Q93JL5"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93JL5"
FT                   /protein_id="CAC40592.1"
FT                   /translation="MARDIAAPPVPTNHQELISWVNEIAELTQPDAVVWCDGSEAEYER
FT                   LCGELVEKGTFRKLDPIKRPNSYYAASDPTDVARVEDRTFICSAKEEDAGPTNHWKDPA
FT                   EMRAIFTGDKGEGGLFRGSMRGRTMYVVPFCMGPLGSPLSALGVEITDSAYVAASMRTM
FT                   TRMGQPVLDELGDEGFFVKAVHSVGAPLEPGQADVPWPCNSTKYISHFPEDREIWSYGS
FT                   GYGGNALLGKKCYALRIASVMARDEGWLAEHMLVLKLTPPTGAPKYVAAAFPSACGKTN
FT                   LAMLEPTISGWTVETIGDDIAWMRFGEDGRLYAINPEAGFFGVAPGTGEHTNANAMKTL
FT                   WGNSVFTNVALTDDGDVWWEGMTEETPAHLTDWKGNDWTPESGTPAAHPNARFTTPAAQ
FT                   CPIIAPEWEDPRGVPISAILFGGRRATAVPLVTESFDWNHGVFLGANVASEKTAAAEGK
FT                   VGELRRDPFAMLPFCGYNMGDYMGHWVDVAKDKDQSKLPKIYYVNWFRKDDAGRFVWPG
FT                   FGENGRVLKWIVERLEGRADGVETPIGVLPTKESLDTDGLDLADADLEFLLSVDKEVWR
FT                   EEAALVPEHLNTFGDHTPAELWDQYRALVRRLG"
FT   misc_feature    46342..48111
FT                   /note="Pfam match to entry PF00821 PEPCK,
FT                   Phosphoenolpyruvate carboxykinase, score 1344.70, E-value
FT                   0"
FT   misc_feature    47104..47130
FT                   /note="PS00505 Phosphoenolpyruvate carboxykinase (GTP)
FT                   signature"
FT   CDS_pept        complement(48400..49350)
FT                   /transl_table=11
FT                   /gene="SCO4980"
FT                   /gene_synonym="2SCK36.03c"
FT                   /product="hypothetical protein 2SCK36.03c"
FT                   /note="2SCK36.03c, unknown, len: 316 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL4"
FT                   /protein_id="CAC40593.1"
FT                   /translation="MSGDGLEGLLAAVHRLTAQRMGPPVCGTAGHGTGHVCLVPPAGAG
FT                   LPGIEEAIGSRFGEPLRLVTGTTTEAAGGSAGLPLRTPFGERIVEMRAWAYGDRWIGCG
FT                   TVRADDADGAVRPVVLVAERADPAAGASAPATWVDGIVAVTGWETARARAVDWPAVEAR
FT                   LGTPLPGDYKRLVEIFGGAGAFDGYLQLQVPDAHDRSTDLVRHTEWLGEWARTHGSRLW
FT                   EPYPVYPAPGGLLQWASTEQADGFYWLTGDPDPDRWPVLAKEDVPDSWERFDGPTGEFV
FT                   HRMLTEPDHPFSTARWFDVHWYQDYGPAAADEGRV"
FT   CDS_pept        complement(49347..50747)
FT                   /transl_table=11
FT                   /gene="SCO4981"
FT                   /gene_synonym="2SCK36.04c"
FT                   /product="putative bifunctional protein"
FT                   /note="2SCK36.04c, possible bifunctional protein, len: 466
FT                   aa; N-terminal region presents low similarity to N-terminal
FT                   region of TR:O14362 (EMBL:Z97992) Schizosaccharomyces pombe
FT                   putative glucan synthase-1 (EC 2.4.1.34) SPBC30D10.17c, 504
FT                   aa; fasta scores: opt: 176 Z-score: 188.3 bits: 44.3 E():
FT                   0.0071; 24.931% identity in 361 aa overlap and C-terminal
FT                   region to C-terminal region of TR:AAK22951 (EMBL:AE005774)
FT                   Caulobacter crescentus oxidoreductase, GFO/IDH/MOCA family
FT                   CC0967, 307 aa; fasta scores: opt: 146 Z-score: 160.2 bits:
FT                   38.4 E(): 0.26; 26.590% identity in 173 aa overlap"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL3"
FT                   /protein_id="CAC40594.1"
FT                   /translation="MSSIHDFATWEPLLRLVRASHPERLAGPGGHVMGQIGLGGWSVPV
FT                   RRPHPAPGRASLVEDMQDEFTAVEAVQAALRAHGRQSVSFMVETRVDGRTALHVVDSGP
FT                   AVEHGLVSPFVGTLVLVEGAVPEPWRRLPEAVPGALPAPSADPALLERTLRERLPDAVG
FT                   ATEAEIAEAQTRLGVTLPDELKALYRVVRARWQDWRGDYAAQERVVDAVGCELLPLDQL
FT                   YVADARSRPCLWQFAATDAAVTAPDAAVQGLVGSPGWIAFGDNGGGDRLALDLTPGPGG
FT                   HTGQVVMIGHEDSIGAGLLAESLTDMVVNGRAEWHPGRDWDRPPVVARLNVLGDDVSAV
FT                   ARPELEVLVLGGREGEPRSLAPLAGLPRLRTLHACPGALADPLEIAGLTRLEYLRLGPE
FT                   EWRVLLDAGAVPRSLLAAHIEVRGEHHPPRIIALANELLSLWDRPLISRTVLEGDLDTD
FT                   RTAQGGAR"
FT   regulatory      complement(50755..50758)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      50923..50929
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50938..51120
FT                   /transl_table=11
FT                   /gene="SCO4982"
FT                   /gene_synonym="2SCK36.05"
FT                   /product="putative membrane protein"
FT                   /note="2SCK36.05, putative membrane protein, len: 60 aa.
FT                   Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q93JL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL2"
FT                   /protein_id="CAC40595.1"
FT                   /translation="MADGGDFYSRDRPREPDPQLREDRPRGGGPEDPHQRGNWPVWAIV
FT                   LAIILVFVVLTVIFG"
FT   CDS_pept        complement(51206..51628)
FT                   /transl_table=11
FT                   /gene="SCO4983"
FT                   /gene_synonym="2SCK36.06c"
FT                   /product="hypothetical protein 2SCK36.06c"
FT                   /note="2SCK36.06c, unknown, len: 140 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL1"
FT                   /protein_id="CAC40596.1"
FT                   /translation="MYEPIRSKSVHSTMAGTTTDFPGRSRDDELDIQLAGHLAALLAVT
FT                   DELRALAPDTGLDAAAERLAEQVTRLRGGQAPVRLQVAATRQEPRPAALHRRAHTLAAR
FT                   ALVVAASRADTAVAILTAERMDAHSAALEPRPLASR"
FT   regulatory      complement(51635..51641)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(51700..52911)
FT                   /transl_table=11
FT                   /gene="SCO4984"
FT                   /gene_synonym="2SCK36.07c"
FT                   /product="putative aminotransferase"
FT                   /note="2SCK36.07c, probable aminotransferase, len: 403 aa;
FT                   similar to many, e.g. TR:O86587 (EMBL:AL031514)
FT                   Streptomyces coelicolor putative aminotransferase
FT                   SC2H4.04c, 402 aa; fasta scores: opt: 1881 Z-score: 2193.7
FT                   bits: 414.8 E(): 1.4e-114; 65.920% identity in 402 aa
FT                   overlap. Contains Pfam match to entry PF00155 aminotran_1,
FT                   Aminotransferase class-I"
FT                   /db_xref="GOA:Q93JL0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JL0"
FT                   /protein_id="CAC40597.1"
FT                   /translation="MQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPAAF
FT                   GFECPPEILEDILRNVSTAHGYGDAKGLLAARRAVVMHNQTLGIETDVEHVFIGNGVSE
FT                   LIVMAMQGLLDDGDEVLVPAPDYPLWTAAVSLSGGTAVHYRCDEQSDWMPDLADVERKI
FT                   TDRTKALVIINPNNPTGAVYDDAMLRGLTDIARRHNLLVCSDEIYDKILYDDATHTPTA
FT                   AIAPDLLTLTFNGMSKAYRVAGYRVGWMSISGPRAHAESYIEGLTILANMRLCANMPGQ
FT                   HGVVAALSGRQTINELVLPGGRLREQRDAAHEALTSIPGVTCVKPKGALYLFPRLDPKV
FT                   FKIKDDRRMVLDLLRQEKIMVVQGTGFNWPEPDHFRVVTLPTAADLREAVDRIGNFLDG
FT                   YSQP"
FT   misc_feature    complement(51715..52896)
FT                   /note="Pfam match to entry PF00155 aminotran_1,
FT                   Aminotransferase class-I, score 99.70, E-value 5.7e-26"
FT   CDS_pept        53145..53999
FT                   /transl_table=11
FT                   /gene="SCO4985"
FT                   /gene_synonym="2SCK36.08"
FT                   /product="hypothetical protein 2SCK36.08"
FT                   /note="2SCK36.08, unknown, len: 284 aa"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK9"
FT                   /protein_id="CAC40598.1"
FT                   /translation="MNKPLLAALATLAVTGVGVAPAAASPAAPAASASPAAPAVRAVSF
FT                   AGTVALSNCSGSVVRLPASEDDDPALVMSNGHCLETGFPAAGEVVVDQPSSRTFGLLNA
FT                   SGTRVGTLRAGKIAYATMTDTDVSLYQLTSTYAQIRGSYGISPLTLDDTRPTAGTAITV
FT                   VSGYWKRTYACNVDGFAYRLKEGEWTWKDSVRYTSACRTIGGTSGSPVVDNATGKVVAV
FT                   NNTGNEDGGRCTDNNPCEVAEDGTVTVREGINYGQQTYRIPACFALDNKLDLSRSGCAL
FT                   PKP"
FT   CDS_pept        complement(54037..55647)
FT                   /transl_table=11
FT                   /gene="SCO4986"
FT                   /gene_synonym="2SCK36.09c"
FT                   /product="putative D-aminoacylase"
FT                   /note="2SCK36.09c, probable D-aminoacylase, len: 536 aa;
FT                   similar to SW:NDAD_ALCXX (EMBL:S80683) Alcaligenes
FT                   xylosoxydans D-aminoacylase (EC 3.5.1.81) Dan, 483 aa;
FT                   fasta scores: opt: 370 Z-score: 413.6 bits: 86.1 E():
FT                   2e-15; 33.647% identity in 532 aa overlap"
FT                   /db_xref="GOA:Q93JK8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK8"
FT                   /protein_id="CAC40599.1"
FT                   /translation="MEELVIRDADVVDGSGGDSYRADVVVDGGRIVSIVKEAAAAGCQR
FT                   PEARRELDAEGLVLSPGFIDMHAHSDLALLRDPDHSAKAAQGVTLEVIGQDGLSYAPVD
FT                   DRTLGEVRRAIAGWNGHGDDVDFDWRSVGEYLDRLDRGIAVNAAYLIPQGTVRALAVGW
FT                   DDREATEAELEHMRRLVAEGLEQGAVGLSSGLTYTPGMYAKDAELTELCRVVASYGGYY
FT                   CPHHRSYGAGALKAYEEMVELTREAGCPLHLAHATMNFGVNKGKAPELLTLLDEALAGG
FT                   ADITLDTYPYTPGCTTLVALLPSWASEGGPEQILKRLADDDTAERIRHHMEVIGSDGSH
FT                   GVPMEWETIEISGTGDPALAEYVGRTVLESARLRGESPWTVARHLLLADRLAPTILQHV
FT                   GHEENVRAIMRHRVHTGGSDGILQGAKPHPRAYGTFPHYLGHYVRELGVLPLEECVAHL
FT                   TSRPAARLRLPDRGLVREGYRADLVLFDPATVAAGSSFDEPRVLPTGIPYVLVDGRFVM
FT                   EDGRRTDVLAGRSVRRVPR"
FT   regulatory      complement(55656..55661)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(55676..56977)
FT                   /transl_table=11
FT                   /gene="SCO4987"
FT                   /gene_synonym="2SCK36.10c"
FT                   /product="putative D-amino acid deaminase"
FT                   /note="2SCK36.10c, possible D-amino acid deaminase, len:
FT                   433 aa; similar to TR:Q45085 (EMBL:AF158699) Burkholderia
FT                   cepacia D-serine deaminase Dsd, 432 aa; fasta scores: opt:
FT                   919 Z-score: 1026.2 bits: 199.0 E(): 1.5e-49; 41.259%
FT                   identity in 429 aa overlap. Contains match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK7"
FT                   /protein_id="CAC40600.1"
FT                   /translation="MALDNGPAGGREALAELAEERVDHRFKGLPPDAYGLTLAELAGQR
FT                   RNLFTGGFTTPVLALSAERLEHNLKLMETYSARHGLAFAPHGKTSMAPQLFHRQIEHGA
FT                   WGITLAVPHQVRVARAFGVQRVFLANELVDAAALRWISAELDADPGFRFVCYADSVRGV
FT                   ELMDAALTDAGAARPLDVVVELAAGAGARTGVRTEAGCAAVADAVAGARTLRLAGVAGY
FT                   EGEVPDADPERVHAWLRRLVALAVDFDRAGRFDGLEEIVLSAGGSAWFDAVADVFAEVP
FT                   GLSLPVLKLLRSGAYVSHDDGHYRELTPFNRVPEEGALEPAFRLWSQVVSRPSPEQAFT
FT                   NAGKRDAAYDLHLPFAQVVRPADGGPERPATGVEVTGLSDQHAWLRTSGEADLAVGDWV
FT                   GAGLSHPCTSFDKWQLIPVAQADGTVVDYIRTFF"
FT   misc_feature    complement(56711..56734)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   regulatory      complement(56982..56986)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      57098..57102
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        57114..58169
FT                   /transl_table=11
FT                   /gene="SCO4988"
FT                   /gene_synonym="2SCK36.11"
FT                   /product="putative carbohydrate kinase"
FT                   /note="2SCK36.11, probable carbohydrate kinase, len: 351
FT                   aa; similar to TR:Q9K6K5 (EMBL:AP001519) Bacillus
FT                   halodurans 2-keto-3-deoxygluconate kinase (EC 2.7.1.45)
FT                   KdgK or BH3724, 317 aa; fasta scores: opt: 578 Z-score:
FT                   638.8 bits: 126.5 E(): 5.7e-28; 38.835% identity in 309 aa
FT                   overlap. Contains Pfam match to entry PF00294 pfkB, pfkB
FT                   family carbohydrate kinase"
FT                   /db_xref="GOA:Q93JK6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK6"
FT                   /protein_id="CAC40601.1"
FT                   /translation="MTVDGPRSTAPDVVDVVALGESMVTFLPSRPGRLADVPSFDRAIG
FT                   GAESNVACVLAAAGHSARWAGRVGADGFGDHLVEAIGAYGVDVSAVRRDPARPTGVYFR
FT                   TAGDRATDAHEVAYYRAGSAASAMSVDTMDLDAIRSGRVLHLSGITPALSAGCLGLMRE
FT                   LTARRPGRPLVSFDVNHRPGLWRDARHGHGPEVLLELARGADLVFVGDDEARDAWGLGG
FT                   PEAVRAALPEPELLVVKQGASGATAFHGTDATSVPALHVDVVAAVGAGDAFAAGFLSAT
FT                   LRGKPVRERLRHGHLWAAAALTVPADLAAPPARGHADRLVALDDTAWGRLRLGPGWTHA
FT                   EEGAEEEVRTP"
FT   misc_feature    57150..58055
FT                   /note="Pfam match to entry PF00294 pfkB, pfkB family
FT                   carbohydrate kinase, score 194.20, E-value 2.1e-54"
FT   regulatory      58150..58156
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        58166..58930
FT                   /transl_table=11
FT                   /gene="SCO4989"
FT                   /gene_synonym="2SCK36.12"
FT                   /product="putative IclR-family transcriptional regulatory
FT                   protein"
FT                   /note="2SCK36.12, probable IclR-family transcriptional
FT                   regulatory protein, len: 254 aa; similar to SW:KDGR_ECOLI
FT                   (EMBL:AE000277) Escherichia coli transcriptional regulator
FT                   KdgR, 263 aa; fasta scores: opt: 420 Z-score: 488.7 bits:
FT                   98.0 E(): 1.3e-19; 30.992% identity in 242 aa overlap.
FT                   Contains Pfam match to entry PF01614 IclR, Bacterial
FT                   transcriptional regulator and possible helix-turn-helix
FT                   motif at residues 20..41 (+3.12 SD)"
FT                   /db_xref="GOA:Q93JK5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK5"
FT                   /protein_id="CAC40602.1"
FT                   /translation="MSQTVDRALSILPLLAEGPADLGRVADRLGVHKSTALRLLRTLHD
FT                   HGFVYRQSDQRYRLGARLISLAQEAMENLDVREIAHPHLVRLNEQVGHTVHLAVHEEDE
FT                   VLYIDKVESRYPVRMYSRIGKPVAITVAAVAKLLLADLPEDERRAVAEQLDYPMYTARS
FT                   TPNADGFLKELAKVREQGWATDLGGHEESINCVAAPIRGADGRVVAAMSVSAPNVVVTA
FT                   DELLTLLPLVRRTADAISGEYSGRTPVKEVTA"
FT   misc_feature    58334..58891
FT                   /note="Pfam match to entry PF01614 IclR, Bacterial
FT                   transcriptional regulator, score 203.80, E-value 2.5e-57"
FT   regulatory      58913..58917
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        58927..59337
FT                   /transl_table=11
FT                   /gene="SCO4990"
FT                   /gene_synonym="2SCK36.13"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK36.13, conserved hypothetical protein, len: 136
FT                   aa; similar to SW:YABJ_BACSU (EMBL:D26185) Bacillus
FT                   subtilis putative regulator of purine biosynthesis YabJ,
FT                   124 aa; fasta scores: opt: 239 Z-score: 301.4 bits: 61.4
FT                   E(): 3.5e-09; 36.641% identity in 131 aa overlap. Contains
FT                   Pfam match to entry PF01042 UPF0076, YjgF family"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK4"
FT                   /protein_id="CAC40603.1"
FT                   /translation="MTDKIALVPATHTVPPAKFSHGVKKGNILQVAGQVGFLPHEEGKA
FT                   PTPAGPTLREQTLQTLANVKAILEEGGASWDDVMMLRVYLTDVDHFAEMNEIYNAYFAE
FT                   QGLTQPPAARTTVYVGLPAGLLIEIDALAVLG"
FT   misc_feature    58957..59331
FT                   /note="Pfam match to entry PF01042 UPF0076, YjgF family,
FT                   score 98.90, E-value 1e-25"
FT   CDS_pept        59458..60936
FT                   /transl_table=11
FT                   /gene="SCO4991"
FT                   /gene_synonym="2SCK36.14"
FT                   /product="putative sugar transport integral membrane
FT                   protein"
FT                   /note="2SCK36.14, probable sugar transport integral
FT                   membrane protein, len: 492 aa; similar to SW:GNTP_BACSU
FT                   (EMBL:J02584) Bacillus subtilis gluconate permease GntP,
FT                   448 aa; fasta scores: opt: 988 Z-score: 1028.7 bits: 199.7
FT                   E(): 1.1e-49; 39.186% identity in 467 aa overlap. Contains
FT                   Pfam match to entry PF02447 GntP_permease, GntP family
FT                   permease and match to Prosite entry PS00017 ATP/GTP-binding
FT                   site motif A (P-loop). Also contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q93JK3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK3"
FT                   /protein_id="CAC40604.1"
FT                   /translation="MSYSSLRLAAAEAPPHTGGLLTLIDGTAGLLTVAAIGIALLLFLI
FT                   IKVRLQPFVALLAVSIAVGLLAGLSVTELFGTVQKSDAVSTIESGMGGILGHVAIIIGL
FT                   GTMLGAILEVSGGAQVLASRLLGLFGEKRAPLAMGLTGLIFGIPVFFDVGIFVLAPIVY
FT                   AAAKRSGKSILLYCLPLLAGLSMTHAFLPPHPGPVAAAGLLNVKLGWIILMGIVCGIPA
FT                   VLAAWVFSAWIGRRIFVPVPQDMVEASEEAKQAVIEEQRKAGVAPNESPVALGTVLGII
FT                   GTPLVLILAATFSSIALDPSTLRSVIEFFGNPFVALTIALLLAYYLLGIRRGWSRKSLE
FT                   TVSTASLKPVGNILLVVGAGGVFGAVLKASGVAQALSDTFNDVGLPVIVLAYLISVVLR
FT                   VAQGSATVAIVTTAGIVAPLLAEGDHSQAFVALVIMAISAGSIFASHVNDGGFWMVAKY
FT                   FGISERDTLKTWTVLESVLSVAGFVVAAVVSLFV"
FT   misc_feature    59542..60930
FT                   /note="Pfam match to entry PF02447 GntP_permease, GntP
FT                   family permease, score 514.40, E-value 8.3e-151"
FT   misc_feature    59950..59973
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        61032..61676
FT                   /transl_table=11
FT                   /gene="SCO4992"
FT                   /gene_synonym="2SCK36.15"
FT                   /product="hypothetical protein 2SCK36.15"
FT                   /note="2SCK36.15, unknown, len: 214 aa. High content of
FT                   alanine and glutamic amino acid residues in C-terminal
FT                   region"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK2"
FT                   /protein_id="CAC40605.1"
FT                   /translation="MEQRRGSTSQPLEGAGFDPAFIPGLTAPVSGEPEDVRRAEDEAEK
FT                   DADAETEESSHSPAADEPPAEDAEDAEEPDAEAPVDGPVFEASDRRAKIVADHRGVRLS
FT                   LDDQACEFRWDEVGAVETETGRFGKRFTVTVHTPDRRWYPIEIEAASRSRFAEWESALD
FT                   EVLDAYFEDGEAESETEAEAVEAAETADTADTAEKDAEDAEGAEEAKARAE"
FT   misc_feature    61551..61673
FT                   /note="high concentration of alanine and glutamic amino
FT                   acid residues"
FT   CDS_pept        61696..63066
FT                   /transl_table=11
FT                   /gene="SCO4993"
FT                   /gene_synonym="2SCK36.16"
FT                   /product="putative metal ion transport protein"
FT                   /note="2SCK36.16, possible metal ion transport protein,
FT                   len: 456 aa; similar to SW:MNTH_SALTY (EMBL:AF161317)
FT                   Salmonella typhimurium manganese transport protein MntH,
FT                   413 aa; fasta scores: opt: 241 Z-score: 273.7 bits: 59.8
FT                   E(): 1.2e-07; 20.824% identity in 437 aa overlap. Contains
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q93JK1"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK1"
FT                   /protein_id="CAC40606.1"
FT                   /translation="MHALLSHRRPWAFLTPMADTTGNTSDAGVSVGADQAPRKSSWRYI
FT                   GPGIVVAATGVGAGDLVATLIAGSNFGYTLLWAAVIGCLVKISLAEACGRWHLATGRTL
FT                   FDGWASIGSWTTWFFAIYAVIWGFVYGAAAMSSSALPLQALFPDVMDLEWWGIACGLVG
FT                   LVFVWFNKYNVFEKVMTVLVGVMFVITVYLAIRVTPNLGDAFAGLLPVLPDEKDSVLNT
FT                   LGLIGGVGGTITLAAYGYWVNAKGWTTTGWMKVMRLDNRVAYATTGIFVVAMLLVGAEL
FT                   LHSANIAIASGDKGLIQLGDILEQEYGTATGKLFLIGFFATSFTSLIGVWHGVSLMFAD
FT                   FLARRRGEREARGDELASGRRERSWAFRAYLLWLTFPPMILLFQDEPFRLIIIYGVLGA
FT                   AFMPFLALTLMWLLNSSRTPREWRNGSLSNGMLAMAGLLFLVLCVKQIWDQPWSEFF"
FT   CDS_pept        63210..64163
FT                   /transl_table=11
FT                   /gene="SCO4994"
FT                   /gene_synonym="2SCK36.17"
FT                   /product="hypothetical protein 2SCK36.17"
FT                   /note="2SCK36.17, unknown, len: 317 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JK0"
FT                   /protein_id="CAC40607.1"
FT                   /translation="MRGHDRQSDHELTGRRSAGDRGPVVRTDRAASTAGQAWSAGDLSP
FT                   HAVSDLQNSAGNAAVAASLAGQRQQHGSQPPVQRMFQKMKNAVSGNRSAAQQEVNVRVG
FT                   EDDIPMTRQGAFYVFRTPQGGRAYIHDVAVVNGVLNDDLTPHVMKYRMGGLALYRGIPR
FT                   HHETWHDVNGGGVIPPLGSGELPDYATNNTSFIPFSPSERVARGSAVATRGMAERNRAE
FT                   YVQGYSRSNENFFVGLVATVVAGPNLDVGFFNGGEVQIRGPVHGFETDHIRMGTDVQEA
FT                   LTGTPGDPREPISENRPNTPNEEQKKEFEKEHGMLP"
FT   CDS_pept        complement(64218..65480)
FT                   /transl_table=11
FT                   /gene="SCO4995"
FT                   /gene_synonym="2SCK36.18c"
FT                   /product="putative membrane protein"
FT                   /note="2SCK36.18c, putative membrane protein, len: 420 aa.
FT                   Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q93JJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JJ9"
FT                   /protein_id="CAC40608.1"
FT                   /translation="MLENERQDPFEDRLGTALRDAGDGFEADRAALVTAGRARGRRALL
FT                   RRRAAVVGGVAGVALAGVGGVLVLPADHPAGPDRSGTASAPSAGDATTAAASFTGDDLL
FT                   HELKGLLPPGTYGEESARGSDHQLGPTAQLVYDDGAGAAAIGMGFARVEPGSAQVRELM
FT                   ACPDHNITPYDDCSSDRLPDGSLLKLYQGYEYPDLRVDTKRWTADLVTAEGQHVSVSEW
FT                   NSPAEKGAPVSREEPPLSTERLRELVTAGVWREVVDAVPKSRKPPRSAAPRTERPEVSG
FT                   KSVGDTLAALLPRKLDVVSRGGQESEYAYVVVDDGRGRSLVQINVQHGMADVAGQLYAD
FT                   GETLPDGTRVATRQGPGEKAGSGVVMWTVDTLRPGPAGFRVVISAFNTGDQNKDATRDA
FT                   PALTMEQLRKIALSGEWDRLR"
FT   CDS_pept        complement(65560..66069)
FT                   /transl_table=11
FT                   /gene="SCO4996"
FT                   /gene_synonym="2SCK36.19c"
FT                   /product="putative RNA polymerase ECF sigma factor"
FT                   /note="2SCK36.19c, probable RNA polymerase ECF sigma
FT                   factor, len: 169 aa; similar to SW:RPOE_STRCO (EMBL:L29636)
FT                   Streptomyces coelicolor RNA polymerase sigma-E factor SigE
FT                   or SCE94.07, 176 aa; fasta scores: opt: 278 Z-score: 347.2
FT                   bits: 70.7 E(): 9.9e-12; 36.527% identity in 167 aa
FT                   overlap. Contains Pfam match to entry PF00776 Sigma70_ECF,
FT                   Sigma-70 factor (ECF subfamily)"
FT                   /db_xref="GOA:Q93JJ8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JJ8"
FT                   /protein_id="CAC40609.1"
FT                   /translation="MRQGRADEYAEFAVARAGHLYRSACLLTAGDTHLAEDLVQETFGR
FT                   LYVRWGRVSRAENPAAYAQTVLTRAFLAHQRRRSSGERATDVFPDLPGAGDGDASLRLT
FT                   LLDALARLPAKDRAVVVLRYWDDRSVEQTADVLGVSSAAVRTRCSRALGRLRELLGEDL
FT                   SEYARP"
FT   misc_feature    complement(65836..66003)
FT                   /note="Pfam match to entry PF00776 Sigma70_ECF, Sigma-70
FT                   factor (ECF subfamily), score 14.20, E-value 0.0028"
FT   CDS_pept        complement(66168..66359)
FT                   /transl_table=11
FT                   /gene="SCO4997"
FT                   /gene_synonym="2SCK36.20c"
FT                   /product="hypothetical protein"
FT                   /note="2SCK36.20c, hypothetical protein, len: 63 aa;
FT                   similar to TR:Q9F3E1 (EMBL:AL450289) Streptomyces
FT                   coelicolor putative AbaA-like protein SC2H2.14, 89 aa;
FT                   fasta scores: opt: 96 Z-score: 150.9 bits: 31.9 E(): 0.86;
FT                   32.787% identity in 61 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JJ7"
FT                   /protein_id="CAC40610.1"
FT                   /translation="MDDITWEEPFCGEGASCFRLGTDATGNAYVAIAGAEDAALTDSRE
FT                   ALRRMILDIKAGKADHLL"
FT   regulatory      complement(66367..66371)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(66371..67222)
FT                   /transl_table=11
FT                   /gene="SCO4998"
FT                   /gene_synonym="2SCK36.21c"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SCK36.21c, hypothetical protein, len: 283 aa;
FT                   similar to TR:Q9XD96 (EMBL:AF106004) Streptomyces
FT                   coelicolor hypothetical 31.8 kDa protein ORF3, 283 aa;
FT                   fasta scores: opt: 815 Z-score: 959.3 bits: 185.4 E():
FT                   8e-46; 45.230% identity in 283 aa overlap. Contains Pfam
FT                   match to entry PF01381 HTH_3, Helix-turn-helix"
FT                   /db_xref="GOA:Q93JJ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q93JJ6"
FT                   /protein_id="CAC40611.1"
FT                   /translation="MPPRTTPTERQRRLGAELRKMRTAAGITADQAAGLLGLDRAKVSN
FT                   IETGIRTISPERLRTLACNCDCSDEAYVEALVRMARPGARGWWERYRGSLSAGLLDIAE
FT                   FEAQATRMRTIHIAHIPGLLQTSDHALELFRAVLPLLPEHEVALRLAYRVERQRVLEGD
FT                   DPPEYVAVVHEAAVRMQFGGPTVARAQLEHLVAVSERPTVRLLVVPFTAGAFPGSGQIF
FT                   NYLEGPVPQLDTVQIDSTHGPEFLSGEAQLAKYRTHLDRMERIALSPQASRDFIRDVAN
FT                   GL"
FT   misc_feature    complement(67007..67171)
FT                   /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix,
FT                   score 36.30, E-value 6.9e-07"
FT   regulatory      complement(67228..67232)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      67425..67429
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        67435..67923
FT                   /transl_table=11
FT                   /gene="SCO4999"
FT                   /gene_synonym="SCK15.01"
FT                   /product="hypothetical protein SCK15.01"
FT                   /note="SCK15.01, hypothetical protein, len: 162 aa; similar
FT                   to TR:CAB7697 (EMBL:AL159178) Streptomyces coelicolor
FT                   hypothetical 16.8 kD protein SCH22A.02c, 160 aa; fasta
FT                   scores: opt: 133 z-score: 165.9 E(): 0.09; 28.9% identity
FT                   in 142 aa overlap"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KYA3"
FT                   /protein_id="CAB92592.1"
FT                   /translation="MPTTRCPAAPTYPADPTPPIPETLAYSLTLPAALASAALARATTR
FT                   EVLRAHGLTDMLDPALQAVGELTAVASQFTESSNYYLTLRYRFSTLRLIAYDSHPRHTS
FT                   PHLATACDTRRRAALRVLACVCRACDGTWGFGEAREPGGGTRMWATLPRASAAAYGAS"
FT   CDS_pept        68306..68614
FT                   /transl_table=11
FT                   /gene="SCO5000"
FT                   /gene_synonym="SCK15.02"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK15.02, conserved hypothetical protein, len: 102
FT                   aa; similar to TR:CAB77311 (EMBL:AL160312) Streptomyces
FT                   coelicolor hypothetical 11.3 kD protein SCD35.27c, 101 aa;
FT                   fasta scores: opt: 465 z-score: 578.9 E(): 9e-25; 72.6%
FT                   identity in 95 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KYA2"
FT                   /protein_id="CAB92593.1"
FT                   /translation="MSFLKFAEAEVKDMAAKLETSGGHMKSASKEMKSADTKQVGHSGL
FT                   ESACDDFADSWDYGFGQLSKITKGVSKFANKAAEEFAELDQKLYDELRKAREEKGEK"
FT   regulatory      68333..68336
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      68603..68607
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        68611..69252
FT                   /transl_table=11
FT                   /gene="SCO5001"
FT                   /gene_synonym="SCK15.03"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.03, possible integral membrane protein, len:
FT                   213 aa; similar to TR:CAB77310 (EMBL:AL160312) Streptomyces
FT                   coelicolor putative integral membrane protein SCD35.26, 198
FT                   aa; fasta scores: opt: 349 z-score: 424.5 E(): 3.6e-16;
FT                   37.4% identity in 182 aa overlap. Contains possible
FT                   hydrophobic membrane spanning regions at C-terminal domain"
FT                   /db_xref="GOA:Q9KYA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KYA1"
FT                   /protein_id="CAB92594.1"
FT                   /translation="MSLRRHLGKLLRATGEDGRPSGSAHAPGSSGETVASFTTEVPWPS
FT                   LRKFAQFAYIAEQYGYRYSGLDPDLRDSGTPFFVFRRLPDAGERAARTRGSFPGAPENG
FT                   RLPGMRAWPLPVLTLPAARSEVKLLLARIVVDYYGALGRQRMRPWLIGIPVVFLLFLLV
FT                   NGELHATGLRVAAGMAVALIVVLTASRVFMRRRRATYRRLLERSGLGPPP"
FT   CDS_pept        complement(69185..69835)
FT                   /transl_table=11
FT                   /gene="SCO5002"
FT                   /gene_synonym="SCK15.04c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK15.04c, conserved hypothetical protein, len: 216
FT                   aa; similar to TR:CAB77308 (EMBL:AL160312) Streptomyces
FT                   coelicolor hypothetical 26.0 kD protein SCD35.24c, 241 aa;
FT                   fasta scores: opt: 613 z-score: 732.4 E(): 0; 52.8%
FT                   identity in 197 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KYA0"
FT                   /protein_id="CAB92595.1"
FT                   /translation="MPGADALERVQSAERMRHSLPMFLDRDDTLVDIAMCLGAERVRDE
FT                   DKLSYGLLVVSVRPSGHDDRLLAAEGIYRAKERLFFTREAEVEELDFALGKGGRGQQDM
FT                   LLAAKLPGGPGVMSASLRTVELRTAGQAASGGEDAAAQKIPMAVLQLICPAPRDYCTYI
FT                   TIATPSVYLLDSYTERLAHIGRTFVFEAPTPLTEAGRAPTAQAAAGTSHGDGA"
FT   misc_feature    complement(69862..71812)
FT                   /note="previously sequenced fragment EMBL:AB017008
FT                   Streptomyces coelicolor gene for ChiA, partial cds."
FT   CDS_pept        complement(69963..71678)
FT                   /transl_table=11
FT                   /gene="SCO5003"
FT                   /gene_synonym="chiA"
FT                   /gene_synonym="SCK15.05c"
FT                   /product="chinitase A precursor"
FT                   /note="SCK15.05c, chiA, chinitase A precursor, len: 571 aa;
FT                   identical to previously sequenced TR:Q9Z9M9 (EMBL:AB017008)
FT                   Streptomyces coelicolor chinitase A precursor ChiA, 571 aa
FT                   and to TR:Q59924 (EMBL:D13775) Streptomyces lividans
FT                   chitinase A precursor (EC 3.2.1.14) ChiA, 571 aa. Contains
FT                   Pfam match to entry PF02018 CBD_6, Cellulose binding
FT                   domain, PF00041 fn3, Fibronectin type III domain, PF00704
FT                   Glyco_hydro_18, Glycosyl hydrolases family 18 and matches
FT                   to Prosite entries PS00678 Trp-Asp (WD) repeats signature
FT                   and PS01095 Chitinases family 18 active site. Contains also
FT                   possible N-terminal region signal peptide sequence"
FT                   /db_xref="GOA:Q9KY99"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY99"
FT                   /protein_id="CAB92596.1"
FT                   /translation="MDPVRRRSRGRRLGSLTGAVTAALALAFTAVGPASAADVNNAKNA
FT                   GFESGLSNWACSANSGTTVASPAHAGSAALKATPAGQDNARCSQSVAVKPNSTYTLSAW
FT                   VQGGYSYLGVTGTGTTDVSTWTPDSTAWKQLKTTFSTGSSTTSVSVYTHGWYGQAAYYV
FT                   DDLSVFGPDGGGGDGGNPDPTVPSAPAGLSVSGTTPNSASLSWNTVSGATGYNVYRDGT
FT                   KVTAVTGTSATVTGLAASTSYSFQVTATNAAGESVKSAAVTARTTAPDDGGNGGDLPKH
FT                   AVTGYWQNFNNGATVQKISDVPSAYDIIAVAFADATTTPGAVTFNLDSAGLGGYTVDQF
FT                   KADVRAKQAAGKKVIISVGGEKGTVSVNSSASATNFANSVYSVMREYGFDGVDIDLENG
FT                   LNPTYMTQALRALSAKAGPDMILTMAPQTIDMQSTQGGYFQTALNVKDILTVVNMQYYN
FT                   SGTMLGCDGKVYAQGTVDFLTALACIQLEGGLAPSQVGLGLPASTRAAGGGYVSPSVVN
FT                   AALDCLTKATNCGSFKPSKTYPDLRGAMTWSTNWDATAGNAWSNSVGAHVHALP"
FT   misc_feature    complement(70488..70514)
FT                   /note="PS01095 Chitinases family 18 active site"
FT   misc_feature    complement(70494..70580)
FT                   /note="Pfam match to entry PF00704 Glyco_hydro_18, Glycosyl
FT                   hydrolases family 18, score 19.40, E-value 3.7e-05"
FT   misc_feature    complement(70902..71123)
FT                   /note="Pfam match to entry PF00041 fn3, Fibronectin type
FT                   III domain, score 64.00, E-value 3.1e-15"
FT   misc_feature    complement(71055..71099)
FT                   /note="PS00678 Trp-Asp (WD) repeats signature"
FT   misc_feature    complement(71166..71564)
FT                   /note="Pfam match to entry PF02018 CBD_6, Cellulose binding
FT                   domain, score 101.70, E-value 1.5e-26"
FT   CDS_pept        71997..72938
FT                   /transl_table=11
FT                   /gene="SCO5004"
FT                   /gene_synonym="SCK15.06"
FT                   /product="hypothetical protein SCK15.06"
FT                   /note="SCK15.06, unknown, len: 313 aa. Contains hydrohilic
FT                   C-terminall region"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY98"
FT                   /protein_id="CAB92597.1"
FT                   /translation="MGDGEPRVPTAIAVTSADLALPPQDERTLPAAVLQDVDRRPLESV
FT                   LAELQTLVDQCGHVIVVCSQAVPASVERRLHTVRALLETDRIALFRPPLPPLGIAVLAR
FT                   QLRQLASCDLSPGVLASAGRLLTHYIHAGALLGSVARLDHVPVGLKAHARSWVPGSQFG
FT                   VVAHPVPQLVRIGPEAALAGPEFGTWLLVAKGQHPTDWVTGSLAPSWHVQGLRETALPA
FT                   ESATWWGTGRLTEFCAYLPDLSVLYQLVTSVRRGTCHWCGIDVIGDRCVFCSATPPVYD
FT                   DGGAGGGGRDRALAPRRDPALGRRRERRALTG"
FT   CDS_pept        73213..73824
FT                   /transl_table=11
FT                   /gene="SCO5005"
FT                   /gene_synonym="SCK15.07"
FT                   /product="hypothetical proten SCK15.07"
FT                   /note="SCK15.07, unknown, len: 203 aa"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY97"
FT                   /protein_id="CAB92598.1"
FT                   /translation="MKSKVGPEVTAYRVKSDIEPYTELGATQFEKVEMPERWLSENAVT
FT                   DLSRVRGKIAVTTLKAGSLLQTDMIVDTPALRPGQQEVAIMIDAATGVAGKITPGSTVN
FT                   VYATFEGPREGDPDQSKIIVTGAKVIDVGELTSLEPDEDSRDREPTDAVPITFALSTID
FT                   AQRITYAESFARRVRLALVAPGGDTTVPDKDRTYELAKDK"
FT   CDS_pept        73832..75088
FT                   /transl_table=11
FT                   /gene="SCO5006"
FT                   /gene_synonym="minD1"
FT                   /gene_synonym="SCK15.08"
FT                   /product="putative septum site-determining protein"
FT                   /note="SCK15.08, minD1, possible septum site-determining
FT                   protein, len: 418 aa; N-terminal domain similar to
FT                   TR:Q9RZD9 (EMBL:AE001862) Deinococcus radiodurans
FT                   DNA-binding response regulator DRA0010, 211 aa; blastp
FT                   scores: Score = 103 (36.3 bits), Expect = 0.0045,
FT                   Identities = 50/194 (25%), Positives = 85/194 (43%) and
FT                   C-terminal domain highly similar to TR:Q9ZF15
FT                   (EMBL:AJ005576) Streptomyces griseus septum
FT                   site-determining protein MinD protein, 396 aa; fasta
FT                   scores: opt: 1230 z-score: 1302.8 E(): 0; 70.5% identity in
FT                   281 aa overlap. Contains Pfam matches to entries PF00072
FT                   response_reg, Response regulator receiver domain and
FT                   PF00991 ParA, ParA family ATPase"
FT                   /db_xref="GOA:Q9KY96"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY96"
FT                   /protein_id="CAB92599.1"
FT                   /translation="MATRILPAVGDPDAVRSLTTLLSQLPEAEPVAPVTDSTQLVDTLA
FT                   RLAAESVDELPEVVIVHERIGPVPALELIREVALRFPAVGVILVTSDPGPGLFQAAMDH
FT                   GARGLVALPLGYEELASRVQAVAQWSAGVRRHLGGAVDVFTGTGGTVVTVSGAKGGVGA
FT                   TLTAVQLALAAQASGRSTALLDMDLQTGDVASYLDVQFRRSVADLAAITDLSPRVLADA
FT                   VFRHDSGLALLLAPGEGERGEEITDRAARQIVGALRSRYEVVVVDCGAQLGGAGAAAVE
FT                   SADTALLVTTPDVVAVRGAKRAVRMWERLQIRKAAETTVVVNRHTRGTEIQPPLIQKIT
FT                   GTAIAATTVPANFKELQGAVDAGRVHELDGRSTVKQALWALAGELGLAGVPDAGRKGHG
FT                   RLKGDRGASGFRRRKDGAG"
FT   misc_feature    73838..74200
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 1.30, E-value 0.0034"
FT   misc_feature    74504..74827
FT                   /note="Pfam match to entry PF00991 ParA, ParA family
FT                   ATPase, score 47.60, E-value 2.7e-10"
FT   CDS_pept        75085..75480
FT                   /transl_table=11
FT                   /gene="SCO5007"
FT                   /gene_synonym="minD2"
FT                   /gene_synonym="SCK15.09"
FT                   /product="putative septum site-determining protein"
FT                   /note="SCK15.09, minD2, possible septum site-determining
FT                   protein, len: 131 aa; similar to C-terminal domain of
FT                   TR:Q9ZF15 (EMBL:AJ005576) Streptomyces griseus septum
FT                   site-determining protein MinD protein, 396 aa; fasta
FT                   scores: opt: 360 z-score: 444.6 E(): 2.7e-17; 47.3%
FT                   identity in 129 aa overlap and to Streptomyces coelicolor
FT                   septum site-determining protein minD3 SCK15.10, 131 aa;
FT                   fasta scores: opt: 177 z-score: 196.8 E(): 2.1e-05; 35.8%
FT                   identity in 109 aa overlap. Contains possible hydrophobic
FT                   membrane spanning region and TTA leucine codon, possible
FT                   target for bldA regulation"
FT                   /db_xref="GOA:Q9KY95"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY95"
FT                   /protein_id="CAB92600.1"
FT                   /translation="MSGLRGRDRARDGGQVTIEFLGMTPVIIATLVVLWQLVLVGYTYT
FT                   LAGNAADEAVRAATAAERGARQGACREAGLDKLPGSWEGGASVGCDAAGGFVTADVRIE
FT                   VPLLFPGTLSLPFTVHGHAGAVEEEDD"
FT   misc_feature    75094..75096
FT                   /gene="none"
FT                   /note="TTA leucine codon. Possible target for bldA
FT                   regulation"
FT   repeat_region   75109..75147
FT                   /note="2x degenerate repeat: RA(G/R)D(R/G)GQV(A/T)IE(Y/F)L"
FT   regulatory      75468..75473
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        75482..75877
FT                   /transl_table=11
FT                   /gene="SCO5008"
FT                   /gene_synonym="minD3"
FT                   /gene_synonym="SCK15.10"
FT                   /product="putative septum site-determining protein"
FT                   /note="SCK15.10, minD3, possible septum site-determining
FT                   protein, len: 131 aa; similar to TR:Q9ZF15 (EMBL:AJ005576)
FT                   Streptomyces griseus septum site-determining protein MinD
FT                   protein, 396 aa; fasta scores: opt: 180 z-score: 224.4 E():
FT                   5e-05; 37.7% identity in 122 aa overlap and to Streptomyces
FT                   coelicolor septum site-determining protein minD2, 131 aa;
FT                   fasta scores: opt: 177 z-score: 189.4 E(): 5.4e-05; 36.4%
FT                   identity in 107 aa overlap. Contains possible hydrophobic
FT                   membrane spanning region"
FT                   /db_xref="GOA:Q9KY94"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY94"
FT                   /protein_id="CAB92601.1"
FT                   /translation="MPYSRRKKPTGTPYRRGARAGDRGQVAIEYLGFLPILVLVGMAAV
FT                   QLGLIAYTAQQAGTAARAGARSASLRESAETACAAAVSSWLADGTDCPASYGGDEVTVT
FT                   ATVEIPSIVPGWEFDPATRTATMPLDH"
FT   repeat_region   75536..75574
FT                   /note="2x degenerate repeat: RA(G/R)D(R/G)GQV(A/T)IE(Y/F)L"
FT   regulatory      75881..75885
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        75896..77233
FT                   /transl_table=11
FT                   /gene="SCO5009"
FT                   /gene_synonym="SCK15.11"
FT                   /product="putative secretory protein"
FT                   /note="SCK15.11, probable secretory protein, len: 445 aa;
FT                   similar to TR:P94647 (EMBL:U77780) Chlorobium limicola
FT                   secretory protein kinase Kbh, 474 aa; fasta scores: opt:
FT                   1192 z-score: 1311.8 E(): 0; 47.7% identity in 396 aa
FT                   overlap, to SW:TRBB_AGRT6 (EMBL:U43675) Agrobacterium
FT                   tumefaciens conjugal transfer protein TrbB, 323 aa; fasta
FT                   scores: opt: 512 z-score: 568.9 E(): 3.2e-24; 30.4%
FT                   identity in 326 aa overlap and to TR:Q9X921 (EMBL:AL035636)
FT                   Streptomyces coelicolor putative secretory protein
FT                   SCH5.19c, 523 aa; fasta scores: opt: 878 z-score: 847.4
FT                   E(): 0; 40.3% identity in 365 aa overlap. Contains Pfam
FT                   match to entry PF00437 GSPII_E, Bacterial type II secretion
FT                   system protein and match to Prosite entry PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9KY93"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY93"
FT                   /protein_id="CAB92602.1"
FT                   /translation="MSLRARIHSPEEHGSRGEDGHLVASYRAKLLEEIDLAEMSALATA
FT                   ERRARLERVLGHIISREGPVLSTVERSQLIRRVVDEALGLGILEPLLEDASITEIMVNG
FT                   PDAIFVERAGRVEQLPLRFASHDQLMQTIERIVSTVNRRVDESNPMVDARLPSGERVNV
FT                   IIPPLSLTGATLTIRRFPRSFTLQELIGLGSLDENMLYLLAGLVQARFNIIVSGATGTG
FT                   KTTLLNALSGLIPESDRIITIEDSAELQLQQAHVIRLESRPPNVEGQGRITIRDLVRNS
FT                   LRMRPDRIVVGEVRGGESLDMLQAMSTGHDGSLATVHANSAEDALMRLQTLASMSDVEI
FT                   PFVALHDQINSSVDVLIQLTRFADGARRITEIALLASHGGEPYRLATVARFNARPMSAD
FT                   GRVVGAYEYHPLPHRTAERLYMAGQPIPQAFGVAHTPDQLTTREAR"
FT   misc_feature    76532..76891
FT                   /note="Pfam match to entry PF00437 GSPII_E, Bacterial type
FT                   II secretion system protein, score 64.70, E-value 1.7e-18"
FT   misc_feature    76544..76567
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        77243..78193
FT                   /transl_table=11
FT                   /gene="SCO5010"
FT                   /gene_synonym="SCK15.12"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.12, possible integral membrane protein, len:
FT                   316 aa; similar to TR:AAF40196 (EMBL:AF229646) Caulobacter
FT                   crescentus hypothetical 34.6 kD protein, 325 aa; fasta
FT                   scores: opt: 287 z-score: 328.2 E(): 8.2e-11; 21.9%
FT                   identity in 315 aa overlap. Contains possible N-terminal
FT                   region signal peptide sequence and possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9KY92"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY92"
FT                   /protein_id="CAB92603.1"
FT                   /translation="MEPELDTLVTLTTGVTLLTCVLAIVGLHSYAAGKAQRAALVDRLT
FT                   ATGQAPSAGRRRRFPTLDRRLRRTGLGRNLERRLSATGLDVTPGEFFAYMLATVAGLWL
FT                   IGQAALAPFFGPLAGLLGIGVAIQFLNWQRQKRIEKFINQLPELARILANATQAGLALR
FT                   TAIGMAAEELEAPAGEELGKVADQLAIGASMDDALGELAGRLPSRELVVLVTTLVLSNR
FT                   AGGQVVGALRNLTETLEERKETRREVRTQLSQVTMTSYAVPVLGIGSLLLMNGVKDGAL
FT                   ERMTGSPAGQAAVITAFALYAVGFVLIRRLSRIDV"
FT   CDS_pept        78213..79115
FT                   /transl_table=11
FT                   /gene="SCO5011"
FT                   /gene_synonym="SCK15.13"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.13, possible integral membrane protein, len:
FT                   300 aa; similar to TR:O27061 (EMBL:AE000871)
FT                   Methanobacterium thermoautotrophicum conserved protein
FT                   MTH980, 313 aa; fasta scores: opt: 235 z-score: 285.2 E():
FT                   2e-08; 27.7% identity in 238 aa overlap. Contains possible
FT                   N-terminal region signal peptide sequence and possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9KY91"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY91"
FT                   /protein_id="CAB92604.1"
FT                   /translation="MPPALPAVLLALLMALAVWGVFAGVRMYRAEAKLPDDLALALEVG
FT                   ATRTGAAHSLIDRMGMRYAPAVLRLMGPALVARYRRRIDLAGNPGGLTIDRYAARRAVY
FT                   GFLGALGFLVFLLRGQYLVALLLLAFGAFWTEAGIWSAIRIRKDVIERTLPDFLDVLAV
FT                   VVSAGLGFRQALDRVSTRYEGPWADELRITLRQMDLGMSRREAFTELRRRNDSEQVAMF
FT                   VTALQQGEELGAPIVDTLVSLAKDMRRTDAQNARRKAARAVPKATLMITTFMVPATMIL
FT                   LGAGLILGSGTDFGTITGE"
FT   regulatory      79365..79368
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        79378..79575
FT                   /transl_table=11
FT                   /gene="SCO5012"
FT                   /gene_synonym="SCK15.14"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.14, possible integral membrane protein, len:
FT                   65 aa; similar to some other integral membrane proteins,
FT                   e.g. TR:AAF40189 (EMBL:AF229646) Caulobacter crescentus
FT                   PilA, 59 aa; fasta scores: opt: 84 z-score: 142.8 E(): 1.8;
FT                   36.2% identity in 47 aa overlap. Contains possible
FT                   hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q9KY90"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY90"
FT                   /protein_id="CAB92605.1"
FT                   /translation="MTNWLHTAAAYLHTRLTTRHDKGQTAVEYLGIIAVVVAIVLAITG
FT                   TDIGETIYNAITDKIDEVID"
FT   CDS_pept        79578..80174
FT                   /transl_table=11
FT                   /gene="SCO5013"
FT                   /gene_synonym="SCK15.15"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.15, possible secreted protein, len: 198 aa.
FT                   Contains possible N-terminal region signal peptide
FT                   sequence. High content in alanine amino acid residues"
FT                   /db_xref="GOA:Q9KY89"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY89"
FT                   /protein_id="CAB92606.1"
FT                   /translation="MYSSQRDAGQAFPIYITVVAGLLFLALAYFAVGQAATNRNGAQTA
FT                   ADAAALAAAQETRDQLAGEWVDNLSDPASWERIFDGLGTGPSDSCWRASELAAQNDAQV
FT                   DSCEPDGPLGFKVEVTSDDPVGDSIVPGTEDKHAQASATAVIEPNCEFELPDGDGKDDV
FT                   LPRITCDDQDWELDPEDLPELPKPQDLFDVHLADS"
FT   regulatory      80196..80199
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        80207..80785
FT                   /transl_table=11
FT                   /gene="SCO5014"
FT                   /gene_synonym="SCK15.16"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.16, possible secreted protein, len: 192 aa.
FT                   Contains possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY88"
FT                   /protein_id="CAB92607.1"
FT                   /translation="MGIRFAVKVRNGATGLTVAVGLALCVVGCSSGGGDDNKAEASASA
FT                   TAGEQSDPTAQEGTDSPLAELKGEDGLLLTIDSAERDAGGFVTVSGEIKNDGAEAARVP
FT                   IQTRGDETEIMRHGGSLGGATLVDPAKKKRYYVLRDTDGRPLTTTDMPRIKPGASIPVF
FT                   MQFPAPPTDTGKVTFQLPTFASAPIEISG"
FT   CDS_pept        80794..81405
FT                   /transl_table=11
FT                   /gene="SCO5015"
FT                   /gene_synonym="SCK15.17"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.17, possible secreted protein, len: 203 aa;
FT                   similar to many other membrane proteins, e.g. TR:Q9S6B8
FT                   (EMBL:AF115336) Pseudomonas fluorescens major outer
FT                   membrane protein OprF, 343 aa; fasta scores: opt: 247
FT                   z-score: 285.4 E(): 2e-08; 34.3% identity in 181 aa
FT                   overlap. Contains Pfam match to entry PF00691 OmpA, OmpA
FT                   family and possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="GOA:Q9KY87"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY87"
FT                   /protein_id="CAB92608.1"
FT                   /translation="MHNSRVAVLLTTSVLTAASVGVSQSYAADDPPGTEPSASAPVEVD
FT                   PNDPDLKLPDGATLAQAKVLDIKSVVEEQSGDERREDTNTSVTLALQAEVLFGKDSSKL
FT                   GAEAKSRIRGIADEIRTQNATRVRVFGFTDDLGSSAHGDVLSKRRANAVHDVLSQSLND
FT                   AGITYEVRGYGEQYPIADNSTEAGRKKNRRVEVSFPRTEP"
FT   misc_feature    81079..81369
FT                   /note="Pfam match to entry PF00691 OmpA, OmpA family, score
FT                   77.70, E-value 2.4e-19"
FT   CDS_pept        complement(81503..82318)
FT                   /transl_table=11
FT                   /gene="SCO5016"
FT                   /gene_synonym="SCK15.18c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.18c, possible secreted protein, len: 271 aa.
FT                   Contains possible N-terminal region signal peptide sequence
FT                   and a repeat region: 7x AS at N-terminal domain"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY86"
FT                   /protein_id="CAB92609.1"
FT                   /translation="MGEVAAVVSAITAVAGLLLAVFGIPLVGNSSPIGRSVADSGPTSG
FT                   AAPAASHSTADAGSEGASASASASASASASGSSKVPSSTAPSGSAPTGQPPAGGDEPRS
FT                   SASASSCSSSLPQGWRRVEVPALTVCFGRPGGWGEKPAGELQSSWGSPDGVYDLTVKRD
FT                   RTYGTTARAASAGQLAWYRDTSESSMAGVEVTTHKTRQNGRDALWLEIDYHWEKQSAPR
FT                   KRLEVFVAGKAGYVYQLLVDTEATSQRLAEQSRLFASARKNLLIDVSTG"
FT   repeat_region   complement(82094..82135)
FT                   /note="conserved repeat region translated in CDS SCK15.18c"
FT   CDS_pept        82526..83623
FT                   /transl_table=11
FT                   /gene="SCO5017"
FT                   /gene_synonym="SCK15.19"
FT                   /product="putative araC family regulatory protein"
FT                   /note="SCK15.19, possible araC family regulatory protein,
FT                   len: 365 aa; similar to TR:Q54308 (EMBL:X86780)
FT                   Streptomyces hygroscopicus helix-turn-helix DNA-binding
FT                   protein, 330 aa; fasta scores: opt: 247 z-score: 294.6 E():
FT                   6.1e-09; 28.6% identity in 346 aa overlap. Contains fam
FT                   match to entry PF00165 HTH_AraC, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family and match to Prosite
FT                   entry PS00041 Bacterial regulatory proteins, araC family
FT                   signature. Contains also a TTA leucine codon, possible
FT                   target for bldA regulation"
FT                   /db_xref="GOA:Q9KY85"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY85"
FT                   /protein_id="CAB92610.1"
FT                   /translation="MPGDEQPRRGRRHTERGTAVEQTGTWDASVFLSTDSVSGPEGFGW
FT                   WGDMVSRAVMPVSIASEHAGHFKGEVTTLELVDTDFSAFSFSPMSARRTPDHIRASDPE
FT                   NYYLFLVHGSPIGLEQRRNNALLRAGDVALFDTSQPLACEFQDQGRPSRVSVLRLPRTA
FT                   LPLPGDRTDRLVATPLPARTGSGALLTSYLAGLRENAAHCGPTELRRLGTMALELAVTF
FT                   LAARLDSPPALPAESRRRVLLARINAYIDHNLHDPDLGPATIAAHHHISIRLLHALFEE
FT                   EPETVGATIRRRRLERSRTDLGDPRLRHRTIGEIAARWGFRHPAAFSRTFREAYGISPT
FT                   EARTALHDKQPCTPRRGPGHRTLAP"
FT   misc_feature    83222..83224
FT                   /gene="none"
FT                   /note="TTA leucine codon. Possible target for bldA
FT                   regulation"
FT   misc_feature    83297..83563
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   70.90, E-value 2.7e-17"
FT   misc_feature    83405..83542
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature"
FT   CDS_pept        83774..83983
FT                   /transl_table=11
FT                   /gene="SCO5018"
FT                   /gene_synonym="SCK15.20"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK15.20, possible integral membrane protein, len:
FT                   69 aa. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q9KY84"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY84"
FT                   /protein_id="CAB92611.1"
FT                   /translation="MHGDSSWHTTRSVPSIVVVVLIVIWTVFAVQWKEKDCALVPTSYL
FT                   LVITHGTPSVFEGCGDHAIDVTDD"
FT   CDS_pept        complement(83993..84598)
FT                   /transl_table=11
FT                   /gene="SCO5019"
FT                   /gene_synonym="SCK15.21c"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.21c, possible secreted protein, len: 201 aa;
FT                   similar to TR:Q9UZM5 (EMBL:AJ248286;) Pyrococcus abyssi
FT                   hypothetical 13.4 kD protein, 117 aa; fasta scores: opt:
FT                   167 z-score: 206.8 E(): 0.00048; 31.0% identity in 100 aa
FT                   overlap. Contains possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY83"
FT                   /protein_id="CAB92612.1"
FT                   /translation="MPISASATASFPLPGLSSLPHADSVKAAVAVSVSAVKRAGQRALT
FT                   IGSWVGRGFSSAKQFCTEGIGMGRQRWRDGAGALVVVGQSGEGACVPLEIAGSYRARTK
FT                   GLLGRGSVDGAMLLTPANSVHTFRMRMAIDVAYLDRRLNVIAVRTMRPGRLGLPRLRAR
FT                   HVLEAEAGAMDEWGVRVGARVEVVEGSAESADGAGRLG"
FT   CDS_pept        84591..85127
FT                   /transl_table=11
FT                   /gene="SCO5020"
FT                   /gene_synonym="SCK15.22"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK15.22, hypothetical protein, len: 178 aa; similar
FT                   to C-terminal region of TR:Q9KY81 (EMBL:AL356813)
FT                   Streptomyces coelicolor putative lipoprotein SCK15.23, 221
FT                   aa; fasta scores: opt: 444 Z-score: 519.8 E(): 2.5e-21;
FT                   39.080% identity in 174 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY82"
FT                   /protein_id="CAB92613.1"
FT                   /translation="MGTTSPSASPTESESSKAGRPKIELPADLSYSFEWPKSGDQVKDA
FT                   ILADAEQSIKAVDLAIVNQDALDKAYLYYYEGEAAAGTQKFIQNYVDQKAGITGRYRFY
FT                   APEVAVDEDGTASFTYCEDQGRAYVKYLETNKVRRTEVSAQSYVIYHTSLKKNGEGVWE
FT                   IQKIDSQSGSAKCRP"
FT   regulatory      85305..85308
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        85315..85980
FT                   /transl_table=11
FT                   /gene="SCO5021"
FT                   /gene_synonym="SCK15.23"
FT                   /product="putative lipoprotein"
FT                   /note="SCK15.23, possible lipoprotein, len: 221 aa; similar
FT                   to Streptomyces coelicolor SCK15.24, 220 aa; fasta scores:
FT                   opt: 736 z-score: 652.9 E(): 8.3e-31; 54.3% identity in 221
FT                   aa overlap. Contains correctly situated match to Prosite
FT                   entry PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site and possible N-terminal region signal
FT                   peptide sequence"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY81"
FT                   /protein_id="CAB92614.1"
FT                   /translation="MNRRRPTLLAALTLTAAAALTLSACGSDGSPGKGEGEIAGSDVGD
FT                   ESSASPSPSSSSTAAAGRPKVKLPPDLRLTFEDAETGDPVKDAVLADNAERMRAVDAAI
FT                   SGTDPKGKALGFYNTGKALEAAVSWVGQFEKANATVTGHVRFFDRDVTLKGTTSAVLTF
FT                   CADESKGFSKDKETGEVTKTPVTKDSYVQYNTRLDKNADGVWQTSQILSTRGAAQCQA"
FT   misc_feature    85357..85389
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   regulatory      86210..86214
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        86221..86883
FT                   /transl_table=11
FT                   /gene="SCO5022"
FT                   /gene_synonym="SCK15.24"
FT                   /product="putative lipoprotein"
FT                   /note="SCK15.24, possible lipoprotein, len: 220 aa; similar
FT                   to Streptomyces coelicolor SCK15.23, 221 aa; fasta scores:
FT                   opt: 736 z-score: 703.5 E(): 1.3e-33; 54.3% identity in 221
FT                   aa overlap. Contains correctly situated match to Prosite
FT                   entry PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site and possible N-terminal region signal
FT                   peptide sequence"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY80"
FT                   /protein_id="CAB92615.1"
FT                   /translation="MNRRRPTLLAALTLTAAAALTLSACGSDDDGAAKDSDKIAGADTG
FT                   SETSAAPSPSETDTAGRPKITFPSDAKNVFEYEKTGNATKDAALADSTLSVNSVDEAIF
FT                   EGSTDTKALGFYNAESALSDSITYVLGYINKNHTWVGETRYFDYKVSLSGELEAYVTYC
FT                   SDESKSFIKDKKTGKVKDTPTTADSYVLYHAKLAKNAQGVWQTTDIASTRGSKECQP"
FT   misc_feature    86263..86295
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        86892..87902
FT                   /transl_table=11
FT                   /gene="SCO5023"
FT                   /gene_synonym="SCK15.25"
FT                   /product="putative secreted protein"
FT                   /note="SCK15.25, possible secreted protein, len: 336 aa;
FT                   similar to TR:CAB77312 (EMBL:AL160312) Streptomyces
FT                   coelicolor putative secreted protein SCD35.28c, 361 aa;
FT                   fasta scores: opt: 890 z-score: 972.2 E(): 0; 47.3%
FT                   identity in 357 aa overlap. Contains possible N-terminal
FT                   region signal peptide sequence"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY79"
FT                   /protein_id="CAB92616.1"
FT                   /translation="MRCATVAAIVLVSVISAPMAFAGGRGEGGSRGSTDQQANADGNGT
FT                   VSVTVGGVVFDRSKNGSGDSVGAVTSSTSWSPPACWYAPKYTPEELQDYLEPIWEAEST
FT                   GYEWDAKQREKYNAKDEKKGFNKDKTGKGFWWGSYVNESFPPGWDKCDTDYFWVDTGDP
FT                   PPADKENAVTPEVLAELAYAEIRVPGTEVTLAPAEATKVNLPTWAWLDGAEFKPVSVTA
FT                   SVKEIGIEATATAEPVSLQIKPGTPDAETYPASGVCEIKNGRIGAPYEKGRADDAPPCG
FT                   VKYLRSSGDGTFPLQATVTWEIHWTGTGGAGGDLPDGTFGATQDVVVQEIQAVNR"
FT   CDS_pept        88019..88891
FT                   /transl_table=11
FT                   /gene="SCO5024"
FT                   /gene_synonym="SCK15.26"
FT                   /product="putative oxidoreductase"
FT                   /note="SCK15.26, possible oxidoreductase, len: 290 aa;
FT                   similar to TR:Q9UXP0 (EMBL:AJ011519) Methanolobus tindarius
FT                   F420-dependent N5,N10-methylene-tetrahydromethanopterin
FT                   reductase, putative FfdA, 326 aa; fasta scores: opt: 323
FT                   z-score: 369.8 E(): 4e-13; 28.3% identity in 240 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9KY78"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY78"
FT                   /protein_id="CAB92617.1"
FT                   /translation="MTGLGAVFRPQLAPERLRAVARVADEVGLEELWLWEDCFREGGIS
FT                   TAAAALAWTERVRVGVGLLPVPLRNVAVTAMEAATLHRMFPGRPVLGVGHGVQDWMGQV
FT                   GARAESPLTLLREHLVALRELLRGGRVTSTGRYVRLDDVALDWPPEQPVEVLAGATGPR
FT                   SLRLAGEAADGTVLTANTPPDGVRRARRLIDEGRAASGRTEAHRVVVYLLAATGSGAAE
FT                   RLRNELVAEGVGAVPDLGVAGDAQAVADAVRRLAEAGADTVILQPTGDEPDPEGFVRFA
FT                   AERVRPLVA"
FT   CDS_pept        88994..89911
FT                   /transl_table=11
FT                   /gene="SCO5025"
FT                   /gene_synonym="SCK15.27"
FT                   /product="putative transcriptional regulator"
FT                   /note="SCK15.27, possible transcriptional regulator, len:
FT                   305 aa; similar to TR:Q9RJS9 (EMBL:AL132707) Streptomyces
FT                   coelicolor putative transcriptional regulator SCF51.06 334
FT                   aa; fasta scores: opt: 166 z-score: 190.7 E(): 0.0037;
FT                   27.3% identity in 289 aa overlap and to SW:TIPA_STRLI
FT                   (EMBL:S64314) Streptomyces lividans transcriptional
FT                   activator TipA, 253 aa; fasta scores: opt: 174 z-score:
FT                   201.3 E(): 0.00096; 35.5% identity in 107 aa overlap.
FT                   Contains Pfam match to entry PF00376 merR, Bacterial
FT                   regulatory proteins, merR family and possible
FT                   helix-turn-helix at residues 11..32 (+2.74 SD)"
FT                   /db_xref="GOA:Q9KY77"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY77"
FT                   /protein_id="CAB92618.1"
FT                   /translation="MRSSFMPPRQVKIGDAAAFVGSTPRAIRHYHEIGLLPEPERGSDG
FT                   RRRYGYEDMIRLLWIRRTADAGIALDDIRDAFATGTDSAGAESGEDVAGILERLEETLA
FT                   EREAELRRQRAAVRRMRTEGSRTGLLSDFVTERLKSAPEGSLRQADLDSLLVTERILGP
FT                   LGAAVQATRFVVLATHPALREESDRVDDAEEALDDGVAVDDPRVAQVAAERRAFESALE
FT                   AVIEESGPGADDDALFDAWDTLHPAADGAGEADSVSAFEATGWMPYDFSPARLRCMELA
FT                   AELAADPSARDNTAAQSYRAEPSS"
FT   misc_feature    89033..89140
FT                   /note="Pfam match to entry PF00376 merR, Bacterial
FT                   regulatory proteins, merR family, score 39.80, E-value
FT                   6e-08"
FT   regulatory      89896..89899
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        89908..90726
FT                   /transl_table=11
FT                   /gene="SCO5026"
FT                   /gene_synonym="SCK15.28"
FT                   /product="conserved hypothetical protein SCK15.28"
FT                   /note="SCK15.28, hypothetical protein, len: 272 aa; similar
FT                   to TR:O06593 (EMBL:Z95586) Mycobacterium tuberculosis
FT                   hypothetical 27.9 kD protein MTCY336.07c, 252 aa; fasta
FT                   scores: opt: 968 z-score: 1156.3 E(): 0; 57.5% identity in
FT                   254 aa overlap"
FT                   /db_xref="GOA:Q9KY76"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY76"
FT                   /protein_id="CAB92619.1"
FT                   /translation="MTPPAHPGTFERLVAEGAAVPTEGWDFSWFEGRATEARPSWGYAR
FT                   SMAGRLAGATAVLDVQTGGGEVLDFALEAAGPHRAPLVAATEGWAPNVAQATRLLRPRG
FT                   VPVVASADDAPLPFADGAFDLVVSRHPVEPHWDEVARVLMPGGTYFAQHVGPASVFELI
FT                   EYFLGPLPEDSRRHRDPERERADAEAAGLEVVELRAERLRMEFLDIGAVVHFLRKVVWM
FT                   VPGFTVEAYRDRLRDLHERIEADGPFVAHSSRHLFDVRKPDATSGPDARP"
FT   CDS_pept        complement(90757..91950)
FT                   /transl_table=11
FT                   /gene="SCO5027"
FT                   /gene_synonym="SCK15.29c"
FT                   /product="hypothetical protein SCK15.29c"
FT                   /note="SCK15.29c, hypothetical protein, len: 397 aa;
FT                   similar to TR:Q9RKN1 (EMBL:AL121850) Streptomyces
FT                   coelicolor hypothetical 37.4 kD protein (fragment)
FT                   SCC78.05, 347 aa; fasta scores: opt: 180 z-score: 199.8
FT                   E(): 0.0012; 28.6% identity in 360 aa overlap"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KY75"
FT                   /protein_id="CAB92620.1"
FT                   /translation="MTKSTGITWAAASARRLERQFLARRARTGTPVADVAAAMLGVHAQ
FT                   VLSAAELSVGLRADGVTRTDVRDALWPTAPLAPPAPALVKTHGPRGTVHLLPARDLPMW
FT                   CAALPAIPAGPAAFPTDVRLTGEQAGQVVAAIADALDGTFLTVDELGEEVVARTGPWAG
FT                   DLVMPAFQTMWPRWRQVLHRAGQCGALSFGPNRGRRVTYTRPPRFTPLPPEEASRLLAR
FT                   RYLYAYGPATPQHFARWLAAPPGWAKARYAELAAAGEIEEVRFEGAPAWVAAGDTAFPD
FT                   APERDELLRGVRLLPYFDAYVVAAQPRELLFPGAAYRRALAGGQAGNFPVLLVDGVAAG
FT                   VWHQRRRGRRTTVTVEPLARLTARQERELADCVERVGAVLEAAAELVIGEVTVGAHA"
FT   misc_feature    92236..92434
FT                   /note="high G+C content region (81.4%)"
FT   CDS_pept        93012..94337
FT                   /transl_table=11
FT                   /gene="SCO5028"
FT                   /gene_synonym="SCK7.01"
FT                   /product="putative ATP-binding protein"
FT                   /note="SCK7.01, possible ATP-binding protein, len: 441 aa;
FT                   similar to TR:Q9X792 (EMBL:AL049491) Mycobacterium leprae
FT                   putative ATP-binding protein MLCB1222.20, 433 aa; fasta
FT                   scores: opt: 2024 z-score: 2236.8 E(): 0; 72.2% identity in
FT                   428 aa overlap. Contains and match to Prosite entry PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FBP8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP8"
FT                   /protein_id="CAC05873.1"
FT                   /translation="MVTSTKRHKPDRRTYVLDTSVLLADPNALNRFDEHEVVLPIVVVT
FT                   ELEAKRHHPELGYFARQALRLLDEFRVRHGRLDAPIPIGDLGGTVRVELNHSDPSVLPT
FT                   GYRLGDNDSRILAVARNLQAEGFDVTVVSKDLPLRIKASSVGLLAEEYRAELAITDASG
FT                   WTGMSELTLPGEQVDVLFEEGRVYVPEAAGLPVHTGLTIQSERGKALGRVTPDGNVRLV
FT                   RGDREAFGIKGRSAEQRIALDLLLDPDVGIVSMGGRAGTGKSALALCAGLEAVLERRQH
FT                   QKVMVFRPLYAVGGQELGYLPGSEAEKMSPWAQAVFDTLSAVTSREVIEEVTARGMLEV
FT                   LPLTHIRGRSLHDAFVIVDEAQSLERNVLLTVLSRIGANSRVVLTHDVAQRDNLRVGRY
FT                   DGVVAVVEKLKGHPLFAHVTLTRSERSQIAALVTEMLEDGHI"
FT   misc_feature    93780..93803
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        94767..95483
FT                   /transl_table=11
FT                   /gene="SCO5029"
FT                   /gene_synonym="SCK7.02"
FT                   /product="putative secreted protein"
FT                   /note="SCK7.02, possible secreted protein, len: 238 aa;
FT                   similar to C-terminal region of TR:CAB93446 (EMBL:AL357591)
FT                   Streptomyces coelicolor hypothetical 16.0 kDa protein
FT                   SCC53.17, 154 aa; fasta scores: opt: 477 z-score: 484.5
FT                   E(): 1.6e-19; 64.4% identity in 101 aa overlap. Contains
FT                   possible N-terminal region signal peptide sequence and
FT                   possible coiled-coil region at aprox. residues 82..123"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP7"
FT                   /protein_id="CAC05874.1"
FT                   /translation="MLEGNRVSRISVRGFAVASATAVTAVGSVVGVASGSVAQNNDDAE
FT                   ATAAGTTLLADIPMGEQAQVQTASLTQQADVQAIAADASAKKDAEEAARKAAAKTAVDK
FT                   QEKAKKAAQAAKQREAQQEAASRDAKRESTSFAVQSSYSTSQIQAMARQMVPSGQFQCF
FT                   SNIVNHESSWNYQAVNASSGAYGLFQALPAGKYASAGADWRTNPATQIKWGLSYMDNRY
FT                   GSPCDAWAFWQANHWY"
FT   regulatory      95635..95638
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        95646..97043
FT                   /transl_table=11
FT                   /gene="SCO5030"
FT                   /gene_synonym="SCK7.03"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK7.03, possible integral membrane protein, len:
FT                   465 aa; similar to SW:Y205_MYCTU (EMBL:AL021928)
FT                   Mycobacterium tuberculosis hypothetical 38.0 kDa protein
FT                   MTV033.13, 367 aa; fasta scores: opt: 892 z-score: 833.4
FT                   E(): 0; 41.1% identity in 343 aa overlap. Contains Pfam
FT                   match to entry PF01594 UPF0118, Domain of unknown function
FT                   DUF20 and possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBP6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP6"
FT                   /protein_id="CAC05875.1"
FT                   /translation="MSRVPGWLGRLGAGLTRASERLEQRREEARRDDADDGPGPVSDHE
FT                   RRPLDDTAEDSAVEHLAAHRPVALAHRPDPAQAVPWGVRVAAEAGWRLLVLAGTVWVLM
FT                   RVISAVQLVVLAFVAALLITALLQPAVAWLRRHGVPRGPATALTAILGFVVMGLIGWFV
FT                   TWQVMENIDNLSDQVQDGIDELRNWLLNSPFHVTDKQINEIAKNLRDAVGANTDQITSA
FT                   GLEGVTVVVEALTGILLAAFSTLFLLYDGKRIWQWSLKLVPAAARPGVAGAGPRAWRTL
FT                   TAYVRGTVIVALIDAIFIGLGIYFLDVPMAVPLAVFIFLFAFIPLVGAVVSGALAVVVA
FT                   LVTQGVFAAVMTLVVVLAVQQIEGHILQPFILGRAVRVHPLAVVLSVAAGGMVAGIGGA
FT                   VVAVPLVAVTNTVVGYLRAYSREAALRRTPRPHGATSTDAAPAVDRVPGPPKPPAPPAD
FT                   GPPSDAP"
FT   misc_feature    95913..96896
FT                   /note="Pfam match to entry PF01594 UPF0118, Domain of
FT                   unknown function DUF20, score 201.10, E-value 1.7e-56"
FT   misc_feature    97128..99737
FT                   /note="previously sequenced fragment. EMBL:AF186371
FT                   Streptomyces coelicolor A3(2) AhpD (ahpD), AhpC (ahpC), and
FT                   OxyR (oxyR) genes, complete cds."
FT   CDS_pept        complement(97332..97868)
FT                   /transl_table=11
FT                   /gene="SCO5031"
FT                   /gene_synonym="ahpD"
FT                   /gene_synonym="SCK7.04c"
FT                   /product="alkyl hydroperoxide reductase system hypothetical
FT                   protein"
FT                   /note="SCK7.04c, ahpD, alkyl hydroperoxide reductase system
FT                   hypothetical protein, len: 178 aa; identical to previously
FT                   sequenced TR:Q9RN73 (EMBL:AF186371) Streptomyces coelicolor
FT                   A3(2) AhpD, 178 aa"
FT                   /db_xref="GOA:Q7AKI6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004674"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AKI6"
FT                   /protein_id="CAC05876.1"
FT                   /translation="MSLDSLKSAVPDYAKDLKLNLGSVIGNSDLPAQQLWGTVLATAIA
FT                   SRSPIVLRELEPEAKANLSPEAYSAAKSAAAVMAMNNVFYRTRHLLSDHEYGTLRAGLR
FT                   MNVIGNPGVDKVDFELWSFAVSAINGCGMCLDSHEQVLRKAGVDRETIQEAFKIAAVVE
FT                   AVGVTLDAEAVLAAE"
FT   CDS_pept        complement(97875..98429)
FT                   /transl_table=11
FT                   /gene="SCO5032"
FT                   /gene_synonym="ahpC"
FT                   /gene_synonym="SCK7.05c"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /note="SCK7.05c, ahpC, alkyl hydroperoxide reductase,
FT                   len:184 aa; identical to previously seqeunced TR:Q9RN72
FT                   (EMBL:AF186371) Streptomyces coelicolor A3(2) AhpC, 184 aa.
FT                   Contains Pfam match to entry PF00578 AhpC-TSA, AhpC/TSA
FT                   family"
FT                   /db_xref="GOA:Q9FBP5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP5"
FT                   /protein_id="CAC05877.1"
FT                   /translation="MLTVGDKFPEFDLTACVSLEKGKEFQQINHKTYEGQWKVVFAWPK
FT                   DFTFVCPTEIAAFGKLNDEFADRDAQILGFSGDSEFVHHAWRKDHPDLTDLPFPMLADS
FT                   KHELMRDLGIEGEDGFAQRAVFIVDQNNEIQFTMVTAGSVGRNPKEVLRVLDALQTDEL
FT                   CPCNWSKGDETLDPVALLSGE"
FT   misc_feature    complement(97971..98420)
FT                   /note="Pfam match to entry PF00578 AhpC-TSA, AhpC/TSA
FT                   family, score 159.60, E-value 5.2e-44"
FT   regulatory      complement(98435..98438)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      98553..98558
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        98567..99505
FT                   /transl_table=11
FT                   /gene="SCO5033"
FT                   /gene_synonym="oxyR"
FT                   /gene_synonym="SCK7.06"
FT                   /product="hydrogen peroxide sensing regulator"
FT                   /note="SCK7.06, oxyR, hydrogen peroxide sensing regulator,
FT                   len: 312 aa; identical to previously sequenced TR:Q9RN71
FT                   (EMBL:AF186371) Streptomyces coelicolor A3(2) hydrogen
FT                   peroxide sensing regulator OxyR, 313 aa. Contains Pfam
FT                   match to entry PF00126 HTH_1, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family and match to Prosite
FT                   entry S00044 Bacterial regulatory proteins, lysR family
FT                   signature. Also contains possible helix-turn-helix motif at
FT                   residues 23..44 (+3.89 SD)"
FT                   /db_xref="GOA:Q9FBP4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP4"
FT                   /protein_id="CAC05878.1"
FT                   /translation="MSSKKRQPSLAQLRAFDAVAEHLHFRDAAAAIGMSQPALSGAVSA
FT                   LEEALGVTLLERTTRKVLLSPAGARLAVRTKAVLAEVGALVEEAEAVRAPFTGALRLGV
FT                   IPTVAPYLLPTVLRLVHERYPDLDLQVHEEQTASLLEGLTTGRLDLLLLAVPLGVPGVT
FT                   ELPLFDEDFVLVTPLDHRLGGREGLERSVLRELKLLLLDEGHCLRDQALDICREAGRAG
FT                   VPATTTAAGLSTLVQLVAGGLGVTLLPRTAVRVETSRSSQLLTASFTDPAPTRRIALAM
FT                   RTGAARSAEYGELAAALREAMADLPVRTVHD"
FT   misc_feature    98594..99022
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   165.90, E-value 6.6e-46"
FT   misc_feature    98636..98728
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature"
FT   CDS_pept        complement(99633..101969)
FT                   /transl_table=11
FT                   /gene="SCO5034"
FT                   /gene_synonym="SCK7.07c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK7.07c, possible integral membrane protein, len:
FT                   778 aa; similar to TR:AAF74504 (EMBL:M34538) Streptomyces
FT                   clavuligerus hypothetical 42.6 kDa protein (fragment) 407
FT                   aa; fasta scores: opt: 509 z-score: 559.6 E(): 1.1e-23;
FT                   31.5% identity in 413 aa overlap. Contains possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP3"
FT                   /protein_id="CAC05879.1"
FT                   /translation="MRQWAADLMLGVRFAFTGGREGWTRAVLTAVGVGLGVALLLLTTA
FT                   LPNALTVRHDREAARSDITFATDPMPKADDTLVLARLDDTFRDDDVRGRALEPEGPRAP
FT                   LPPGLEKFPAVGEMVVSPALKKLLNSDSGALLRERLPDRVVGTIAEEGLIGSAELAYYR
FT                   GAEGLAEHITSGRIERIDRFGDPDPGEERSDPVLILLILVVFVVLLMPVAVFIAAAVRF
FT                   GGERRDRRLAALRLVGSDSRMTRRIAAGEAMAGAALGLLFGAGFFMVGRQLAGSAEVFR
FT                   ISVFPSYLNPSPVLALLVAVAVPTAAVLVTLLALRGVVIEPLGVVRAGRPARRQLWWRL
FT                   ILPLAGLAMLYPMIGNGRENGDFNQYLVTGGVVLLLVGVTALLPWVVESVVARLGSGGV
FT                   AWQLAVRRLQLSSGTAARMVNGIAVAVAGAIALQMLFAGVDDDYTKSTGQDVSWAQMEA
FT                   ILPSGVPMDQAAAKFRDTKGVEAVNAFSEGWLGDRPKDPDHGTTLTVGDCASLREIARL
FT                   SSCAEGDVFVVHGAEWDAEEDVTKLAAPGRKLYVDPSYEGIPKRHEIPWTVPQGVKAAK
FT                   PRTGLLAGTDRGGLLITRKAMPEALAPALDGHAYLRLDQSVPDVHDLVRNTTVAIDPLA
FT                   DAVAWAATERTDRFDAIRTGLFVGAACVLALIGASLLVSQLEQLRERKKLLSALVAFGT
FT                   RRRTLSLSVLWQTAIPIVLGLLLASVVGLTLGTVLLKMTSTPVSVDWTGVLAMTGIGAA
FT                   VVLVVTLCSLPPLLRLMRPEGLRTE"
FT   CDS_pept        complement(101972..102661)
FT                   /transl_table=11
FT                   /gene="SCO5035"
FT                   /gene_synonym="SCK7.08c"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="SCK7.08c, possible ABC transporter ATP-binding
FT                   protein, len: 229 aa; similar to TR:CAB81857
FT                   (EMBL:AL161691) Streptomyces coelicolor putative ABC
FT                   transporter ATP-binding protein SCD40A.12c, 246 aa; fasta
FT                   scores: opt: 597 z-score: 668.0 E(): 9.7e-30; 47.6%
FT                   identity in 206 aa overlap. Contains Pfam match to entry
FT                   PF00005 ABC_tran, ABC transporter and match to Prosite
FT                   entry PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FBP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP2"
FT                   /protein_id="CAC05880.1"
FT                   /translation="MTPPAGSLLSADQLRKAYGPTLALDGAEFSIHPGEVVAVMGPSGS
FT                   GKSTLLHCLAGIVPPDSGTITYNGRELSAMSDAQRSALRRSDFGFVFQFGQLVPELTCV
FT                   ENVALPLRLNGTSRKEAERAALSWMERLEVDDLRKKRPGEVSGGQGQRVAVARSLVTNP
FT                   RVLFADEPTGALDSLNGERVMELLTDAARSTNAAVVLVTHEARVAAYSDREIVVRDGKS
FT                   RDMERAV"
FT   misc_feature    complement(102002..102562)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 224.40, E-value 1.6e-63"
FT   misc_feature    complement(102518..102541)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        complement(102658..103182)
FT                   /transl_table=11
FT                   /gene="SCO5036"
FT                   /gene_synonym="SCK7.09c"
FT                   /product="hypothetical protein"
FT                   /note="SCK7.09c, hypothetical protein, len: 174 aa; similar
FT                   to TR:O50432 (EMBL:AL010186) Mycobacterium tuberculosis
FT                   hypothetical 21.1 kDa protein MTV005.12c, 189 aa; fasta
FT                   scores: opt: 183 z-score: 238.8 E(): 7.8e-06; 30.1%
FT                   identity in 186 aa overlap"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP1"
FT                   /protein_id="CAC05881.1"
FT                   /translation="MSIGHTLLGLLESGPRHGYDLKRAFDEKFGHDRPLHYGQVYSTMS
FT                   RLLKNGLVVVDGIEAGGGPERKRYAITDEGITDVQRWLATPEKPEPYLQSTLYTKVVLA
FT                   LLTHRDAADILDTQRSEHLRSMRILTDRKRKGDLADQLICDHALFHLEADLRWLELTAA
FT                   RLDKLREAVTR"
FT   CDS_pept        complement(103366..103671)
FT                   /transl_table=11
FT                   /gene="SCO5037"
FT                   /gene_synonym="SCK7.10c"
FT                   /product="hypothetical protein SCK7.10c"
FT                   /note="SCK7.10c, unknown, len: 101 aa. Highly hydrophilic.
FT                   Also high in G+C content (80.52 %)"
FT                   /db_xref="GOA:Q9FBP0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBP0"
FT                   /protein_id="CAC05882.1"
FT                   /translation="MTSPPEDSAPEDSVRDSAPSEGPAPKRRPHQRKQVLLRLDPQVYE
FT                   ALARWAGDELRSANAQIEFLLRRALAEAGRLPGGTGPLPRRGRPPGGGGPGAAPPP"
FT   CDS_pept        complement(103668..104606)
FT                   /transl_table=11
FT                   /gene="SCO5038"
FT                   /gene_synonym="SCK7.11c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCK7.11c, possible integral membrane protein, len:
FT                   312 aa; similar to TR:Q9RDB7 (EMBL:AL136058) Streptomyces
FT                   coelicolor putative membrane protein SCE20.08c, 383 aa;
FT                   fasta scores: opt: 467 z-score: 517.9 E(): 2.2e-21; 31.2%
FT                   identity in 301 aa overlap. Contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9KIM1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KIM1"
FT                   /protein_id="CAC05883.1"
FT                   /translation="MSTHDAPQVTADVPEMPAPRVRENQAHSIGGGFALLLGLVGLLVG
FT                   AGLIAGATAVDSTGGKAVLIIGGILIALAAFLAMCGLNMVAPGEARVVQLFGRYRGTIR
FT                   QDGLRWVNPFTSRTKISTRVRNHETAVLKVNDAYGNPIELAAVVVWRVEDTAQATFEVD
FT                   DYVEFVSTQTEAAVRHIAIEYPYDAHDEDGLSLRGNAEEITEKLAVELHARVEAAGVQI
FT                   IESRFTHLAYAPEIASAMLQRQQAGAVVAARRQIVDGAVGMVEAALARISEQDIVELDD
FT                   ERKAAMVSNLMVVLCGDRAAQPVLNTGTLYQ"
FT   CDS_pept        105026..107176
FT                   /transl_table=11
FT                   /gene="SCO5039"
FT                   /gene_synonym="SCK7.12"
FT                   /product="putative penicillin-binding protein"
FT                   /note="SCK7.12, possible penicillin-binding protein, len:
FT                   773 aa; similar to TR:CAB88838 (EMBL:AL353832) Streptomyces
FT                   coelicolor probable penicillin-binding protein SCE6.34, 756
FT                   aa; fasta scores: opt: 1080 z-score: 911.6 E(): 0; 46.0%
FT                   identity in 733 aa overlap and to SW:PBPD_BACSU
FT                   (EMBL:U11882) Bacillus subtilis penicillin-binding protein
FT                   4 precursor PbpD, 624 aa; fasta scores: opt: 513 z-score:
FT                   438.2 E(): 6.1e-17; 28.7% identity in 582 aa overlap.
FT                   Contains Pfam matches to entries PF00912 Transglycosyl,
FT                   Transglycosylase and PF00905 Transpeptidase, Penicillin
FT                   binding protein transpeptidase domain and 2x matches to
FT                   Prosite entry PS00017 ATP/GTP-binding site motif A
FT                   (P-loop)"
FT                   /db_xref="GOA:Q9FBN9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN9"
FT                   /protein_id="CAC05884.1"
FT                   /translation="MGAFIVLYMMIDIPEGNPEADLQSNVYKYSDGSIMARTGERNREI
FT                   VDLAKIPKDVQRTFVAAENKTFYNDAGVDLKGTARGVLNTLSGKGAQGGSTITQQYVKN
FT                   YYLTQEQTVSRKLKELVISLKLDREKSKDYILAGYINTSYYGRGAYGIQAAAQAYYRVD
FT                   AEDLTVEQGAYLSALLQAPNQYDWAIASETGKKLVQQRWNYVLDNMVEQKWLGAGDRQG
FT                   MKFPEPKEPKAAAGKEGQVGYLVDAADHALKKQLVAQGAAEDMEQAKALVDLGGYTVTL
FT                   NIDKKKQAALEAAVKKQLTSKLDPDERKVDADVQAGAASVDPKTGSVVAMYGGVNYLKH
FT                   FTNNATRDDYQPASTFKPVILAAAVDHDAETQDGVPITANTLYDGDSERPVMDGDKKVG
FT                   FAPPNEDDHDYGEIDVQEAMNKSVNSVFAQMGIDVGMPEVMKVAADLGMDTEGEQAVPA
FT                   QTLGSMGASPLEMAGVYATFDNHGKKVTPAIVKSVEHKDRKVEMPDPIGEQVISREAAD
FT                   TVTSVLTGVVNDGTAKKSVRENPLRDGQKVAGKTGTSDNNKSAWFSGFTPGLVTSVGLF
FT                   GEDDEPPHKQVPMYKAAGVDYRVNGGGPPAEIWAAYTFGVMDEVTEFDLETKQGAAVRP
FT                   SKSPTAPESPTKSPTREETSEAPPPSSDPTTEAPPSSDPTTEEPPESPTNSPSNSPSTE
FT                   PPPDGGSTESGDPELPGVDWGQ"
FT   misc_feature    105095..105598
FT                   /note="Pfam match to entry PF00912 Transglycosyl,
FT                   Transglycosylase, score 190.50, E-value 2.6e-53"
FT   misc_feature    105866..106801
FT                   /note="Pfam match to entry PF00905 Transpeptidase,
FT                   Penicillin binding protein transpeptidase domain, score
FT                   74.70, E-value 1.9e-18"
FT   misc_feature    106655..106678
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        complement(107315..109528)
FT                   /transl_table=11
FT                   /gene="SCO5040"
FT                   /gene_synonym="SCK7.13c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK7.13c, conserved hypothetical protein, len: 737
FT                   aa; similar to TR:Q9ZBJ0 (EMBL:AL035161) Streptomyces
FT                   coelicolor conserved hypothetical protein SC9C7.20, 860 aa;
FT                   fasta scores: opt: 1430 z-score: 1211.3 E(): 0; 37.5%
FT                   identity in 787 aa overlap. Contains match to Prosite
FT                   entry, TTA leucine codon, possible target for bldA
FT                   regulation and 3x degenerate repeat (P/A)(D/G)GGQ"
FT                   /db_xref="GOA:Q9FBN8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN8"
FT                   /protein_id="CAC05885.1"
FT                   /translation="MTEHPTSFDRPSTGADPTDPRGALLPAPVPPRASGSALPAQGRTG
FT                   ETPPTAGEDSPGVFEHSQPGAEQAAEPDTHRPRPGAEGVPVQPDGGQPDGGQAGGGQPG
FT                   GVPAGAAPRVAPSDGSALDGMPGGGQAAEVRPGSEVPAGATDRRDAPAEPDRRTGQPTA
FT                   PGQPTPMRRDGDRLRFVGAATRRIARGMDLDEIVMGLCRATVPTFADAILVYLREPLPV
FT                   GDERPTGPLVLRLRRTDRIPAERDTEGGFAPAAQPEPSELETVGAELCEVRPGSALAEV
FT                   LRGVRPVFTDTPAARAALPELLGEERDFALPDGRRAILAPLRGRRRVIGAALFLRGPER
FT                   IPFEADDLLVAAQLATHSALGIDKAVLYGREAYIADELQRTMLPENLPRCTGVRLASRY
FT                   LPAAETARVGGDWYDAIPLPGSRVALVVGDVMGHSMTSAAIMGQLRTTAQTLAGLDLPP
FT                   QEVLHHLDEQAQRLGTDRMATCLYAVYDPVSHRITVANAGHPPPVLLHLGGEAEVLRVP
FT                   AGAPIGVGGVDFEAVELDAPAGATLLLYTDGLVESRLRDVWTGIEQLRERLAATAQLTG
FT                   PDHPPPLEALCDEVLDMLGPGDRDDDIALLAARFDGIAPSDVSYWFLDPEDAAPGKARR
FT                   LARRALARWGMEDLTDAVELLVSEVVTNAVRYASKPVTLRLLRTDVLRCEVGDDVPQLP
FT                   RLRQARATDEGGRGLYLVNRLARRWGATRLSTGKVVWFELNRG"
FT   repeat_region   complement(109223..109267)
FT                   /note="3x degenerate repeat translated into SCK7.13c"
FT   misc_feature    complement(109415..109417)
FT                   /gene="none"
FT                   /note="TTA leucine codon. Possible target for bldA
FT                   regulation"
FT   CDS_pept        complement(109825..110535)
FT                   /transl_table=11
FT                   /gene="SCO5041"
FT                   /gene_synonym="SCK7.14c"
FT                   /product="hypothetical protein"
FT                   /note="SCK7.14, hypothetical protein, len: 236 aa; similar
FT                   to TR:O83033 (EMBL:AB016934) Streptomyces wedmorensis FomD
FT                   protein, 209 aa; fasta scores: opt: 282 z-score: 320.1 E():
FT                   2.3e-10; 34.5% identity in 197 aa overlap"
FT                   /db_xref="GOA:Q9FBN7"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="PDB:3CBT"
FT                   /db_xref="PDB:3EXM"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN7"
FT                   /protein_id="CAC05886.1"
FT                   /translation="MTDGEAVSAAAGPGAEGPPGPVGHWAPGSHILWRYRENGGPHVHI
FT                   ARPVTVVRDDADLLAVWLAPGTECVKPVLADGTPVHLEPLATRYTKPRTVQRDQWFGTG
FT                   VLKLARPGEAWSVWLFWDPGWRFKNWYVNLERPLTRWEGGVDSEDHFLDISVHPDRTWH
FT                   WRDEDEFAQALRDGLMDPASAGRVRRAGRSAVAEIRAWGSPFADGWEHWRPDPAWPVPS
FT                   LPGDWDRTPAHVSS"
FT   CDS_pept        complement(110624..112009)
FT                   /transl_table=11
FT                   /gene="SCO5042"
FT                   /gene_synonym="fumC"
FT                   /gene_synonym="SCK7.15c"
FT                   /product="fumarate hydratase C"
FT                   /note="SCK7.15c, fumC, fumarate hydratase C, len: 461 aa;
FT                   similar to SW:FUMC_PSEAE (EMBL:U59458) Pseudomonas
FT                   aeruginosa fumarate hydratase C (EC 4.2.1.2) FumC, 458 aa;
FT                   fasta scores: opt: 1505 z-score: 1638.8 E(): 0; 53.6%
FT                   identity in 459 aa overlap. Contains Pfam match to entry
FT                   PF00206 lyase_1, Lyase and match to Prosite entry PS00163
FT                   Fumarate lyases signature"
FT                   /db_xref="GOA:Q9FBN6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBN6"
FT                   /protein_id="CAC05887.1"
FT                   /translation="MSEYRIEHDSMGEVRVPADAKWRAQTQRAVENFPVSGQRIERAHI
FT                   EALARIKSAAAKVNAELGVLDEDVAGAIQEAAGEVAEGKWDEHFPVDVFQTGSGTSSNM
FT                   NTNEVVATLATERLGRDVHPNDHVNASQSSNDVFPSSIHIAATAAVTRDLIPALDHLAG
FT                   ALERKAGEFADVVKSGRTHLMDATPVTLGQEFGGYAAQVRYGIERLQASLPRLAELPLG
FT                   GTAVGTGINTPPGFSAAVIEEVARATGLPLTEARDHFEAQGARDGIVETSGQLRTIGVG
FT                   LTKIANDLRWMASGPRTGLAEISLPDLQPGSSIMPGKVNPVIPEAVLMVAAQVTGNDAT
FT                   VAAAGAAGNFELNVMLPVIAKNVLESVRLLANVSRLLADRTVDGIVAHPERAREYAESS
FT                   PSVVTPLNKYLGYEEAAKVAKRALAERKTIRQTVLEGGYVERGDLTREQLDQALDVLRM
FT                   TRP"
FT   misc_feature    complement(110642..111976)
FT                   /note="Pfam match to entry PF00206 lyase_1, Lyase, score
FT                   508.30, E-value 5.9e-149"
FT   misc_feature    complement(111050..111079)
FT                   /note="PS00163 Fumarate lyases signature"
FT   CDS_pept        complement(112101..113561)
FT                   /transl_table=11
FT                   /gene="SCO5043"
FT                   /gene_synonym="SCK7.16c"
FT                   /product="putative hydrolase (putative membrane protein)"
FT                   /note="SCK7.16c, probable hydrolase (putative membrane
FT                   protein), len: 486 aa; N-terminal similar to SW:APX_STRGR
FT                   Streptomyces griseus aminopeptidase (EC 3.4.11.-), 284 aa;
FT                   fasta scores: opt: 967 z-score: 1057.3 E(): 0; 53.7%
FT                   identity in 283 aa overlap and C-terminal region similar to
FT                   TR:O69311 (EMBL:D84193) Streptomyces lividans chitinase (EC
FT                   3.2.1.14) ChiB, 610 aa; blastp scores: Score = 87 (30.6
FT                   bits), Expect = 2.1, P = 0.87; Identities = 46/159 (28%),
FT                   Positives = 60/159 (37%). Contains possible hydrophobic
FT                   membrane spanning region"
FT                   /db_xref="GOA:Q9FBN5"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN5"
FT                   /protein_id="CAC05888.1"
FT                   /translation="MRTCPAWPPLSHFWRTKVKRRFAVASLSLAVVLGLGTLPAVAAGT
FT                   APAAQSPDVDVTKVKAHLTELHSIAGRNGGTRRSTGQGYRDSVAYVKGKLQAAGYTVTE
FT                   QPCTSGCSSGAGPNLIAEWPHGDANDVYMFGAHLDSVSAGPGMNDNGSGSAALLENALT
FT                   LARQNPTMQGRVRFAWWTDEEQGLNGSDFYVRSLSSAQRSAITAYYNFDMIASTNGGYF
FT                   VNHVTSAAAAPMKAYWDSLGLQPEENTEGAGRSDDYSFEQYGIPTSGYAMGASARKTSA
FT                   QAAKWGGTAGTSYDPCYHRSCDNLDNINTTGLDRASDGIAYTIWQRAVGTGDDGGGDGC
FT                   DTDPVVNGGFESGSSPWTGDTGTIGAHSGQSAHTGTRFAWLAGYGSTHTESVAQTVTVP
FT                   TGCTRLAYWLHIDTDESGTTAYDTFKVKADGTTLATLSNADARDGYVQRTVDLGAYAGR
FT                   QVALSFTGSEDGSLQTGFVLDDVSLLAG"
FT   CDS_pept        complement(113742..115418)
FT                   /transl_table=11
FT                   /gene="SCO5044"
FT                   /gene_synonym="fumB"
FT                   /gene_synonym="SCK7.17c"
FT                   /product="fumarate hydratase class I"
FT                   /note="SCK7.17c, fumB, fumarate hydratase class I, len: 558
FT                   aa; similar to SW:FUMB_ECOLI (EMBL:M27058) Escherichia coli
FT                   fumarate hydratase class I, anaerobic (EC 4.2.1.2) FumB,
FT                   548 aa; fasta scores: opt: 2386 z-score: 2782.7 E(): 0;
FT                   64.9% identity in 539 aa overlap. Contains Pfam match to
FT                   entry PF00206 lyase_1, Lyase and match to Prosite entry
FT                   PS00163 Fumarate lyases signature"
FT                   /db_xref="GOA:Q9FBN4"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN4"
FT                   /protein_id="CAC05889.1"
FT                   /translation="MGEMPEFAYTDLLPQGEDTTPYRLVTAEGVATFEADGRTFLKVEP
FT                   EALRKLAEEAVHDIQHYLRPAHLAQLRRIIDDPEASGNDKFVALDLLKNANIAAAGVLP
FT                   MCQDTGTAIVMGKRGQNVLTEGGDEEALSRGIYDAYKNLNLRYSQMAPLTMWEEKNTGS
FT                   NLPAQIELYATDGGAYKFLFMAKGGGSANKSFLYQETKAVLNESSMMKFLEEKIRSLGT
FT                   AACPPYHLAIVVGGTSAEYALKTAKYASAHYLDEIPAEGSELGHGFRDKELEEKVFELT
FT                   QKIGIGAQFGGKYFCHDVRVVRLPRHGASCPVAIAVSCSADRQAVAKITAEGVFLEQLE
FT                   TDPARFLPETTDEHLEEEGDVVKVDLNQPMDDILAELTRHPVKTRLSLTGPLVVARDIA
FT                   HAKIKERLDAGEEMPQYLKDHPVYYAGPAKTPEGYASGSFGPTTAGRMDSYVEQFQAAG
FT                   GSKVMLAKGNRSKQVTDACDAHGGFYLGSIGGPAARLAQDCIKKVEVVEYEELGMEAVW
FT                   KIEVEDFPAFIVVDDKGNDFFQDPAPAPTFTTIPVRGPGLA"
FT   misc_feature    complement(113925..114269)
FT                   /note="Pfam match to entry PF00206 lyase_1, Lyase, score
FT                   61.10, E-value 2.9e-16"
FT   misc_feature    complement(114015..114044)
FT                   /note="PS00163 Fumarate lyases signature"
FT   regulatory      complement(115420..115423)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        115654..116337
FT                   /transl_table=11
FT                   /gene="SCO5045"
FT                   /gene_synonym="SCK7.18"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK7.18, conserved hypothetical protein, len: 227
FT                   aa; similar to TR:CAB88834 (EMBL:AL353832) Streptomyces
FT                   coelicolor hypothetical 30.8 kDa protein SCE6.30c, 277 aa;
FT                   fasta scores: opt: 403 z-score: 468.8 E(): 1.2e-18; 38.6%
FT                   identity in 220 aa overlap"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN3"
FT                   /protein_id="CAC05890.1"
FT                   /translation="MDLHKHAPAAAPRTSELRASDADRDRVADMLREALAEGRLTADEH
FT                   AERVEGVLAAKTVGELDVFVRDLPAAHRGRETTAPAPHRPTAGAIPAEPDENVVAVFSS
FT                   AVRKGRWRANRRIHAYAVFGSIEIDLSEAVFEYQQVVIKAFSVFGSVEVRVPENVSVRG
FT                   AGGSVLGSFEVHTLDSSEAEAPVIYVDGWAVLGSVEARPKRGKVVADILDRVHRRVEKG
FT                   LRKHV"
FT   misc_feature    116087..117329
FT                   /note="previously sequenced DNA fragment. EMBL:AJ239088
FT                   Streptomyces coelicolor wblI gene for hypothetical protein"
FT   regulatory      116430..116435
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        116443..116820
FT                   /transl_table=11
FT                   /gene="SCO5046"
FT                   /gene_synonym="wblI"
FT                   /gene_synonym="SCK7.19"
FT                   /product="hypothetical protein"
FT                   /note="SCK7.19, wblI, len: 125 aa; identical to previously
FT                   sequenced TR:Q9X953 (EMBL:AJ239088) Streptomyces coelicolor
FT                   hypothetical 13.9 kDa protein WblI, 125 aa and to TR:O88103
FT                   (EMBL:AJ010601) Streptomyces coelicolor WhiD protein, 112
FT                   aa; fasta scores: opt: 297 z-score: 395.0 E(): 1.6e-14;
FT                   46.7% identity in 105 aa overlap"
FT                   /db_xref="GOA:Q7AKI4"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKI4"
FT                   /protein_id="CAC05891.1"
FT                   /translation="MLQPPHSSLQVAAVPAQRVPVRDRDQDAPWHTEAVCRRDEAGLFF
FT                   APSKEPTAARLSREEAAKRVCARCPVMVECREHALLQPEPYGVWGGLTAAERRVVLARR
FT                   RRRDVELRNAARTTGRIAAAG"
FT   CDS_pept        complement(117077..118108)
FT                   /transl_table=11
FT                   /gene="SCO5047"
FT                   /gene_synonym="SCK7.20c"
FT                   /product="conserved hypothetical protein GlpX"
FT                   /note="SCK7.20c, conserved hypothetical protein, len: 343
FT                   aa; similar to SW:GLPX_ECOLI (EMBL:Z11767) Escherichia coli
FT                   hypothetical protein GlpX, 336 aa; fasta scores: opt: 789
FT                   z-score: 868.1 E(): 0; 46.5% identity in 325 aa overlap"
FT                   /db_xref="GOA:Q9FBN2"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN2"
FT                   /protein_id="CAC05892.1"
FT                   /translation="MTEHHLPSELDVPSEAPDRNLAMELVRVTEAAAMAAGRWVGRGDK
FT                   NGADGAAVRAMRTLVHTVSMNGVVVIGEGEKDEAPMLFNGERVGDGTGAEVDIAVDPID
FT                   GTTLTANGMTNAIAVLAAAERGSMFDPSAVFYMDKLVTGPEAADFVDINAPVAVNIRRI
FT                   AKAKRRTPEDVTVVILDRPRHQGLIKEVRETGARIKLISDGDVAGSILALREGTGIDLL
FT                   LGIGGTPEGIISACAVKCLGGTIQGKLWPKDAEERQRAVDAGHDLDRVLTTDDLVSGDN
FT                   VFFVATGITDGELLRGVRYRSETATTDSIVMRSKSGTVRRIDSEHRLSKLRAYSAVDFD
FT                   RAK"
FT   CDS_pept        118244..118768
FT                   /transl_table=11
FT                   /gene="SCO5048"
FT                   /gene_synonym="SCK7.21"
FT                   /product="putative secreted protein"
FT                   /note="SCK7.21, possible secreted protein, len: 174 aa.
FT                   Contains possible N-terminal signal peptide sequence"
FT                   /db_xref="GOA:Q9FBN1"
FT                   /db_xref="InterPro:IPR025339"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBN1"
FT                   /protein_id="CAC05893.1"
FT                   /translation="MKGKQKSARDMILSLGVIVLAAGVIWIFIPHDDGEPDVKRVDYRV
FT                   ELLTAQRAASYPVAAPEGLSEDWKPTSVRFRGDDSDAWHLGFRTPDGEYVAVEQSTKKP
FT                   STFIHDASQGGQATERTEEIGGRTWTRYTGGRYDALVLDGTGDMKGATTVVAGTGSFEQ
FT                   LGKMAAALKLA"
FT   CDS_pept        complement(118832..119422)
FT                   /transl_table=11
FT                   /gene="SCO5049"
FT                   /gene_synonym="SCK7.22c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCK7.22, hypothetical protein, len: 196 aa; similar
FT                   to TR:P75894 (EMBL:AE000202) Escherichia coli hypothetical
FT                   protein, 196 aa; fasta scores: opt: 466 z-score: 572.4 E():
FT                   2e-24; 40.6% identity in 192 aa overlap and to
FT                   SW:YDFN_BACSU (EMBL:AB001488) Bacillus subtilis putative
FT                   NAD(P)H nitroreductase YdfN, 206 aa; fasta scores: opt: 133
FT                   z-score: 170.9 E(): 0.047; 23.1% identity in 199 aa
FT                   overlap. Contains Pfam match to entry PF00881
FT                   Nitroreductase, Nitroreductase family. Similar also to
FT                   TR:Q9FBV0 (EMBL:AL391072) Streptomyces coelicolor putative
FT                   nitroreductase SC9A4.03c, 202 aa; fasta scores: opt: 599
FT                   Z-score: 706.0 E(): 1.1e-31; 49.474% identity in 190 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9FBN0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBN0"
FT                   /protein_id="CAC05894.1"
FT                   /translation="MSLVLDPAAQDLLFREARTANTFTDEPVTDEQVQAIYDLVKYGPT
FT                   AFNQSPLRITLVRSPEARERLVAHMAEGNRPKTAAAPLVAILSADNEFHEELPELFPHF
FT                   PAAKDAFFSERPVREGAATLNAALQAAYFIVGVRAAGLAAGPMTGLDFEGVRKEFLDDD
FT                   HTPLMVVNIGRPGPDAWFPRSPRLAYDQVVTTV"
FT   misc_feature    complement(118937..119341)
FT                   /note="Pfam match to entry PF00881 Nitroreductase,
FT                   Nitroreductase family, score 10.40, E-value 0.00063"
FT   CDS_pept        119640..120971
FT                   /transl_table=11
FT                   /gene="SCO5050"
FT                   /gene_synonym="SCK7.23"
FT                   /product="putative nucleotide-sugar dehydrogenase"
FT                   /note="SCK7.23, possible nucleotide-sugar dehydrogenase,
FT                   len: 443 aa; similar to TR:CAB82012 (EMBL:AL161755)
FT                   Streptomyces coelicolor putative nucleotide-sugar
FT                   dehydrogenase SCD63.05c, 405 aa; fasta scores: opt: 736
FT                   z-score: 812.9 E(): 0; 36.2% identity in 423 aa overlap.
FT                   Contains Pfam match to entry PF00984 UDPG_MGDP_dh,
FT                   UDP-glucose/GDP-mannose dehydrogenase family"
FT                   /db_xref="GOA:Q9FBM9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBM9"
FT                   /protein_id="CAC05895.1"
FT                   /translation="MKFKSDSSHFDVSGPTVAVVGLGYVGLPTALALCDAGATVIGVDS
FT                   SPERLRDIARGAVDLLPLHHAQLACASAGDRFRLTPDATAVRDADAVVICVPTPVDARR
FT                   RPDLAALSAACASVVEHAVPGQLIVLTSTSYVGTTRDLLVEPLRARGLTVDEDVYVAFA
FT                   PERIDPGNERHTPERTPRLVGGAGPRSSRAAADLLAPTASAVRTVPDPETAEMAKLWEN
FT                   TYRAVNIALANELADACHSLGLAPAPVIEAAATKPYGFMPFYPGPGVGGHCIPCDPHYL
FT                   LWQLGKVRQQAPLVATALAANSRRPARITERALDLLADSAVPAHGARVLLIGVAYKEGV
FT                   ADVRESPALEILAGLAEAGAHVAYCDPLVPSLRVGADALHHLPDPHTRPWDLVVLNTVH
FT                   PVHDLTWLCADDAPPVLDTRQRGPLTKAAARAATGVPPAAEATA"
FT   misc_feature    119682..120893
FT                   /note="Pfam match to entry PF00984 UDPG_MGDP_dh,
FT                   UDP-glucose/GDP-mannose dehydrogenase family, score 293.40,
FT                   E-value 2.7e-84"
FT   regulatory      120956..120960
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        120968..122431
FT                   /transl_table=11
FT                   /gene="SCO5051"
FT                   /gene_synonym="SCK7.24"
FT                   /product="putative glycosyltransferase"
FT                   /note="SCK7.24, possible glycosyltransferase, len: 487 aa;
FT                   similar to SW:NODC_RHIME (EMBL:X01649) Rhizobium meliloti
FT                   N-acetylglucosaminyltransferase (EC 2.4.1.-) NodC, 426 aa;
FT                   fasta scores: opt: 377 z-score: 447.1 E(): 2e-17; 29.6%
FT                   identity in 433 aa overlap. Contains Pfam match to entry
FT                   PF00535 Glycos_transf_2, Glycosyl transferases and possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBM8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBM8"
FT                   /protein_id="CAC05896.1"
FT                   /translation="MTVLRPGHGPAAPVRSAARHRLGTRLDALDPRVRRDVVRLLTLLA
FT                   LLPLLLLLARGAVRLPHAFDPLALYGLAVLAGTVCLLHLAYSRYDDPAVRPLRSRPRHA
FT                   EAFPALPARPRVSFLLAVRNERAHIEACVRSMAGVDYPDVQLVVVDDASDDGTPDVLER
FT                   LAAELPLTLIRLEENLGKKGALVRACAVADGDVLLFTDSDCVVAPDAVRHCVTALVRHP
FT                   ELGAVGGHCRALNTDAGLLARVQDIWYEGQFRISKAAEAAFGSVTCVSGPLAAFRREAV
FT                   WNYLPAWAEDRFLGAPFRFATDRQLTGYVLGQAWHGRALKDRHADSPFVRDHDYPELRW
FT                   EVGYTRAARVWTRVPSRPGSFLRQQIRWKKSFIRNLFFTGRFMWRRGPAAAALYYGHAL
FT                   WVIAAPVLVVRHLLWAPLHLAGPLTLLYLGGVVLKGCVWGLAYRLDHPGDRAWRCRPLM
FT                   SLLSCCVLAWLLPYALLTLRRGVWSRSAA"
FT   misc_feature    121316..121822
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferases, score 77.20, E-value 3.3e-19"
FT   regulatory      122417..122421
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        122428..122535
FT                   /transl_table=11
FT                   /gene="SCO5052"
FT                   /gene_synonym="SCK7.25"
FT                   /product="putative membrane protein"
FT                   /note="SCK7.25, possible membrane protein, len: 35 aa.
FT                   Doubtful CDS. Contains possible hydrophobic membrane
FT                   spanning region"
FT                   /db_xref="GOA:Q9FBM7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBM7"
FT                   /protein_id="CAC05897.1"
FT                   /translation="MRVLLRGLGRSLAVGLTCAAVALVYVFVVTRGRWL"
FT   CDS_pept        122532..124091
FT                   /transl_table=11
FT                   /gene="SCO5053"
FT                   /gene_synonym="SCK7.26"
FT                   /product="putative secreted protein"
FT                   /note="SCK7.26, possible secreted protein, len: 519 aa.
FT                   Contains possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="GOA:Q9FBM6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBM6"
FT                   /protein_id="CAC05898.1"
FT                   /translation="MSSDGSRGNRPRRMPDGRPLLRAALGLLTAAVVALPFTAAWQYDT
FT                   LRRAVAEQAAPPAPSSGDGGPGLGADAEPAPARNAPVVLAYHDVGPDDRSRYTVSPEHF
FT                   DAQLRALRDAGYRTLTTREFTGFLRTGRTPGPRTVHLTFDDGTHGLWTHADPVLARYGM
FT                   KAAAYLITGQVGTHRPYYLSWPEVERMARSGRWDFQAHTHLSHERAAVDAAGHERSVFT
FT                   NRLWLADEGRVETSDEYRRRVAADLDRSIRDLVRHDLPRPRLFAYPFSERLDESNLGAR
FT                   DADALRSMLRERFTATLTNSAARPLPAGPRAAAAGQVQRLEVTRDTTAAGLLRELGRWA
FT                   TVTPQDADRPLAHPAHWQTTGATGQAGPGMLTGGSRPPAGTAYASADYRPFATADWTDY
FT                   RLRAAVGGLHGTSNSAGITLRAGSGHPVSLSVGHHTASLTTADPETTGDRRSCRLKPSA
FT                   THRITVSVTPRHVRVSVDGETCAAVRAGRWRVAEGAGGFSLSVRNDGPERQWPRFTSLK
FT                   VR"
FT   CDS_pept        124102..124416
FT                   /transl_table=11
FT                   /gene="SCO5054"
FT                   /gene_synonym="SCK7.27"
FT                   /product="hypothetical protein SCK7.27"
FT                   /note="SCK7.27, unknown, len: 104 aa"
FT                   /db_xref="InterPro:IPR025629"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBM5"
FT                   /protein_id="CAC05899.1"
FT                   /translation="MRPPITSRAGRGPKSTTPLVTRTPHLVPRERIDMTATVKGPASYF
FT                   PSIEKKYGRPVAEWKDLIRSSPLTKHMELVAWLKAEHGLGHGHANALVAHTLAEGPAKG
FT                   "
FT   CDS_pept        complement(124413..124679)
FT                   /transl_table=11
FT                   /gene="SCO5055"
FT                   /gene_synonym="SCK7.28c"
FT                   /product="putative exoribonuclease"
FT                   /note="SCK7.28c, possible exoribonuclease small subunit,
FT                   len: 88 aa; similar to SW:EX7S_ECOLI (EMBL:D00694)
FT                   Escherichia coli exodeoxyribonuclease small subunit (EC
FT                   3.1.11.6) XseB, 79 aa; fasta scores: opt: 129 z-score:
FT                   174.2 E(): 0.031; 35.3% identity in 68 aa overlap and to
FT                   TR:Q9X784 (EMBL:AL049491) Mycobacterium leprae putative
FT                   exodeoxyribonuclease small subunit XseB, 87 aa; fasta
FT                   scores: opt: 231 z-score: 293.6 E(): 7e-09; 55.1% identity
FT                   in 78 aa overlap"
FT                   /db_xref="GOA:Q9FBM4"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBM4"
FT                   /protein_id="CAC05900.1"
FT                   /translation="MTSEVEQPTAMSEALGYEQARDELIEVVRRLEAGGTTLEESLALW
FT                   ERGEELAEVCRRRLDGARARLDAALAEEADPEDGASGADGGGA"
FT   CDS_pept        complement(124689..125897)
FT                   /transl_table=11
FT                   /gene="SCO5056"
FT                   /gene_synonym="SCK7.29c"
FT                   /product="putative exoribonuclease large subunit"
FT                   /note="SCK7.29c, possible exoribonuclease large subunit,
FT                   len: 402 aa; similar to TR:O53456 (EMBL:AL021897)
FT                   Mycobacterium tuberculosis exonuclease VII large subunit
FT                   XseA or MTV017.61c, 415 aa; fasta scores: opt: 1318
FT                   z-score: 1486.0 E(): 0; 52.3% identity in 407 aa overlap
FT                   and to SW:EX7L_ECOLI (EMBL:J02599) Escherichia coli
FT                   exodeoxyribonuclease large subunit (EC 3.1.11.6) XseA, 456
FT                   aa; fasta scores: opt: 610 z-score: 689.7 E(): 6e-31; 30.8%
FT                   identity in 413 aa overlap"
FT                   /db_xref="GOA:Q9FBM3"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBM3"
FT                   /protein_id="CAC05901.1"
FT                   /translation="MAANSTPEGPLPVGEVSRLIGGWIDRLGAVWVEGQITQLSRRPGA
FT                   GVVFLTLRDPSYDISVSVTCYRQVFDAVADVVGEGARVVVHAKPEWYAPRGQLSLRAAE
FT                   IKPVGVGELLARLEQLKKALAREGLFAAERKQPLPFLPQLIGLVCGRASAAERDVLENA
FT                   RHRWPAVRFEVRNVPVQGVHAVPQVVQAVKELDARDDVDVIVVARGGGSVEDLLPFSDE
FT                   QLVRAVAACRTPVVSAIGHEPDSPLLDLVADLRASTPTDAAKKVVPDVGEEYERVRLLR
FT                   DRARRCVAAFVDREERGLAHALARPSIQDPHRMIEERAEQVTALLDRGRRSLRHHLDRA
FT                   DSELTHTHARVVALSPAATLKRGYAVLQRADGHAVRDPGEVEPGETLRARVSEGDFSVR
FT                   VDA"
FT   repeat_region   126052..126076
FT                   /note="3x degenerate repeat unit:
FT                   CAGCGCG(T/C)GCCGCGCGTGTGT(C/T)GCC"
FT   repeat_region   126162..126186
FT                   /note="3x degenerate repeat unit:
FT                   CAGCGCG(T/C)GCCGCGCGTGTGT(C/T)GCC"
FT   repeat_region   126272..126296
FT                   /note="3x degenerate repeat unit:
FT                   CAGCGCG(T/C)GCCGCGCGTGTGT(C/T)GCC"
FT   CDS_pept        complement(126474..127856)
FT                   /transl_table=11
FT                   /gene="SCO5057"
FT                   /gene_synonym="SCK7.30c"
FT                   /product="putative amino acid permease"
FT                   /note="SCK7.30c, possible amino acid permease, len: 460 aa;
FT                   similar to SW:MMUP_ECOLI (EMBL:D83536) Escherichia coli
FT                   probable S-methylmethionine permease MmuP, 475 aa; fasta
FT                   scores: opt: 345 z-score: 390.5 E(): 2.8e-14; 23.3%
FT                   identity in 408 aa overlap and to TR:P74848 (EMBL:X99945)
FT                   Salmonella typhimurium amino acid permease YeeF like
FT                   protein, 448 aa; fasta scores: opt: 705 z-score: 792.4 E():
FT                   0; 32.0% identity in 416 aa overlap. Contains Pfam match to
FT                   entry PF00324 aa_permeases, Amino acid permease and
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBM2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBM2"
FT                   /protein_id="CAC05902.1"
FT                   /translation="MAQSGTTAPEAGGEERLRRSLGFRDLVVYGLLFIAPMAPVGVFGT
FT                   LDAKSHGAVALVYLVATVAMAFTAFSYAQMVRVVPQAGSVFAYARAGLGNGAGFVAGWM
FT                   AMLDYILIPAVAYLFSGIAMEALVPEVSRWVWTAIAVVVTTLLNLWGVRTAARVGFLVL
FT                   AMEIVVLLVFVATAIVVLAQDGAERDWLSPLSGDGTQGAFALSAVVGAVSVAVLSYLGF
FT                   DAIATFAEEVTGGSAKVARALLFCLALAGVLFVAQTYLVALLEPVSSAQLAAEPERQGS
FT                   AFYDAVDVSVGTWLHDLVAVSKAIGAAFAALAGQAAAGRLLFAMGRDRRLPGVLARTDA
FT                   GVPRVALLVSAVITMAAAVWAARRDDGLDHLVSVVDVGALTAFTLLHASVVGWFVVRRG
FT                   GGRVIWWRHLLVPVLGAAITIAVIVEASGTAQVVGAIWLAVGLVVLAAQWRGRRDAETT
FT                   GA"
FT   misc_feature    complement(126498..127733)
FT                   /note="Pfam match to entry PF00324 aa_permeases, Amino acid
FT                   permease, score -171.30, E-value 2.7e-06"
FT   regulatory      complement(127861..127865)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        127985..129001
FT                   /transl_table=11
FT                   /gene="SCO5058"
FT                   /gene_synonym="lytB"
FT                   /gene_synonym="SCBAC20F6.01"
FT                   /gene_synonym="SCK7.31"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC20F6.01, lytB, len: >148 aa; highly similar to
FT                   C-terminal region of SW:LYTB_ECOLI (EMBL:X54945)
FT                   Escherichia coli LytB protein LytB or B0029, 316 aa; fasta
FT                   scores: opt: 434  Z-score: 512.5  bits: 101.9 E(): 5.9e-21;
FT                   51.145% identity in 131 aa overlap. Contains Pfam match to
FT                   entry PF02401 LYTB, LytB protein"
FT                   /note="SCK7.31, hypothetical protein (fragment), len: >224
FT                   aa; similar to SW:LYTB_ECOLI (EMBL:AE000113) Escherichia
FT                   coli regulator, control of stringent response; involved in
FT                   penicillin tolerance LytB protein, 316 aa; fasta scores:
FT                   opt: 781 z-score: 922.7 E(): 0; 53.2% identity in 216 aa
FT                   overlap"
FT                   /db_xref="GOA:Q9FBM1"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBM1"
FT                   /protein_id="CAD55221.1"
FT                   /translation="MGAMTASPGRRVLLAAPRGYCAGVDRAVIAVEKALEQYGAPVYVR
FT                   HEIVHNKYVVQTLEKKGAIFVERTEEVPEGNIVMFSAHGVAPVVHEEAERGKLATIDAT
FT                   CPLVTKVHKEAVRFANDDYDILLIGHEGHEEVIGTSGEAPDHIQLVDGPEDVAKVEVRD
FT                   PSKVVWLSQTTLSVDETMETVDALKDKFPQLISPPSDDICYATQNRQLAVKQMGAEAEL
FT                   VIVVGSRNSSNSKRLVEVAKQAGSRAAYLVDFADEIDETWLDGVTTVGVTSGASVPDVL
FT                   VEQVLEWLSRRGFEDVEIVKAAEESIIFSLPKELRRDLREEAASLVAERGGSGTAGA"
FT   misc_feature    128555..128860
FT                   /note="Pfam match to entry PF02401 LYTB, LytB protein,
FT                   score -87.40, E-value 2.5e-05"
FT   CDS_pept        129055..129795
FT                   /transl_table=11
FT                   /gene="SCO5059"
FT                   /gene_synonym="ppgK"
FT                   /gene_synonym="SCBAC20F6.02"
FT                   /product="polyphosphate glucokinase"
FT                   /note="SCBAC20F6.02, ppgK, polyphosphate glucokinase, len:
FT                   246 aa; highly similar to SW:PPGK_MYCTU (EMBL:U44834)
FT                   Mycobacterium tuberculosis polyphosphate glucokinase (EC
FT                   2.7.1.63) PpgK or RV2702 or MTCY05A6.23, 265 aa; fasta
FT                   scores: opt: 912 Z-score: 1042.8 bits: 200.5 E(): 1.7e-50;
FT                   57.322% identity in 239 aa overlap. Contains Pfam match to
FT                   entry PF00480 ROK, ROK family"
FT                   /db_xref="GOA:Q9ADE8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE8"
FT                   /protein_id="CAC37447.1"
FT                   /translation="MQIFGVDIGGSGIKGAPVDLDRGDLAQERCKVLTPHPATPDGVAD
FT                   GVKQVVEHFGWTGRVGLTFPGVVTGGATVRTAANVDKGWVDTDARALFAERLGGLDVTV
FT                   VNDADAAGVAEMHFGAGRGRKGTVVLLTFGTGIGSAVFTDGLLVPNTELGHLELDGHDA
FT                   EKRASSKVKDDHDMSWEHWAHRVQKYLAHVEMLFSPELFIIGGGVSRKSQKFLPHIKDV
FT                   RAEIVPAQLQNNAGIVGAAMHAAG"
FT   misc_feature    129067..129477
FT                   /note="Pfam match to entry PF00480 ROK, ROK family, score
FT                   21.60, E-value 2.4e-05"
FT   CDS_pept        complement(129806..130408)
FT                   /transl_table=11
FT                   /gene="SCO5060"
FT                   /gene_synonym="SCBAC20F6.03c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCBAC20F6.03c, possible integral membrane protein,
FT                   len: 200 aa. Contains possible hydrophobic membrane
FT                   spanning regions and high G+C content in N-terminal region"
FT                   /db_xref="GOA:Q9ADE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE7"
FT                   /protein_id="CAC37448.1"
FT                   /translation="MEQHRTRPAQYGPRRSGAPLPAQGRGGAVARPPAGRVGPPAGRRP
FT                   EPVRPAPGAPSPVARVVRALRGMPNPRLTGLGSGLFCAAVMTLLGFLDELLFGSSLTAY
FT                   GVLFVPVSLLTALWVRRGDLLTAPVVVPIAFAVGLVPVAESGDGGLGGRLMGIVTALAT
FT                   EAGWLYGGTLVAGSTVIVRRIRLMRRRAAAARNRPPA"
FT   misc_feature    complement(130174..130384)
FT                   /note="high G+C content region (82.46%)"
FT   CDS_pept        130594..131682
FT                   /transl_table=11
FT                   /gene="SCO5061"
FT                   /gene_synonym="SCBAC20F6.04"
FT                   /product="putative ATP/GTP binding protein"
FT                   /note="SCBAC20F6.04, possible ATP/GTP binding protein, len:
FT                   362 aa; highly similar to SW:YCHF_ECOLI (EMBL:AE000219)
FT                   Escherichia coli probable GTP-binding protein in treA-pth
FT                   intergenic region YchF or Gtp1 or B1203, 362 aa; fasta
FT                   scores: opt: 1193 Z-score: 1225.2 bits: 235.3 E(): 1.2e-60;
FT                   51.944% identity in 360 aa overlap. Contains Pfam match to
FT                   entry PF01018 GTP1_OBG, GTP1/OBG family and match to
FT                   Prosite entry PS00017 ATP/GTP-binding site motif A
FT                   (P-loop)"
FT                   /db_xref="GOA:Q9ADE6"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE6"
FT                   /protein_id="CAC37449.1"
FT                   /translation="MSLTIGIVGLPNVGKSTLFNALTKNDVLAANYPFATIEPNVGVVG
FT                   VPDPRLTKLAEIFSSEKILPATVDFVDIAGIVRGASEGEGLGNKFLANIRESDAICQVI
FT                   RAFKDENVVHVDGKVSPKDDIETINTELILADLQTIEKVLPRLQKESRIKKDVAPKVKA
FT                   VEEAKEILEKGDTLFSQGILQGSERAELLHDLHLLTTKPFLYVFNVDEDELTDDDFKSE
FT                   QRALVAPAEAIFLNAKLEADLAELDEDEALELLQSVGQDEPGLATLAHVGFRTLGLQTY
FT                   LTAGPKESRAWTIKKGATAPEAAGVIHTDFQKGFIKAEVISFDDLVETGSVTEARAKGK
FT                   ARMEGKEYVMRDGDVVEFRFNV"
FT   misc_feature    130606..130725
FT                   /note="Pfam match to entry PF01018 GTP1_OBG, GTP1/OBG
FT                   family, score 15.50, E-value 0.00092"
FT   misc_feature    130618..130641
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        complement(131804..132196)
FT                   /transl_table=11
FT                   /gene="SCO5062"
FT                   /gene_synonym="SCBAC20F6.05c"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC20F6.05c, hypothetical protein, len: 130 aa;
FT                   similar to TR:Q9X8E7 (EMBL:AL049573) Streptomyces
FT                   coelicolor hypothetical 16.4 kDa protein SCE39.24, 148 aa;
FT                   fasta scores: opt: 257 Z-score: 327.8 bits: 66.5 E():
FT                   1.1e-10; 39.394% identity in 132 aa overlap"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE5"
FT                   /protein_id="CAC37450.1"
FT                   /translation="MPGTLLLDSEGLSKLYRKDRTVMALVQAAAEEGVRVATSAMTTLE
FT                   ADYERIHPARIKWILSRVDVHDVTKEITDQAAALLRAHRLHGHTYAIDAAFAVIARDAS
FT                   RPVTVLTSDPEDLTLLCGPSVGVVKV"
FT   CDS_pept        complement(132196..132447)
FT                   /transl_table=11
FT                   /gene="SCO5063"
FT                   /gene_synonym="SCBAC20F6.06c"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC20F6.06c, hypothetical protein, len: 83 aa;
FT                   similar to TR:Q9XAG7 (EMBL:AL079356) Streptomyces
FT                   coelicolor hypothetical 8.8 kDa protein SC6G9.07, 84 aa;
FT                   fasta scores: opt: 167  Z-score: 224.6  bits: 45.9 E():
FT                   6.3e-05; 43.103% identity in 58 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE4"
FT                   /protein_id="CAC37451.1"
FT                   /translation="MSGSRKYSISLPEDLAEAVRAHVGPGGFSAYVAEALEQRVAMDKL
FT                   REIVADFETDNEALTHEEVEAARALLRHDHRQAGGAAA"
FT   CDS_pept        132446..134848
FT                   /transl_table=11
FT                   /gene="SCO5064"
FT                   /gene_synonym="SCBAC20F6.07"
FT                   /product="putative bifunctional protein"
FT                   /note="SCBAC20F6.07, possible bifunctional protein, len:
FT                   800 aa; N-terminal domain does not present similarity to
FT                   any known protein and C-terminal half is similar to the
FT                   C-terminal domain of may prokaryotic putative helicases,
FT                   e.g. TR:Q9CE08 (EMBL:AE006434) Lactococcus lactis (subsp.
FT                   lactis) SWI/SNF family helicase Snf, 1034 aa; fasta scores:
FT                   opt: 317  Z-score: 332.6  bits: 72.8 E(): 6.1e-11; 29.817%
FT                   identity in 436 aa overlap. Contains Pfam match to entry
FT                   PF00176 SNF2_N, SNF2 and others N-terminal domain and Pfam
FT                   match to entry PF00271 helicase_C, Helicase conserved
FT                   C-terminal domain"
FT                   /db_xref="GOA:Q9ADE3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE3"
FT                   /protein_id="CAC37452.1"
FT                   /translation="MVPILPAVVSLGGEWLPRGSVDQQGAVNARRGPVWAVERCGEGQR
FT                   GAGSVGRGERDTVARGTRLYEAAQAVVGDHARAVEAVRAALKPIHDEAVKRELDAIPVA
FT                   RLQDVTEGRLRLGSVEKSGLRTLGRVLEAGPYRLRQIPGVGQRTVDQILAAARRLSEAV
FT                   HETVAVHIDVDRPEPRTTALVMALHVLVEAGPEARRAVDKATVLTERLGPLLADAGPAA
FT                   GRVRMLLAGREKKARAWAAVAATRSLVDEAEQAGLPGLLAQASVDLLRGTASDVAAWVD
FT                   FELRSAEYYSLLAEISGRPPDAAAVEGFLPDEVAERVRTQHLDDTHRRVSLRGYQAFGA
FT                   RFALAQRKVILGDEMGLGKTIQAIAVLAHLAAEGQSHFMVVCPASVLVNWTREIEARSA
FT                   LRVMVLHGPDRHYAFADWKGRGGVGVTTFDALRGFPAPGGGEVGLLVVDEAHSVKNPKA
FT                   KRSQAVGLWAERCERTLFMTGTPMENRVAEFRNLVQMLDGDVADSLGERDALAGSVTFR
FT                   KAVAPVYLRRNQEDVLTELPSLQQTDEWEELSASDEEAYREAVRAGNFMAMRRAAYMSS
FT                   GNSAKLERLREIVQEAGENGQKTVVFSNFKDVLAVVKEALAVETTRVTPVFGPLTGGVP
FT                   AQRRQEIVDDFAGVQGPAVLLGQIQAAGVGLNMQAASVVVICEPQIKPTIEHQAVARAH
FT                   RMGQVRPVRVHRLLATGGVDERMVKMLEAKTRLFDAYARRSAVAEATPDAVDVSDTELA
FT                   RRIVEEEQARLGMTDERPTSSEWGVPRSAASPQDPLNGRRESTNANE"
FT   misc_feature    133448..133924
FT                   /note="Pfam match to entry PF00176 SNF2_N, SNF2 and others
FT                   N-terminal domain, score 94.40, E-value 5.5e-25"
FT   misc_feature    134285..134536
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain, score 31.50, E-value 2e-05"
FT   CDS_pept        complement(134937..137768)
FT                   /transl_table=11
FT                   /gene="SCO5065"
FT                   /gene_synonym="SCBAC20F6.08c"
FT                   /product="putative transcriptional regulator"
FT                   /note="SCBAC20F6.08c, possible transcriptional regulator,
FT                   len: 943 aa; similar to many putative transcriptional
FT                   regulatory proteins, e.g. TR:Q9XAT8 (EMBL:U95170)
FT                   Rhodococcus erythropolis ThcG, 927 aa; fasta scores: opt:
FT                   1419 Z-score: 1371.5 bits: 265.1 E(): 8.4e-69; 35.446%
FT                   identity in 931 aa overlap. Contains Pfam match to entry
FT                   PF00196 GerE, Bacterial regulatory proteins, luxR family
FT                   and matches to Prosite entries PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and PS00622 Bacterial regulatory proteins,
FT                   luxR family signature. Also contains possible
FT                   helix-turn-helix motif at residues 893..914 (+3.76 SD)"
FT                   /db_xref="GOA:Q9ADE2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE2"
FT                   /protein_id="CAC37453.1"
FT                   /translation="MKNGERARAGHGSPAAPGPTAGPGPAPAPGPTVVGREAEIAEIRS
FT                   RIAADRSHSSVLIVEGDPGAGKSVLLDLAVRLTRGTGQRVLRAVGSESEASLAFAGLHQ
FT                   MLRPVLDDLGGLPARQRSALRTALGLAEDAEDAADTPDALLVGLAVLTLVSDLSEPAPL
FT                   LVVVDDAQWIDRASLDVLSFLARRMAGEPVTLLMGVRAAAVLPGFDKGYERLEIGPLSG
FT                   DAANRLLDEQPKRPTGRTRARILREAAGNPLALVELARATADREPEGSGVEGPLPVTDR
FT                   LEGIFARHVRHLPEATRRALLLLAAADAADAPAAARGLPEAADTVWAPAERAGLVRQDG
FT                   TGVSFRHPLVRSAVYHAAPFEQRRRAHLALARQLGEEPDRRAWHLAAAAVRPDEQVSAA
FT                   LRETAGRARRRGGHAAAAAALERAAELSPHRADQARLLADAADTAVFTGQLGWVEHLAA
FT                   GARERSDDPALIGRAALATGRLLTLGPHHTAAFALLSRVADEAAATRSPRLLDALAAAA
FT                   VVRYYSGEESQRQRIEALLADVPDSAAGGALRAWVLAVSDPSGAGASLAPALPRLIAAA
FT                   KGEAGSLTALAVVAWLLDRTPLAARTFDEAFGRWQAHGPLPAGLACAAGWAYLEQGRWA
FT                   DARSVAAEIAEVASGAGLDHAEACARTLDATVLALLGEPAEARGSAERALALVAPLESR
FT                   SVAVLARRALGLAAVAEGDYDSAYAQFRAAFTEDGDLVHYHVSPTVLAELAAAAVRRGH
FT                   REPAARLLERSARHLGPGMSARLFLLVERGRALLAEPERAERHFRAALAGEAGEQWPFE
FT                   RAQTRLDYGEWLRRQRRVAEARPLLTGALDTFRRLGARPWIDRAKAELRAAGIEADAAA
FT                   PGALTELSPQQQQIVRLAAHGLTNREIGERLFLSPRTVGSHLYRVFPKLGITARAQLRD
FT                   LLDDALQATGSAQ"
FT   misc_feature    complement(134949..135146)
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 55.50, E-value
FT                   1.2e-12"
FT   misc_feature    complement(135012..135095)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature"
FT   misc_feature    complement(137565..137588)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   regulatory      complement(137774..137777)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      138068..138071
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        138078..138992
FT                   /transl_table=11
FT                   /gene="SCO5066"
FT                   /gene_synonym="SCBAC20F6.09"
FT                   /product="putative beta-lactamase"
FT                   /note="SCBAC20F6.09, possible beta-lactamase, len: 304 aa;
FT                   similar to TR:Q9X7X2 (EMBL:AL049485) Streptomyces
FT                   coelicolor putative beta-lactamase SC6E5.26c, 310 aa; fasta
FT                   scores: opt: 598 Z-score: 696.3 bits: 136.9 E(): 3.4e-31;
FT                   53.115% identity in 305 aa overlap and to SW:BLA1_XANMA
FT                   (EMBL:X75074) Xanthomonas maltophilia
FT                   metallo-beta-lactamase L1 precursor (beta-lactamase, type
FT                   II) (EC 3.5.2.6), 290 aa; fasta scores: opt: 146 Z-score:
FT                   175.9 bits: 40.6 E(): 0.033; 25.952% identity in 289 aa
FT                   overlap. Contains Pfam match to entry PF00753 lactamase_B,
FT                   Metallo-beta-lactamase superfamily and match to Prosite
FT                   entry PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE1"
FT                   /protein_id="CAC37454.1"
FT                   /translation="MDTITLGDVTVTRVREYYGPVGMTPEAFVPDSPAQAWDTHRSWLV
FT                   PDFLDAETRIVNTAIQTWVLRSEGRTILVDTGVGNHKDRPYAPVWSRLETDFLANLARA
FT                   GVQPEDVDIVINTHLHIDHVGWNTYLDGRTWVPTFPNATYLMAKADFDYWNPANEIKTL
FT                   LGRGNQNVFEDSVAPVHEAGLTRLWEDGHRIDSNLRLELAPGHTPGSSVLRLESGSDRG
FT                   LFVGDLMHSPIQIHEPDANSCFCEDPAEARATRRRLLGSAVDSNALVFPAHLGGHGAAE
FT                   VVREGGKFAVKGWAPFTPYTPSV"
FT   misc_feature    138240..138896
FT                   /note="Pfam match to entry PF00753 lactamase_B,
FT                   Metallo-beta-lactamase superfamily, score 53.00, E-value
FT                   6.4e-12"
FT   misc_feature    138288..138320
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site"
FT   regulatory      139001..139006
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        139015..140508
FT                   /transl_table=11
FT                   /gene="SCO5067"
FT                   /gene_synonym="SCBAC20F6.10"
FT                   /product="putative carboxylesterase"
FT                   /note="SCBAC20F6.10, probable carboxylesterase, len: 497
FT                   aa; similar to SW:PNBA_BACSU (EMBL:U06089) Bacillus
FT                   subtilis para-nitrobenzyl esterase (EC 3.1.1.*) PnbA, 489
FT                   aa; fasta scores: opt: 784 Z-score: 827.6 bits: 162.6 E():
FT                   1.6e-38; 37.205% identity in 508 aa overlap. Contains 2x
FT                   Pfam matches to entry PF00135 COesterase, Carboxylesterase
FT                   and match to Prosite entry PS00122 Carboxylesterases type-B
FT                   serine active site"
FT                   /db_xref="GOA:Q9ADE0"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADE0"
FT                   /protein_id="CAC37455.1"
FT                   /translation="MNHHPEPVVTTAQGAVRGLRQEDGTAAFLNIPYAAPPLGAGRFAP
FT                   PRPHEPWDGVRDATVPGPNAPQSERRLGSIDMAPYFGTGWSRGEDYLTVNVFTPATGAG
FT                   DLPVMVFVHGGGFVAGSTRSAMYDGSAFARDGVVLVTLNYRLGIAGFLDIPGAPANRGL
FT                   LDVVAALRWVRENVSAFGGNPHHVTLFGQSAGATVVGGVLATPEADGLFRRAIVQSGSG
FT                   LGAFTPEQAARVTAAAAQALGVEPHVDAFAGIPDERLVEAASGLAGIDLRTGTHFDPLI
FT                   GLSPFSLVLDTQPAASVAAGRAADVDLLVGTNTEEGNLYLVPVGKYATSTAADVDEAAA
FT                   RAHPDPAQLVAAYRTSRPEATFAELRSAVMADALFGAGSRALASAHATHPRAATYAYEF
FT                   AWRSRALDGELGATHAVELPFVFDLADRPELNGPAALLGPEQAPADLAARVHATWIRFA
FT                   RTGDPGWDPYDTDRRATMRIDAEWSQTDDPRSKEREVWS"
FT   misc_feature    139033..139965
FT                   /note="Pfam match to entry PF00135 COesterase,
FT                   Carboxylesterase, score 253.00, E-value 6e-73"
FT   misc_feature    139552..139599
FT                   /note="PS00122 Carboxylesterases type-B serine active site"
FT   misc_feature    140119..140502
FT                   /note="Pfam match to entry PF00135 COesterase,
FT                   Carboxylesterase, score 47.70, E-value 3.2e-13"
FT   CDS_pept        complement(140516..141115)
FT                   /transl_table=11
FT                   /gene="SCO5068"
FT                   /gene_synonym="SCBAC20F6.11c"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SCBAC20F6.11c, possible tetR-family transcriptional
FT                   regulator, len: 199 aa; similar to many actinomycetes
FT                   putative tetR-family transcriptional regulators, e.g.
FT                   TR:Q9RJL5 (EMBL:AL121849) Streptomyces coelicolor putative
FT                   tetR-family transcriptional regulator SCF6.16, 194 aa;
FT                   fasta scores: opt: 419 Z-score: 483.9 bits: 96.4 E():
FT                   2.3e-19; 38.095% identity in 189 aa overlap. Contains Pfam
FT                   match to entry PF00440 tetR, Bacterial regulatory proteins,
FT                   tetR family and possible helix-turn-helix motif at residues
FT                   36..57 (+4.64 SD)"
FT                   /db_xref="GOA:Q9ADD9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="PDB:2REK"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADD9"
FT                   /protein_id="CAC37456.1"
FT                   /translation="MSWENPGPPKRADARRNYDRIIEAAAAEVARHGADASLEEIARRA
FT                   GVGSATLHRHFPSRWGLLQAVFQERVAQLCDEARSLAAEHPPATALTRWLTSLAVFGAV
FT                   TRGAARSLLPATGTNTGAALDSRCEQLLTEAGADLLARAQEDGTVRDDVTALELLSLAN
FT                   AVSLAAEHTPDAAHHATRLMGIALGGLGAPGPRPQG"
FT   misc_feature    complement(140918..141055)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 52.60, E-value
FT                   5.2e-12"
FT   CDS_pept        141271..142227
FT                   /transl_table=11
FT                   /gene="SCO5069"
FT                   /gene_synonym="SCBAC20F6.12"
FT                   /product="putative oxidoreductase"
FT                   /note="SCBAC20F6.12, possible oxidoreductase, len: 318 aa;
FT                   similar to many oxidoreductases/dehydratases, e.g.
FT                   TR:Q9WX20 (EMBL:AL079345) Streptomyces coelicolor putative
FT                   dehydrogenase SCE68.12c, 318 aa; fasta scores: opt: 998
FT                   Z-score: 1062.9  bits: 204.9 E(): 1.3e-51; 52.997% identity
FT                   in 317 aa overlap. Contains Pfam match to entry PF00107
FT                   adh_zinc, Zinc-binding dehydrogenases"
FT                   /db_xref="GOA:Q9ADD8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADD8"
FT                   /protein_id="CAC37457.1"
FT                   /translation="MRAVQFDRFGPPDVLRVNDVPAPRPGPGEVLVEVRAASVDAGETA
FT                   FRAGRMRRVTRVRFPRGLGSDFAGRVAALGSGVRAWSVGDAVWGLMPHLTFGAIADYVA
FT                   VPEQRLARAPQNLDLLEAAALPVVGTTAMTALSGKARLQPGERLLVRGATGGVGSVAVQ
FT                   LGKALGAHVTALAAARNLDWITRLGADEAVDYRTTRPEDLDRFDVIVDVVGTDLGAYRK
FT                   RLARGGRLVALSFDSDRVVSSMLGIALRAAATPRRVKMFSNNPSADRIAELTRAVEAGT
FT                   IRPVVDTVFPMRDIAAVHQRLEAGGVRGKYVVDLRLP"
FT   misc_feature    141310..142215
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenases, score 182.30, E-value 8e-51"
FT   misc_feature    142241..147486
FT                   /note="previously sequenced DNA fragment. EMBL:X62373
FT                   S.coelicolor genes for hydroxyacyl-CoA dehydrogenase"
FT   CDS_pept        complement(142268..143452)
FT                   /transl_table=11
FT                   /gene="SCO5070"
FT                   /gene_synonym="SCBAC20F6.13c"
FT                   /product="hydroxylacyl-CoA dehydrogenase"
FT                   /note="SCBAC20F6.13c, ORFB hydroxylacyl-CoA dehydrogenase,
FT                   len: 394 aa; identical to previously sequenced TR:Q53924
FT                   (EMBL:X62373) Streptomyces coelicolor hydroxylacyl-CoA
FT                   dehydrogenase ORFB, 394 aa. There is an alternative start
FT                   codon 120 base pairs upstream of the previously sequenced
FT                   one"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKI3"
FT                   /protein_id="CAC37458.1"
FT                   /translation="MLSVGHGPRHVLVVARPHPDEPVGGATALALAELVAGGDRRSPAT
FT                   DPEAVTWDIVLCLDPDGAALSEGIETATAGPAPSLASYYRAAFRPVAAEQPEWAPIVGR
FT                   PLPESRALFDVIDDLRPVLQCSLHNVDAGGTWAQLTRDLPGLAAPFAASAAALGVPVQH
FT                   GTYDALYWENPAPGIHVLPPPGSTARPAAGSEDIGLSTWCAPQRYGGATAIVEVPLWAT
FT                   APADDPTPHADPARALRALSGLVREGGRQVTAVFERARGLLPAPEDSPPVRVLEWMAED
FT                   LYDLVADSWGPLVRQAEAGPRTDGSPALTTAGIGALEVVARRQPLRAAGLLLRLLHAAD
FT                   APAAAGLHHELDALFTAWCTDFETSLRLRWVPVHAQVELQARTVVAAAECALTP"
FT   CDS_pept        complement(143809..144249)
FT                   /transl_table=11
FT                   /gene="SCO5071"
FT                   /gene_synonym="SCBAC20F6.14c"
FT                   /product="hydroxylacyl-CoA dehydrogenase"
FT                   /note="SCBAC20F6.14c, ORFA hydroxylacyl-CoA dehydrogenase,
FT                   len: 146 aa; identical to previously sequenced TR:Q53925
FT                   (EMBL:X62373) Streptomyces coelicolor hydroxylacyl-CoA
FT                   dehydrogenase ORFA, 146 aa"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKI2"
FT                   /protein_id="CAC37459.1"
FT                   /translation="MTITALPTGLYAEVLSFYGHQMQKLDGRDFAGYAATFTEDGEFRH
FT                   SPSLPAAHTRAGITAVLEDFHRKFDARKIQRRHWFDHTALSQASDGSITATSYCLVLTV
FT                   HADVKAPEFGPSCLVHDVLVRGADGELLLRSRHVTHDHVFPA"
FT   misc_feature    144323..144841
FT                   /note="Pfam match to entry PF02737 3HCDH_N,
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD binding domain, score
FT                   78.20, E-value 1.7e-19"
FT   CDS_pept        144323..145246
FT                   /transl_table=11
FT                   /gene="SCO5072"
FT                   /gene_synonym="SCBAC20F6.15"
FT                   /product="hydroxylacyl-CoA dehydrogenase"
FT                   /note="SCBAC20F6.15, ORF1 hydroxylacyl-CoA dehydrogenase,
FT                   len: 307 aa; identical to previously sequenced TR:Q53926
FT                   (EMBL:X62373) Streptomyces coelicolor hydroxylacyl-CoA
FT                   dehydrogenase ORF1, 307 aa. Contains Pfam matches to
FT                   entries PF02737 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenase,
FT                   NAD binding domain and PF00725 3HCDH, 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain. Contains possible
FT                   hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q7AKI1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKI1"
FT                   /protein_id="CAC37460.1"
FT                   /translation="MSTVTVIGAGTIGLGWINLFSARGLTVRVNSRRPDVRRVVHEALE
FT                   LFSPGRVDELAARIEYEPDVGRAVAGADVVSENAPDDLPLKQRLFAEIGAAAPDHALVL
FT                   SSTSKLLPDELSRDMPGPGRLVVAHPFNPPHIVPLVEVVRGERTDPEAVERTLAFLASV
FT                   GRTPVVVRRALPGFAANRLQSALLRESIHLVLEGVVTVEELDRIVTDSIGLRWSTIGPF
FT                   HAFHLGGGPGGLRKWLEHLGSGLEQGWRGLGQPALTPQAVEALVAQTEAAYGHRPYAEL
FT                   VRDRDDRHLAVLAALERTEQPQEETK"
FT   misc_feature    144848..145156
FT                   /note="Pfam match to entry PF00725 3HCDH, 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain, score -8.40, E-value
FT                   0.048"
FT   regulatory      145233..145237
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145243..146232
FT                   /transl_table=11
FT                   /gene="SCO5073"
FT                   /gene_synonym="SCBAC20F6.16"
FT                   /product="putative oxidoreductase"
FT                   /note="SCBAC20F6.16, ORF2, possible oxidoreductase, len:
FT                   329 aa; identical to previously sequenced TR:Q53927
FT                   (EMBL:X62373) Streptomyces coelicolor genes for
FT                   hydroxylacyl-CoA dehydrogenase ORF2, 329 aa. Contains Pfam
FT                   match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenases and match to Prosite entry PS01162 Quinone
FT                   oxidoreductase / zeta-crystallin signature"
FT                   /db_xref="GOA:Q7AKI0"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKI0"
FT                   /protein_id="CAC37461.1"
FT                   /translation="MMRAVQFDRYGDPDVLYVAERPVPEPGPGQVRIAVDAVSVGHAQT
FT                   QMRREAFPAPMWRPVFPVVLGGDVVGRITAVGPGVTALRPGDRVGAFTLYGAYAEQVVV
FT                   DAVTVVPVPEELDAAEAAVLPGTGLIALGILRTGRLRKGETVLIHAAAGGVGHIAVQLA
FT                   RAAGAGLIIGTAGAAAKREFARATGADAVVDHRSAHWADEVRELTGGRGPDLILDGIGA
FT                   EVLEQGVGLLAPGGRLVFYGSSGGELAIPKVSVMDLIGIKYVTGFALSAWRGGRPQEYE
FT                   AGVAELTRLLAEGQVTSAVHARLPLERAAEAHAVVEARAQLGRVVLVP"
FT   misc_feature    145285..146229
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenases, score 276.60, E-value 3.3e-79"
FT   misc_feature    145669..145734
FT                   /note="PS01162 Quinone oxidoreductase / zeta-crystallin
FT                   signature"
FT   regulatory      146285..146290
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        146299..146943
FT                   /transl_table=11
FT                   /gene="SCO5074"
FT                   /gene_synonym="SCBAC20F6.17"
FT                   /product="putative dehydratase"
FT                   /note="SCBAC20F6.17, possible dehydratase, len: 214 aa;
FT                   identical to previously sequenced TR:Q53928 (EMBL:X62373)
FT                   Streptomyces coelicolor ORF 3, 214 aa. Similar to TR:Q56172
FT                   (EMBL:L37334) putative dehydratase from granaticin
FT                   biosynthesis cluster of Streptomyces violaceoruber Tu22
FT                   (221 aa) fasta scores; opt: 349, Z-score: 400.9, E():
FT                   1.1e-14, 35.465% identity (37.195% ungapped) in 172 aa
FT                   overlap."
FT                   /db_xref="UniProtKB/TrEMBL:Q9ADD7"
FT                   /protein_id="CAC37462.1"
FT                   /translation="MTSSLHHAIRLTTASAIALGGLVTLGTSAHAASVAVPYECRTWVQ
FT                   GNTHPVYDYARGFDVSVPASVRAGKKFKATYDPDPITAFAEYNQIVNDVRIAYRIPDGA
FT                   KVHKVRLTGGSGLGDSDVRVQVKGRDIVVSASGPFQGGVEFDLPTLKVTYKAPKTTGPL
FT                   NFVSGGSGYEDPGFYWYRYQPILDEWGPFECFPDPAKPEAVLASTQVKKHK"
FT   regulatory      146968..146971
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        146977..147897
FT                   /transl_table=11
FT                   /gene="SCO5075"
FT                   /gene_synonym="ORF4"
FT                   /gene_synonym="SCBAC28G1.01"
FT                   /gene_synonym="SCBAC20F6.18"
FT                   /product="putative oxidoreductase"
FT                   /note="SCBAC28G1.01, possible oxidoreductase, previously
FT                   sequenced as ORF4, len: 167 aa; identical to C-terminal
FT                   region of previously sequenced TR:Q53929 (EMBL:X62373)
FT                   Streptomyces coelicolor ORF4, 306 aa; fasta scores: opt:
FT                   1029 Z-score: 1146.7 bits: 219.4 E(): 2.9e-56; 95.808%
FT                   identity in 167 aa overlap. Contains match to Prosite entry
FT                   PS01162 Quinone oxidoreductase / zeta-crystallin signature"
FT                   /note="SCBAC20F6.18, ORF4, possible oxidoreductase, len:
FT                   170 aa; identical to N-terminal region of the previously
FT                   sequenced TR:Q53929 (EMBL:X62373) Streptomyces coelicolor
FT                   ORF 4, 306 aa. Contains match to Prosite entry PS01162
FT                   Quinone oxidoreductase / zeta-crystallin signature"
FT                   /db_xref="GOA:Q8CJS3"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CJS3"
FT                   /protein_id="CAD55222.1"
FT                   /translation="MPKAVAIHQFGGPDVLGLVDVPEPVPGPGQVTVRVRAAGVNGFDC
FT                   RVRSGGMRGRYPVEFPQIIGNEFAGVVERTGPEATGFAPGDEVLGFAVLQSGTELLAVG
FT                   ADQITVKPPELSWEVAGSLSAVGQTADIALAELRVGPGDTVLVHAAAGGVGSLAVQLVR
FT                   ERGGTAIGSAGEHNHDYLRSLGALPVAYGPGFADRVRALAPNGVDAALDCHGGPEALAV
FT                   SLELVADRARIATVANFRAAAQEGIVMPRVVRSAERLAALAALCAEGRLRPHVEAVLPF
FT                   AKAAEAHHRLEQGHVRGKLVLVPDL"
FT   misc_feature    147394..147910
FT                   /note="previously sequenced DNA fragment. EMBL:X62373
FT                   S.coelicolor genes for hydroxyacyl-CoA dehydrogenase"
FT   misc_feature    147400..147465
FT                   /note="PS01162 Quinone oxidoreductase / zeta-crystallin
FT                   signature"
FT   misc_feature    147876..153275
FT                   /note="previously sequenced DNA fragment. EMBL:X58833.1
FT                   S.coelicolor 6 actVA region genes of the actinorhodin
FT                   biosynthetic gene cluster"
FT   CDS_pept        147894..149495
FT                   /transl_table=11
FT                   /gene="SCO5076"
FT                   /gene_synonym="actVA1"
FT                   /gene_synonym="SCBAC28G1.02"
FT                   /product="integral membrane protein"
FT                   /note="SCBAC28G1.02, actVA1, probable integral membrane
FT                   protein, len: 533 aa; identical to previously sequenced
FT                   TR:Q53903 (EMBL:X58833) Streptomyces coelicolor 6 ActVA
FT                   region genes of the actinorhodin biosynthetic gene cluster,
FT                   ActVA1, 533 aa. Contains possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q7AKH9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH9"
FT                   /protein_id="CAC44189.1"
FT                   /translation="MTANPGRPGGPADQGHPRRWAILGVLVLSLVGIILDNTVLNVTLR
FT                   TLTDPEQGLGASHSQVEWVLSAYTLAFAATLFTWGVLGDRLGRRRVLLLGLGLFGLSSL
FT                   AGAYAGSPEQLIAARACMGVSGAAVLPSTLATIAAVFPLRERPKALGIWAASVGFALGI
FT                   GPVTGGILLAHFWWGSVLLVNVPLMAGCLVAVVLVVPETRGTAGRRVDAAGLLLSIAGV
FT                   VPLVYAIIEAGRSGGVTRPAVWAAGLAGLGLLLVFLWHERRTPEPSLELGFFRMKAFST
FT                   AVAAVGFVSFAMMGFLFFSAFYLQSVRGYTPLQAGGCTVALAVANVVCGPLSTVLVRSI
FT                   GPRNVCAAGMLAVTASLCGVTFVTQHAPVWLILVLFAALGAGVACVMPTAAVSIMNAIP
FT                   REKAGVASAMNNTVRQLGGALGVAVLGSLMGAAYRRGIEDELAVLPPSARHQAGESLDA
FT                   TLLAATRLGESGLVGPARQAFLDAMHLAAGAAAAVALVGALAVLRWLPSSVTTPTPPAG
FT                   AVPGREHSDHLKVQGS"
FT   regulatory      149485..149489
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        149497..149892
FT                   /transl_table=11
FT                   /gene="SCO5077"
FT                   /gene_synonym="actVA2"
FT                   /gene_synonym="SCBAC28G1.03"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC28G1.03, actVA2, hypothetical protein, len: 131
FT                   aa; identical to previously sequenced TR:Q53904
FT                   (EMBL:X58833) Streptomyces coelicolor 6 ActVA region genes
FT                   of the actinorhodin biosynthetic gene cluster, ActVA2, 131
FT                   aa"
FT                   /db_xref="GOA:Q93IZ3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024031"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IZ3"
FT                   /protein_id="CAC44190.1"
FT                   /translation="MPFTPDELEYYASQNLGRLATVAPDGQPQANPVSFRVNTETGTID
FT                   IGGHNLTASKKFRNVTKHDQVAFVVDDLISTQPWNVRGIEVRGRAEALTDAQPPHPYFG
FT                   TAMIRIHPKRIITWGLGGDAAQRGRDV"
FT   regulatory      149974..149978
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        149987..150832
FT                   /transl_table=11
FT                   /gene="SCO5078"
FT                   /gene_synonym="actVA3"
FT                   /gene_synonym="SCBAC28G1.04"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC28G1.04, actVA3, hypothetical protein, len: 281
FT                   aa; identical to previously sequenced TR:Q53905
FT                   (EMBL:X58833) Streptomyces coelicolor 6 ActVA region genes
FT                   of the actinorhodin biosynthetic gene cluster, ActVA3, 281
FT                   aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IZ2"
FT                   /protein_id="CAC44191.1"
FT                   /translation="MSTEIFHEEFAGGLVTEGPGAPWRLRPVDGLEAGDGLVRGGPDGL
FT                   VVVPSAAHPGTRRPAFTEPKPGPDGTPLHLRWGAFTTGGTTGGTAGARAAFTAVPGERL
FT                   SVRAEMGLRGFGLRSHPYDDVTEPDADARLGAGGLISVDLESGIIFDFFLTHSRLYAVY
FT                   ERLALRPDAEFAAFTYCVPVADRTPGTLHRLEVGYDVAAGTAHWTADGQEVLSVDRIGF
FT                   RALDARWLRRDNGGREEAVRPRGLSFGLGLFLERHFGQGVRLSVRRLSVLTSPAGSRDS
FT                   "
FT   regulatory      150844..150849
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        150857..151741
FT                   /transl_table=11
FT                   /gene="SCO5079"
FT                   /gene_synonym="actVA4"
FT                   /gene_synonym="SCBAC28G1.05"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCBAC28G1.05, actVA4, conserved hypothetical
FT                   protein, len: 294 aa; identical to previously sequenced
FT                   TR:Q53906 (EMBL:X58833) Streptomyces coelicolor 6 ActVA
FT                   region genes of the actinorhodin biosynthetic gene cluster,
FT                   ActVA4, 294 aa"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH8"
FT                   /protein_id="CAC44192.1"
FT                   /translation="MPDENKPVLVLGATGKQGGSAARYLLERGWTVRAFVRDPGAPKAK
FT                   ELRELGASLHTGDLEDAGSVRAAMKGAYGVFSIQTPMTPAGVEGEERQGKICADAARDL
FT                   GVQHYVHSSVGGAERPEGVNWRLSKLAIEQRIQENALRFTFLRPSYFMENLNHDMSPLV
FT                   MEDGVLTFRRGLGPANTLQMISGPDIGYFAADAFDDPDTFGGAKIELAGDELTGEQIAA
FT                   AFGRHTGLPARFVSVPIPELHRTGFEWQAISYTWLNGIGYHADIPTLRARFPQLLTLDQ
FT                   WLARTGWTPRDPA"
FT   regulatory      151726..151729
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        151738..152883
FT                   /transl_table=11
FT                   /gene="SCO5080"
FT                   /gene_synonym="actVA5"
FT                   /gene_synonym="SCBAC28G1.06"
FT                   /product="putative hydrolase"
FT                   /note="SCBAC28G1.06, actVA5, possible hydrolase, len: 381
FT                   aa; identical to previously sequenced TR:Q53907
FT                   (EMBL:X58833) Streptomyces coelicolor 6 ActVA region genes
FT                   of the actinorhodin biosynthetic gene cluster, ActVA5, 381
FT                   aa and similar to TR:Q9F0J3 (EMBL:AF218066) Streptomyces
FT                   arenae hydrolase NcnH, 405 aa; fasta scores: opt: 1391
FT                   Z-score: 1521.5 bits: 290.3 E(): 3.9e-77; 56.522% identity
FT                   in 368 aa overlap"
FT                   /db_xref="GOA:Q7AKH7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH7"
FT                   /protein_id="CAC44193.1"
FT                   /translation="MSEDTMTQERPSLTAHARRIAELAGKRAADAEQQRRLSPDVVDAV
FT                   LRAGFAAHFVPVAHGGRAATFGELVEPVAVLGEACASTAWYASLTASLGRMAAYLPDEG
FT                   QAELWSDGPDALIVGALMPLGRAEKTPGGWHVSGTWPFVSVVDHSDWALICAKVGEEPW
FT                   FFAVPRQEYGIVDSWYPMGMRGTGSNTLVLDGVFVPDARACTRAAIAAGLGPDAEAICH
FT                   TVPMRAVNGLAFALPMLGAARGAAAVWTSWTAGRLAGPTGQNAVSSQDRVVYEHTLARA
FT                   TGEIDAAQLLLERVAAVADAGSATGVLVGRGARDCALAAELLTAATDRLFASAGTRAQA
FT                   QDSPMQRLWRDVHAAGSHIGLQFGPGAALYAGELLRRSNDG"
FT   regulatory      152863..152868
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        152876..153217
FT                   /transl_table=11
FT                   /gene="SCO5081"
FT                   /gene_synonym="actVA6"
FT                   /gene_synonym="SCBAC28G1.07"
FT                   /product="hypothetical protein"
FT                   /note="SCBAC28G1.07, actVA6, hypothetical protein, len: 113
FT                   aa; identical to previously sequenced TR:Q53908
FT                   (EMBL:X58833) Streptomyces coelicolor 6 ActVA region genes
FT                   of the actinorhodin biosynthetic gene cluster, ActVA6, 113
FT                   aa and similar to SW:TCMH_STRGA (EMBL:M80674) Streptomyces
FT                   glaucescens tetracenomycin polyketide synthesis hydroxylase
FT                   TcmH, 112 aa; fasta scores: opt: 193 Z-score: 247.6 bits:
FT                   51.0 E(): 3.5e-06; 43.210% identity in 81 aa overlap"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH6"
FT                   /protein_id="CAC44194.1"
FT                   /translation="MAEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPG
FT                   FLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFM
FT                   TPRGAILPS"
FT   misc_feature    152991..158890
FT                   /note="previously sequenced DNA fragment. EMBL:M64683
FT                   Streptomyces coelicolor ORF1-4 (actII) gene, complete cds"
FT   CDS_pept        complement(153183..153962)
FT                   /transl_table=11
FT                   /gene="SCO5082"
FT                   /gene_synonym="actII-1"
FT                   /gene_synonym="SCBAC28G1.08c"
FT                   /product="putative transcriptional regulatory protein"
FT                   /note="SCBAC28G1.08c, actII-1, probable transcriptional
FT                   regulatory protein, len: 259 aa; identical to previously
FT                   sequenced TR:Q53901 (EMBL:M64683) Streptomyces coelicolor
FT                   ORF1-4 (ActII), 259 aa. Contains Pfam matches to entries
FT                   PF00440 tetR, Bacterial regulatory proteins, tetR family
FT                   and PF02909 tetR_C, Tetracyclin repressor, C-terminal
FT                   all-alpha domain and possible helix-turn-helix motif at
FT                   residues 53..73 (+2.78 SD)"
FT                   /db_xref="GOA:Q7AKH5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH5"
FT                   /protein_id="CAC44195.1"
FT                   /translation="MSRSEEGRPMPEEIPVPPWRRPKKAPPRMPLTQDRIVVTALGILD
FT                   AEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQV
FT                   KEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLL
FT                   STFVTAEALEQSSRNPGTEQGREQAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDS
FT                   DRRFELGLEIIIAGLLAGAGEAADDQVRTAGSPPAES"
FT   misc_feature    complement(153240..153683)
FT                   /note="Pfam match to entry PF02909 tetR_C, Tetracyclin
FT                   repressor, C-terminal all-alpha domain, score 217.30,
FT                   E-value 2.2e-61"
FT   misc_feature    complement(153717..153857)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 43.50, E-value
FT                   1.3e-09"
FT   regulatory      complement(153968..153971)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        154073..155809
FT                   /transl_table=11
FT                   /gene="SCO5083"
FT                   /gene_synonym="actII-2"
FT                   /gene_synonym="SCBAC28G1.09"
FT                   /product="putative actinorhodin transporter"
FT                   /note="SCBAC28G1.09, actII-2, probable actinorhodin
FT                   transporter, len: 578 aa; identical to previously sequenced
FT                   SW:AC22_STRCO (EMBL:M64683) Streptomyces coelicolor
FT                   probable actinorhodin transporter ActII-2, 578 aa. Contains
FT                   possible hydrophobic membrane spanning regions and a
FT                   leucine TTA codon, possible target for bldA regulation"
FT                   /db_xref="GOA:P46105"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46105"
FT                   /protein_id="CAC44196.1"
FT                   /translation="MSSVEADEPDRATAPPSALLPEDGPGPDGTAAGPPPYARRWAALG
FT                   VILGAEIMDLLDGTVMNVAAPAVRADLGGSLSVIQWITVGYTLAFAVLLVVGGRLGDIY
FT                   GRKRMFVVGAVGFTAASVLCSVAAGPEMLTAARFLQGGLGALMIPQGLGLIKQMFPPKE
FT                   TAAAFGAFGPAIGLGAVLGPIVAGFLVDADLFGTGWRSVFLINLPIGVAVIVGAVLLLP
FT                   EGKAPVRPKFDVVGMALVTSGLTLLIFPLVQGRERGWPAWAFVLMLAGAAVLVGFVAHE
FT                   LRQERRGGATLIELSLLRRSRYAAGLAVALVFFTGVSGMSLLLALHLQIGLGFSPTRAA
FT                   LTMTPWSVFLVVGAILTGAVLGSKFGRKALHGGLVVLALGVLIMLLTIGDQAGGLTSWE
FT                   LVPGIAVAGLGMGIMIGLLFDIALADVDKQEAGTASGVLTAVQQLGFTVGVAVLGTLFF
FT                   GLLGSQATASVDDGASRARTELAAAGASTTEQDRLLADLRVCLRESASQQDSERTPDSC
FT                   RNLQQARPAVAEATARAWRTAHTENFSTAMVRTLWVVIALLAVSFALAFRLPPKPREEE
FT                   GF"
FT   misc_feature    154127..154129
FT                   /note="TTA leucine codon; possible target for bldA
FT                   regulation"
FT   CDS_pept        155809..157944
FT                   /transl_table=11
FT                   /gene="SCO5084"
FT                   /gene_synonym="actII-3"
FT                   /gene_synonym="SCBAC28G1.10"
FT                   /product="putative membrane protein"
FT                   /note="SCBAC28G1.10, actII-3, putative membrane protein,
FT                   len: 711 aa; identical to previously sequenced
FT                   SW:MMLA_STRCO (EMBL:M64683) Streptomyces coelicolor
FT                   putative membrane protein ActII-3, 711 aa. Contains
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q53902"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q53902"
FT                   /protein_id="CAC44197.1"
FT                   /translation="MTRTLLSWPGGRRLKWLVLAAWIGLLIVLQPLAGKLGDVESNDAA
FT                   AWLPGNAESTEVLELSEKFQPADTSPTVIVYDRPSGITAADEAKARADATHFADGTGVV
FT                   GEPYGPVRSDDGKALRTVVNVHLGKDGWEGLNAAAKDMRAIARPSAPDGLGVHVTGPTG
FT                   YAADSAESFSSADFKLTLVTLLIVVTILVVTYRSPLLWLLPMISAGMSLVISQAIVYLL
FT                   AKNAGLTVNAQTAMILTVLVLGAATDYALLLVARYREELRRHEDRHEAMAVALRRAGPA
FT                   IVASAATVAVSMLVLLLAALNSTKGLGPVCAVGVLVGLLSMMTLLPALLVIFGRWVFWP
FT                   ARPKHGTEPDVTRGLWSRIARLVSGRPRAVWVTTSLLLGAVATLAVTLNADGLQQKDGF
FT                   KTKPESVVGEEILTRHFPAGSGEPMVVIAKGASADQVHAALETVPGVIEVAPPQVKDGL
FT                   AYVEATLGAGADSPAAMRSVTAARETLARLDGAQARVGGSSAVVHDMREASSRDRGLII
FT                   PVILAVVFCILALLLRALVAPLLLIASVVLSFFTALGLAALFFNHVFDFAGADSAFPLW
FT                   VFVFLVALGVDYNIFLVTRIKEESDRLGTRQGALKGLTSTGGVITAAGLVLAGTFAALA
FT                   TLPLVFIAELGFTVAVGVLLDTMIVRSVLVTALTLDVGRWMWWPHPLARREDPSEDPAV
FT                   SGMPDSIDSEASTTASR"
FT   stem_loop       157951..157993
FT                   /note="possible stem loop. Score 60: 20/20 (100%) matches,
FT                   0 gaps"
FT   misc_feature    157957..157962
FT                   /note="AseI site matched ATTAAT. Divides the AseI-K and the
FT                   AseI-N genomic restriction fragments"
FT                   /note="Cleavage site for AseI restriction endonuclease
FT                   AT*TAAT."
FT   misc_feature    complement(157957..157962)
FT                   /note="Cleavage site for AseI restriction endonuclease
FT                   AT*TAAT."
FT   misc_feature    157983..157988
FT                   /note="AseI site matched ATTAAT. Divides the AseI-K and the
FT                   AseI-N genomic restriction fragments"
FT                   /note="Cleavage site for AseI restriction endonuclease
FT                   AT*TAAT."
FT   misc_feature    complement(157983..157988)
FT                   /note="Cleavage site for AseI restriction endonuclease
FT                   AT*TAAT."
FT   CDS_pept        158094..158861
FT                   /transl_table=11
FT                   /gene="SCO5085"
FT                   /gene_synonym="actII-4"
FT                   /gene_synonym="SCBAC28G1.11"
FT                   /product="actinorhodin cluster activator protein"
FT                   /note="SCBAC28G1.11, actII-4, actinorhodin cluster
FT                   activator protein, len: 255 aa; identical to previously
FT                   sequenced SW:AC24_STRCO (EMBL:M64683) Streptomyces
FT                   coelicolor actinorhodin operon activator protein ActII-4,
FT                   255 aa. Contains a leucine TTA codon, possible target for
FT                   bldA regulation"
FT                   /db_xref="GOA:P46106"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46106"
FT                   /protein_id="CAC44198.1"
FT                   /translation="MRFNLLGRVHVITDAGCVIPLKSSKATQLLVLLLLRRHEVVGSGV
FT                   LIEELWADHPPRSAMTTLQTYVYHTRRLLGEHRVTSDDRELVLTQPPGYFALIDEDELD
FT                   VAVAERLIRTGGRLLEENRLEEALASLDAGLDLWRGPALSTVPCGRVLESNIAHLEELR
FT                   LFGMQLRIDANWRLGRIGPMIPELRSLVISHPLNETLHAKLMGALCQMGRRAEALESYR
FT                   NLRRILSDELGVDPTPEIQRMHMEILNGEKVLV"
FT   misc_feature    158106..158108
FT                   /note="TTA leucine codon; possible target for bldA
FT                   regulation"
FT   misc_feature    complement(158795..159829)
FT                   /note="previously sequenced DNA fragment. EMBL:M19536
FT                   S.coelicolor actIII gene, complete cds."
FT   stem_loop       158864..158928
FT                   /note="possible stem loop. Score 96: 32/32 (100%) matches,
FT                   0 gaps"
FT   CDS_pept        complement(158935..159720)
FT                   /transl_table=11
FT                   /gene="SCO5086"
FT                   /gene_synonym="actIII"
FT                   /gene_synonym="SCBAC28G1.12c"
FT                   /product="ketoacyl reductase"
FT                   /note="SCBAC28G1.12c, actIII, ketoacyl reductase, len: 261
FT                   aa; identical to previously sequenced SW:ACT3_STRCO
FT                   (EMBL:M19536) Streptomyces coelicolor putative ketoacyl
FT                   reductase ActIII, 261 aa. Contains Pfam matches to entries
FT                   PF00106 adh_short, short chain dehydrogenase and PF00678
FT                   adh_short_C2, Short chain dehydrogenase/reductase
FT                   C-terminus and match to Prosite entry PS00061 Short-chain
FT                   dehydrogenases/reductases family signature"
FT                   /db_xref="GOA:P16544"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:1W4Z"
FT                   /db_xref="PDB:1X7G"
FT                   /db_xref="PDB:1X7H"
FT                   /db_xref="PDB:1XR3"
FT                   /db_xref="PDB:2RH4"
FT                   /db_xref="PDB:2RHC"
FT                   /db_xref="PDB:2RHR"
FT                   /db_xref="PDB:3CSD"
FT                   /db_xref="PDB:3QRW"
FT                   /db_xref="PDB:3RI3"
FT                   /db_xref="PDB:4DBZ"
FT                   /db_xref="PDB:4DC0"
FT                   /db_xref="PDB:4DC1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16544"
FT                   /protein_id="CAC44199.1"
FT                   /translation="MATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRT
FT                   TLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELAD
FT                   ELWLDVVETNLTGVFRVTKQVLKAGGMLERGTGRIVNIASTGGKQGVVHAAPYSASKHG
FT                   VVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEVSTEEAFDRITARVP
FT                   IGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGNY"
FT   misc_feature    complement(158959..159051)
FT                   /note="Pfam match to entry PF00678 adh_short_C2, Short
FT                   chain dehydrogenase/reductase C-terminus, score 25.80,
FT                   E-value 1.4e-05"
FT   misc_feature    complement(159142..159702)
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 302.10, E-value 6.8e-87"
FT   misc_feature    complement(159205..159291)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature"
FT   regulatory      159792..159795
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        159801..161204
FT                   /transl_table=11
FT                   /gene="SCO5087"
FT                   /gene_synonym="actIORF1"
FT                   /gene_synonym="SCBAC28G1.13"
FT                   /product="actinorhodin polyketide beta-ketoacyl synthase
FT                   alpha subunit"
FT                   /note="SCBAC28G1.13, actIORF1, actinorhodin polyketide
FT                   beta-ketoacyl synthase alpha subunit, len: 467 aa;
FT                   identical to C-terminal region of SW:KASA_STRCO
FT                   (EMBL:X63449) Streptomyces coelicolor actinorhodin
FT                   polyketide putative beta-ketoacyl synthase 1 ActI ORF1, 424
FT                   aa. Previously sequenced start codon at residue 44 of this
FT                   sequence. Also similar to TR:CAB45606 (EMBL:AL079356)
FT                   Streptomyces coelicolor polyketide beta-ketoacyl synthase
FT                   alpha (WhiE locus) SC6G9.15, 424 aa; fasta scores: opt:
FT                   1706 Z-score: 1660.2 bits: 316.4 E(): 9.5e-87; 61.871%
FT                   identity in 417 aa overlap. Contains Pfam matches to
FT                   entries PF00109 ketoacyl-synt, Beta-ketoacyl synthase,
FT                   N-terminal domain and PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain and match to
FT                   Prosite entry PS00606 Beta-ketoacyl synthases active site"
FT                   /db_xref="GOA:Q02059"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="PDB:1QXG"
FT                   /db_xref="PDB:1TQY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02059"
FT                   /protein_id="CAC44200.1"
FT                   /translation="MPLDAAPVDPASRGPVSAFEPPSSHGADDDDDHRTNASKELFGLK
FT                   RRVVITGVGVRAPGGNGTRQFWELLTSGRTATRRISFFDPSPYRSQVAAEADFDPVAEG
FT                   FGPRELDRMDRASQFAVACAREAFAASGLDPDTLDPARVGVSLGSAVAAATSLEREYLL
FT                   LSDSGRDWEVDAAWLSRHMFDYLVPSVMPAEVAWAVGAEGPVTMVSTGCTSGLDSVGNA
FT                   VRAIEEGSADVMFAGAADTPITPIVVACFDAIRATTARNDDPEHASRPFDGTRDGFVLA
FT                   EGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGREMAETIRVALDESR
FT                   TDATDIDYINAHGSGTRQNDRHETAAYKRALGEHARRTPVSSIKSMVGHSLGAIGSLEI
FT                   AACVLALEHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGGFQSAMVLR
FT                   DAETAGAAA"
FT   misc_feature    159824..165109
FT                   /note="previously sequenced DNA fragment. EMBL:X63449
FT                   S.coelicolor genes actIORF1, actIORF2, actIORF3, actVII,
FT                   actIV and actVB for beta-ketoacyl synthase/acyl
FT                   transferase, acyl carrier protein, cyclase/dehydrase,
FT                   dehydrase and dimerase"
FT   misc_feature    159933..160682
FT                   /note="Pfam match to entry PF00109 ketoacyl-synt,
FT                   Beta-ketoacyl synthase, N-terminal domain, score 310.40,
FT                   E-value 2.2e-89"
FT   misc_feature    160407..160457
FT                   /note="PS00606 Beta-ketoacyl synthases active site"
FT   misc_feature    160707..161183
FT                   /note="Pfam match to entry PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain, score 248.10,
FT                   E-value 1.2e-70"
FT   misc_feature    161201..161923
FT                   /note="Pfam match to entry PF00109 ketoacyl-synt,
FT                   Beta-ketoacyl synthase, N-terminal domain, score 279.40,
FT                   E-value 4.5e-80"
FT   CDS_pept        161201..162424
FT                   /transl_table=11
FT                   /gene="SCO5088"
FT                   /gene_synonym="actIORF2"
FT                   /gene_synonym="SCBAC28G1.14"
FT                   /product="actinorhodin polyketide beta-ketoacyl synthase
FT                   beta subunit"
FT                   /note="SCBAC28G1.14, actIORF2, actinorhodin polyketide
FT                   beta-ketoacyl synthase beta subunit (also known as chain
FT                   length factor), len: 407 aa; identical to previously
FT                   sequenced SW:KASB_STRCO (EMBL:X63449) Streptomyces
FT                   coelicolor actinorhodin polyketide putative beta-ketoacyl
FT                   synthase 2 ActI ORF2, 407 aa. Contains Pfam matches to
FT                   entries PF00109 ketoacyl-synt, Beta-ketoacyl synthase,
FT                   N-terminal domain and PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain"
FT                   /db_xref="GOA:Q02062"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="PDB:1QXG"
FT                   /db_xref="PDB:1TQY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02062"
FT                   /protein_id="CAC44201.1"
FT                   /translation="MSVLITGVGVVAPNGLGLAPYWSAVLDGRHGLGPVTRFDVSRYPA
FT                   TLAGQIDDFHAPDHIPGRLLPQTDPSTRLALTAADWALQDAKADPESLTDYDMGVVTAN
FT                   ACGGFDFTHREFRKLWSEGPKSVSVYESFAWFYAVNTGQISIRHGMRGPSSALVAEQAG
FT                   GLDALGHARRTIRRGTPLVVSGGVDSALDPWGWVSQIASGRISTATDPDRAYLPFDERA
FT                   AGYVPGEGGAILVLEDSAAAEARGRHDAYGELAGCASTFDPAPGSGRPAGLERAIRLAL
FT                   NDAGTGPEDVDVVFADGAGVPELDAAEARAIGRVFGREGVPVTVPKTTTGRLYSGGGPL
FT                   DVVTALMSLREGVIAPTAGVTSVPREYGIDLVLGEPRSTAPRTALVLARGRWGFNSAAV
FT                   LRRFAPTP"
FT   misc_feature    161951..162412
FT                   /note="Pfam match to entry PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain, score 188.60,
FT                   E-value 1e-52"
FT   regulatory      162439..162442
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        162449..162709
FT                   /transl_table=11
FT                   /gene="SCO5089"
FT                   /gene_synonym="actIORF3"
FT                   /gene_synonym="SCBAC28G1.15"
FT                   /product="actinorhodin polyketide synthase acyl carrier
FT                   protein"
FT                   /note="SCBAC28G1.15, actIORF3, actinorhodin polyketide
FT                   synthase acyl carrier protein, len: 86 aa; identical to
FT                   previously sequenced SW:ACPA_STRCO (EMBL:X63449)
FT                   Streptomyces coelicolor actinorhodin polyketide synthase
FT                   acyl carrier protein ActI ORF3, 86 aa. Contains Pfam match
FT                   to entry PF00550 pp-binding, Phosphopantetheine attachment
FT                   site and match to Prosite entry PS00012 Phosphopantetheine
FT                   attachment site"
FT                   /db_xref="GOA:Q02054"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="PDB:1AF8"
FT                   /db_xref="PDB:1NNZ"
FT                   /db_xref="PDB:2AF8"
FT                   /db_xref="PDB:2K0X"
FT                   /db_xref="PDB:2K0Y"
FT                   /db_xref="PDB:2KG6"
FT                   /db_xref="PDB:2KG8"
FT                   /db_xref="PDB:2KG9"
FT                   /db_xref="PDB:2KGA"
FT                   /db_xref="PDB:2KGC"
FT                   /db_xref="PDB:2KGD"
FT                   /db_xref="PDB:2KGE"
FT                   /db_xref="PDB:2MVU"
FT                   /db_xref="PDB:2MVV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02054"
FT                   /protein_id="CAC44202.1"
FT                   /translation="MATLLTTDDLRRALVECAGETDGTDLSGDFLDLRFEDIGYDSLAL
FT                   METAARLESRYGVSIPDDVAGRVDTPRELLDLINGALAEAA"
FT   misc_feature    162482..162682
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site, score 68.00, E-value
FT                   3.4e-17"
FT   misc_feature    162557..162604
FT                   /note="PS00012 Phosphopantetheine attachment site"
FT   regulatory      162698..162701
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        162706..163656
FT                   /transl_table=11
FT                   /gene="SCO5090"
FT                   /gene_synonym="actVII"
FT                   /gene_synonym="SCBAC28G1.16"
FT                   /product="actinorhodin polyketide synthase bifunctional
FT                   cyclase/dehydratase"
FT                   /note="SCBAC28G1.16, actVII, actinorhodin polyketide
FT                   synthase bifunctional cyclase/dehydratase, len: 316 aa;
FT                   identical to previously sequenced SW:CYPK_STRCO
FT                   (EMBL:X63449) Streptomyces coelicolor actinorhodin
FT                   polyketide synthase bifunctional cyclase/dehydratase ActI
FT                   ORF4, 316 aa"
FT                   /db_xref="GOA:Q02055"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02055"
FT                   /protein_id="CAC44203.1"
FT                   /translation="MSRPGEHRVVHTLRTQAPARRLYELVARVEDWPAVFEPTVHVQVL
FT                   ERGPGTERFRIWARVGGRVKTWTSRRTLDPDTLRVTFRQELTQPPIASMGGSWEFRGDG
FT                   DGTEVVLTHDFAAVDEAALPGLREALDANSGKELAALVALAERRQPPEELVFTFEDTLR
FT                   VPSGDDAYAFIERSDLWQERLPHVRKVTLTEEAAGTGPAETRDMTVQDMTMETVTTDGG
FT                   THTTRSIRLCVPARSIVYKQLVPPALLSGHCGAWTFGEDTVTARHTVAIDPARVEEVLG
FT                   KGATVADARTHLREVLGANSRATLRHAAAAAGPAS"
FT   CDS_pept        163653..164546
FT                   /transl_table=11
FT                   /gene="SCO5091"
FT                   /gene_synonym="actIV"
FT                   /gene_synonym="SCBAC28G1.17"
FT                   /product="cyclase"
FT                   /note="SCBAC28G1.17, actIV, cyclase, len: 297 aa; identical
FT                   to previously sequenced TR:Q02057 (EMBL:X63449)
FT                   Streptomyces coelicolor dehydrogenase ActI ORF5, 297 aa.
FT                   Contains Pfam match to entry PF00753 lactamase_B,
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IZ0"
FT                   /protein_id="CAC44204.1"
FT                   /translation="MTVEVREVAEGVYAYEQAPGGWCVSNAGIVVGGDGALVVDTLSTI
FT                   PRARRLAEWVDKLAAGPGRTVVNTHFHGDHAFGNQVFAPGTRIIAHEDMRSAMVTTGLA
FT                   LTGLWPRVDWGEIELRPPNVTFRDRLTLHVGERQVELICVGPAHTDHDVVVWLPEERVL
FT                   FAGDVVMSGVTPFALFGSVAGTLAALDRLAELEPEVVVGGHGPVAGPEVIDANRDYLRW
FT                   VQRLAADAVDRRLTPLQAARRADLGAFAGLLDAERLVANLHRAHEELLGGHVRDAMAIF
FT                   AELVAYNGGQLPTCLA"
FT   misc_feature    163710..164264
FT                   /note="Pfam match to entry PF00753 lactamase_B,
FT                   Metallo-beta-lactamase superfamily, score 124.60, E-value
FT                   1.9e-33"
FT   regulatory      164547..164550
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        164558..165091
FT                   /transl_table=11
FT                   /gene="SCO5092"
FT                   /gene_synonym="actVB"
FT                   /gene_synonym="SCBAC28G1.18"
FT                   /product="actinorhodin polyketide putative dimerase"
FT                   /note="SCBAC28G1.18, actVB, actinorhodin polyketide
FT                   possible dimerase, len: 177 aa; identical to previously
FT                   sequenced SW:DIM6_STRCO (EMBL:X63449) Streptomyces
FT                   coelicolor actinorhodin polyketide dimerase ActI ORF6,
FT                   ActVB, 177 aa Contains Pfam match to entry PF01613
FT                   Flavin_Reduct, Flavin reductase like domain"
FT                   /db_xref="GOA:Q02058"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02058"
FT                   /protein_id="CAC44205.1"
FT                   /translation="MAADQGMLRDAMARVPAGVALVTAHDRGGVPHGFTASSFVSVSME
FT                   PPLALVCLARTANSFPVFDSCGEFAVSVLREDHTDLAMRFARKSADKFAGGEFVRTARG
FT                   ATVLDGAVAVVECTVHERYPAGDHIILLGEVQSVHVEEKGVPAVYVDRRFAALCSAAGA
FT                   CPSATGRGVPAHAG"
FT   misc_feature    164591..165031
FT                   /note="Pfam match to entry PF01613 Flavin_Reduct, Flavin
FT                   reductase like domain, score 254.60, E-value 1.3e-72"
FT   misc_feature    165079..169930
FT                   /note="previously sequenced DNA fragment. EMBL:Y18817
FT                   Streptomyces coelicolor A3(2) transcriptional regulator and
FT                   actinorhodin biosynthetic genes, strain J1501"
FT   CDS_pept        complement(165110..165607)
FT                   /transl_table=11
FT                   /gene="SCO5093"
FT                   /gene_synonym="ORF7"
FT                   /gene_synonym="SCBAC28G1.19c"
FT                   /product="putative mini-circle protein"
FT                   /note="SCBAC28G1.19c, ORF7, putative mini-circle protein,
FT                   len: 165 aa; identical to previously sequenced TR:Q9X9V2
FT                   (EMBL:Y18817) Streptomyces coelicolor A3(2) putative
FT                   mini-circle protein ORF7, 165 aa"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9X9V2"
FT                   /protein_id="CAC44206.1"
FT                   /translation="MPTTPRTHRRDTPPPRTGGGEAETLRGFLDYLRTSIAGKVEDAPE
FT                   PQVRTAAVASGTNLLGLLNHLTHVERAVFLGEEVRSWPATFRAASQDGVADVVARYREA
FT                   VERANRVLDACTDLGAPLPRPRPGRPAPSVRWALTHMVEETGRHAGHADILRELIDGAT
FT                   GR"
FT   regulatory      complement(165617..165621)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(165661..166287)
FT                   /transl_table=11
FT                   /gene="SCO5094"
FT                   /gene_synonym="ORF8"
FT                   /gene_synonym="SCBAC28G1.20c"
FT                   /product="putative methyltransferase"
FT                   /note="SCBAC28G1.20c, ORF8, putative methyltransferase,
FT                   len: 208 aa; identical to previously sequenced TR:Q9X9V1
FT                   (EMBL:Y18817) Streptomyces coelicolor A3(2) putative
FT                   methyltransferase ORF8, 208 aa"
FT                   /db_xref="GOA:Q9X9V1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q9X9V1"
FT                   /protein_id="CAC44207.1"
FT                   /translation="MSTTDAVTFWDGVYAARPAPDAPRPNVRLVETVTGLPPGDALDLG
FT                   CGSGGDALWLARRGWRVTAVDISGVAAERLAGHARTHGLGDLVDAVRHDLRDSFPEGRF
FT                   DLVSAHYLHTPFDLDRASVLRGAAHALRPGGRLLVVDHGSTAPWSWDQDPDARHPAPQE
FT                   VAADLALDPATWRVERAEAPRRTATGPGGRTAEVVDHVLLVRRAD"
FT   regulatory      complement(166293..166298)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        166422..166994
FT                   /transl_table=11
FT                   /gene="SCO5095"
FT                   /gene_synonym="ORF9"
FT                   /gene_synonym="SCBAC28G1.21"
FT                   /product="putative DNA-binding protein"
FT                   /note="SCBAC28G1.21, ORF9, probable DNA-binding protein,
FT                   len: 190 aa; identical to previously sequenced as TR:Q9X9V0
FT                   (EMBL:Y18817) Streptomyces coelicolor A3(2) hypothetical
FT                   20.6 kDa protein ORF9, 190 aa and similar to TR:O86784
FT                   (EMBL:AL031317) Streptomyces coelicolor SC6G4.21, 202 aa;
FT                   fasta scores: opt: 642 Z-score: 656.2 bits: 128.2 E():
FT                   7.9e-31; 53.968% identity in 189 aa overlap. Contains Pfam
FT                   match to entry PF01381 HTH_3, Helix-turn-helix and possible
FT                   helix-turn-helix motif at residues 25..46 (+6.01 SD)"
FT                   /db_xref="GOA:Q9X9V0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9X9V0"
FT                   /protein_id="CAC44208.1"
FT                   /translation="MDAATDDVLDAVGPRLRTLRRERGITLAHLSAATGVSESTLSRLE
FT                   SGQRRATLELLLPLARIYDVPLDDLVGAPRTGDPRIHLKPVRRFGMVFVPLSRRPGGTQ
FT                   AFKMIIPSRPAPLEPTPQTHEGSEWLYVLSGRLRLLVGERDLTLSPGEAAEFDTSLPHW
FT                   LGSADGGAVELLVLFGLQGVRAHVHSG"
FT   misc_feature    166467..166631
FT                   /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix,
FT                   score 59.50, E-value 7.3e-14"
FT   CDS_pept        complement(167246..168175)
FT                   /transl_table=11
FT                   /gene="SCO5096"
FT                   /gene_synonym="SCBAC28G1.22c"
FT                   /product="LysR-family transcriptional regulatory protein"
FT                   /note="SCBAC28G1.22c, LysR-family transcriptional
FT                   regulatory protein, len: 309 aa; identical to previously
FT                   sequenced TR:Q9X9U9 (EMBL:Y18817) Streptomyces coelicolor
FT                   A3(2) transcriptional regulator of LysR family, 307 aa.
FT                   Contains Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family and match
FT                   to Prosite entry PS00044 Bacterial regulatory proteins,
FT                   lysR family signature. Also contains a possible
FT                   helix-turn-helix motif at residues 22..43 (+5.22 SD)"
FT                   /db_xref="GOA:Q93IY9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY9"
FT                   /protein_id="CAC44209.1"
FT                   /translation="MGMTTDVHVRELRYFATVAEELHFTRAAELLYVSQPALSKQIRAL
FT                   ERQLGAELFHRGPRGVTLTEAGTALLPHARRMLADWTEGAAAVEAARAARRDTLVVGMS
FT                   TSPGRGGLLPAIRSRFTAAHPEAVLQLRQMSWEDPTAGLADGTADVAYVWLPLPDADRY
FT                   AWTVVAEEPRLVALPDSHPLAAREEIDFADLAGEPFLALPPEAGVLRDFWLALDERRAL
FT                   DGPAARPPRVGAEISGTEETYEALVAGLGICLVATGNAPLITLGGVVTRPVRGLSPSRY
FT                   ALARRREDEGRALVRGYVEACRRVTDRA"
FT   misc_feature    complement(167720..168151)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   160.50, E-value 2.8e-44"
FT   misc_feature    complement(168017..168109)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature"
FT   regulatory      168261..168264
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        168270..169100
FT                   /transl_table=11
FT                   /gene="SCO5097"
FT                   /gene_synonym="SCBAC28G1.23"
FT                   /product="short-chain oxidoreductase"
FT                   /note="SCBAC28G1.23, short-chain oxidoreductase, len: 276
FT                   aa; identical to previously sequenced TR:Q9X9U8
FT                   (EMBL:Y18817) Streptomyces coelicolor A3(2) oxidoreductase
FT                   of short-chain, 276 aa. Contains Pfam match to entry
FT                   PF00106 adh_short, short chain dehydrogenase and match to
FT                   Prosite entry PS00061 Short-chain dehydrogenases/reductases
FT                   family signature"
FT                   /db_xref="GOA:Q93IY8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY8"
FT                   /protein_id="CAC44210.1"
FT                   /translation="MNKVWLITGASSGFGRAIAEAALADGDVVVGAARRPEALDDLVAA
FT                   HPDQMEALRLDVADTAAAGDAVRDVVARHGRVDVLVNNAGRTHVGALEETGEDELRALF
FT                   DVHVFGPAALTRAVLPSMRERRSGAIVQMSSMGGQMSFAGFSAYSGTKFALEGMSEGLA
FT                   DEVRDFGIKVLIVEPGSFRTGLFEAGNAGISADSGVYAKVGETRGMIAAGDGSQPGDPA
FT                   RAAAVIRAALAAEHTPLRLPLGDDGVTAVLGHLDRVREEVETWEKQTRATAFDD"
FT   misc_feature    168276..168821
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 211.20, E-value 1.6e-59"
FT   misc_feature    168672..168758
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature"
FT   CDS_pept        169158..169622
FT                   /transl_table=11
FT                   /gene="SCO5098"
FT                   /gene_synonym="ORF12"
FT                   /gene_synonym="SCBAC28G1.24"
FT                   /product="putative integral membrane protein"
FT                   /note="SCBAC28G1.24, possible integral membrane protein,
FT                   len: 154 aa; identical in its C-terminal domain to
FT                   TR:Q9X9U7 (EMBL:Y18817) Streptomyces coelicolor A3(2)
FT                   hypothetical 11.9 kDa protein ORF11, 113 aa. Contains
FT                   possible hydrophobic membrane spanning regions and 10x
FT                   degenerate repeat at N-terminal region: M(P/V). Alternative
FT                   start codon in previously sequence EMBL entrance after the
FT                   repeat region at residue 42"
FT                   /db_xref="GOA:Q93IY7"
FT                   /db_xref="InterPro:IPR021214"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY7"
FT                   /protein_id="CAC44211.1"
FT                   /translation="MPDCTRPCPIVPVPMPMPMPMPMPMPMPVPVPASVPNQESAVLSS
FT                   LKAVNLLVMFLLELAVYTAVVLWGVAVGGTWPVEVALGVGAPVVMMAAWALFGSPRARR
FT                   PARGAGRFVLEVLWFGAGAAALAASGRPWWAAALAGVCLVNAVLRRLWKQ"
FT   repeat_region   169191..169250
FT                   /note="10x degenerate repeat translated in SCBAC28G1.24"
FT   CDS_pept        169732..170862
FT                   /transl_table=11
FT                   /gene="SCO5099"
FT                   /gene_synonym="SCBAC28G1.25"
FT                   /product="putative membrane protein"
FT                   /note="SCBAC28G1.25, possible membrane protein, len: 376
FT                   aa. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q93IY6"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY6"
FT                   /protein_id="CAC44212.1"
FT                   /translation="MSIPPPPGPQGQYPQGPYAPQWGHPLAPYPRPAPVSGLAVAAFVL
FT                   GVLCFLPAVGLVLGLVALARIRRRGERGKGFAVAGCVLSSVGLALWTLTLSTGAAGDFW
FT                   DGFRDAARGGGTAYSLEKGQCFTTPSGSLQGVTYDVDEVPCAREHDGEVFASFDLPDGS
FT                   YPGDGEITRAADDRCYALQDAYAMDRWALPTDVDVYYLTPTAASWRTGDREITCLFGNT
FT                   DERGTLTGSLRNDGARFDADQHTYLLAEGYLNRAMDEVPAAEAVEDDLAGYRTWAGQVS
FT                   EALRGEVAMLDGHEWPAGAERPVAALTDDLRSAQEEWGLAAKAADLDAYYEHYGKGYDL
FT                   VVADSTVTARKALGLATTPPDYEGGEGGGDDPGVEV"
FT   regulatory      171000..171003
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        171010..171762
FT                   /transl_table=11
FT                   /gene="SCO5100"
FT                   /gene_synonym="SCBAC28G1.26"
FT                   /product="putative gntR-family regulatory protein"
FT                   /note="SCBAC28G1.26, possible gntR-family regulatory
FT                   protein, len: 250 aa; low similarity to SW:FARR_ECOLI
FT                   (EMBL:X15790) Escherichia coli fatty acid responsive
FT                   regulator (P30 protein) FarR, 240 aa; fasta scores: opt:
FT                   206 Z-score: 237.6 bits: 51.4 E(): 1.3e-05; 25.926%
FT                   identity in 243 aa overlap. Contains Pfam match to entry
FT                   PF00392 gntR, Bacterial regulatory proteins, gntR family"
FT                   /db_xref="GOA:Q93IY5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY5"
FT                   /protein_id="CAC44213.1"
FT                   /translation="MTFGEQPAYLRVAGDLRKKIADGLLPPHTRLPSQARIREEYGVSD
FT                   TVALEARKVLMAEGLVEGRSGSGTYVRERPVPRRVARSGYRPAGGATPFRQEQADGDAR
FT                   GTWESRSEQAEASGAVAERLGIKPGDRVMCTRYVFREAGEAVMLSTSWEPLDLTGRTPV
FT                   MLPEEGPLGGMGVVERMAAIDVVVDNVTEEVGARPGLAEELLALGGVPGHVVLVVQRTF
FT                   YASGRAVETADVVVPADRYRVAYHLPVR"
FT   misc_feature    171043..171222
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 50.40, E-value
FT                   5.3e-14"
FT   regulatory      172197..172201
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        172208..172399
FT                   /transl_table=11
FT                   /gene="SCO5101"
FT                   /gene_synonym="SCBAC28G1.27"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCBAC28G1.27, conserved hypothetical protein, len:
FT                   63 aa; similar to TR:Q9HTF6 (EMBL:AE004953) Pseudomonas
FT                   aeruginosa hypothetical protein PA5408, 58 aa; fasta
FT                   scores: opt: 146 Z-score: 225.2 bits: 45.1 E(): 6.2e-05;
FT                   45.652% identity in 46 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY4"
FT                   /protein_id="CAC44214.1"
FT                   /translation="MNDSTVTLPWLVFRQDDNGNRYRVGRYATRAEAQEIADTLDGRGH
FT                   KQLYWVEKLAAPGAGAAD"
FT   CDS_pept        172475..172909
FT                   /transl_table=11
FT                   /gene="SCO5102"
FT                   /gene_synonym="SCBAC28G1.28"
FT                   /product="putative mutT-like protein"
FT                   /note="SCBAC28G1.28, possible mutT-like protein, len: 144
FT                   aa; similar to SW:MUTT_ECOLI (EMBL:X04831) Escherichia coli
FT                   mutator MutT protein
FT                   (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.*)
FT                   MutT, 129 aa; fasta scores: opt: 190 Z-score: 228.6 bits:
FT                   48.1 E(): 4e-05; 33.333% identity in 132 aa overlap.
FT                   Contains Pfam match to entry PF00293 mutT, MutT-like domain
FT                   and match to Prosite entry PS00893 mutT domain signature"
FT                   /db_xref="GOA:Q93IY3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY3"
FT                   /protein_id="CAC44215.1"
FT                   /translation="MTERIVVGAALLDGGRLLAARRSAPAELAGRWELPGGKVEPGETP
FT                   EAALVRELREELGVAAEAGGRVPGQWPLRAPFVLQVWTARLRPGSAAPAPLEDHDELRW
FT                   LTPGQIWDVPWLDQDVPAVERVLAHLGLEAGTGRNGTGPG"
FT   misc_feature    172481..172861
FT                   /note="Pfam match to entry PF00293 mutT, MutT-like domain,
FT                   score 85.50, E-value 1.1e-21"
FT   misc_feature    172583..172642
FT                   /note="PS00893 mutT domain signature"
FT   CDS_pept        172948..173415
FT                   /transl_table=11
FT                   /gene="SCO5103"
FT                   /gene_synonym="SCBAC28G1.29"
FT                   /product="putative regulatory protein"
FT                   /note="SCBAC28G1.29, possible regulatory protein, len: 155
FT                   aa; similar to TR:Q53897 (EMBL:X60316) Streptomyces
FT                   coelicolor AbaA gene (putative regulator) or SCF42.12c, 192
FT                   aa; fasta scores: opt: 207 Z-score: 233.7 bits: 49.7 E():
FT                   2.1e-05; 41.270% identity in 126 aa overlap. Contains Pfam
FT                   match to entry PF02518 HATPase_c, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY2"
FT                   /protein_id="CAC44216.1"
FT                   /translation="MGSSAGEVIGVKDGEGDCAEWVFPAAPDAVRTARSLVRRTLGEWR
FT                   LDSVGDIAALLVSELVTNALRHATGPIGVRLVRSPAPAAPAAGGAGGDGADGVLLVEVS
FT                   DPLPDPPRERVARPDDEDGRGLQLVASAARRWGTRPGEAGKTVWFELALPR"
FT   misc_feature    173095..173262
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, phytochrome-like ATPase, score
FT                   10.00, E-value 0.22"
FT   regulatory      173699..173703
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        173715..176357
FT                   /transl_table=11
FT                   /gene="SCO5104"
FT                   /gene_synonym="SCBAC28G1.30"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCBAC28G1.30, hypothetical protein, len: 880 aa;
FT                   similar to many Streptomyces coelicolor hypothetical
FT                   proteins, e.g. TR:Q9KYN1 (EMBL:AL356592) hypothetical 84.7
FT                   kDa protein SC9H11.08, 802 aa; fasta scores: opt: 1062
FT                   Z-score: 1155.9 bits: 224.9 E(): 9.1e-57; 38.902% identity
FT                   in 856 aa overlap. Contains 2x Pfam matches, Pfam match to
FT                   entry PF01590 GAF, GAF domain, to entry PF00989 PAS, PAS
FT                   domain and to entry PF02518 HATPase_c, Histidine kinase-,
FT                   DNA gyrase B-, phytochrome-like ATPase"
FT                   /db_xref="GOA:Q93IY1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY1"
FT                   /protein_id="CAC44217.1"
FT                   /translation="MSEIPARAKEPTESTESGGPSADAPLGDAVWQSSPPGSIYDYIKV
FT                   ASFSIGPDGLVDQWSLRAEQLLGIRAEDAVGSDPIEAFIDPDLRERGQRKMTEILDGRE
FT                   WTGVVPFRAPDEAEGTARHASGRPADGPPTGGRPGQRGLAEVYVMPTRTEDGEKAAVCI
FT                   VVDVRVLRSIETDLAASQAIFGQSPFGFLLIDPDLTVRRANQRFASIFGGTPDDHRGKG
FT                   VHDYLPRAEADRVCATLRRVLETGDSITDMHVTGFVPGSEERRHWSVNLYRVHSGSGRP
FT                   IGVAWLGTDITARRQAAREAANARRNLALLNEAGARIGNSLDLETTARELLDVVVPGFC
FT                   DLATVDLYQGLLVGDETPPGLADGSAELRRVAFSSAVSDAPFLGTGERVKLGAVHHYPF
FT                   NSPCADALRTARPRSVPAEDGGLVQSTLAVPMVAHDTVVGLVQFARTKGSEPFGDRDRD
FT                   LAVELAARAAVCIDNARLYRREHERALILQRSLLPPGDPEASGLDIACRYLPGEAATGR
FT                   ASEVGGDWFDVIELPGHRTALVVGDVMGRGLRAAVAMGELRTAVRTLAQLDIEPAEVLS
FT                   QLDEIARGLGAPGGVQQATRAARRPREADLSEVYLATCVYAVYDSVTRRCTFANAGHLP
FT                   PVLVEPGESALMLDVPPGLPLGVGGEPFEEVEVELPEGALLALYTDGLVESRDHPLDEG
FT                   LQAFVGALTDPTQPLEDVCDQVLNTLDSHHGEDDIALLMARVQGLPADSVGDWTLPREP
FT                   RSVGRAREYARAQLLAWDMEPLVDTTELLVSELVTNALRYGEGEIRLRLLLDRTLVCEV
FT                   WDSGLVQPRRRRARDTDEGGRGLQLVGLLSAAWGSRRTPRGKTVWFELPLPGADTQLTD
FT                   PAEALLSLF"
FT   misc_feature    173841..174011
FT                   /note="Pfam match to entry PF00989 PAS, PAS domain, score
FT                   9.80, E-value 0.44"
FT   misc_feature    174246..174440
FT                   /note="Pfam match to entry PF00989 PAS, PAS domain, score
FT                   15.70, E-value 0.0098"
FT   misc_feature    174681..175142
FT                   /note="Pfam match to entry PF01590 GAF, GAF domain, score
FT                   42.60, E-value 8.6e-09"
FT   misc_feature    176058..176162
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, phytochrome-like ATPase, score
FT                   9.60, E-value 0.28"
FT   regulatory      176587..176591
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176599..177831
FT                   /transl_table=11
FT                   /gene="SCO5105"
FT                   /gene_synonym="SCBAC31E11.01"
FT                   /product="putative membrane protein"
FT                   /note="SCBAC31E11.01, possible membrane protein, len: 410
FT                   aa. Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q93IV0"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IV0"
FT                   /protein_id="CAC44312.1"
FT                   /translation="MADTEPGNTEPRSTEPGNTELRSTEPGSIEPGSTEPEAADGEDGP
FT                   PGPPASDDESGTGGAGGNRDAEGEAEATRRTRRRTRIRRTAVAVLLVLLVPLLTAETAL
FT                   RVNYMGDPADGTHTRNRDAMWLGHAWVDGRKDDADLAAFARRVKATGIRDLYVHTGPME
FT                   HDGTLPKSLYPRARWLVGAVHRELPGVRVQAFLGDVLATESPDGMRLEKPATRAAVVGS
FT                   ARQVLDVGYDGVHLDLEPLHSGDGDYLSLLDDVRAVTRARDAQLSVAAHQIDPLPGFHS
FT                   FWGTVAGHPKWWSQEFFGQVARRVDQIAVMSYDTMQPLESLYGGYVAQQTSLALEVTPP
FT                   TTHLLMGLPFYHENRFGHWNHAETVAAAVRGVRLGLSRTDADRERFGVAAYIDFAATEQ
FT                   DWASYRDGWVR"
FT   CDS_pept        complement(177828..178607)
FT                   /transl_table=11
FT                   /gene="SCO5106"
FT                   /gene_synonym="SCBAC31E11.02c"
FT                   /gene_synonym="shdB2"
FT                   /product="putative succinate dehydrogenase iron-sulfur
FT                   subunit"
FT                   /note="SCBAC31E11.02c, shdB2, probable succinate
FT                   dehydrogenase iron-sulfur subunit, len: 259 aa; highly
FT                   similar to TR:AAK44479 (EMBL:AE006934) Mycobacterium
FT                   tuberculosis ferredoxin, 2Fe-2S MT0261, 248 aa; fasta
FT                   scores: opt: 1355 Z-score: 1588.1 bits: 301.4 E(): 7.7e-81;
FT                   74.900% identity in 251 aa overlap and to SW:DHSB_BACSU
FT                   (EMBL:M13470) Bacillus subtilis succinate dehydrogenase
FT                   iron-sulfur protein SdhB, 252 aa; fasta scores: opt: 365
FT                   Z-score: 434.1 bits: 87.9 E(): 1.4e-16; 30.603% identity in
FT                   232 aa overlap. Contains Pfam match to entry PF00111 fer2,
FT                   2Fe-2S iron-sulfur cluster binding domains"
FT                   /db_xref="GOA:Q93IU9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU9"
FT                   /protein_id="CAC44313.1"
FT                   /translation="MSGYEARFKVWRGDVAGGGLEDFTVEVNDGEVVLDIIHRLQATQA
FT                   PDLAVRWNCKAGKCGSCSAEINGRPRLLCMTRMSVFTREETITVTPLRAFPVIRDLVTD
FT                   VGFNYTKAREVPAFVPPADLGPGEYRMMQEDVDRSQEFRKCIECFLCQDTCHVVRDHEE
FT                   NKPAFAGPRFLMRVAELDMHPLDAAGDTGLDRSRTAQDEHGLGFCNITKCCTEVCPEGI
FT                   RITDNALIPLKERAVDRKYDPLVWLGAKIGRRSRDTP"
FT   misc_feature    complement(178368..178550)
FT                   /note="Pfam match to entry PF00111 fer2, 2Fe-2S iron-sulfur
FT                   cluster binding domains, score 35.00, E-value 1.7e-06"
FT   CDS_pept        complement(178604..180565)
FT                   /transl_table=11
FT                   /gene="SCO5107"
FT                   /gene_synonym="SCBAC31E11.02c"
FT                   /gene_synonym="shdA2"
FT                   /product="putative succinate dehydrogenase flavoprotein
FT                   subunit"
FT                   /note="SCBAC31E11.03c, shdA2, probable succinate
FT                   dehydrogenase flavoprotein subunit, len: 653 aa; highly
FT                   similar to TR:AAK44480 (EMBL:AE006934) Mycobacterium
FT                   tuberculosis CDC1551 FAD flavoprotein oxidase, putative
FT                   MT0262, 646 aa; fasta scores: opt: 2941 Z-score: 3164.4
FT                   bits: 595.8 E(): 1.2e-168; 70.416% identity in 649 aa
FT                   overlap and to SW:DHSA_RICPR (EMBL:M88696) Rickettsia
FT                   prowazekii succinate dehydrogenase flavoprotein subunit (EC
FT                   1.3.99.1) SdhA, 596 aa; fasta scores: opt: 643 Z-score:
FT                   693.1 bits: 138.4 E(): 5.4e-31; 35.218% identity; in 619 aa
FT                   overlap. Contains Pfam matches to entries PF00890
FT                   FAD_binding_2, FAD binding domain and PF02910
FT                   succ_DH_flav_C, Fumarate reductase/succinate dehydrogenase
FT                   flavoprotein C-terminal domain and match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop"
FT                   /db_xref="GOA:Q93IU8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU8"
FT                   /protein_id="CAC44314.1"
FT                   /translation="MSVVDRQEWDVVVVGAGGAGLRAAVEARERGARTAVICKSLFGKA
FT                   HTVMAEGGIAASMGNVNSGDNWQVHFRDTMRGGKFLNQWRMAELHAQEAPQRVWELETW
FT                   GALFDRTKDGRISQRNFGGHEYPRLAHVGDRTGLELIRTLQQKIVSLQQEDFRETGDHE
FT                   SRLKVFQECTVTRLLQEDRKVSGVFGYERESGRFFVLQAPSVVIATGGIGKSFKVTSNS
FT                   WEYTGDGHALALLAGAPLLNMEFVQFHPTGMVWPPSVKGILVTESVRGDGGVLRNSEGR
FT                   RFMFDYVPDVFKEKYAESEAEGDRWYDDPDHNRRPPELLPRDEVARAINAEVKEGRGSP
FT                   HGGVFLDVSTRMPAEVIRRRLPSMYHQFKELADVDITAEAMEVGPTCHYVMGGIAVDSD
FT                   TAAARGVPGLFAAGEVAGGMHGSNRLGGNSLSDLLVFGRRAGRYAAEYAAGRTEEGTRA
FT                   RVDDAQVDAAAAEALRPFSAEAQEPGAGPPENPYTLHQELQQTMNDLVGIIRREAEMKQ
FT                   ALEKLAELRVRARRAGVEGHRQFNPGWHLALDLRNMLLVSECVARAALERTESRGGHTR
FT                   EDHPSMDRRWRPANLLCSLADPAGEAAGEAAATDPERGRIALERQTTEPIRPDLLALFD
FT                   KEELVKYLADEELEGRSE"
FT   regulatory      complement(178618..178622)
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(178769..179083)
FT                   /note="Pfam match to entry PF02910 succ_DH_flav_C, Fumarate
FT                   reductase/succinate dehydrogenase flavoprotein C-terminal
FT                   domain, score 69.20, E-value 8.9e-17"
FT   misc_feature    complement(179162..180238)
FT                   /note="Pfam match to entry PF00890 FAD_binding_2, FAD
FT                   binding domain, score 404.30, E-value 1.2e-117"
FT   misc_feature    complement(179921..179944)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   regulatory      complement(180573..180576)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(180582..181418)
FT                   /transl_table=11
FT                   /gene="SCO5108"
FT                   /gene_synonym="SCBAC31E11.04c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCBAC31E11.04c, possible integral membrane protein,
FT                   len: 278 aa; similar to TR:O53671 (EMBL:AL021929)
FT                   Mycobacterium tuberculosis hypothetical 31.1 kDa protein
FT                   MTV034.15c, 273 aa; fasta scores: opt: 1010 Z-score: 1230.3
FT                   bits: 235.4 E(): 6.5e-61; 54.545% identity in 275 aa
FT                   overlap. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q93IU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU7"
FT                   /protein_id="CAC44315.1"
FT                   /translation="MATGTEPPATEDRPPGGGVHTPTRAAIRARHLRTDRWWLAPAATA
FT                   AGLLAFVVYSTWRAFANADYYAAPYVSPFYSPCLAENCEPMRSGPNWELFGTWWGISPA
FT                   IIILIFPLGFRLTCYYYRKAYYRGFWASPPACAVAEPHRKYTGETRFPLILQNVHRYFF
FT                   YAALLVAGILSYDTVLAFRDEHYAWGHMGLGTLVFLANIALIWAYTLSCHSCRHIVGGK
FT                   LKHFSRHPVRYRMWQLVGRLNARHMQLAWASLVSVALADFYVYLVASGVFDDPRFF"
FT   regulatory      complement(181426..181429)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(181480..181920)
FT                   /transl_table=11
FT                   /gene="SCO5109"
FT                   /gene_synonym="SCBAC31E11.05c"
FT                   /product="hypothetical protein SCBAC31E11.05c"
FT                   /note="SCBAC31E11.05c, unknown, len: 146 aa. Contains a
FT                   possible coiled-coil region at approx. residues 60..87"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU6"
FT                   /protein_id="CAC44316.1"
FT                   /translation="MPPAVHRRAPANRCTSLPSDWCDARHSQAHERSPPRPAAHCRVRR
FT                   KRGHVLSVHDDLSSVQRSLDELSRTVTRLEQQLGSGDLEVRRVRTDADHLRESVALLRA
FT                   ATAAPQAPRRPDLVPIPDTPYDGSLWTDSDDEGLGARDRRAP"
FT   regulatory      182080..182085
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        182093..184408
FT                   /transl_table=11
FT                   /gene="SCO5110"
FT                   /gene_synonym="SCBAC31E11.06"
FT                   /product="putative lipoprotein"
FT                   /note="SCBAC31E11.06, possible lipoprotein, len: 771 aa;
FT                   similar to SW:YC80_MYCTU (EMBL:Z77137) Mycobacterium
FT                   tuberculosis hypothetical 63.5 kDa protein MTCY50.02, 591
FT                   aa; fasta scores: opt: 565 Z-score: 501.6 bits: 103.2 E():
FT                   2.5e-20; 26.190% identity in 756 aa overlap. Contains
FT                   correctly situated match to Prosite entry PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site and
FT                   possible N-terminal region signal peptide sequence"
FT                   /db_xref="GOA:Q93IU5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU5"
FT                   /protein_id="CAC44317.1"
FT                   /translation="MSHVGVGPRAVMRAVAFLTTGVLAVPALAGCTSEDPAGKPLAEQD
FT                   VAAAARARISDGGTLRWAVDSVPDTLNAFQSDADATTTRVAQAVLPSMYRMDETGSPVR
FT                   NPDYLESAEVVDTEPKQVVVYKLNQQAVWSDGREIGAADFAAQWRALSGKDSAYWTARN
FT                   AGYDRIEKVERGANDLEVKVTFSRPYADWKALFTPLYPKDVTGTPDAFNDGARRALKVS
FT                   AGPFAVKKVDTKGDQVVLTGNPRWWGEPAKLDEIVLRAVPRDERVSELVAGKLDLAEID
FT                   PETADEVTLAAGPRDPATGTPLMGPGGTPAAGPQGRSAAEALRSWAIANGSDEEAAEEE
FT                   VLAREERGEAEAKARRRQQALSGFELRKSLEPAYTQLALNGAEGPLADERVRRAVARAL
FT                   DREELAEAVLKPLGLPAEPVGSHLALSGQPAYADGSGALGEQNAKEARALLADAGWVPG
FT                   GPVKKKDGEEAAGAEKDENKDEDKKDEEKSEGGDDGTYIVGEDDKNKDGKNKDGKNDDG
FT                   KNDDGGNDDGGNDDAGDAKDGADRESGEKHSSGKNTAQGGAPGAYAPKGTAAPAGAAAA
FT                   PLAKDGKELTLRFVLPSGPGSGTLRTVADRITDMLKEIGIGTRITKVPDESYFKDHIAA
FT                   GEYDLALYSWPASAFPATDARPIYAKPVPAADGSLNVAQNYTRVGTDQVDQLFDRALAT
FT                   LDQKESRDLLRKADSRIWAAAGSVPLYQRPQLTAARKNLANAGAFGFGTPVYEDMGFLK
FT                   KGAQGSRPTAPASPSPSS"
FT   misc_feature    182153..182185
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   misc_feature    183476..183553
FT                   /note="high content in lysine, glutamic acid and aspartic
FT                   acid amino acid residues"
FT   misc_feature    183593..183712
FT                   /note="high content in aspartic acid, asparagine, glycine
FT                   and lysine amino acid residues"
FT   regulatory      184527..184530
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        184541..186448
FT                   /transl_table=11
FT                   /gene="SCO5111"
FT                   /gene_synonym="SCBAC31E11.07"
FT                   /product="putative GTP-binding protein"
FT                   /note="SCBAC31E11.07, possible GTP-binding protein, len:
FT                   635 aa; similar to SW:TYPA_ECOLI (EMBL:L19201) Escherichia
FT                   coli GTP-binding protein TypA/BipA (tyrosine phosphorylated
FT                   protein A) TypA or BipA or B3871, 591 aa; fasta scores:
FT                   opt: 915 Z-score: 968.6 bits: 189.3 E(): 2.5e-46; 48.039%
FT                   identity in 612 aa overlap. Contains Pfam match to entry
FT                   PF00009 GTP_EFTU, Elongation factor Tu family and matches
FT                   to Prosite entries PS00017 ATP/GTP-binding site motif A
FT                   (P-loop) and PS00301 GTP-binding elongation factors
FT                   signature"
FT                   /db_xref="GOA:Q93IU4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU4"
FT                   /protein_id="CAC44318.1"
FT                   /translation="MATRHDIRNVAIVAHVDHGKTTIVDGMLKQAGAFAAHQLEGVDDR
FT                   MMDSNDLEREKGITILAKNTAVKYHPKDGGDVITINIIDTPGHADFGGEVERGLSMVDG
FT                   VVLLVDASEGPLPQTRFVLRKALSQRLPIILCINKTDRPDARIDEVVNETYDLFLDLDA
FT                   DEEQIEFPIVYACGRDGVASLTKPEDGTVPSDSTSLEPFFSTILDHIPAPTYDEDAPLQ
FT                   AHVTNLDADNFLGRIALLRVHQGELKKGQTVAWMKRDGSVQNVRISELMMTEALTRKPA
FT                   EKAGPGDICAVAGIPDIMIGETLADVENPVPLPLITVDEPAISMTIGTNTSPLVGRGAT
FT                   GKGADNKAVVKDRKVTARQVKDRLDRELIGNVSLRVLDTERPDAWEVQGRGELALAILV
FT                   EQMRREGFELTIGKPQVVTKEVEGKTYEPVERMTIDVPEEHMGAVTQLMGVRKGRMDNM
FT                   SNHGSGWVRMEFVVPSRGLIGFRTEFLTQTRGTGIAHSIHEGHEPWFGTLTTRNNGSLV
FT                   ADRSGAVTAFAMTNLQERGVLFTDPGTEVYEGMIVGENSRADDMDVNITKEKKLTNMRS
FT                   SSADSFEAIVPPRKLSLEQSLEFCRDDECVEVTPEAVRIRKVNLDARERARAASRAKHG
FT                   "
FT   misc_feature    184553..185803
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu family, score 320.10, E-value 2.7e-92"
FT   misc_feature    184580..184603
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    184682..184729
FT                   /note="PS00301 GTP-binding elongation factors signature"
FT   stem_loop       186457..186513
FT                   /note="possible stem loop. Score 64: 24/26 (92%) matches, 0
FT                   gaps"
FT   misc_feature    186929..193308
FT                   /note="previously sequenced DNA fragment. EMBL:U68036
FT                   Streptomyces coelicolor bldKA, bldKB, bldKC, and bldkD
FT                   genes, complete cds, and bldkE gene, partial cds"
FT   CDS_pept        187355..188386
FT                   /transl_table=11
FT                   /gene="SCO5112"
FT                   /gene_synonym="bldKA"
FT                   /gene_synonym="SCBAC31E11.08"
FT                   /product="BldKA, putative ABC transport system integral
FT                   membrane protein"
FT                   /note="SCBAC31E11.08, bldKA, possible ABC transport system
FT                   integral membrane protein, len: 343 aa; identical to
FT                   previously sequenced TR:P72406 (EMBL:U68036) Streptomyces
FT                   coelicolor BldKA, 335 aa. Methionine start codon 9 amino
FT                   acids upstream from the previous sequence start; possible
FT                   frameshift from frame 2 into frame 1 in the previously
FT                   sequenced DNA. Contains Pfam match to entry PF00528
FT                   BPD_transp, Binding-protein-dependent transport systems
FT                   inner membrane component and match to Prosite entry PS00402
FT                   Binding-protein-dependent transport systems inner membrane
FT                   comp sign. Also contains possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q93IU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU3"
FT                   /protein_id="CAC44319.1"
FT                   /translation="MTSPIEIEGAEASSVLDKESAPQGDAPKPKEPEGRKPGQLMWARF
FT                   KRDRAGVISAFVVLFFFVIAAAAPLISMVYGKDPYTLYGQDNPDLLDMFTMPAAPYGGI
FT                   DGDFWFGIEPGLGRDVFTQLLYGMRNSMATALAATIIMTVLGVLIGLAGGYFGGKIDYW
FT                   LGRITDFFMALPSQLFFVAAMPVITTVFVAPDKETPTYVRAAAIIIVLSFLGWMSMARI
FT                   VRGATMSLRDREFIEAARISGASPWRILRKELLPNIVTPTLVQATLTLPSTILSIAFLS
FT                   FVGVGYVEPTPDWGRMFAIGADIVEQDPYYMLFPGVAMVIFIVAFNLLGDSVRDAFDPK
FT                   GNR"
FT   misc_feature    188033..188263
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 51.00, E-value 2.6e-11"
FT   misc_feature    188036..188122
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp sign."
FT   CDS_pept        188498..190300
FT                   /transl_table=11
FT                   /gene="SCO5113"
FT                   /gene_synonym="bldKB"
FT                   /gene_synonym="SCBAC31E11.09"
FT                   /product="BldKB, putative ABC transport system lipoprotein"
FT                   /note="SCBAC31E11.09, bldKB, possible ABC transport system
FT                   lipoprotein, len: 600 aa; almost identical to TR:P72407
FT                   (EMBL:U68036) Streptomyces coelicolor BldKB, 602 aa.
FT                   Contains 4x Pfam matches to entry PF00496 SBP_bac_5,
FT                   Bacterial extracellular solute-binding proteins, family 5,
FT                   match to Prosite entry PS00017 ATP/GTP-binding site motif A
FT                   (P-loop) and correctly situated match to Prosite entry
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site. Also contains possible N-terminal region signal
FT                   peptide sequence"
FT                   /db_xref="GOA:Q93IU2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU2"
FT                   /protein_id="CAC44320.1"
FT                   /translation="MSILRNRTATAAIVAVAAGALTLTACGGGDSDSSAKDNSKKKEDA
FT                   KSQSKPVQIGDAQASTGPAPEVPGAKPGGTMTVYQTADFSHLDPGQIYVSDGKLLGRLI
FT                   FRGLTQYDEDENGNLTVVGDLATDAGKQTDGGKTWTYTLKDNLKDANGNPINSADIRHT
FT                   IERMYSSYITDGPTYLQQWLSGDGTTYRDAYAGPDKGKHLPDNVLETPDDKTIVFHFKT
FT                   ARPDLPQMLTMPGYSVVPEETDTKEKYDSAPVAAGPYKIAEFKPGKSMKLVKNTQWDPK
FT                   SDSVRHQYVDGFNIEMNHDDEDQTKTLLADQGGAKNAMMFTGQVATTQLQKVVGDKDAM
FT                   KNRTIQGYAPYVWQLNFNMNRVKDKKLRDAITLALPSDSVFKADGGAYGGEVANSLMSP
FT                   TTPGYDEAFDPFGRAKKPNGDIEAAKKLIKEGGFEGKSLVYAYANTPERQKQAVLISTA
FT                   LEKIGLDIQKKEIDSATWYEQVGKVDNGLDLYMTGWGQDWPSASTVIPPVYDGKQIQDG
FT                   ASNYSHINDDHVNSEIQRIQQITDTAEATKAWAELNEYISKEVNPAAPIYYTKVFQIFG
FT                   SNVGGIRYSSDSSYVDVTRVFLKK"
FT   misc_feature    188543..188575
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   misc_feature    188546..188635
FT                   /note="Pfam match to entry PF00496 SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score
FT                   1.40, E-value 13"
FT   misc_feature    188897..188965
FT                   /note="Pfam match to entry PF00496 SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score
FT                   5.20, E-value 1.2"
FT   misc_feature    189131..189322
FT                   /note="Pfam match to entry PF00496 SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score
FT                   19.80, E-value 9.6e-05"
FT   misc_feature    189281..189304
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    189584..190291
FT                   /note="Pfam match to entry PF00496 SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score
FT                   8.50, E-value 0.13"
FT   CDS_pept        190414..191391
FT                   /transl_table=11
FT                   /gene="SCO5114"
FT                   /gene_synonym="bldKC"
FT                   /gene_synonym="SCBAC31E11.10"
FT                   /product="BldKC, putative ABC transport system integral
FT                   membrane protein"
FT                   /note="SCBAC31E11.10, bldKC, possible ABC transport system
FT                   integral membrane protein, len: 325 aa; almost identical to
FT                   previously sequenced TR:P72408 (EMBL:U68036) Streptomyces
FT                   coelicolor BldKC, 323 aa. Contains Pfam match to entry
FT                   PF00528 BPD_transp, Binding-protein-dependent transport
FT                   systems inner membrane component. Also contains possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q93IU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU1"
FT                   /protein_id="CAC44321.1"
FT                   /translation="MLQFLIRRSFGAVLILVLISAFTFFMFFAIPQDPAMLACGKNCTP
FT                   DALEIIHKNLGLDQPVTVQYWHFLAGIFTGRDFAVGHCDAPCFGVSFANNQNVWDTILD
FT                   RFPLTVSLTVGSLIVFLIVGLGAGLLAAKNRGTWIDKVFSSGSLVVSSLQIYFLGPLVL
FT                   LALVYSTGWLQKPKYVPISEDAAGWFAGLLIPWIVMATIFTANYTRMSRSSMIEQLQEE
FT                   HVRAARAKGMSSNYTFFRYAWRGSLVPIVTILGIDLSALMGGGMVTEMTFGLAGIGRLA
FT                   LESVINKDLPMLMGVMLVSAALIIVFNLIVDAMYAVIDPRVRLS"
FT   misc_feature    191056..191271
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 25.30, E-value 0.0015"
FT   regulatory      191390..191394
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        191402..192463
FT                   /transl_table=11
FT                   /gene="SCO5115"
FT                   /gene_synonym="bldKD"
FT                   /gene_synonym="SCBAC31E11.11"
FT                   /product="BldKD, putative ABC transporter intracellular
FT                   ATPase subunit"
FT                   /note="SCBAC31E11.11, bldKD, putative ABC transporter
FT                   intracellular ATPase subunit, len: 353 aa; almost identical
FT                   to previously sequenced TR:P72409 (EMBL:U680360)
FT                   Streptomyces coelicolor BldKD putative ABC transporter
FT                   intracellular ATPase subunit, 353 aa and similar to
FT                   TR:O86574 (EMBL:AL031184) Streptomyces coelicolor
FT                   SC2A11.13, 366 aa; fasta scores: opt: 1427 Z-score: 1344.1
FT                   bits: 257.3 E(): 3.8e-69; 60.340% identity in 353 aa
FT                   overlap. Contains Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter and match to Prosite entry PS00017
FT                   ATP/GTP-binding site motif A (P-loop) and PS00211 ABC
FT                   transporters family signature"
FT                   /db_xref="GOA:Q93IU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU0"
FT                   /protein_id="CAC44322.1"
FT                   /translation="MTTQTKPEEAPAAAAGDAFLSVRDLKVHFSTEGGVVKAVDGLSFD
FT                   LERGKTLGIVGESGSGKSVTNLAVLGLHDRRRTAIDGSITLDGQELTDASEKQLEKLRG
FT                   KKMAMIFQDALTALSPYYTVGRQIAEPFMKHNGASKKDARVRAIDLLQKVGIPHPQKRV
FT                   DDYPHQFSGGMRQRAMIAMALSCNPDLLIADEPTTALDVTVQAQILDLLKDLQQEFGSA
FT                   IIMITHDLGVVGNMADDIMVMYAGRAVERGTVREVLKSPQHPYTWGLLSSMPNLTSDVD
FT                   EPLMPIPGSPPSLMNPPSGCAFHPRCGFTDLVSGERCSGERPTLPHGRAAACHLTGDQR
FT                   QQVFIEKIQPRLG"
FT   misc_feature    191546..192139
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 208.90, E-value 7.7e-59"
FT   misc_feature    191567..191590
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    191909..191953
FT                   /note="PS00211 ABC transporters family signature"
FT   CDS_pept        192491..193636
FT                   /transl_table=11
FT                   /gene="SCO5116"
FT                   /gene_synonym="SC9E12.01"
FT                   /gene_synonym="bldKE"
FT                   /gene_synonym="SCBAC31E11.12"
FT                   /product="putative peptide transport system ATP-binding
FT                   subunit"
FT                   /note="SC9E12.01, probable peptide transport system
FT                   ATP-binding protein (fragment), len: >142 aa; similar to
FT                   SW:OPPF_ECOLI (EMBL:AE000223) Escherichia coli oligopeptide
FT                   transport protein ATP-binding protein OppF, 334 aa; fasta
FT                   scores: opt: 344 z-score: 423.0 E(): 4.3e-16; 56.5%
FT                   identity in 92 aa overlap and to TR:O86575 (EMBL:AL031184)
FT                   Streptomyces coelicolor oligopeptide ABC transporter
FT                   ATP-binding protein SC2A11.14, 496 aa; fasta scores: opt:
FT                   488 z-score: 576.6 E(): 1.7e-26; 56.6% identity in 136 aa
FT                   overlap"
FT                   /note="SCBAC31E11.12, bldKE, putative ABC transporter
FT                   intracellular ATPase subunit (fragment), len: >272 aa;
FT                   almost identical to previously sequenced TR:P72410
FT                   (EMBL:U68036) Streptomyces coelicolor putative ABC
FT                   transporter intracellular ATPase subunit (fragment) BldKE,
FT                   284 aa and similar to N-terminal region of TR:O86575
FT                   (EMBL:AL031184) Streptomyces coelicolor SC2A11.14, 497 aa;
FT                   fasta scores: opt: 1186 Z-score: 1170.6 bits: 225.2 E():
FT                   1.7e-59; 63.603% identity in 272 aa overlap. Contains Pfam
FT                   match to entry PF00005 ABC_tran, ABC transporter and
FT                   matches to Prosite entries PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and PS00211 ABC transporters family
FT                   signature"
FT                   /db_xref="GOA:Q8CJS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CJS2"
FT                   /protein_id="CAD55223.1"
FT                   /translation="MSDNSKTTTAVADDFPQQRDGDTAPLLKVSGLSKHFPIKGGFPIK
FT                   RTVGHVKAVDGVDFEVFPGESLGLVGESGCGKSTTGRLLTRLYEPTQGSIEYRGKDITR
FT                   ANRRELAPVRSEIQMIFQDPYASLNPRQTVGTIISGPMEINGINPPGGREKRVRELLEI
FT                   VGLNPEHYNRFPHEFSGGQRQRIGVARAVALQPKLIVADEPVSALDVSIQAQVVNLLQE
FT                   VQREMGIAFVFIAHDLAIVRHFSQRVAVMYLGKIVEIADRDSLYNRPRHPYTHALLSAV
FT                   PETDLDAEKRERIRLEGDVPSPISPPSGCRFRTRCWKAQDKCATEEPPLVQLSGNREGH
FT                   LTACHFPEEGSTEARAEDIVMDPGLKAMEDGADGGATLSKG"
FT   misc_feature    192680..193252
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 192.00, E-value 9.3e-54"
FT   misc_feature    192701..192724
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    193022..193066
FT                   /note="PS00211 ABC transporters family signature"
FT   stem_loop       193653..193695
FT                   /note="possible stem loop. Score 57: 19/19 (100%) matches,
FT                   0 gaps"
FT   regulatory      193824..193829
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193836..195470
FT                   /transl_table=11
FT                   /gene="SCO5117"
FT                   /gene_synonym="SC9E12.02"
FT                   /product="putative peptide transport system secreted
FT                   peptide-binding protein"
FT                   /note="SC9E12.02, possible peptide transport system
FT                   secreted peptide-binding protein, len: 544 aa; similar to
FT                   SW:OPPA_BACSU (EMBL:X56347) Bacillus subtilis
FT                   oligopeptide-binding protein OppA precursor, 545 aa; fasta
FT                   scores: opt: 648 z-score: 642.6 E(): 2.5e-28; 26.1%
FT                   identity in 552 aa overlap and to TR:P72407 (EMBL:U68036)
FT                   Streptomyces coelicolor SpoOKA homologue BldKB, 602 aa;
FT                   blastp scores: Score = 165 (58.1 bits), Expect = 2.9e-10,
FT                   Sum P(2) = 2.9e-10; Identities = 116/502 (23%), Positives =
FT                   202/502 (40%). Contains 2x Pfam matches to entry PF00496
FT                   SBP_bac_5, Bacterial extracellular solute-binding proteins,
FT                   family 5 and correctly situated match to Prosite entry
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site. Also contains possible N-terminal region signal
FT                   peptide sequence"
FT                   /db_xref="GOA:Q9F353"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F353"
FT                   /protein_id="CAC05747.1"
FT                   /translation="MRGATHARWAACAAAVALAATACGGGGGDGGSGGGSGGVLSSSWG
FT                   DPQNPLEPANTNEVQGGKVLDMIFRGLKKYDPGTGEAQNMLAEKIDTSDSQNFTVTVKD
FT                   GWTFSNGEKVTAQSFVDAWNYGASLKNNQRNAYFFAYIDGYDKVHPESGSQSTDTLSGL
FT                   KVTGPRTFTIKLSQKFSTFPDTLGYPAFAPLPKAFFDDHDAWLKKPVGNGPYQVDNYTR
FT                   GSQMSLRKWDDYPGPDKAQNGGVDLKVYTDNNTAYTDLIAGNLDLVDDVPASQLKNVKN
FT                   DLGDRYINTPAGIIQTLAFPFYDNDWNKSGSEKVRKGLSMAIDRKQITDTIFQNTRTPA
FT                   TDWTSPVLGKDGGYKPGLCGDACEYNAAEAKKLVKEGGGLPGGQVKITYNADTGSHKQW
FT                   VDAVCNSINNALDNDRACAGNPVGTFADFRNQITNQKMSGPFRAGWQMDYPLIQNFLQP
FT                   LYYTNASSNDGKWSSKKFDDLVDQANAETDTAKAVGLFQQAEEVLRDDMGAIPLWYQNG
FT                   SAGYSDRLSNVKLNPFSVPVYNEIKVG"
FT   misc_feature    193872..193904
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   misc_feature    193986..194969
FT                   /note="Pfam match to entry PF00496 SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score
FT                   85.80, E-value 3.8e-23"
FT   misc_feature    195159..195464
FT                   /note="Pfam match to entry PF00496 SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score
FT                   38.20, E-value 7.2e-10"
FT   regulatory      195469..195472
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        195480..196403
FT                   /transl_table=11
FT                   /gene="SCO5118"
FT                   /gene_synonym="SC9E12.03"
FT                   /product="putative peptide transport system integral
FT                   membrane protein"
FT                   /note="SC9E12.03, probable peptide transport system
FT                   integral membrane protein, len: 307 aa; similar to TR:
FT                   SW:OPPB_BACSU (EMBL:X56347) Bacillus subtilis oligopeptide
FT                   transport system permease protein OppB, 311 aa; fasta
FT                   scores: opt: 688 z-score: 788.7 E(): 0; 36.0% identity in
FT                   308 aa overlap and to TR:P72408 (EMBL:U68036) Streptomyces
FT                   coelicolor SpoOKC homologue BldKC, 323 aa; blastp scores:
FT                   Score = 354 (124.6 bits), Expect = 1.9e-32, P = 1.9e-32;
FT                   Identities = 82/235 (34%), Positives = 138/235 (58%).
FT                   Contains Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component. Also contains possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q9F352"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F352"
FT                   /protein_id="CAC05748.1"
FT                   /translation="MGRYVVRRLLQMIPVFIGATLLIFLMVNVMGDPIAGLCGDRECDP
FT                   ATAAQLRHEFGLDQPVWQQYATYMGNVFTGDFGTAFNGQPVTELMGTAFPVTIRLTIVA
FT                   ILFEIVVGIILGVLTGLRRGRPVDTGVLLLTLVVISVPTFVTGLLLQLLLGVKWGWIDP
FT                   AVSSEAAFGELIVPGLVLASVSLAYVTRLTRTSIAENRRSDYVRTAIAKGLPRHRVITR
FT                   HLLRNSLIPVVTFIGTDIGALMGGAIVTERIFNIHGVGYQLYQGILRQNTQTVVGFVTV
FT                   LVLVFLVANLVVDLLYAVLDPRIRYA"
FT   misc_feature    196068..196283
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 24.20, E-value 0.0031"
FT   CDS_pept        196459..197376
FT                   /transl_table=11
FT                   /gene="SCO5119"
FT                   /gene_synonym="SC9E12.04"
FT                   /product="putative peptide transport system integral
FT                   membrane protein"
FT                   /note="SC9E12.04, probable peptide transport system
FT                   integral membrane protein, len: 305 aa; similar to
FT                   SW:OPPC_BACSU (EMBL:X56347) Bacillus subtilis oligopeptide
FT                   transport system permease protein OppC, 305 aa; fasta
FT                   scores: opt: 670 z-score: 745.0 E(): 0; 35.5% identity in
FT                   296 aa overlap and to TR:P72406 (EMBL:U68036) Streptomyces
FT                   coelicolor SpoOKB homologue BldKA, 335 aa; blastp scores:
FT                   Score = 382 (134.5 bits), Expect = 9.1e-41, Sum P(2) =
FT                   9.1e-41; Identities = 88/231 (38%), Positives = 134/231
FT                   (58%). Contains Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component and possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q9F351"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F351"
FT                   /protein_id="CAC05749.1"
FT                   /translation="MDLGASEAVTLEQPPGPDGADPRDKPRSLWTDAWHDLRRNPVFII
FT                   SALVIIFLIVISIWPSLIASGSPLKCDLAKAQEGSQPGHPFGFNGQGCDVYTRTVYGAR
FT                   TSVAVGILATLGVALLGSVLGGLAGFFGGGGDAVLSRITDIFFAIPVVLGGLVLLSVIT
FT                   SNTIWPVIGFIVLLGWPQISRIARGSVITAKQNDYVQAARALGASNSRLLLRHIAPNAV
FT                   APVIVVATIALGTYISLEATLSFLGVGLKPPSVSWGIDISSAAPYVRNAPHALLWPSGA
FT                   LAITVLAFIMLGDAVRDALDPKLR"
FT   misc_feature    197026..197256
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 21.60, E-value 0.018"
FT   CDS_pept        197385..198368
FT                   /transl_table=11
FT                   /gene="SCO5120"
FT                   /gene_synonym="SC9E12.05"
FT                   /product="putative peptide transport system ATP-binding
FT                   protein"
FT                   /note="SC9E12.05, probable peptide transport system
FT                   ATP-binding protein, len: 327 aa; similar to SW:OPPD_BACSU
FT                   (EMBL:X56347) Bacillus subtilis oligopeptide transport
FT                   system ATP-binding protein OppD, 358 aa; fasta scores: opt:
FT                   1126 z-score: 1167.7 E(): 0; 53.9% identity in 310 aa
FT                   overlap, to TR:P72409 (EMBL:U68036) Streptomyces coelicolor
FT                   putative ABC transporter intracellular ATPase subunit
FT                   BldKD, 353 aa; fasta scores: opt: 1035 z-score: 1074.2 E():
FT                   0; 51.5% identity in 326 aa overlap and to TR:O86574
FT                   (EMBL:AL031184) Streptomyces coelicolor oligopeptide ABC
FT                   transporter ATP-binding protein SC2A11.13, 365 aa; fasta
FT                   scores: opt: 1097 z-score: 945.2 E(): 0; 52.3% identity in
FT                   331 aa overlap. Contains Pfam match to entry PF00005
FT                   ABC_tran, ABC transporter and matches to Prosite entries
FT                   PS00017 ATP/GTP-binding site motif A (P-loop) and PS00211
FT                   ABC transporters family signature"
FT                   /db_xref="GOA:Q9F350"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F350"
FT                   /protein_id="CAC05750.1"
FT                   /translation="MLLEVRDLHVEFHTRDGVAKAVNGVSYGVDAGETLAVLGESGSGK
FT                   SVTAQTIMGILDIPPGRVTAGEILFEGRDLLKLKEEERRKVRGAEMAMIFQDALSSLNP
FT                   VLTVGAQLAEMFTVHRGMSRKDAHAKAVELMDRVRIPAAKERVRQYPHQFSGGMRQRIM
FT                   IAMAMALEPKLIIADEPTTALDVTVQAQVMDLLAELQRELHMGLILITHDLGVVADVAD
FT                   KIAVMYAGRIVETAPVHDIYKAPAHPYTRGLLESIPRLDQKGQELYAIKGLPPNLTRIP
FT                   PGCAFHPRCPMAQDVCRTDVPPLYDVTESDAERGSACHFWRECLHG"
FT   misc_feature    197478..198074
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 210.40, E-value 2.7e-59"
FT   misc_feature    197499..197522
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    197844..197888
FT                   /note="PS00211 ABC transporters family signature"
FT   regulatory      198350..198353
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        198361..199431
FT                   /transl_table=11
FT                   /gene="SCO5121"
FT                   /gene_synonym="SC9E12.06"
FT                   /product="putative peptide transport system ATP-binding
FT                   protein"
FT                   /note="SC9E12.06, probable peptide transport system
FT                   ATP-binding protein, len: 356 aa; similar to SW:APPF_BACSU
FT                   (EMBL:U20909) Bacillus subtilis oligopeptide transport
FT                   ATP-binding protein AppF, 329 aa; fasta scores: opt: 1255
FT                   z-score: 1332.6 E(): 0; 57.3% identity in 335 aa overlap,
FT                   to TR:P72410 (EMBL:U68036) Streptomyces coelicolor putative
FT                   ABC transporter intracellular ATPase subunit BldKE
FT                   (fragment), 284 aa; fasta scores: opt: 999 z-score: 1063.6
FT                   E(): 0; 58.1% identity in 260 aa overlap and to TR:O86575
FT                   (EMBL:AL031184) Streptomyces coelicolor oligopeptide ABC
FT                   transporter ATP-binding protein SC2A11.14, 496 aa; fasta
FT                   scores: opt: 1306 z-score: 1117.3 E(): 0; 55.4% identity in
FT                   345 aa overlap. Contains Pfam match to entry PF00005
FT                   ABC_tran, ABC transporter and matches to Prosite entries
FT                   PS00017 ATP/GTP-binding site motif A (P-loop) and PS00211
FT                   ABC transporters family signature"
FT                   /db_xref="GOA:Q9F349"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F349"
FT                   /protein_id="CAC05751.1"
FT                   /translation="MAETTEPILEVRGLVKHYPLTSGILFKKQVGAVKAVDGVDFRLAR
FT                   GETLGIVGESGCGKSTVAKMLVNLERPTAGEIRYKGEDITRLSGRALKSVRRNIQMVFQ
FT                   DPYTSLNPRMTVGDIIGEAYDIHPEVAPKGDRRRRVQDLLDVVGLNPEYINRYPHQFSG
FT                   GQRQRIGIARGLALRPEIIVADEPVSALDVSVQAQVINLMARLQDEFDLSYIFIAHDLS
FT                   IVRHISDRVGVMYLGRIVETGRDEEIYDHPTHPYTQALLSAVPVPDPEAREHRERIILS
FT                   GDVPSPTNIPSGCRFRTRCWKARERCALEVPALAVPAEFRSVSGPAAHDSACHFAEEKQ
FT                   VVPPEGEGEGEGSGPG"
FT   misc_feature    198496..199071
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 223.20, E-value 3.9e-63"
FT   misc_feature    198517..198540
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    198841..198885
FT                   /note="PS00211 ABC transporters family signature"
FT   CDS_pept        complement(199564..201687)
FT                   /transl_table=11
FT                   /gene="SCO5122"
FT                   /gene_synonym="SC9E12.07c"
FT                   /product="putative peptidase"
FT                   /note="SC9E12.07c, probable peptidase, len: 707 aa; similar
FT                   to TR:P95782 (EMBL:D83263) Xanthomonas maltophilia
FT                   dipeptidyl peptidase IV, 741 aa; fasta scores: opt: 442
FT                   z-score: 478.1 E(): 3.7e-19; 33.2% identity in 733 aa
FT                   overlap. Contains Pfam matches to entries PF00930
FT                   DPPIV_N_term, Dipeptidyl peptidase IV (DPP IV) N-terminal
FT                   region and PF00326 Peptidase_S9, Prolyl oligopeptidase
FT                   family and match to Prosite entry PS00708 Prolyl
FT                   endopeptidase family serine active site"
FT                   /db_xref="GOA:Q9F348"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F348"
FT                   /protein_id="CAC05752.1"
FT                   /translation="MTTESDSFPKRHARTQRFTLGAPRSFTVAPDGSRVAFLRSGTGTD
FT                   RANSLWVLDAEKGGERMAADPRALLGGAQERLSPEERARRERSREGGAGIVGYATDSSV
FT                   ELASFALSGRLFVAELQVGTARELPTPGPVIDPRPSPDGRHVAYVAQGALRVVGAEGDG
FT                   DRALAEADGEGVTYGLAEFVAAEEMSRSRGFWWSPESDRLLVARVDDTPVQRWWISDPA
FT                   HPGRDPQHVPYPAAGTPNADVRLFVVGLDGGRTEVLWDRARYPYLARVHWSAAGAPLLL
FT                   VQARDQRSQLFLAVDTESGTTRMVHADEDPIWLELFPGVPYWSPSGQLVRIADEGGARV
FT                   LAVGERLLTGAQLHLRAVLDVGADDVLVSASAGEEAAEAEIGEVHVYRVNELGVERLSQ
FT                   EPGVHSAVRAGGVTVLVSATLDRPGARVRVLRDGKAAATIASYAEDPGLSPRVTLTQGG
FT                   ARRVPCAVLMPTDYHGDTPLPVLLDPYGGPHGQRVVAAHNAHLTSQWFADQGFAVVVAD
FT                   GRGTPGRSPAWEKAVKDDVAAVVLQDQVDALHALAADFPLDLDRVAVRGWSFGGYLAAL
FT                   AALRRPDVFHAAVVGAPVTDLRLYDTHYQERYLGDPGEQPDVYRRNSVIDDAGLVDAAE
FT                   PHRPMMVIHGLADDNVVVAHSLRLSSALLAAGRPHEVLPLSGVTHMTPQESVAENLLRL
FT                   QVDFLKRSLPAPA"
FT   misc_feature    complement(199969..200061)
FT                   /note="PS00708 Prolyl endopeptidase family serine active
FT                   site"
FT   misc_feature    complement(199969..200166)
FT                   /note="Pfam match to entry PF00326 Peptidase_S9, Prolyl
FT                   oligopeptidase family, score 29.60, E-value 7.3e-08"
FT   misc_feature    complement(200203..201636)
FT                   /note="Pfam match to entry PF00930 DPPIV_N_term, Dipeptidyl
FT                   peptidase IV (DPP IV) N-terminal region, score -82.80,
FT                   E-value 5.4e-07"
FT   regulatory      201860..201867
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        201874..202068
FT                   /transl_table=11
FT                   /gene="SCO5123"
FT                   /gene_synonym="SC9E12.08"
FT                   /product="putative small membrane protein"
FT                   /note="SC9E12.08, possible small membrane protein, len: 64
FT                   aa; similar to TR:Q9RKX4 (EMBL:AL133213) Streptomyces
FT                   coelicolor putative secreted protein SC6D7.24c, 64 aa;
FT                   fasta scores: opt: 225 z-score: 329.1 E(): 7.3e-11; 56.5%
FT                   identity in 62 aa overlap. Contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F347"
FT                   /protein_id="CAC05753.1"
FT                   /translation="MALSISAVVLLAIIVFLLVKKSGLKAGHAVVCMLLGFYLASSTIA
FT                   PTISELTTNIAGMIGDINF"
FT   CDS_pept        complement(202058..202264)
FT                   /transl_table=11
FT                   /gene="SCO5124"
FT                   /gene_synonym="SC9E12.09c"
FT                   /product="hypothetical protein"
FT                   /note="SC9E12.09c, hypothetical protein, len: 68 aa;
FT                   similar to TR:Q9RDR5 (EMBL:AL136500) Streptomyces
FT                   coelicolor hypothetical 7.7 kDa protein SC1G2.14c, 73 aa;
FT                   fasta scores: opt: 217 z-score: 327.7 E(): 8.7e-11; 55.9%
FT                   identity in 59 aa overlap"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F346"
FT                   /protein_id="CAC05754.1"
FT                   /translation="MIRTSSSTGLVWSKSSYSSGGETDSCVEVALAPGTVHVRDSKNLP
FT                   DTGPRLALAPEAWGCFVAGTVRS"
FT   CDS_pept        complement(202261..203124)
FT                   /transl_table=11
FT                   /gene="SCO5125"
FT                   /gene_synonym="SC9E12.10c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SC9E12.10c, hypothetical protein, len: 287 aa;
FT                   similar to TR:Q9RDR4 (EMBL:AL136500) Streptomyces
FT                   coelicolor hypothetical 31.7 kDa protein SC1G2.15c, 284 aa;
FT                   fasta scores: opt: 1240 z-score: 1466.1 E(): 0; 67.2%
FT                   identity in 287 aa overlap"
FT                   /db_xref="GOA:Q9F345"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F345"
FT                   /protein_id="CAC05755.1"
FT                   /translation="MSVDAGTDQVDEPGWEVDPDDDWALAVIATVGRQLRLRREAAGMR
FT                   APDFAVAIGYGEDLVYKVEGGRRIPRPEYLDRADEVLTAGGLVAAMKEDVKKVRYPKKV
FT                   RDLAQMEARAVELQLYDPVNVHGLLQTPDYARALFRMRRPRYAEDEIERGVAARTARKA
FT                   VFERDPAPELGFVQDEWTLRRRLGGTDVVRRQLEHLLMLGRLPNVEIQVMPMDREEHAG
FT                   VDGAIEVLKFEDGTAVGRSPGVANGRPVTDLRQVRILELRYGIIRAQALTPCESAAFIE
FT                   QLLGET"
FT   regulatory      complement(202267..202270)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(203133..203139)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        203276..204163
FT                   /transl_table=11
FT                   /gene="SCO5126"
FT                   /gene_synonym="SC9E12.11"
FT                   /product="conserved hypothetical protein"
FT                   /note="SC9E12.11, hypothetical protein, len: 295 aa;
FT                   similar to TR:O50426 (EMBL:AL010186) Mycobacterium
FT                   tuberculosis hypothetical 31.7 kDa protein MTV005.06, 303
FT                   aa; fasta scores: opt: 531 z-score: 607.8 E(): 2.2e-26;
FT                   44.4% identity in 306 aa overlap"
FT                   /db_xref="GOA:Q9F344"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017810"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9F344"
FT                   /protein_id="CAC05756.1"
FT                   /translation="MTDLPGRRLLLVHAHPDDESINNGVTMARYAAEGAHVTLVTCTLG
FT                   ERGEVIPPALAHLSGAALGGHRRGELADAMRALGVDDFRLLGGPGRYADSGMLGLSDND
FT                   DPGCLWQADVDAAAALLVDVIREVRPQVLVTYDPNGGYGHPDHIQAHRIAMRAAELAAE
FT                   AGCPVAKVYWNRVPRSRVEDAFARLRDDLPGLPFEKAAGVEDVPGVVDDERITTEIRGE
FT                   GTAYAAAKAAAMRAHATQITVAEPYFVLSNDLAQPILTTEYYELVRGERGGEGRENDLF
FT                   AGIAGTFDTGEATS"
FT   regulatory      204148..204152
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204160..204582
FT                   /transl_table=11
FT                   /gene="SCO5127"
FT                   /gene_synonym="SC9E12.12"
FT                   /product="putative integral membrane protein"
FT                   /note="SC9E12.12, possible integral membrane protein, len:
FT                   1450 aa. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q9F343"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F343"
FT                   /protein_id="CAC05757.1"
FT                   /translation="MNGRNEPPSSALAQPLRPPSLGRAALYAGLFVLGAVLGVAGALLQ
FT                   PAWFPGGLLLALAAEAGLCAGAGRAVGRRGGAVAPALGWALAVVLLTTSRPEGDFLFAA
FT                   GAGSYLFLLGGIAVAVICATLAPVRQPDGGPARLRK"
FT   regulatory      204726..204729
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204738..207065
FT                   /transl_table=11
FT                   /gene="SCO5128"
FT                   /gene_synonym="SC9E12.13"
FT                   /product="putative membrane protein"
FT                   /note="SC9E12.13, possible membrane protein, len: 775 aa;
FT                   highly hydrophilic. Contains possible hydrophobic membrane
FT                   spanning region"
FT                   /db_xref="GOA:Q9F342"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F342"
FT                   /protein_id="CAC05758.1"
FT                   /translation="MSRETDSSSSGPHGRGGAAYPSGTPPYGTPTASDAGADAGRSATR
FT                   PEERKTETTLTTRIRINIPGSRPIPPVVVRKPVADGEDTADSTETTGERPAPAPSAAAP
FT                   GAAAPEAPAESAQSAQSAEEKPTSDWFAPRKSGPGKGTQGGGSTNGAGLPAGSAPTAGT
FT                   PGAAGARGAGPAGASGAGARPGGGSGRPGGVVGSMNAPGGARSGSAGGGARSGATGGPV
FT                   APGHGGGTGSFDVTEALAAGPLGGNGNGNGNGNGSGPRPGTDAGGEPRRDDLPYFAGEG
FT                   RADQAPGGQQNGLNGQSPYGTGPQGPAGPTSGPATGDSRLTPPPAGDLGGLGTAGGPAA
FT                   PGTQREPAPNGLRGPGSLGGPGGPGGPGRPAGSGPDAARLGPGGGLSDDTAILTPQRPV
FT                   PPGAANPDNISGNTVTSGIPVVPGERTAPFPAGSGDGPRPHTPPKLPEPVSAPPASSAK
FT                   PAKKKGRRKLPLLVVGVVVVAGVTYGAGLLMNRSDVPKGTTVLGVDIGGGTRDDAVEKL
FT                   DKALGARAAKPLKLTVGGDTVSLKPDQAGLQLDTQTTASSAATSDYNPMSVIGSLFGQK
FT                   RVVEPAMPVDEEKLHAALEDAAGGAGSATEGSIRFESGKAVPVYGKAGQGIDVAKSTEA
FT                   VQAAYRAQVETGTATAVNVPTTAKQPTVAKAEVDRMLKEFAEPAMSARVTVQTDAAHSI
FT                   QFSPEKSLWKFLRVTAVDGKLVDKPDLNALKELYGQTFDGVLIARANGEKTAVTPQDVY
FT                   GAMRQALKSKTDRVAVIDTNPS"
FT   misc_feature    205164..205892
FT                   /note="high content region in alanine, glycine and proline
FT                   amino acid residues. High G+C content also (81.61%)"
FT   CDS_pept        207212..208168
FT                   /transl_table=11
FT                   /gene="SCO5129"
FT                   /gene_synonym="SC9E12.14"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="SC9E12.14, possible ABC transporter ATP-binding
FT                   protein, len: 318 aa; similar to TR:CAB88183
FT                   (EMBL:AL352972) Streptomyces coelicolor putative ABC
FT                   transporter ATP-binding protein SCC30.13, 308 aa; fasta
FT                   scores: opt: 861 z-score: 926.3 E(): 0; 54.4% identity in
FT                   309 aa overlap. Contains Pfam match to entry PF00005
FT                   ABC_tran, ABC transporter and matches to Prosite entries
FT                   PS00017 ATP/GTP-binding site motif A (P-loop) and PS00211
FT                   ABC transporters family signature"
FT                   /db_xref="GOA:Q9F341"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F341"
FT                   /protein_id="CAC05759.1"
FT                   /translation="MTRTTAVGFDRVTKGYGDVRAVDGLTLALHPGETVALLGPNGAGK
FT                   STTLDLLLGLRRPDAGTVHVFGGEPREAVVAGRVGAMLQSGGLMDEVTVAELVRLGCAL
FT                   HPRAYPAADVLARAGLTKIADRRVDKLSGGQAQRVRFALATAGDSDLIVLDEPTTGMDV
FT                   TARQAFWATMREQADQGRTVLFATHYLEEADAIADRVLVLHRGRLLADGTAAEIKARAG
FT                   TRRISFDLDGGPDASPDASPDGSRNGTVDEATLRALPHLTALDVSGRTVRIQSADADAT
FT                   VYALYGLGLYPRNLEVAGLGLEQAFVALTAAEEAKQP"
FT   misc_feature    207305..207829
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 180.30, E-value 3.2e-50"
FT   misc_feature    207326..207349
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    207602..207646
FT                   /note="PS00211 ABC transporters family signature"
FT   regulatory      208149..208154
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        208165..208905
FT                   /transl_table=11
FT                   /gene="SCO5130"
FT                   /gene_synonym="SC9E12.15"
FT                   /product="putative ABC transporter integral membrane
FT                   protein"
FT                   /note="SC9E12.15, possible ABC transporter integral
FT                   membrane protein, len: 246 aa; similar to TR:CAB88184
FT                   (EMBL:AL352972) Streptomyces coelicolor putative ABC
FT                   transporter integral membrane protein SCC30.14, 238 aa;
FT                   fasta scores: opt: 516 z-score: 611.2 E(): 1.4e-26; 35.9%
FT                   identity in 237 aa overlap. Contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9F340"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F340"
FT                   /protein_id="CAC05760.1"
FT                   /translation="MNGLIKLELTRALRNRKFLFFSVIYPSALFLLIAGSADATSEVDG
FT                   TGLTLPTFFMVSMASFGALTAVLMGNSERIAKERESGWVRQLRLTALPGRGYVLAKTAS
FT                   AAVVSLPSVVVVFVVAAAVKDVRLHAWQWLALTGVIWAGSLVFAALGVAIGYLATGDAV
FT                   RPITMIVYFGLSMLGGLWMPTTTFPQWLRDVAEWLPTHAYAALGQSIEQSHAPHAQDLA
FT                   VLAVYFVLFAGGAAWLYRKDTLKA"
FT   CDS_pept        208902..210068
FT                   /transl_table=11
FT                   /gene="SCO5131"
FT                   /gene_synonym="SC9E12.16"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="SC9E12.16, possible two-component system sensor
FT                   kinase, len: 388 aa; similar to TR:CAB88185 (EMBL:AL352972)
FT                   Streptomyces coelicolor putative two-component system
FT                   sensor kinase SCC30.15, 409 aa; fasta scores: opt: 773
FT                   z-score: 840.8 E(): 0; 41.9% identity in 389 aa overlap.
FT                   Contains possible hydrophobic membrane spanning regions at
FT                   N-terminal domain"
FT                   /db_xref="GOA:Q9F339"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F339"
FT                   /protein_id="CAC05761.1"
FT                   /translation="MSGVGIGQRPENRRQKTVKVMWTAIWLAYLGAPVSDLLHGGHAVG
FT                   VQVLGWIGLVAFVVWYMLLLFRTGRGERTRLVLGSLAVLAAESTLLALTLGREWLVLFV
FT                   YVAIASGAALPLRLARWTIPGASALLTAMALVVPGGTSFIAGLLLPALLGGFAMTGVRE
FT                   LVRTTIALREARATVAQLAANEERLRLARDLHDLLGHSLSLITLKSELAGRMLPAHPDK
FT                   AAQQVADIEQVSRQALVDVREAVTGYRRARLAPELAGAKVALTAAGVDAELPGEPDPAH
FT                   LPEDSEAALAWALREAVTNVVRHSGARRCVVELLERQTLDGAVLELSVEDNGSGGPASA
FT                   NAPGNGLTGLAERLEKAGGTLEAGGSRRGFRLVARVPVGAATDVGSGA"
FT   CDS_pept        210065..210679
FT                   /transl_table=11
FT                   /gene="SCO5132"
FT                   /gene_synonym="SC9E12.17"
FT                   /product="putative two-component system response regulator"
FT                   /note="SC9E12.17, possible two-component system response
FT                   regulator, len: 204 aa; similar to TR:CAB88186
FT                   (EMBL:AL352972) Streptomyces coelicolor  putative
FT                   two-component response regulator SCC30.16, 210 aa; fasta
FT                   scores: opt: 822 z-score: 928.1 E(): 0; 63.0% identity in
FT                   200 aa overlap. Contains Pfam matches to entries PF00072
FT                   response_reg, Response regulator receiver domain and
FT                   PF00196 GerE, Bacterial regulatory proteins, luxR family.
FT                   Also contains possible helix-turn-helix motif at residues
FT                   159..180 (+5.28 SD)"
FT                   /db_xref="GOA:Q9F338"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F338"
FT                   /protein_id="CAC05762.1"
FT                   /translation="MSRTIKVLLAEDQAMVREALAALLGLEEDIEVVAQVARGDEVLDA
FT                   ARAHGVDVALLDIEMPGATGIEAAALVHRELPAVKLVVLTTFGRPGYLRSAMESGADAF
FT                   LVKDAPAAQLAEAVRRVLAGERVIDPTLAAAALAEGANPLTDREREILRAAADGSTNAE
FT                   LASALHLSQGTVRNYLSTAIQKLAVRNRAEAVRVARNKGWL"
FT   misc_feature    210077..210418
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 100.50, E-value 3.2e-26"
FT   misc_feature    210485..210676
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 65.30, E-value
FT                   1.3e-15"
FT   CDS_pept        complement(210789..211685)
FT                   /transl_table=11
FT                   /gene="SCO5133"
FT                   /gene_synonym="SC9E12.18c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SC9E12.18c, hypothetical protein, len: 298 aa;
FT                   C-terminal highly similar to N-terminal domain of TR:Q07641
FT                   (EMBL:AB006206) Streptomyces griseus hypothetical 34.5 kDa
FT                   protein in AmfR 3'region (fragment), 87 aa; fasta scores:
FT                   opt: 371 z-score: 414.3 E(): 1.3e-15; 63.2% identity in 87
FT                   aa overlap"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F337"
FT                   /protein_id="CAC05763.1"
FT                   /translation="MRPPRPPRPPSPQRSAELRRRFAQEARSERPDLATLCLLVGAEAD
FT                   GTLDEAGLDAAQVELDRLAGELPFRPGTPRAWAVALRDLLGERYGFHGVAADYQRLESS
FT                   LLHEVVRRRRGLPILLSVVWLEVARRAGAPVYGVALPGHFVVGFGGESAAASGPGSAPL
FT                   GERVLVDPYDGGRLLSGTDAEALVAGATGAELRASMLEPAAPLDVVARVLNNIRAWAAA
FT                   RPEQSAVGLWAVELALLLPAHAARLRYERAVLLVQRGEFAAGAGELEAYAEVVEAVDEA
FT                   VAEEVRGEARTARAMLN"
FT   repeat_region   complement(211656..211682)
FT   CDS_pept        complement(211727..212761)
FT                   /transl_table=11
FT                   /gene="SCO5134"
FT                   /gene_synonym="SC9E12.19c"
FT                   /product="hypothetical protein"
FT                   /note="SC9E12.19c, hypothetical protein, len: 344 aa;
FT                   highly similar to TR:O87087 (EMBL:AB006206) Streptomyces
FT                   griseus AmfR, AmfA and AmfB genes and 4 ORFS, complete CDS,
FT                   ORF5, 264 aa; fasta scores: opt: 1018 z-score: 1086.7 E():
FT                   0; 63.3% identity in 264 aa overlap. Contains Pfam match to
FT                   entry PF00583 Acetyltransf, Acetyltransferase (GNAT)
FT                   family"
FT                   /db_xref="GOA:Q9F336"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F336"
FT                   /protein_id="CAC05764.1"
FT                   /translation="MEFSAAGRLEVRITTADVGKRVSVRRLSEAGAAGEKFTDTVGVLT
FT                   SWTDGVLLITRKSGESVRVAESALVAGKVVPPAPARRRGPAASYEELARVAARSWRPVE
FT                   SERLGAWELRAAGGFTRRANSVLPLGDPGLPLDEALTAVRRWYGVRGLPAYVQTATGAA
FT                   GTQELLCAELERRGWVREVTAEVWTGPLAPVADLAGDTGVVLSREADETWLARYQRKGV
FT                   SEVALRVLESGPSVWFATVPGAEGADGAGGGGGVAAIGRCVVDGRWASFAAVEVDPAQR
FT                   RRGLATAVMAALARRALDEGASAAWLQVETDNAGARALYAGMGFAAHHSYHHYREPAAA
FT                   GTDR"
FT   misc_feature    complement(211784..212008)
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family, score 55.30, E-value
FT                   1.4e-12"
FT   regulatory      212887..212892
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        212902..213222
FT                   /transl_table=11
FT                   /gene="SCO5135"
FT                   /gene_synonym="fdxA1"
FT                   /gene_synonym="SC9E12.20"
FT                   /product="ferredoxin"
FT                   /note="SC9E12.20, fdxA1, ferredoxin, len: 106 aa; similar
FT                   to SW:FER_SACER (EMBL:M61119) Saccharopolyspora erythraea
FT                   ferredoxin FdxA, 105 aa; fasta scores: opt: 618 z-score:
FT                   759.8 E(): 0; 78.1% identity in 105 aa overlap and to
FT                   TR:CAC04216 (EMBL:AL391515) Streptomyces coelicolor FdxA,
FT                   ferredoxin, 129 aa; fasta scores: opt: 520 z-score: 702.1
FT                   E(): 1.8e-33; 65.7% identity in 105 aa overlap. Contains
FT                   Pfam match to entry PF00037 fer4, 4Fe-4S binding domain and
FT                   match to Prosite entry PS00198 4Fe-4S ferredoxins,
FT                   iron-sulfur binding region signature"
FT                   /db_xref="GOA:Q9F335"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F335"
FT                   /protein_id="CAC05765.1"
FT                   /translation="MTYVIAQPCVDVKDKACIEECPVDCIYEGQRSLYIHPDECVDCGA
FT                   CEPVCPVEAIFYEDDTPEEWKDYYKANVEFFDELGSPGGASKLGLIERDHPFVAALPPQ
FT                   NQ"
FT   misc_feature    212998..213069
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain, score 37.10, E-value 3.9e-07"
FT   misc_feature    213019..213054
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature"
FT   stem_loop       213242..213297
FT                   /note="possible stem loop. Score 50: 18/19 (94%) matches, 0
FT                   gaps"
FT   regulatory      213326..213329
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        213339..214436
FT                   /transl_table=11
FT                   /gene="SCO5136"
FT                   /gene_synonym="SC9E12.21"
FT                   /product="putative aminotransferase"
FT                   /note="SC9E12.21, probable aminotransferase, len: 365 aa;
FT                   similar to TR:O50434 (EMBL:AL010186) Mycobacterium
FT                   tuberculosis aminotransferase MTV005.14, 362 aa; fasta
FT                   scores: opt: 1448 z-score: 1704.1 E(): 0; 61.7% identity in
FT                   360 aa overlap. Contains match to Prosite entry PS00105
FT                   Aminotransferases class-I pyridoxal-phosphate attachment
FT                   site"
FT                   /db_xref="GOA:Q9F334"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019880"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F334"
FT                   /protein_id="CAC05766.1"
FT                   /translation="MSAVSDRLPTFPWDKLEPYKKTAAAHPGGIVDLSVGTPVDPVPEL
FT                   IQKALVDAADSPGYPTVWGTPALRDAITGWVERRLGARDVTHRHVLPVVGSKELVAWLP
FT                   TQLGLGPGDRVAFPRLAYPTYEVGARLARAEYEAYEDPTELDPAGLKLLWLNSPSNPTG
FT                   KVLSKADLTRIVAWAREHGVLVVSDECYLELGWEADPVSVLHPDVNGGSYDGLVAVHSL
FT                   SKRSNLAGYRAAFLAGDPAVLGPLLEIRKHGGMMTPAPTQAAVVAALGDDEHVRVQRER
FT                   YAARRTVLREALLGAGFRIEHSEASLYLWATRGESCWETVAHLAERGILVAPGDFYGPA
FT                   GAHFVRVALTATDDRVQAAADRLRS"
FT   misc_feature    213999..214040
FT                   /note="PS00105 Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site"
FT   CDS_pept        complement(214655..215086)
FT                   /transl_table=11
FT                   /gene="SCO5137"
FT                   /gene_synonym="SC9E12.22c"
FT                   /product="putative ATP-binding protein"
FT                   /note="SC9E12.22c, possible ATP-binding protein, len: 143
FT                   aa. Contains match to Prosite entry PS00017 ATP/GTP-binding
FT                   site motif A (P-loop). Contains possible hydrophobic
FT                   membrane spanning region"
FT                   /db_xref="GOA:Q9F333"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F333"
FT                   /protein_id="CAC05767.1"
FT                   /translation="MSLPLTRRIARAALLVAAGAAAGVGAAGSASAAPELPATPNLGGL
FT                   TALDGANVGNTAASAAESATETAGDTGGKAVKKAVPTAGKTGGSVVKKATPAAQNAAGD
FT                   AAGSAGDIVGDTAATATKGGLPTDALGKGGLPVQGLPLG"
FT   misc_feature    complement(214829..214852)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   regulatory      complement(215091..215096)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(215424..216392)
FT                   /transl_table=11
FT                   /gene="SCO5138"
FT                   /gene_synonym="SCP8.01c"
FT                   /gene_synonym="SC9E12.23c"
FT                   /product="putative membrane protein"
FT                   /note="SCP8.01c, possible membrane protein (fragment), len:
FT                   >86 aa. . Contains possible hydrophobic membrane spanning
FT                   region"
FT                   /note="SC9E12.23c, hypothetical protein (fragment), len:
FT                   >270 aa; similar to TR:Q9X867 (EMBL:AL049661) Streptomyces
FT                   coelicolor putative lipoprotein SCE134.12, 381 aa; fasta
FT                   scores: opt: 432 z-score: 481.0 E(): 2.5e-19; 41.2%
FT                   identity in 211 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CJS1"
FT                   /protein_id="CAD55224.1"
FT                   /translation="MLQPSPPRKRRGRLARSGAASMVLLAVAGYLAVQYVTGGAFAPGC
FT                   KVAGGKGGRTTYEFTPEQAVNAATITAVGTARKLPDRAVTIALAAALQESALRNLDHGD
FT                   KDSLGLFQQRPSQGWGKPEEIMDPAYSAGLFYDHLVEVPGYLDLPLTDAAQRVQRSAFP
FT                   DAYAKHEPDAELLAAALTGRSAATLTCVGRPGATPEKGPDAVRAALVRDFGHDVLRPAG
FT                   AEVGGDAASRRPATGSDERTVTLPVTGSTGSGPAREHVRRGWQLAHWAVANASSLHIQR
FT                   VTYAGREWTAGNTDSKWYPTGTEGAKGAERAAEAVRITSAR"
FT   CDS_pept        216476..217555
FT                   /transl_table=11
FT                   /gene="SCO5139"
FT                   /gene_synonym="dapE"
FT                   /gene_synonym="SCP8.02"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="SCP8.02, dapE, succinyl-diaminopimelate
FT                   desuccinylase, len: 359 aa; highly similar to SW:DAPE_CORGL
FT                   (EMBL:X81379) Corynebacterium glutamicum
FT                   succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) DapE,
FT                   369 aa; fasta scores: opt: 1189 z-score: 1383.5 E(): 0;
FT                   52.1% identity in 361 aa overlap. Contains Pfam match to
FT                   entry PF01546 Peptidase_M20, Peptidase family M20/M25/M40"
FT                   /db_xref="GOA:Q9FBL9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL9"
FT                   /protein_id="CAC01340.1"
FT                   /translation="MADTPLDLTLDAAELTARLVDFPSESGTEKPLADAIESALRTLPH
FT                   LSVERYGNNLVARTGLGRAERVILAGHIDTVPIAGNVPSRLDEDGVLWGCGTCDMKAGV
FT                   AVQLRIAATVPAPNRDLTFVFYDNEEVAAELNGLKHVAEAHPEWLEGDFAVLLEPSDGQ
FT                   VEGGCQGTLRVLLKTAGERAHSARSWMGSNAIHAAAPILARLAAYEPRYPVIDGLEYRE
FT                   GLNAVGITGGVAGNVIPDECVVTVNFRYAPDRSPEEALAHVREVFDGCGVTDFVVDDHS
FT                   GAALPGLSHPAAAAFIEAVGGTPQPKYGWTDVSRFSALGVPAVNYGPGNPHLAHKRDER
FT                   VEVAKILAGEERLRSWLTA"
FT   misc_feature    216521..217282
FT                   /note="Pfam match to entry PF01546 Peptidase_M20, Peptidase
FT                   family M20/M25/M40, score 165.00, E-value 2.1e-46"
FT   CDS_pept        217673..218431
FT                   /transl_table=11
FT                   /gene="SCO5140"
FT                   /gene_synonym="SCP8.03"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.03, hypothetical protein, len: 252 aa; similar
FT                   to TR:Q46063 (EMBL:X81379) Corynebacterium glutamicum ORF2,
FT                   211 aa; fasta scores: opt: 938 z-score: 1070.3 E(): 0;
FT                   67.1% identity in 210 aa overlap"
FT                   /db_xref="GOA:Q9FBL8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="PDB:5ZI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL8"
FT                   /protein_id="CAC01341.1"
FT                   /translation="MATGNPEGKKRPPEEQRLGPVLRRRGQVQESTTDQRLLDERAPTD
FT                   WVHTDPWRVLRIQSEFIEGFGTLAELPPAISVFGSARTPADSPEYDAGVRLGRGLVEAG
FT                   FAVITGGGPGAMEAANKGALEAKGTSVGLGIELPFEQGLNPYVDIGLNFRYFFVRKMMF
FT                   VKYAQGFVVLPGGLGTLDELFEALTLVQTQKVTRFPIVLFGSEYWGGLVDWLRGTLVAQ
FT                   GKAAEKDLMLFHVTDDVDEAVALVSKEAGR"
FT   CDS_pept        complement(218682..219566)
FT                   /transl_table=11
FT                   /gene="SCO5141"
FT                   /gene_synonym="folP"
FT                   /gene_synonym="SCP8.04c"
FT                   /product="dihydropteroate synthase"
FT                   /note="SCP8.04c, folP, dihydropteroate synthase, len: 294
FT                   aa; similar to SW:DHPS_MYCLE (EMBL:U15180) Mycobacterium
FT                   leprae dihydropteroate synthase (EC 2.5.1.15) (DHPS) FolP,
FT                   291 aa; fasta scores: opt: 1095 z-score: 1239.8 E(): 0;
FT                   60.6% identity in 292 aa overlap. Contains Pfam match to
FT                   entry PF00809 DHPS, Dihydropteroate synthase and matches to
FT                   Prosite entries PS00792 Dihydropteroate synthase signature
FT                   1 and PS00793 Dihydropteroate synthase signature 2"
FT                   /db_xref="GOA:Q9FBL7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL7"
FT                   /protein_id="CAC01342.1"
FT                   /translation="MDQEMSQGMLRLGRREFAAHEPVIMAIVNRTPDSFYDRGATFGDE
FT                   PALARVEQAVAEGAAIIDVGGVKAGPGDEVSAAEEARRTVGFVAEVRRRHPDVVISVDT
FT                   WRHEVGEAVCEAGADLLNDAWGGVDPKLAEVAARYGVGLVCTHAGGAEPRTRPHRVTYD
FT                   DVVADVLRVTLGLAERAVGLGVPRESVLIDPGHDFGKNTRHSLEATRRLGEMVETGWPV
FT                   LVSLSNKDFVGETLDRPVKERLIGTLATTAVSAWLGARVYRVHEVAETRQVLDMVATIA
FT                   GHREPAVARRGLA"
FT   misc_feature    complement(218730..219494)
FT                   /note="Pfam match to entry PF00809 DHPS, Dihydropteroate
FT                   synthase, score 330.90, E-value 1.4e-95"
FT   misc_feature    complement(219354..219395)
FT                   /note="PS00793 Dihydropteroate synthase signature 2"
FT   misc_feature    complement(219450..219497)
FT                   /note="PS00792 Dihydropteroate synthase signature 1"
FT   CDS_pept        219711..220070
FT                   /transl_table=11
FT                   /gene="SCO5142"
FT                   /gene_synonym="SCP8.05"
FT                   /product="putative secreted protein"
FT                   /note="SCP8.05, possible secreted protein, len: 119 aa.
FT                   Contains possible coiled-coil region at approx residues
FT                   77..95 and N-terminal region signal peptide sequence"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL6"
FT                   /protein_id="CAC01343.1"
FT                   /translation="MVMFLFLVIALAVVVAAVTLAVVGGGESGPLPDAAPERVRDALPP
FT                   DRPVGRGDVERLRFPLVVRGYRMADVDDALGRLGAELAEREARIADLESALAGARAAAA
FT                   HRHVVMDKPDREEQQ"
FT   regulatory      220057..220061
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        220067..220651
FT                   /transl_table=11
FT                   /gene="SCO5143"
FT                   /gene_synonym="tag"
FT                   /gene_synonym="SCP8.06"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /note="SCP8.06, tag, DNA-3-methyladenine glycosylase I,
FT                   len: 194 aa; highly similar to SW:3MG1_ECOLI (EMBL:J02606)
FT                   Escherichia coli DNA-3-methyladenine glycosylase I (EC
FT                   3.2.2.20) Tag, 187 aa; fasta scores: opt: 529 z-score:
FT                   636.5 E(): 5.5e-28; 45.2% identity in 177 aa overlap"
FT                   /db_xref="GOA:Q9FBL5"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL5"
FT                   /protein_id="CAC01344.1"
FT                   /translation="MSAGEAVAGPDGALRCPWALSTADYVTYHDDEWGRPVHGDDALYE
FT                   RLSLEAFQSGLSWITILRRRTGFRSAFAGFEIAKVAAFTDTDRERLLADTGIIRNRAKI
FT                   DATLTNARVLAEWAPGDLDELIWSHAPDPAGRPAPKTLTDVPAVTPESTALSKALKKRG
FT                   LRFVGPTTAYALMQACGLVDDHLAACVARRP"
FT   CDS_pept        complement(221303..222106)
FT                   /transl_table=11
FT                   /gene="SCO5144"
FT                   /gene_synonym="SCP8.07c"
FT                   /product=" putative acyl CoA isomerase"
FT                   /note="SCP8.07c, probable acyl CoA isomerase, len: 267 aa;
FT                   highly similar to TR:AAF73478 (EMBL:AF268489) Streptomyces
FT                   collinus 2-cyclohexenylcarbonyl CoA isomerase ChcB, 269 aa;
FT                   fasta scores: opt: 1476 z-score: 1623.5 E(): 0; 87.6%
FT                   identity in 266 aa overlap and to SW:CRT_CLOAB
FT                   (EMBL:U17110) Clostridium acetobutylicum
FT                   3-hydroxybutyryl-CoA dehydratase (EC 4.2.1.55) Crt, 261 aa;
FT                   fasta scores: opt: 426 z-score: 476.6 E(): 4.4e-19; 32.4%
FT                   identity in 259 aa overlap. Contains Pfam match to entry
FT                   PF00378 ECH, Enoyl-CoA hydratase/isomerase family and match
FT                   to Prosite entry PS00166 Enoyl-CoA hydratase/isomerase
FT                   signature"
FT                   /db_xref="GOA:Q9FBL4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL4"
FT                   /protein_id="CAC01345.1"
FT                   /translation="MADTVLYEVSDGLATITLNRPEAMNALNIETKVALRDAVRSAAAD
FT                   DAVRAVLLTAAGDRAFCVGQDLKEHIGLLAADRETGSGQTMSTVREHYNPIVRALAGAE
FT                   KPVVAAVNGVAAGAGLGFALAADYRIVADTAAFNTSFAGVALTADSGISWTLPRVVGPG
FT                   RAADLLLFPRSIRAQEAYELGIATRVVPAADLRAEAEKTARALAEGPTVAYAALKEAMA
FT                   YGLTHSLSETLDKEDELQSRAGASEDHAIAVRAFVEKGKPKYLGR"
FT   misc_feature    complement(221534..222067)
FT                   /note="Pfam match to entry PF00378 ECH, Enoyl-CoA
FT                   hydratase/isomerase family, score 171.20, E-value 1.8e-47"
FT   misc_feature    complement(221723..221785)
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature"
FT   regulatory      complement(222115..222119)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        222410..222634
FT                   /transl_table=11
FT                   /gene="SCO5145"
FT                   /gene_synonym="SCP8.08"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.08, conserved hypothetical protein, len: 74 aa;
FT                   highly similar to TR:O05312 (EMBL:Z93777) Mycobacterium
FT                   tuberculosis hypothetical 7.8 kD protein MTCI364.23, 75 aa;
FT                   fasta scores: opt: 323 z-score: 419.6 E(): 6.6e-16; 78.6%
FT                   identity in 70 aa overlap"
FT                   /db_xref="InterPro:IPR021465"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL3"
FT                   /protein_id="CAC01346.1"
FT                   /translation="MPSRAVGGDGELVSGRGTSMAAMKPRTGDGPLEVTKEGRGIVMRV
FT                   PLEGGGRLVVELTPDEADALGDALKKVVG"
FT   CDS_pept        complement(222745..223269)
FT                   /transl_table=11
FT                   /gene="SCO5146"
FT                   /gene_synonym="SCP8.09c"
FT                   /product="putative methyltransferase"
FT                   /note="SCP8.09c, probable methyltransferase, len: 174 aa;
FT                   similar to SW:MDMC_STRMY (EMBL:M93958) Streptomyces
FT                   mycarofaciens O-methyltransferase (EC 2.1.1.-) MdmC, 221
FT                   aa; fasta scores: opt: 253 z-score: 313.8 E(): 5.2e-10;
FT                   31.5% identity in 178 aa overlap. Contains Pfam match to
FT                   entry PF01596 Methyltransf_3, O-methyltransferase"
FT                   /db_xref="GOA:Q9FBL2"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL2"
FT                   /protein_id="CAC01347.1"
FT                   /translation="MTPGTGSALGLLAAAVDAKAVAEIGTGCGVSGIHLLHGMRPDGVL
FT                   TTVDPEPEHQQFARHAFRAAGFASNRARFIPGRALDVLPRLADAGYDLVFCDGDRLEYL
FT                   DYLAESLRLLRPGGLVAFEGVFGAGRTIDSGPQPTEVLRVRELLRAVRESQELVPSLLP
FT                   VGDGLLCAVKR"
FT   misc_feature    complement(222748..223269)
FT                   /note="Pfam match to entry PF01596 Methyltransf_3,
FT                   O-methyltransferase, score -18.50, E-value 5.8e-08"
FT   misc_feature    223455..223460
FT                   /note="DraI restriction site"
FT   CDS_pept        223690..224361
FT                   /transl_table=11
FT                   /gene="SCO5147"
FT                   /gene_synonym="SCP8.10"
FT                   /product="putative ECF-subfamily sigma factor"
FT                   /note="SCP8.10, probable ECF-subfamily sigma factor, len:
FT                   223 aa; similar to TR:O05735 (EMBL:U87308) Mycobacterium
FT                   avium extracytoplasmic function alternative sigma factor
FT                   SigE, 251 aa; fasta scores: opt: 852 z-score: 1013.1 E():
FT                   0; 62.5% identity in 216 aa overlap and to SW:CARQ_MYXXA
FT                   (EMBL:X71062) Myxococcus xanthus RNA polymerase sigma
FT                   factor CarQ, 174 aa; fasta scores: opt: 285 z-score: 347.6
FT                   E(): 6.8e-12; 36.5% identity in 159 aa overlap. Contains
FT                   Pfam match to entry PF00776 Sigma70_ECF, Sigma-70 factor
FT                   (ECF subfamily). Also contains a possible helix-turn-helix
FT                   motif at residues 164..185 (+3.76 SD)"
FT                   /db_xref="GOA:Q9FBL1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL1"
FT                   /protein_id="CAC01348.1"
FT                   /translation="MNDTAADHSHADGPTTGHAHTATFSSDADGQAWTPPTWEEIVSTH
FT                   SGRVYRLAYRLTGNQHDAEDLTQEVFVRVFRSLSTYTPGTFEGWLHRITTNLFLDMVRR
FT                   KQRIRFDALGDDAAERLPSREPTPQQLFHDAHFDADVQQALDTLAPEFRAAVVLCDIEG
FT                   LSYEEIAATLGVKLGTVRSRIHRGRSQLRKALAHRSPKARADRRSLAAGVPALGGGGTS
FT                   A"
FT   misc_feature    223840..224004
FT                   /note="Pfam match to entry PF00776 Sigma70_ECF, Sigma-70
FT                   factor (ECF subfamily), score 95.00, E-value 1.5e-24"
FT   CDS_pept        224358..225347
FT                   /transl_table=11
FT                   /gene="SCO5148"
FT                   /gene_synonym="SCP8.11"
FT                   /product="putative membrane protein"
FT                   /note="SCP8.11, possible membrane protein, len: 329 aa.
FT                   Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL0"
FT                   /protein_id="CAC01349.1"
FT                   /translation="MSGSRPEPEGHLAEQHLGDRLSALVDGELGHDARERVLAHVATCP
FT                   KCKAEVDAQRRLKNVFAEAAPPAPSESFLARLQGLPGGGDSDGGGSPFSGLPGGFGASA
FT                   ASGVFGPRRDERFEFDYVPAGSHTPVLPSATSGRGFRIHEVGRHESDRSASRGLRFAFA
FT                   AAGAVSLAAIALGGVTLGTPDTTTEARGSGSGSNVTPLRTPGSAAATGSESQRRRTAGP
FT                   LLGQGQRALGDLPVASTTASAPLLPGMPAPAGGDARQQAVRALTTPVTAGAAAMSPLIR
FT                   PLEAVPPLSLSSWSAAPEVRPPGLLAAPDPAPSPYPAASPAASSSPLR"
FT   CDS_pept        225838..227466
FT                   /transl_table=11
FT                   /gene="SCO5149"
FT                   /gene_synonym="SCP8.12"
FT                   /product="putative protease"
FT                   /note="SCP8.12, possible protease, len: 542 aa; C-terminal
FT                   region similar to TR:O53896 (EMBL:AL021999) Mycobacterium
FT                   tuberculosis putative serine protease MTV044.11, 464 aa;
FT                   fasta scores: opt: 803 z-score: 614.5 E(): 9.2e-27; 39.4%
FT                   identity in 469 aa overlap and to TR:AAF61294
FT                   (EMBL:AF155705) Lactococcus lactis serine protease HtrA,
FT                   408 aa; fasta scores: opt: 536 z-score: 415.8 E(): 1.1e-15;
FT                   34.8% identity in 310 aa overlap. Contains Pfam matches to
FT                   entries PF00089 trypsin, Trypsin and PF00595 PDZ, PDZ
FT                   domain (Also known as DHR or GLGF)"
FT                   /db_xref="GOA:Q9FBK9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK9"
FT                   /protein_id="CAC01350.1"
FT                   /translation="MEAGSRPHAGTGSVPAADGTSDAGRPKPLHEPDPYSTPPYGEPGP
FT                   WAPAPPVQHPAATPAHGTVTAAGGALHAPVTPVTEGSHAHVPHPGASSVSPPVGAVPDP
FT                   AFADAAPPVPPTAQEQPPAPAATPAYDTAPHDAAPPPAAPADPWGRYDPWAASAQHHDA
FT                   AERAPKRRRGPRAKALVGGALLIALVSGGIGGGVGAYLERNGGVGTVELPQAGPEAAER
FT                   DPDSVAGIAARALPSVVTLHVSGSEAAGTGTGFVLDGRGHILTNNHVVEPAGSGGEITV
FT                   TFNSGDTAEAEVVGRDSGYDLAVVKVKGVTGLTPMPLGNSDNVRVGDPVVAIGAPFDLA
FT                   GTVTSGIISAKERPITAGGEEGDGSDISYVDALQTDAPINPGNSGGPLLDARGRAIGIN
FT                   SAIRSADSGSTESDDGQAGSIGLGFAIPINQGKRVAEELINTGKAAHPVIGITLDMNYT
FT                   GDGARVSAKGGDGGPAVTTGGPGAKAGIKPGDVITAVDGQRVHSGEELIVKTRAHRPGD
FT                   RLELTLQRDGKETKVSLVLGSSGDD"
FT   misc_feature    226513..227067
FT                   /note="Pfam match to entry PF00089 trypsin, Trypsin, score
FT                   32.00, E-value 2.6e-09"
FT   misc_feature    227149..227415
FT                   /note="Pfam match to entry PF00595 PDZ, PDZ domain (Also
FT                   known as DHR or GLGF)., score 21.60, E-value 0.0081"
FT   CDS_pept        227613..228098
FT                   /transl_table=11
FT                   /gene="SCO5150"
FT                   /gene_synonym="SCP8.13"
FT                   /product="putative membrane protein"
FT                   /note="SCP8.13, putative membrane protein, len: 151 aa;
FT                   similar to TR:O69415 (EMBL:AJ005830) Escherichia coli
FT                   Sec-independent protein translocase TatB, 171 aa; fasta
FT                   scores: opt: 169 z-score: 186.8 E(): 0.0061; 23.6% identity
FT                   in 161 aa overlap. High in aspartate, glutamate and serine
FT                   amino acid residues. Highly similar to TR:Q9EWB3
FT                   (EMBL:AJ292256) Streptomyces lividans twin arginine
FT                   translocation complex component TatB 158 aa; fasta scores:
FT                   opt: 1001  Z-score: 1020.1 E(): 3.5e-49; 97.516% identity
FT                   in 161 aa overlap. Contains possible hydrophobic membrane
FT                   spanning region"
FT                   /db_xref="GOA:Q9FBK8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBK8"
FT                   /protein_id="CAC01351.1"
FT                   /translation="MFNDIGALELVTLVVLAVLVFGPDKLPKVIQDVTRTIRKIREFSD
FT                   SAKQDIRQELGPEFKDFEFEDLNPKTFIRKQLDNEELGLKEIRNGFDLKKEMAEVTDAV
FT                   HGRDAESSSSGSSSGSSSAASGNGRVDMSKKPEKPEKPGKTDKPAADDRPPFDMDAT"
FT   CDS_pept        228255..229001
FT                   /transl_table=11
FT                   /gene="SCO5151"
FT                   /gene_synonym="SCP8.14"
FT                   /product="hypothetical protein SCP8.14"
FT                   /note="SCP8.14, unknown, len: 248 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK7"
FT                   /protein_id="CAC01352.1"
FT                   /translation="MRTGRVRPKGGGPFRSDESEEASGHMETTSRAVAQAPAAEGGPQS
FT                   PSGRRTVDGYLRAPFPWYGLDEAFTGRRWLMQIGTAADGAVEHGSIGHGDEPSVRNEHV
FT                   AGDEQDAKEKFAVVVTVAANPDRRSADGTGLLEATSVSSAAWLAGVGLLSFTWPGQMDH
FT                   SLRDDWLEQQTETAWVLADDLDGEDWTTLSLPVDGVPTPFHYRESEFGWVLAGSTEQGV
FT                   HLGAYGRGMSAYGLAFAVVKDVAAYA"
FT   CDS_pept        complement(229076..230209)
FT                   /transl_table=11
FT                   /gene="SCO5152"
FT                   /gene_synonym="SCP8.15c"
FT                   /product="putative ATP-binding protein"
FT                   /note="SCP8.15c, probable ATP-binding protein, len: 371 aa;
FT                   similar to SW:MRP_MYCTU (EMBL:Z98260) Mycobacterium
FT                   tuberculosis Mrp protein homolog MTV006.01c, 390 aa; fasta
FT                   scores: opt: 1650 z-score: 1730.0 E(): 0; 67.9% identity in
FT                   371 aa overlap and to SW:MRP_ECOLI (EMBL:U00007)
FT                   Escherichia coli Mrp protein, 379 aa; fasta scores: opt:
FT                   706 z-score: 744.5 E(): 0; 35.8% identity in 363 aa
FT                   overlap. Contains Pfam matches to entries PF01883 DUF59,
FT                   Domain of unknown function DUF59 and PF00142 fer4_NifH,
FT                   4Fe-4S iron sulfur cluster binding proteins, NifH/frxC
FT                   family and matches to Prosite entries PS00017
FT                   ATP/GTP-binding site motif A (P-loop) and PS01215 Mrp
FT                   family signature"
FT                   /db_xref="GOA:Q9FBK6"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK6"
FT                   /protein_id="CAC01353.1"
FT                   /translation="MATEDAVREALATVNDPEINRPITELGMVKSVEIGADGAVAVAVY
FT                   LTVSGCPMRDTITQRVSDAVSRVEGVTRVDVELDVMSDEQRKELATALRGGQTEREVPF
FT                   AKPGSLTRVYAVASGKGGVGKSSVTVNLAASMAADGLKVGVVDADIYGHSVPRMLGADG
FT                   RPTQVENMIMPPSAHGVKVISIGMFTPGNAPVVWRGPMLHRALQQFLADVYWGDLDVLL
FT                   LDLPPGTGDIAISVAQLVPNAEILVVTTPQQAAAEVAERAGAIAVQTHQKIVGVVENMS
FT                   GLPCPHCGEMVDVFGTGGGQTVADGLTRTTGASVPVLGAIPIDVRLREGGDEGKPVVLS
FT                   DPDSPAGAALRSIAGKLGGRQRGLSGLSLGITPKNKF"
FT   misc_feature    complement(229517..229567)
FT                   /note="PS01215 Mrp family signature"
FT   misc_feature    complement(229781..229876)
FT                   /note="Pfam match to entry PF00142 fer4_NifH, 4Fe-4S iron
FT                   sulfur cluster binding proteins, NifH/frxC family, score
FT                   16.90, E-value 0.00075"
FT   misc_feature    complement(229832..229855)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    complement(229949..230191)
FT                   /note="Pfam match to entry PF01883 DUF59, Domain of unknown
FT                   function DUF59, score 31.60, E-value 7.8e-07"
FT   CDS_pept        complement(230254..230850)
FT                   /transl_table=11
FT                   /gene="SCO5153"
FT                   /gene_synonym="SCP8.16c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCP8.16c, possible integral membrane protein, len:
FT                   198 aa; similar to TR:O86314 (EMBL:Z98260) Mycobacterium
FT                   tuberculosis hypothetical 20.4 kD protein MTV006.03c, 180
FT                   aa; fasta scores: opt: 517 z-score: 619.2 E(): 5.1e-27;
FT                   52.9% identity in 157 aa overlap. Contains possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBK5"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK5"
FT                   /protein_id="CAC01354.1"
FT                   /translation="MPERETTTRERATSGATASSRARARLDQPRPPRRRLLPEWDPESF
FT                   GRLSERVARFLGTGRFIVWMTVVIILWVVWNVSAPSGLRFDEYPFIFLTLMLSLQASYA
FT                   APLILLAQNRQDDRDRVNLEQDRKQNERSIADTEYLTREIAALRIGLGEVATRDWIRSE
FT                   LQDLVRDLEERQNGHHPDRGVFPADRSAGRDVHDR"
FT   CDS_pept        complement(230843..232144)
FT                   /transl_table=11
FT                   /gene="SCO5154"
FT                   /gene_synonym="SCP8.17c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.17c, hypothetical protein, len: 433 aa; highly
FT                   similar to TR:O86315 (EMBL:Z98260) Mycobacterium
FT                   tuberculosis hypothetical 47.4 kD protein MTV006.04c, 435
FT                   aa; fasta scores: opt: 1335 z-score: 1494.5 E(): 0; 49.9%
FT                   identity in 425 aa overlap and C-terminal region similar to
FT                   C-terminal region of TR:Q9X0P4 (EMBL:AE001773) Thermotoga
FT                   maritima Mg2+ transporter MgtE, putative, 446 aa; fasta
FT                   scores: opt: 390 z-score: 439.1 E(): 5.4e-17; 31.3%
FT                   identity in 240 aa overlap"
FT                   /db_xref="GOA:Q9FBK4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK4"
FT                   /protein_id="CAC01355.1"
FT                   /translation="MAAGAPRIFVSHLSGIAVFDPAGDQVGRVRDLVVMLRVGRKPPRV
FT                   LGLVVELTTRRRIFLPMTRVTGIESGQVITTGVLNVRRFEQRPTERLVFGELLDRRVTL
FT                   TETGEEVTVLDLSVQQLPARRDWEIDKVFVRKGRKGGAFRRNKGETLTVEWSGVSGFSV
FT                   EEQGQGAENLLATFEQLRPADLANVLHHLSAKRRAEVAAALDDDRLADVLEELPEDDQI
FT                   EILGKLKEERAADVLEAMDPDDAADLLGELPEADKERLLSLMQPEDAADMRRLMAYEEH
FT                   TAGGLMTTEPIVLRPDATVADALARIRNPDLSPAHAAQVYVCRPPEETPTGKYLGTVHF
FT                   QRLLRDPPYTLVGSILDDDLQPLEPDAALPVVAGFFAAYDMVAAPVVDDSGALLGAVTV
FT                   DDVLDHMLPDDWRETEYHLDETTGTTGEVGADGA"
FT   regulatory      complement(232153..232160)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        232439..233170
FT                   /transl_table=11
FT                   /gene="SCO5155"
FT                   /gene_synonym="SCP8.18"
FT                   /product="putative lipoprotein"
FT                   /note="SCP8.18, possible lipoprotein, len: 243 aa; similar
FT                   to TR:CAB76294 (EMBL:AL158057) Streptomyces coelicolor
FT                   putative lipoprotein SC1G8.21c, 249 aa; fasta scores: opt:
FT                   238 z-score: 275.6 E(): 7e-08; 29.3% identity in 249 aa
FT                   overlap. Contains possible N-terminal region signal peptide
FT                   sequence and correctly situated match to Prosite entry
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK3"
FT                   /protein_id="CAC01356.1"
FT                   /translation="MTPRRRIRRAALLGAVCALAVTGAGLTGCSSEDPDAGTNGLGKLS
FT                   ADKIQAKAGTAAQAARTVRLHGSVEAAGSTYTLDMRLKADGGTGSVAAEGTTFGLLRVG
FT                   EQLFLKADAGFWSHDGGDAKAADKLAGKYVKVPQSDPVYKKFSGFTDKDVLLGGLLTLH
FT                   GTVKTDGRHEQAGVRTIRITGDDGAGGSLDVSLEGTPYPLRLVRAGSAGTIGFSDWNKD
FT                   FALEQPAKDDTLDYGKQLPSS"
FT   misc_feature    232493..232525
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        complement(233185..233697)
FT                   /transl_table=11
FT                   /gene="SCO5156"
FT                   /gene_synonym="SCP8.19c"
FT                   /product="hypothetical protein SCP8.19c"
FT                   /note="SCP8.19c, unknown, len: 170 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK2"
FT                   /protein_id="CAC01357.1"
FT                   /translation="MTSELLDQALVEEATKKSGLVWVKGPGVPARALWHVWHDGAACVV
FT                   GDGPGEQPLPGLADGAAAEVTVRSKDKGGRLVSWAARVVELPSGSEAWQAAVGDLKGKR
FT                   LNAPDGEAMTGRWARECRVLRLEPTGTTAPLPDASLAEAPLPSPATTRQPVPAGLPRLL
FT                   LKRRKRR"
FT   CDS_pept        complement(233731..234846)
FT                   /transl_table=11
FT                   /gene="SCO5157"
FT                   /gene_synonym="SCP8.20c"
FT                   /product="putative metal-transport protein"
FT                   /note="SCP8.20c, probable metal-transport protein, len: 371
FT                   aa; similar to TR:O50455 (EMBL:AL021006) Mycobacterium
FT                   tuberculosis putative magnesium and cobalt transport
FT                   protein MTV006.11c, 366 aa; fasta scores: opt: 1137
FT                   z-score: 1293.8 E(): 0; 47.8% identity in 370 aa overlap
FT                   and to SW:CORA_ECOLI (EMBL:L11042) Escherichia coli
FT                   magnesium and cobalt transport protein CorA, 316 aa; fasta
FT                   scores: opt: 211 z-score: 245.7 E(): 3.2e-06; 23.2%
FT                   identity in 306 aa overlap. Contains Pfam match to entry
FT                   PF01544 CorA, CorA-like Mg2+ transporter protein and
FT                   possible hydrophobic membrane spanning region at C-terminal
FT                   domain"
FT                   /db_xref="GOA:Q9FBK1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK1"
FT                   /protein_id="CAC01358.1"
FT                   /translation="MSMIRDLRAAVRPSRVSLRKDGGAYDTTRDPATASAVVDCAVYHD
FT                   GTRVETDVPLTPHTAMRQVRRDGGFVWIGLHEPTEDEFAGIAREFGLHPLAVEDAVQAH
FT                   QRPKLERYDDSLFTVFKTVHYVDHDQLTANSEVVETGEVMCFTGRDFFITVRHGGQGSL
FT                   RALRRRLQEDPELLLKGPSAVLHAIADHVVDGYIAVADAVQDDIDEVETEVFSPGRKGS
FT                   PRGTDAGRIYQLKREVLEFKRAVAPLLRPMQLLSERPMRLVDPEIQKYFRDVADHVARV
FT                   QEQVIGFDELLNSILQANLAQASVAQNEDMRKITSWAAIIAVPTMVCGVYGMNFDYMPE
FT                   THWKFGYPLVLSVTVCICLGIHRTLKRNGWL"
FT   misc_feature    complement(233734..234654)
FT                   /note="Pfam match to entry PF01544 CorA, CorA-like Mg2+
FT                   transporter protein, score 299.50, E-value 4.1e-86"
FT   regulatory      complement(234853..234858)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        235370..235966
FT                   /transl_table=11
FT                   /gene="SCO5158"
FT                   /gene_synonym="SCP8.21"
FT                   /product="hypothetical protein SCP8.21"
FT                   /note="SCP8.21, unknown, len: 198 aa"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK0"
FT                   /protein_id="CAC01359.1"
FT                   /translation="MADVLPLVEARLRSALGEPDARAAVTFLGTDRIEVLRFPAAGQEG
FT                   DVVRYATLGMSAQPMADPTAVLADPVKGPRAELVLSVRSGAADTDKVLRPLAVLAASPQ
FT                   VEGVIVAPGASLDVGEPLWPGAPFTSVLVAEPGGLVEDLELDAPLDPVRFLPLLPMTPN
FT                   EAAWKRVHGAPALQERWLNHGTDLRDPSRRSVPLD"
FT   CDS_pept        complement(236015..237238)
FT                   /transl_table=11
FT                   /gene="SCO5159"
FT                   /gene_synonym="SCP8.22c"
FT                   /product="putative integral membrane transport protein"
FT                   /note="SCP8.22c, possible integral membrane transport
FT                   protein, len: 407 aa; similar to TR:CAB76344
FT                   (EMBL:AL158061) Streptomyces coelicolor putative
FT                   multidrug-efflux transporter protein SC6D11.21, 577 aa;
FT                   fasta scores: opt: 1286 z-score: 1436.2 E(): 0; 51.1%
FT                   identity in 393 aa overlap and to SW:BMR1_BACSU
FT                   (EMBL:M33768) Bacillus subtilis multidrug resistance
FT                   protein 1 Bmr1, 389 aa; fasta scores: opt: 262 z-score:
FT                   298.0 E(): 3.9e-09; 22.9% identity in 375 aa overlap.
FT                   Contains Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter and possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q9FBJ9"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ9"
FT                   /protein_id="CAC01360.1"
FT                   /translation="MDPFDVGAGGILRQPKAVWATAGASVVAFMGIGLVDPILPSIAKG
FT                   LDASAGQVSLLFTSYFLITALAMLVTGFVSSRIGGRKTLLLGLAFVVVFAGLAGTSDTV
FT                   GQLVGYRAGWGLGNALFVSTALAVIVGAAAGGSAAAILLYESALGLGMACGPLLGALLG
FT                   DASWRYPFFGTAFLMAIGFLCITVFLKEQPRPARKTSLLDPIRALGHGGLASAAVSAFF
FT                   YNYTFFTVLAFTPFVLNMTPYKSGAVFFAWGVLLAVFSVLVAPRMQRRFGSLKVLGGSL
FT                   VLLAADVLVLGYGNHTAAIVCTILSGAFIGVNNTVYTELALGVSDAPRPVASAGYNFVR
FT                   WFAAAAAPYFAPKIEEWTDVHVPFVVAAVTALLGAVVVVVRRRALTHDAEELEPKHASE
FT                   DSVTVFAN"
FT   misc_feature    complement(236060..237172)
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score -93.70, E-value 0.0016"
FT   regulatory      complement(237246..237249)
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    237319..237324
FT                   /note="AseI restriction site"
FT                   /note="Cleavage site for AseI restriction endonuclease
FT                   AT*TAAT."
FT   misc_feature    complement(237319..237324)
FT                   /note="Cleavage site for AseI restriction endonuclease
FT                   AT*TAAT."
FT   CDS_pept        237430..238080
FT                   /transl_table=11
FT                   /gene="SCO5160"
FT                   /gene_synonym="SCP8.23"
FT                   /product="hypothetical protein SCP8.23"
FT                   /note="SCP8.23, unknown, len: 216 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ8"
FT                   /protein_id="CAC01361.1"
FT                   /translation="MRGEPSCPKCGGRVRAPGLFADSWQCDLHGTVHPVQPVLPPSVEA
FT                   LGVVVHRTQVPLWMPWPLPVGWLFTGVACAGDDRSGGRATAVACSGPGPLGGIGELILV
FT                   AEELGVGLGARYAGLDGPDPGPYLDVEKPPQVKVLAAGRPTPLWHVSGGPVDRAVFAGE
FT                   ALGMWLWAVVWPERSGLLMYEELVLTDLRDAGAEVDLVPCGALSPRLIEPTAP"
FT   regulatory      238297..238300
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        238309..239166
FT                   /transl_table=11
FT                   /gene="SCO5161"
FT                   /gene_synonym="SCP8.24"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.24, hypothetical protein, len: 285 aa; similar
FT                   to SW:TRPH_ECOLI (EMBL:AE000224) Escherichia coli TrpH
FT                   protein, 293 aa; fasta scores: opt: 376 z-score: 429.3 E():
FT                   1.9e-16; 30.6% identity in 248 aa overlap. Contains Pfam
FT                   match to entry PF02231 PHP_N, PHP domain N-terminal region"
FT                   /db_xref="GOA:Q9FBJ7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ7"
FT                   /protein_id="CAC01362.1"
FT                   /translation="MRIDLHTHSTASDGTDTPAQLVRKAAATGLDVVALTDHDTTRGHA
FT                   EAVAALPEGLTLVTGAELSCRLDGVSMHMLAYLFDPEEPALLAERELVRDDRVPRARAM
FT                   VAKLNELGVPVTWEQVARIAGGGSVGRPHVASALVELGVVPTVNDAFTRDWLADGGRAH
FT                   VGKHETDPFEALRLIKGAGGVAVFAHPAAAKRGRTVSEAAIADLAAAGLDGIEVDHMDH
FT                   DTQTRARLRGAAKELGLLVTGSSDYHGSRKTCVLGEYTTDPEVYGEITRRAFGAFPVPG
FT                   AGGA"
FT   misc_feature    238315..238503
FT                   /note="Pfam match to entry PF02231 PHP_N, PHP domain
FT                   N-terminal region, score 74.90, E-value 1.7e-18"
FT   CDS_pept        239220..239825
FT                   /transl_table=11
FT                   /gene="SCO5162"
FT                   /gene_synonym="SCP8.25"
FT                   /product="putative integral membrane protein"
FT                   /note="SCP8.25, possible integral membrane protein, len:
FT                   201 aa; similar to SW:YCHE_ECOLI (EMBL:AE000222)
FT                   Escherichia coli hypothetical 23.5 kD protein in AdhE-OppA
FT                   intergenic region YchE, 215 aa; fasta scores: opt: 406
FT                   z-score: 496.2 E(): 3.6e-20; 30.0% identity in 207 aa
FT                   overlap. Contains Pfam match to entry PF01914 UPF0056,
FT                   Uncharacterized protein family UPF0056 and possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBJ6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ6"
FT                   /protein_id="CAC01363.1"
FT                   /translation="MFDVAVFGSLFLTLFVIMDPPGITPIFLALTSGRPGKVQKRMALQ
FT                   AVCVAGGVITVFGLLGHQILDYLHVSVPALMIAGGLLLLLIALDLLTGKTDEPKQTKDV
FT                   NVALVPLGMPLLAGPGAIVSVILAVQKADSVTTQVSVWAAILAIHVVLWLVMRYSLLII
FT                   RVIKDGGVVLVTRLAGMMLSAIAVQQIINGVTQVIQGA"
FT   misc_feature    239229..239813
FT                   /note="Pfam match to entry PF01914 UPF0056, Uncharacterized
FT                   protein family UPF0056, score 165.40, E-value 9.6e-46"
FT   CDS_pept        complement(239892..240044)
FT                   /transl_table=11
FT                   /gene="SCO5163"
FT                   /gene_synonym="SCP8.26c"
FT                   /product="hypothetical protein SCP8.26c"
FT                   /note="SCP8.26c, unknown, len: 50 aa. Highly hydrophilic"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ5"
FT                   /protein_id="CAC01364.1"
FT                   /translation="MRFEVMRLDDVDGTPVDTTVVDAASVNRIVQQAAAIGQRLWIRPA
FT                   DTSAL"
FT   regulatory      complement(240050..240053)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        240280..241185
FT                   /transl_table=11
FT                   /gene="SCO5164"
FT                   /gene_synonym="SCP8.27"
FT                   /product="hypothetical protein"
FT                   /note="SCP8.27, hypothetical protein, len: 300 aa; similar
FT                   to N-terminal region of TR:Q9S2S7 (EMBL:AL096884)
FT                   Streptomyces coelicolor hypothetical 44.0 kD protein
FT                   SC4G6.31c, 403 aa; fasta scores: opt: 423 z-score: 494.8
FT                   E(): 4.3e-20; 36.5% identity in 230 aa overlap"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ4"
FT                   /protein_id="CAC01365.1"
FT                   /translation="MEAMNDDLAPLNARIDRTNELLQRMLAEVAKTPSTHAIFVDAGYL
FT                   YAAAGRLVAGTEDRRAFDLDAEGLIEALIDRARNIFADSRLLRVYWYDGARRRIHTAEQ
FT                   QSIAELPDVKVRLGNLNANNQQKGVDSLIRTDLESLARHRAISDAALLGGDEDLVSAVE
FT                   AAQGFGARVHLWGIEAPEGRNQAEPLLWEVDSQRTLDLDFFKPYVSRRTAPAAEATGLT
FT                   RPAREDVRFVGAQIAAKWLASRGRESLVELLPGHPYLPGSVDQDLLVEAEGLLQYSLRG
FT                   QADLRRALRDGFWEHLRAQY"
FT   CDS_pept        complement(241293..242189)
FT                   /transl_table=11
FT                   /gene="SCO5165"
FT                   /gene_synonym="SCP8.28c"
FT                   /product="putative hydrolase"
FT                   /note="SCP8.28c, possible hydrolase, len: 298 aa; similar
FT                   to TR:Q9RL59 (EMBL:AL121596) Streptomyces coelicolor
FT                   putative hydrolase SCF51A.05, 278 aa; fasta scores: opt:
FT                   217 z-score: 249.2 E(): 2e-06; 27.0% identity in 267 aa
FT                   overlap and to SW:THCF_RHOER (EMBL:U95170) Rhodococcus
FT                   erythropolis non-heme haloperoxidase (EC 1.11.1.-) ThcF,
FT                   274 aa; fasta scores: opt: 185 z-score: 213.7 E():
FT                   0.00019l; 29.0% identity in 241 aa overlap. Contains Pfam
FT                   match to entry PF00561 abhydrolase, alpha/beta hydrolase
FT                   fold and match to Prosite entry PS00120 Lipases, serine
FT                   active site"
FT                   /db_xref="GOA:Q9FBJ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ3"
FT                   /protein_id="CAC01366.1"
FT                   /translation="MSRNAAFSPPPSARAYRLRTARGEFAVVDSPAAAGVAPRGVVMML
FT                   PGFTGSKEDFTLLHRPLGARGYRTVAVDGRGQYESDGPEHDESAYARPELARDVLAQAA
FT                   ALGTRVHLVGHSLGGQIARAAVLLDPAPFLSLTLMSSGPARISESQRQRVKLLRDALDT
FT                   MTMAEVWEVMQAMGPPEEAGAPAPAHGPEDRVRLRDRWLGTRPAQLLATGGQLCTEPDR
FT                   VAELAAVPLPFHVLSGTYDDTWPVPLLDEMALRLDARRTVVAGAEHSPNTDQPLPTARA
FT                   LADFWDDHPVPPRPYVR"
FT   misc_feature    complement(241332..241991)
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 36.00, E-value 8.4e-07"
FT   misc_feature    complement(241833..241862)
FT                   /note="PS00120 Lipases, serine active site"
FT   CDS_pept        complement(242300..244939)
FT                   /transl_table=11
FT                   /gene="SCO5166"
FT                   /gene_synonym="SCP8.29c"
FT                   /product="putative helicase"
FT                   /note="SCP8.29c, possible helicase, len: 879 aa; N-terminal
FT                   domain similar to SW:RHLE_ECOLI (EMBL:L02123) Escherichia
FT                   coli putative ATP-dependent RNA helicase RhlE, 454 aa;
FT                   fasta scores: opt: 884 z-score: 704.8 E(): 8.6e-32; 37.2%
FT                   identity in 444 aa overlap. Contains Pfam matches to
FT                   entries PF00270 DEAD, DEAD/DEAH box helicase and PF00271
FT                   helicase_C, Helicases conserved C-terminal domain and
FT                   matches to Prosite entries PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and PS00039 DEAD-box subfamily
FT                   ATP-dependent helicases signature. Also contains three sets
FT                   of different repeats: 10x RU1: RRTRK, 4x RU2:AAAKAEAAA and
FT                   4x RU3:AAEPA"
FT                   /db_xref="GOA:Q9FBJ2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ2"
FT                   /protein_id="CAC01367.1"
FT                   /translation="MTLPVALSGKDVIGQAKTGTGKTLGFGLPLLERVTVPADVEAGRA
FT                   APESLTDAPQALVVVPTRELCQQVTNDLLTAGKVRNVRVLAIYGGRAYEPQVEALKQGV
FT                   DVIVGTPGRLLDLAGQNKLSLKHIKSLVLDEADEMLDLGFLPDVEKIINMLPARRQTML
FT                   FSATMPGAVIGLARRYMSQPTHISATSPDDEGATVANTKQFIYRAHNMDKPEMVARILQ
FT                   ADGRGLAMVFCRTKRTAADLADQLKQRGFASGAVHGDLGQGAREQALRAFRNGKVDVLV
FT                   CTDVAARGIDVEGVTHVINYQSPEEEKTYLHRIGRTGRAGAKGTAITLVDWDDIPRWQL
FT                   INKALDLGFNDPPETYSTSPHLYTDLGIAEGTKGVLPRSERTRAGLDAEELEDLGEPGG
FT                   RGGRGRGDRGDRGGRGGRDDSRSGDRERDRSSRTTPRRRRRMRGGAPVDAEASVAPAAE
FT                   TVTVTDGAAGATDAGTDTDKAPRTLRRRRRTRSGEPSRRQETAATLGTDGPAAQAAEDA
FT                   ALAPSEAPVVETVAAEPVAAPEAVEAPAKPRRRTRTRKAAETPAAPLETAPTAAPTATE
FT                   ESIVAPAVVETPTVEAPAEKPRRRTRKATAAEATVETAEGAAEPAPEPAETKPRRRTRK
FT                   AAEPAAQAPDAEAEAEAKPRRTRKTTATKTAAAKAEAAADTAEAAEAKPKARRTRKAAE
FT                   PAVQAAPEGEAEAEAKPRRTRKTTATKTAAAKAEAAADTAEAAEAKPKARRTRKAAEPA
FT                   VQAAPEGEAETEAKPRRTRKTTATKTAAAKAEAAAKAEAAADTAEAAEAKPKARRARKT
FT                   AAAVEATAEIPAQASQEPEAAPRRRTRKAAVAVEAPAAGADTAEAKPKARRTRKTAAAA
FT                   QPAEAGES"
FT   repeat_region   complement(242342..242356)
FT                   /note="10x conserved repeat unit translated in SCP8.29c
FT                   (RU1)"
FT   repeat_region   complement(242420..242434)
FT                   /note="RU1"
FT   repeat_region   complement(242507..242521)
FT                   /note="RU1"
FT   repeat_region   complement(242558..242584)
FT                   /note="4x conserved repeat unit translated in SCP8.29c
FT                   (RU2)"
FT   repeat_region   complement(242576..242602)
FT                   /note="RU2"
FT   repeat_region   complement(242621..242635)
FT                   /note="RU1"
FT   repeat_region   complement(242681..242695)
FT                   /note="4x conserved repeat unit translated in SCP8.29c
FT                   (RU3)"
FT   repeat_region   complement(242696..242710)
FT                   /note="RU1"
FT   repeat_region   complement(242747..242773)
FT                   /note="RU2"
FT   repeat_region   complement(242792..242806)
FT                   /note="RU1"
FT   repeat_region   complement(242852..242866)
FT                   /note="RU3"
FT   repeat_region   complement(242867..242881)
FT                   /note="RU1"
FT   repeat_region   complement(242917..242944)
FT                   /note="RU2"
FT   repeat_region   complement(242963..242977)
FT                   /note="RU1"
FT   repeat_region   complement(243020..243034)
FT                   /note="RU3"
FT   repeat_region   complement(243035..243049)
FT                   /note="RU1"
FT   repeat_region   complement(243077..243091)
FT                   /note="RU3"
FT   repeat_region   complement(243131..243145)
FT                   /note="RU1"
FT   misc_feature    complement(243977..244222)
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicases
FT                   conserved C-terminal domain, score 123.30, E-value 4.6e-33"
FT   misc_feature    complement(244328..244936)
FT                   /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box
FT                   helicase, score 172.60, E-value 1.2e-53"
FT   misc_feature    complement(244520..244546)
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature"
FT   misc_feature    complement(244871..244894)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   regulatory      complement(244940..244946)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        245432..246214
FT                   /transl_table=11
FT                   /gene="SCO5167"
FT                   /gene_synonym="SCP8.30"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.30, conserved hypothetical protein, len: 260
FT                   aa; similar to TR:O05856 (EMBL:Z95120) Mycobacterium
FT                   tuberculosis hypothetical 25.1 kD protein MTCY07D11.16, 231
FT                   aa; fasta scores: opt: 599 z-score: 647.2 E(): 1.4e-28;
FT                   42.5% identity in 233 aa overlap. Contains 4x degenerate
FT                   repeat:T(G/A)G"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ1"
FT                   /protein_id="CAC01368.1"
FT                   /translation="MTSSDKPGTAADAPAETAGTAGTAGTGGATPVAARDWAAAAADPQ
FT                   YRAAVVDLLGALAYGELAAFERLAEDAKLAPTLADKAELAKMASAEFHHFERLRDRLAE
FT                   IGEEPTGAMEPFVAAYDGFHKQTDPSDWLEGLVKAYVGDSIASDFYREVAARLDTDTRE
FT                   LVLAVLDDTGHAGFAVEKVRAAIDADPRVGGRLALWARRLMGEALSQSQRVVADRDALS
FT                   TMLVGGVADGFDLAEVGKMFSRITEAHTKRMAALGLAA"
FT   repeat_region   245480..245515
FT                   /note="4x degenerate repeat translated in SCP8.30"
FT   CDS_pept        complement(246330..246599)
FT                   /transl_table=11
FT                   /gene="SCO5168"
FT                   /gene_synonym="SCP8.31c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCP8.31c, possible integral membrane protein, len:
FT                   89 aa. Contains possible hydrophobic membrane spanning
FT                   regions. Also high content in alanine and leucine amino
FT                   acid residues"
FT                   /db_xref="GOA:Q9FBJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ0"
FT                   /protein_id="CAC01369.1"
FT                   /translation="MFLEALSAALLGLALAWAAAHRLPHRLPAPLLVLPTGVAGALFGA
FT                   FVTHTALGAGGLVPVLLGSATVSAASLSLLLRPAGRLRRSSATA"
FT   regulatory      complement(246609..246613)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(246843..247127)
FT                   /transl_table=11
FT                   /gene="SCO5169"
FT                   /gene_synonym="SCP8.32c"
FT                   /product="putative ATP-binding protein"
FT                   /note="SCP8.32c, possible ATP-binding protein, len: 94 aa.
FT                   Contains match to Prosite entry PS00017 ATP/GTP-binding
FT                   site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FBI9"
FT                   /db_xref="InterPro:IPR021456"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI9"
FT                   /protein_id="CAC01370.1"
FT                   /translation="MCWYGAEDRALTDRRRDIAVEVKIGVQHAPREIVLESGQSADEVE
FT                   RVVGEALAGKSQLLSLVDEHGRKVLVPADRLAYVEIGESAPRKVGFGTL"
FT   misc_feature    complement(246960..246983)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        complement(247213..247854)
FT                   /transl_table=11
FT                   /gene="SCO5170"
FT                   /gene_synonym="SCP8.33c"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SCP8.33c, probable tetR-family transcriptional
FT                   regulator, len: 213 aa; similar to TR:O53661
FT                   (EMBL:AL021929) Mycobacterium tuberculosis putative
FT                   regulatory protein MTV034.04, 204 aa; fasta scores: opt:
FT                   309 z-score: 383.4 E(): 6.9e-14; 31.3% identity in 201 aa
FT                   overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 42..63 (+3.37 SD)"
FT                   /db_xref="GOA:Q9FBI8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI8"
FT                   /protein_id="CAC01371.1"
FT                   /translation="MTAIEQTEAVRPRGTRLPRRARRNQLLGAAQEVFVAQGYHAAAMD
FT                   DIAERAGVSKPVLYQHFPGKLDLYLALLDQHCEALIQSVRSALASTSDNKQRVRATMDA
FT                   YFAYVEDDGGAFRLVFESDLTNEPAVRERVDKVTNECAEAICDVIAEDTGLSRAESMLL
FT                   ASGLGGLAQVVARSWLHSDRSVPRDQAVQLLTSLAWRGIAGFPLHGIEQH"
FT   misc_feature    complement(247639..247779)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 68.60, E-value
FT                   1.3e-16"
FT   regulatory      complement(247859..247863)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(248029..248256)
FT                   /transl_table=11
FT                   /gene="SCO5171"
FT                   /gene_synonym="SCP8.34c"
FT                   /product="hypothetical protein SCP8.34c"
FT                   /note="SCP8.34c, unknown, len: 75 aa. Highly hydrophilic"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KIL8"
FT                   /protein_id="CAC01372.1"
FT                   /translation="MTVDPTDPETFDDEAQAPDPEDRDVEAPDADAAEQRADVGQERDA
FT                   PLTGVEPDRADEADLAEQARVVPHDEDDYR"
FT   regulatory      complement(248263..248266)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        248484..249560
FT                   /transl_table=11
FT                   /gene="SCO5172"
FT                   /gene_synonym="SCP8.35"
FT                   /product="putative hydrolase"
FT                   /note="SCP8.35, possible hydrolase, len: 358 aa; similar to
FT                   SW:ACOC_ALCEU (EMBL:M66060) Alcaligenes eutrophus
FT                   dihydrolipoamide acetyltransferase component of acetoin
FT                   cleaving system (EC 2.3.1.12) AcoC, 373 aa; fasta scores:
FT                   opt: 224 z-score: 254.0 E(): 1.1e-06; 29.7% identity in 273
FT                   aa overlap. Contains Pfam match to entry PF00561
FT                   abhydrolase, alpha/beta hydrolase fold"
FT                   /db_xref="GOA:Q9FBI7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI7"
FT                   /protein_id="CAC01373.1"
FT                   /translation="MPSTEPPSVPPANALPKVTAVKVADGERLRSVHLPGITLTVRSRR
FT                   PAREGLPPALYVHGLGGSSQNWSALMPLLDGVVHSEALDLPGFGDSPPPDDGDYSITSH
FT                   ARAVVRHLDASGRGPVHLFGNSLGGAVVTRVAAVRPDLVRTLTLVSPALPEIRVQRTAV
FT                   PTGLLALPGVVSLFNRLTREWTAEQRVRGVTALCHGDPARVTPEGFRNAVEEMERRLRL
FT                   PYFWDAMARSTRGLVNAYTVGGQHGLWRQAERVLAPTLLVYGGRDQLVGYRMALRAARA
FT                   FRDSRLLTLPDAGHVAMMEYPEAVATAFRELLADTADSTAASDTGGTADTVGTGKPAGG
FT                   ERTDGAVDDEPANQTSGG"
FT   misc_feature    248715..249422
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 85.70, E-value 9.5e-22"
FT   regulatory      249559..249562
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        249569..251248
FT                   /transl_table=11
FT                   /gene="SCO5173"
FT                   /gene_synonym="SCP8.36"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.36, hypothetical protein, len: 559 aa; low
FT                   similarity to TR:Q9XAG2 (EMBL:AL079356) Streptomyces
FT                   coelicolor possible membrane protein SC6G9.20, 303 aa;
FT                   fasta scores: opt: 452 z-score: 362.9 E(): 9.5e-13; 34.1%
FT                   identity in 258 aa overlap"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI6"
FT                   /protein_id="CAC01374.1"
FT                   /translation="MGRHSRRGPAPKADAADTAAARENRAGRPDPRRTNGPSQEPQGPY
FT                   QPQGPHQSQRPHQPQGVEGAAPPGAAPGDVPGARQGYAGPSPGRGPGARLPDGETSAHG
FT                   FPRTADGTPAGGVPGYPDGTPAHGVPRYPDGTPAHGVPRFSDGTPAHGVPRVRGGHPEQ
FT                   REPGGGWGEPAGRPGAGYGSVSGPRNGAPESFAPPSPSGPASAFPRQRQAPAEGPRQDY
FT                   LDAFRADDDVFAVRPRGRIPGAARPADPYASVTDWSAEDGGASGGGGIPGGAEADADDE
FT                   PPTGEPAPAKGAKGRTFTGIAAAAVTTVLAVVVAGQVADGSDGSDMRAQSATDQARGAH
FT                   DPASRDDERPTPAASASAKPLTYEQKMGRTYPLGATLKASGKFDAVPGIAKGTGKGQKY
FT                   TYRIDVEQGLGLDGGLFAEAVQKTLNDDRSWAHNGARTFERVESGQPDFVITLASPGTT
FT                   AEWCAKSGLDTTEDNVSCDSAATQRVMINAYRWAQGAAPYGDAIHAYRQMLINHEVGHR
FT                   IGYNHVTCDKDGELAPVMQQQTKFVDHDGIDCRPNAWAYPNG"
FT   misc_feature    251093..251122
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature"
FT   misc_feature    251286..251291
FT                   /note="AseI site matched ATTAAT"
FT                   /note="Cleavage site for AseI restriction endonuclease
FT                   AT*TAAT."
FT   misc_feature    complement(251286..251291)
FT                   /note="Cleavage site for AseI restriction endonuclease
FT                   AT*TAAT."
FT   CDS_pept        251463..253244
FT                   /transl_table=11
FT                   /gene="SCO5174"
FT                   /gene_synonym="SCP8.37"
FT                   /product="putative transferase"
FT                   /note="SCP8.37, possible transferase, len: 593 aa;
FT                   C-terminal region similar to TR:CAB92272 (EMBL:AL356595)
FT                   Streptomyces coelicolor putative transferase SCC61A.27, 436
FT                   aa; fasta scores: opt: 233 z-score: 251.3 E(): 1.6e-06;
FT                   29.9% identity in 462 aa overlap. Contains Pfam match to
FT                   entry PF00534 Glycos_transf_1, Glycosyl transferases group
FT                   1. Also contains 3x conserved repeat unit: ARSSE"
FT                   /db_xref="GOA:Q9FBI5"
FT                   /db_xref="InterPro:IPR022622"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI5"
FT                   /protein_id="CAC01375.1"
FT                   /translation="MRIGLLTEGGYPYVSGEAGLWCDRLVRGLEHHEFDVYALSRSERE
FT                   EDGGWVPLPPQVGRVRTAPLWETVDDGIVHGRRARRRFAECYGELATALCAAAPGDPAR
FT                   SSEARSSEARSSEGEPEGQSALEADRFASALYGLAELARDEGGLPTALRSETAVRALER
FT                   ACRAPGAHRSAREARVPDLLAVAARLERALRPLSLDWYEDDDLGSVDLCHAASGGTGAL
FT                   PGLLARHFCDVPLLVTEYGVRLRTHYLTEPDSSPAIRSLLAAFHGRLAAETYRRAAVIT
FT                   PGNTHTRRWQERCGADRAKLRTVHPGMDAAPFAEAGESPECADPQTLVWVGRVEPAKDL
FT                   VSLLHAFAEVRRAEPGSRLRIVGAPFGPEGVAYLAHCKGLAAQLFPDEADGPHAVGRNP
FT                   VSFEETGGPELPSRADAYASGALVVLSSVVEGFPTGLVEAMFCGRATVSTDVGAVVEAI
FT                   GGTGLVVPPRNPRALAEACVALLRDPERRERLGAAARARALELFTVEQNITAFHGIYLE
FT                   ILSRAPVRRVVLDGAGEPLPFGVPAEAHVPGRWSDATARAAARGGPGAVRTGPGWATGG
FT                   GPVRATTAVSAAEGASR"
FT   repeat_region   251769..251813
FT                   /note="3x conserved repeat translated in SCP8.37"
FT   misc_feature    252726..252953
FT                   /note="Pfam match to entry PF00534 Glycos_transf_1,
FT                   Glycosyl transferases group 1, score 59.90, E-value
FT                   2.1e-15"
FT   regulatory      253230..253233
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        253391..254458
FT                   /transl_table=11
FT                   /gene="SCO5175"
FT                   /gene_synonym="SCP8.38"
FT                   /product="putative integral membrane protein"
FT                   /note="SCP8.38, possible integral membrane protein, len:
FT                   355 aa; similar to TR:Q9RWF6 (EMBL:AE001927) Deinococcus
FT                   radiodurans hypothetical 51.5 kD protein DR0712, 494 aa;
FT                   fasta scores: opt: 182 z-score: 183.8 E(): 0.009; 30.3%
FT                   identity in 429 aa overlap"
FT                   /db_xref="GOA:Q9FBI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI4"
FT                   /protein_id="CAC01376.1"
FT                   /translation="MKGLLHRHRELCERAVDPLEIVAGLEAHGVTDRTAARFRHRDVFS
FT                   LAEEMYARVPRDGDAPAPPEDGPTPRPGGPRAAGSVLLALLPGVLCAAAVAGLRLTDGR
FT                   PRLIAAAVGVLAVSLALGAALRRGPLTAATRTTSTWTCWLLGYALLGDGLLRTAVSGGP
FT                   DGLPDGSPDGAWPVTLAPVLALTLSYAPAAGCAHLFAAGARRKLSSSRGLTDFSASVRP
FT                   LLLGAFALYLGALAALLTLTGAVLGEPADWSQGLSLGALLLLARLLGVHGHTHAGPFVL
FT                   TATAAAEAAALATVFAGRLPGCGLLSAPVEALVAACGPAGVPTAACGIGALALLVHACR
FT                   RLTRASAHASTERTR"
FT   CDS_pept        254510..255622
FT                   /transl_table=11
FT                   /gene="SCO5176"
FT                   /gene_synonym="SCP8.39"
FT                   /product="putative reductase"
FT                   /note="SCP8.39, probable reductase, len: 370 aa; similar to
FT                   TR:O54256 (EMBL:AJ224512) Streptomyces nogalater putative
FT                   dTDP-4-keto-6-deoxyhexose reductase SnoG, 328 aa; fasta
FT                   scores: opt: 316 z-score: 337.4 E(): 2.5e-11; 30.5%
FT                   identity in 364 aa overlap"
FT                   /db_xref="GOA:Q9FBI3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI3"
FT                   /protein_id="CAC01377.1"
FT                   /translation="MKEPPDDHLPTRRLGTGSRPMRVLLIGANGYIGRFVADRLLADPA
FT                   VQLTALGRGDDADVRFDLATGSPGALTRFLDAVHPGVVVNCAGATRGGARELTRHNTVA
FT                   VATVCEALRRSGCGARLVQVGCSAEYGPSQPGSSTAEDAVPRPGGPYGVSKLAATELVL
FT                   GSGLDAVVLRVFSPAGPGTPAGSPLGRLAEAMRRAMQSGDGELRLGGLGAQRDFVDVRD
FT                   VARAVHAASLSAAQGVINIGSGRAVRLRDAAATLARVAGYGGALHELDGPPGALRPTIG
FT                   HPRTESLGHRVDALGHHRSDALGHHRPDPLQSRGERTDPEHTTPAPYPDGCGSWQQADV
FT                   RTARDRLGWRPRIALEESLADIWMEAACRI"
FT   regulatory      255601..255605
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        255610..256359
FT                   /transl_table=11
FT                   /gene="SCO5177"
FT                   /gene_synonym="2SC3B6.01"
FT                   /product="hypothetical protein 2SC3B6.01"
FT                   /note="2SC3B6.01, unknown, len: 249 aa"
FT                   /db_xref="InterPro:IPR021986"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCL1"
FT                   /protein_id="CAC01307.1"
FT                   /translation="MSYLTSTKAGVASTGVHTGLGVPGLAHPLLAPDEWAGLTCPGTPL
FT                   HWVVLNIADGPGAHPDPRCLEAAGRLRNAGIRVLGHLDTAYGARSLGEQISDARRYLDW
FT                   YQVDGFLLAHCPSDRAALPEVRRTVTTLRAIRDDAHIVLGHGTHPCPGYAENADQLVTF
FT                   SGTWADYRWSQAAEWSADYPPERFCHFVHGLPRGHLEEALRIARWQGAATICFTDRTDH
FT                   GGRADPWETMPGYWDEIVSRVGTGVSE"
FT   regulatory      256414..256417
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        256423..257601
FT                   /transl_table=11
FT                   /gene="SCO5178"
FT                   /gene_synonym="2SC3B6.02"
FT                   /product="putative sulfurylase"
FT                   /note="2SC3B6.02, possible sulfurylase, len: 392 aa;
FT                   similar to TR:AAF33130 (EMBL:AF196567) Pseudomonas stutzeri
FT                   putative sulfurylase, 391 aa; fasta scores: opt: 1433
FT                   z-score: 1624.0 E(): 0; 56.2% identity in 395 aa overlap
FT                   and to SW:MOEB_ECOLI (EMBL:M21151) Escherichia coli
FT                   molybdopterin biosynthesis MoeB protein, 249 aa; blastp
FT                   socres: Score = 526 (185.2 bits), Expect = 1.1e-50, P =
FT                   1.1e-5, Identities = 106/249 (42%), Positives = 156/249
FT                   (62%). Contains Pfam match to entry PF00899 ThiF_family,
FT                   ThiF family and PF00581 Rhodanese, Rhodanese-like domain"
FT                   /db_xref="GOA:Q9FCL0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCL0"
FT                   /protein_id="CAC01308.1"
FT                   /translation="MSLPPLVEPAAELTVDEVRRYSRHLIIPDVGMDGQKRLKNAKVLA
FT                   VGAGGLGSPTLMYLAAAGVGTLGIIEFDEVDESNLQRQVIHSQADIGRPKAESARDTIQ
FT                   GINPLVDVILHQERLEADNVMDIFSQYDLIVDGTDNFATRYLVNDACVLLNKPYVWGSI
FT                   YRFDGQASVFWSEHGPCYRCLYPEPPPPGMVPSCAEGGVLGVLCASIGSIQTNEAIKLL
FT                   QGIGEPLVGRLMIYDALEMTYRQVKVRKDPNCAVCGENPTVTELIDYEAFCGVVSEEAQ
FT                   AAAADSTITPKQLKEWIDDGENIELIDVREPNEFEIVSIPGARLIPKNEFLMGSALENL
FT                   PQDKKIVLNCKTGVRSAEVLAVLKSAGFSDAVHVGGGVIGWVNQIEPEKPVY"
FT   misc_feature    256537..256947
FT                   /note="Pfam match to entry PF00899 ThiF_family, ThiF
FT                   family, score 216.00, E-value 5.4e-61"
FT   misc_feature    257290..257574
FT                   /note="Pfam match to entry PF00581 Rhodanese,
FT                   Rhodanese-like domain, score 51.70, E-value 1.6e-11"
FT   CDS_pept        complement(257673..259214)
FT                   /transl_table=11
FT                   /gene="SCO5179"
FT                   /gene_synonym="2SC3B6.03c"
FT                   /product="peptidase"
FT                   /note="2SC3B6.03c, peptidase, len: 513 aa; identical to
FT                   TR:Q54399 (EMBL:L42759) Streptomyces lividans proteinase
FT                   SlpE, 513 aa and highly similar to Streptomyces coelicolor
FT                   2SC3B6.04c, 516 aa; fasta scores: opt: 1544 z-score: 1384.8
FT                   E(): 0; 50.2% identity in 526 aa overlap. Contains Pfam
FT                   match to entry PF00561 abhydrolase, alpha/beta hydrolase
FT                   fold and correctly situated match to Prosite entry PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site.
FT                   Also contains possible N-terminal region signal peptide
FT                   sequence"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK9"
FT                   /protein_id="CAC01309.1"
FT                   /translation="MARLVRWTALTAAAALLTAGCSGGSSDEDKDDGGRSSAGPSAAAP
FT                   SGVPEALASQTLDWARCEGTDDAPAPDGDWRCATLKAPLDWSDPDGETIDLALIRSRAS
FT                   GDDRIGSLLFNFGGPGASGVSTMPSYADTVSSLHERYDLVSWDPRGVAASEGVRCRTDE
FT                   AIEAAESVDSTPDSPAEEQAYLKDAADFGRGCEKAAGKLMEHVSTTDTARDMDLMRHVL
FT                   GDERMHYFGISYGTELGGVYAHLFPEHVGRVILDAVVDPGADTMGHAENQARGFQRALD
FT                   DYLESTGQEPEQGSRKIAGLLERLDAEPLPTSSPGRELTQTLAFTGIVLPLYSESGWPA
FT                   LTSALKAAEEGDGSELLALADGYNERDPSGRYGTTTHSQRVISCLDDKQRPTVEETKKL
FT                   LPRFEKVSPVFGAFLGWDTAGWCHDWPVAGQHETAEVSAPGADPVLVVGNTGDPATPYE
FT                   GARRMADELGKDVGVVLTWQGEGHGAYGNGSDCVDSAVDAYLLKGTVPKDGKVCS"
FT   misc_feature    complement(257715..258794)
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 41.50, E-value 1.9e-08"
FT   misc_feature    complement(259152..259184)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   regulatory      complement(259217..259221)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(259373..260923)
FT                   /transl_table=11
FT                   /gene="SCO5180"
FT                   /gene_synonym="2SC3B6.04c"
FT                   /product="putative peptidase"
FT                   /note="2SC3B6.04c, peptidase, len: 516 aa; highly similar
FT                   to TR:Q54399 (EMBL:L42759) Streptomyces lividans proteinase
FT                   SlpE, 513 aa; fasta scores: opt: 1543 z-score: 1741.5 E():
FT                   0; 50.2% identity in 526 aa overlap and to Streptomyces
FT                   coelicolor putative peptidase 2SC3B6.03c, 513 aa; fasta
FT                   scores: opt: 1544 z-score: 1465.5 E(): 0; 50.2% identity in
FT                   526 aa overlap. Contains Pfam match to entry PF00561
FT                   abhydrolase, alpha/beta hydrolase fold and correctly
FT                   situated match to Prosite entry PS00013 Prokaryotic
FT                   membrane lipoprotein lipid attachment site. Also contains
FT                   possible N-terminal region signal peptide sequence"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK8"
FT                   /protein_id="CAC01310.1"
FT                   /translation="MPNPSRLRAAALTATAAALSALLAGCGGGSQEDDEDLSGQKLHWK
FT                   NCPAPSEAEGGGAAPSPLPDGDEWQCATMKAPLDWDDPKGDTIGLALIRAEADGAADRR
FT                   IGSLVFNFGGPGGSGVTTLPAFGQDYAKLRTRYDLVSFDPRGVGRSDPVECLDDKQLDT
FT                   YFQQDATPDDRAERTEFVDNTEEFNAACEKHSKKILPHVRTTDAARDMDLMRQVLGDEK
FT                   LHYFGISYGTELGGVYAHLFPRHVGRAVFDAVVDPTQTAEQGSLGQAKGFQLALDNFAE
FT                   DCVSKVEDCPVGDTAEDVEARIARLLKDLDRKPIPGIFPRQLTETAATGGIAQALYSKD
FT                   FWEYLTEGLEQAYDGDGRVLMVLSDALNGRNEDGEYSNITAANVAINCADDKPRYDPAY
FT                   VEDKLPEFRDASPLFGDYLAWSMLSCTDWPVAGAADHPDVHAPGAAPILVIGNTGDPAT
FT                   PYEGAGRMVDALGKGVGVELIYKGQGHGAYDSKNRCVQDAVHGYLLDGKVPAAKTVCS"
FT   misc_feature    complement(259415..260515)
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 52.00, E-value 1.3e-11"
FT   misc_feature    complement(260846..260878)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        complement(261004..263781)
FT                   /transl_table=11
FT                   /gene="SCO5181"
FT                   /gene_synonym="2SC3B6.05c"
FT                   /product="putative integral membrane protein"
FT                   /note="2SC3B6.05c, possible integral membrane protein, len:
FT                   925 aa; similar to TR:O53781 (EMBL:AL021942) Mycobacterium
FT                   tuberculosis hypothetical 84.0 kD protein RV0585c, 795 aa;
FT                   fasta scores: opt: 618 z-score: 636.0 E(): 5.9e-28; 28.1%
FT                   identity in 884 aa overlap. Contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9FCK7"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK7"
FT                   /protein_id="CAC01311.1"
FT                   /translation="MKQQGVHPEDAEGTSDASSRPDTPDAGDGAAGEHAAEGPSATAAD
FT                   PDDVAHIDEVEGDEPLLPARVHRPSDLVRLLVGVLAVAVLLAIAAFAHGTTSGLEQDIN
FT                   KGTGQAPDLLIKIAGLASSIAILLVPVAFAIERLIKRDGLRIADGVLAAVLAHGVTLAT
FT                   DLWVAKAAPGSIQEALTQPSPGDIHALTDPVHGYLAPVIAYMTAVGMSRRPRWRAVLWI
FT                   VLLLDAFSMLVTGYTTPFSIILTVLIGWTVAYGTLYAVGSPNVRPTGRTLMAGLRHVGF
FT                   RPVTAARQEAPSDNVETGDRGRRYFVTLEDGRPLDVTVVDREQQAQGFFYRAWRNLTLR
FT                   GFATRSSLPSLRQALEQEALLAYAAIAAGANAPKLIATSELGPDAVMLVYEHTGGRSLD
FT                   SLADEEITDDLLHGTWEQVRALQSRRIAHRRLVGDAILVDRSGTVILTDLRIGEIAAGD
FT                   LLLRMDISQLLVTLGLRVGAERAVASAVAVLGPDTVADCLPMLQPIALSRSTRATLRRL
FT                   ARERAQREREAVLESSRQAKLARAEAAGHDAASHPAEQTDKATQTDKADKKALRAEQRA
FT                   EKRAVDEAIEEAREEDLLTQIRHAVLRIRPQAPVEPARLERVRPRTLISFIAGAIGAYF
FT                   LLTQLTHIEFGPLISNAQWGWVAAAVLFSAASYVAAAMSLLGFVPERVPFLRTVAAQVA
FT                   GSFVKIVAPAAVGGVALNTRFLQRAGVRPGLAVASVGASQLFGLGCHILMLLSFGYLTG
FT                   TEKTPSLSPSRTVIAGLLTVAVLVLVVTSVPFLRKFVVTRVRSLFAGVVPRMLDVLQRP
FT                   QKLITGIGGMLLLTACFVMCLDASIRAFGDESSSISLASVAVVFLAGNALGSAAPTPGG
FT                   VGAVEATLTVGLIAVGLPKEVAAPAVLLYRLLTLWLPVLPGWLVFNHLTRKEAL"
FT   regulatory      complement(263784..263787)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        263823..264374
FT                   /transl_table=11
FT                   /gene="SCO5182"
FT                   /gene_synonym="2SC3B6.06"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.06, conserved hypothetical protein, len: 183
FT                   aa; similar to TR:Q9RX87 (EMBL:AE001902) Deinococcus
FT                   radiodurans conserved hypothetical protein DR0428, 139 aa;
FT                   fasta scores: opt: 187 z-score: 230.6 E(): 2.2e-05; 35.2%
FT                   identity in 122 aa overlap"
FT                   /db_xref="GOA:Q9FCK6"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK6"
FT                   /protein_id="CAC01312.1"
FT                   /translation="MVACRVRLGRHQGARAGRTVCPKHRLRARDAGSRECAALSAGCGR
FT                   MGRMSEQSLPDGVRPQNADALPEYAERVLDMTELIPPGRVMTYGDVAEYLEEGGPRQVG
FT                   RVMSLYGGGVPWWRVVRADGVLLAGHELEALDRYREEGTPLKEASRAAEGHLPRLDLKR
FT                   ARWDGEGRPQGHGGRAQGHT"
FT   CDS_pept        264641..268120
FT                   /transl_table=11
FT                   /gene="SCO5183"
FT                   /gene_synonym="2SC3B6.07"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="2SC3B6.07, possible ATP-dependent DNA helicase, len:
FT                   1159 aa; similar to TR:O53347 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis putative ATP-dependent DNA helicase,
FT                   MTV014.45c, 1101 aa; fasta scores: opt: 349 z-score: 368.0
FT                   E(): 5e-13; 29.2% identity in 1144 aa overlap  to
FT                   SW:UVRD_ECOLI (EMBL:M87049) Escherichia coli DNA helicase
FT                   II (EC 3.6.1.-) UvrD, 720 aa; fasta scores: opt: 241
FT                   z-score: 255.5 E(): 9.2e-07; 26.3% identity in 800 aa
FT                   overlap and to Streptomyces coelicolor 2SC3B6.08, 1222 aa;
FT                   fasta scores: opt: 406 z-score: 336.0 E(): 4.2e-13;30.4%
FT                   identity in 977 aa overlap. Contains Pfam match to entry
FT                   PF00580 UvrD-helicase, UvrD/REP helicase and match to
FT                   Prosite entry PS00017 ATP/GTP-binding site motif A
FT                   (P-loop). Also contains 5x conserved repeat unit: ADAD"
FT                   /db_xref="GOA:Q9FCK5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK5"
FT                   /protein_id="CAC01313.1"
FT                   /translation="MSSSSSSGHPSHPQVRRGSRGAYRLVRTPPARTDPPRLDAAQRAV
FT                   VDHRSGPLLVLAGPGTGKTTTLVESVADRIARGGDPERILVLTFSRKAAVELRDRMALR
FT                   IGAARAPRATTFHSFGYALVRAHQDSDLFVEPLRLLSGPEQDVTVRELLAGQVDLERLG
FT                   LAHVRWPDELRACLTTRGFADEVRAVLARSRELGLGPDALAAFARRIGRPDWRAAAVFL
FT                   AEYLDVLDLQGVLDYAELVHRAVLLARRPEVAAHLTAQYDAVYVDEYQDTDPAQVRLLH
FT                   ALADGGRTLVAFGDPDQSIYAFRGADVNGILDFPTAFPRADGRPAPVGVLRTARRSGSG
FT                   LLAATRLLTQRMPLTRLPADKVRAHRELTPVRGGGRVEAYTYPTAGTELDNIADILRRA
FT                   HLEDGVPWRDMAVLVRAGSRTIPTLRRALTSAGVPLDIDGDDLPLRHEPAVAPLLTALR
FT                   AVAEAEADTGARTGERFGALGSEADADPRADADADADADADAYVDADADAYVDEGGDAA
FT                   TKLSRGEHAYRADEPCWLSTETALTLLTSPLAGMDAADLRRLGRALRDERRAAGNPLPP
FT                   PSDELLAQALAEPERLAVHDPAYARGAQRLGALLRKARERLAGGGSAEEALWDLWDGTP
FT                   WPTRLERSARRGGAAGRNADRDLDAVCALFATAARAEERTGGRGALNFLEEIDAEDIAA
FT                   DTLARRAVRPDAVRLMTAHRSKGLEWRLVVVAGVQEGLWPDLRRRGSLLEADRIGRDGL
FT                   AEPLSPGALLAEERRLFYVAATRARERLVVTAVKAPADDGDQPSRFLTELGVEPADVTG
FT                   RPRRPLAVAALVAELRATTVDPRVSEPLREAAARRLARLAALTDEDGRPLVPSAHPYRW
FT                   WGMWDPTESKVPLRDRDQPVTLSGSALDQLANTCALQWFLGREVKADAPATTAQGFGNV
FT                   VHVLADEVASGHTPADLAVLMERLDSVWNALAFDAPWKSAQEKANARVALERFLKWHVM
FT                   DRAGRTPVASEHDFDVTLEAGEYEVRIRGQMDRVETDADGRAYVVDFKTGKQAPTSSEV
FT                   ARHPQLAVYQLAVREGAVDEAFDGVRPQPGGAELVHLRQGAPKRDGGETLPKVQAQESQ
FT                   EGPEGEWVGDLLATAAGKVLDERFTPTAGQHCTHCSFRASCSARPEGRHVVE"
FT   misc_feature    264752..265960
FT                   /note="Pfam match to entry PF00580 UvrD-helicase, UvrD/REP
FT                   helicase, score 227.60, E-value 1.8e-64"
FT   misc_feature    264809..264832
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   repeat_region   266084..266161
FT                   /note="5x degenerate repeat unit translated in 2SC3B6.07"
FT   CDS_pept        268145..271813
FT                   /transl_table=11
FT                   /gene="SCO5184"
FT                   /gene_synonym="2SC3B6.08"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="2SC3B6.08, possible ATP-dependent DNA helicase, len:
FT                   1222 aa; similar to TR::O53347 (EMBL:AL021646)
FT                   Mycobacterium tuberculosis putative ATP-dependent DNA
FT                   helicase, MTV014.45c, 1101 aa; fasta scores: opt: 1209
FT                   z-score: 1062.9 E(): 0; 38.4% identity in 1199 aa overlap
FT                   to SW:HELD_ECOLI (EMBL:J04726) Escherichia coli helicase IV
FT                   (EC 3.6.1.-) HelD, 648 aa; fasta scores: opt: 216 z-score:
FT                   194.6 E(): 0.0023; 25.3% identity in 471 aa overlap and to
FT                   Streptomyces coelicolor 2SC3B6.07, 1159 aa; fasta scores:
FT                   opt: 406 z-score: 293.0 E(): 1e-10; 30.2% identity in 977
FT                   aa overlap. Contains Pfam match to entry PF00580
FT                   UvrD-helicase, UvrD/REP helicase and match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FCK4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK4"
FT                   /protein_id="CAC01314.1"
FT                   /translation="MWPDRSRPGPPEPPRRAAGVTRRTTRADLHFPPTREDIRHQLSVA
FT                   AASLSDVPAHITDPEQLKELLGIPFTPEQTACIVAPPAPQVIVAGAGSGKTTVMAARVV
FT                   WLVGTGQVAPEQVLGLTFTNKAAGELAERVRTALIRAGVTDPDVIDPDHPPGEPAISTY
FT                   HAFAGRLLTDHGLRLGLEPTSRLLADATRYQLAARVLREAPGPYPALTRSFADLVSDLL
FT                   ALDGELAEHLVRPEDLRAWDAGLLDTLDGVRLSNADLRKVPEAAAARRELADLVIRYRA
FT                   AKRRQDLLDFGDQIALSAQLAGLPEVGRVLRDDYRVVLLDEYQDTSVAQRILLAGLFGG
FT                   GTGHPVTAVGDPCQAIYGWRGASVANLDDFPEHFAHADGRPAARQALSENRRSGGRLLD
FT                   LANGLAEPLRAMHAGVEALRPAPGAERDGMVRCALLSTHAEEIDWIADSVAHLVRTGKA
FT                   PGEIAVLCRTATDFAEIQGALVARDVPVEVVGLSGLLHLPEVADLVAVCEVLQDPGANA
FT                   SLVRLLSGPRWRVGPRDLALLGRRARLLVSHARVEGDDDPDRRLAEAVEGVDPSEVISL
FT                   ADALDTFLETPLDGTGDDDGLPFSADARVRFARLATELRELRRALSDPLMDVLHRVLAV
FT                   TGLEVELSASPHALAARRRETLSNFLDVAASFAAGDGEATLLAFLGFLRTAAQYEKGLD
FT                   NALPGGENTVKVLTAHKSKGLEWDVVAVPGLVTGTFPSGQGREKWTAQGKVLPHGLRGD
FT                   AETLPDVASWDARGLKAFHEAMKDHQHTEELRLGYVTFTRPRSLLLGSGHWWGPSQKKP
FT                   RGPSDFLTALYEHCAAGHGEIEVWADEPAEDEENPALHRATADEVWPLPLDDAALARRR
FT                   SAAETVLAHLDGLAAREDGPPSAPATYEDPDWPPPPEDDEGLPEEAEPDRAGDPAHWDS
FT                   WTTERPAAAREAATAPESPAAPQAGPTVPHQAPPPEQPPGTAPVPAPARLTPEEARTVA
FT                   SWDRDLDALTGELLRARESVTEVPLPASLTASQLLSLAADPDGFAQELARPMPRPPQPA
FT                   ARRGTRFHAWVEARFEPLTLPLLEPEELPGGDAEIADDHDLEFLKDAFERTEYARRTPF
FT                   RVEAPFQLSLAGRVVRGRIDAVYKEGDGDTATYEIVDWKTNRAATADPLQLALYRIAWA
FT                   EQQHVPPASVTAAFLYVRTGEVVRPEGLPDRAALEKLLLAEPVGDEPHDRGVRAGR"
FT   misc_feature    268352..269773
FT                   /note="Pfam match to entry PF00580 UvrD-helicase, UvrD/REP
FT                   helicase, score 286.20, E-value 4e-82"
FT   misc_feature    268409..268432
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        271824..273236
FT                   /transl_table=11
FT                   /gene="SCO5185"
FT                   /gene_synonym="2SC3B6.09"
FT                   /product="putative peptidase"
FT                   /note="2SC3B6.09, possible peptidase, len: 470 aa; similar
FT                   to TR:AAF73713 (EMBL:AE002246) Chlamydophila pneumoniae
FT                   AR39 peptidase, M20/M25/M40 family CP0876, 439 aa; fasta
FT                   scores: opt: 809 z-score: 938.0 E(): 0; 33.6% identity in
FT                   455 aa overlap. Contains Pfam match to entry PF01546
FT                   Peptidase_M20, Peptidase family M20/M25/M40"
FT                   /db_xref="GOA:Q9FCK3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK3"
FT                   /protein_id="CAC01315.1"
FT                   /translation="MSHPVDNAVSAVRTYIEQHRAAFLDDLVEWLRIPSVSAQPDHATD
FT                   VRRSADWLAAKLKETGFPTAEVWPTRGAPAVFAEWPSGDPQAPTVLVYGHHDVQPAARE
FT                   DGWTSEPFDPVVRENRLYARGAADDKGQVFFHTLGVRAHLAATGRKAPAVNLKLLIEGE
FT                   EESGSPHFRALVEERAERLTADAVVVSDTGMWSEDTPTVCTGMRGLAECEIRLHGPDQD
FT                   IHSGSFGGAVPNPATAVARLVAALHDEHARVAIPGFYDGVADLTDRERELFAELPFDER
FT                   QWLRTAKSYAAHGEAGHTTLERIWARPTAEVNGIGGGYQGPGSKTIIPSSAMVKLSFRL
FT                   VAGQDPDHVEKAVRTWADEQVPAGIRCEVVFGSATRPCLTPLDHPALRSVVRAMGRAFD
FT                   KPVRFTREGGSGPAADLQEVLGAPVLFLGISVPSDGWHAPDEKVELDLLLKGVETAAHL
FT                   WGDLGEHWRHAP"
FT   misc_feature    271902..273053
FT                   /note="Pfam match to entry PF01546 Peptidase_M20, Peptidase
FT                   family M20/M25/M40, score 212.90, E-value 4e-60"
FT   CDS_pept        273386..274342
FT                   /transl_table=11
FT                   /gene="SCO5186"
FT                   /gene_synonym="2SC3B6.10"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.10, conserved hypothetical protein, len: 318
FT                   aa; similar to TR:O53345 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 33.8 kD protein MTV014.43c, 313
FT                   aa; fasta scores: opt: 334 z-score: 389.2 E(): 3.3e-14;
FT                   33.3% identity in 318 aa overlap"
FT                   /db_xref="GOA:Q9FCK2"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK2"
FT                   /protein_id="CAC01316.1"
FT                   /translation="MEAPVTTWTDHTADRPISLTAPSGVDRAAHHRLDEAWLAAAWSHP
FT                   STRCFVVSGGQVLIDETPDGATELVMTPSFEAPLTEAHRYFLGTDEDGTSYFALQKDSL
FT                   PGRMDQSARPAGLREAGLLLSPRDAGLMAHAVALENWQRLHRFCSRCGERTVIAAAGHI
FT                   RRCPACGAEHYPRTDPAVIMAVTDGEDRILLGRQVHWARGPLLDPRRFRGARRVHRAVG
FT                   APRGPGGGRRHRRPGRVRREPAVAFPSSLMLGFMAHATSTEIDVDGDEIHEARWFSREE
FT                   LGAAFESGEVLPPYGISIAARLIELWYGRPLPTRSAF"
FT   stem_loop       274363..274408
FT                   /note="probable stemloop. Score 56: 20/21 (95%) matches, 0
FT                   gaps"
FT   CDS_pept        complement(274429..274671)
FT                   /transl_table=11
FT                   /gene="SCO5187"
FT                   /gene_synonym="2SC3B6.11c"
FT                   /product="putative glutaredoxin-like protein"
FT                   /note="2SC3B6.11c, possible glutaredoxin-like protein, len:
FT                   80 aa; similar to SW:NRDH_LACLC (EMBL:X92690) Lactococcus
FT                   lactis glutaredoxin-like protein NrdH, 72 aa; fasta scores:
FT                   opt: 119 z-score: 176.0 E(): 0.024; 35.6% identity in 59 aa
FT                   overlap. Contains match to Prosite entry PS00194
FT                   Thioredoxin family active site"
FT                   /db_xref="GOA:Q9FCK1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011915"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK1"
FT                   /protein_id="CAC01317.1"
FT                   /translation="MSGTVTMYSTTWCGYCRRLKSQMDREGIAYTEVNIEQDPESAAFV
FT                   EKANGGNQTVPTVLFPDGSTLTNPSLAQVKQKIGA"
FT   misc_feature    complement(274603..274659)
FT                   /note="PS00194 Thioredoxin family active site"
FT   CDS_pept        274716..277073
FT                   /transl_table=11
FT                   /gene="SCO5188"
FT                   /gene_synonym="2SC3B6.12"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="2SC3B6.12, probable ATP-dependent DNA helicase, len:
FT                   785 aa; similar to SW:UVRD_ECOLI (EMBL:M87049) Escherichia
FT                   coli DNA helicase II (EC 3.6.1.-) UvrD, 720 aa; fasta
FT                   scores: opt: 649 z-score: 632.5 E(): 9.2e-28; 31.6%
FT                   identity in 643 aa overlap. Contains 2x Pfam matches to
FT                   entry PF00580 UvrD-helicase, UvrD/REP helicase, Pfam match
FT                   to entry PF00570 HRDC, HRDC domain and match to Prosite
FT                   entry PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FCK0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK0"
FT                   /protein_id="CAC01318.1"
FT                   /translation="MRSHGVNVRGGTTIPVAHSHRVMPVALIRLSVRACGQPTHPSRET
FT                   WQHGGVTAATHSTLFPQVPDSADAVLEGLDLEQREVATALRGPVCVLAGAGTGKTRAIT
FT                   HRIAYGVRAGILQPSSVLAVTFTNRAAGEMRGRLRQLGASGVQARTFHSAALRQLQYFW
FT                   PKAIGGSLPRLVDRKIQLVADAAAACRIRLDRGELRDVTAEIEWSKVTQTVPADYAPAA
FT                   AKAGREAPRDPAEIAQLYAAYEDLKRARSVIDFEDVLLLTVAVLQDRHDVAEQVRAQYQ
FT                   HFVVDEYQDVSPLQQRLLELWLGDRDDLCVVGDASQTIYSFTGATPDHLLDFRGRHPGA
FT                   TVVKLVRDYRSTPQVVHLANGLLAQARGRAADHRLELVSQRPAGPEPGYAEYSDEPAEA
FT                   EGAARRIRELIDSGVPAAEIAVLFRTNSQSETYEQALADAGVPYQLRGAERFFDRPEVR
FT                   KAGSALRAAARFGGNDSLLDDAVDLPSQVRAVLSGEGWTTQPPAGSGAVRERWESLAAL
FT                   VGLAQDFAAARAGATLSDLVVELDERAGAQHAPTVQGVTLASLHSAKGLEWDVVFLVGV
FT                   AEGMMPITYAKTDEQIEEERRLLYVGVTRARERLHLSWALARSPGGRPNRRPSRFLKGL
FT                   RPGSGTAGGQAAAAGAGGVERGIRGGGGGGAAAAPRRTQRTPARCRVCGRTLTDAGEMK
FT                   LMRCEGCPSDMDEGVYERLREWRAVQAGRSGQPAFCVFTDKTLMAIAESVPEDERELAR
FT                   IPGVGMRKLNRYGTDVLAICAGQEGVGLDEDD"
FT   misc_feature    274935..275192
FT                   /note="Pfam match to entry PF00580 UvrD-helicase, UvrD/REP
FT                   helicase, score 109.50, E-value 3.2e-29"
FT   misc_feature    274992..275015
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   misc_feature    275415..276119
FT                   /note="Pfam match to entry PF00580 UvrD-helicase, UvrD/REP
FT                   helicase, score 218.20, E-value 1.2e-61"
FT   misc_feature    276822..277064
FT                   /note="Pfam match to entry PF00570 HRDC, HRDC domain, score
FT                   43.70, E-value 4.1e-09"
FT   regulatory      277154..277158
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        277169..277570
FT                   /transl_table=11
FT                   /gene="SCO5189"
FT                   /gene_synonym="2SC3B6.13"
FT                   /product="hypothetical protein 2SC3B6.13"
FT                   /note="2SC3B6.13, unknown, len: 133 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ9"
FT                   /protein_id="CAC01319.1"
FT                   /translation="MLYLHIRGLVRPSPPRRREEASPVISIKSSFIVSSTAKMTDRSAV
FT                   SLCMLGASHSGTGLSGIRAVRPAAAAAAPAGLPVRERNERPTKALEAAVAAQAQAYAFT
FT                   ATGAGFRKQTTQHHLMWAFRGPEPWSDPA"
FT   CDS_pept        277747..278115
FT                   /transl_table=11
FT                   /gene="SCO5190"
FT                   /gene_synonym="2SC3B6.14"
FT                   /product="putative DNA-binding protein"
FT                   /note="2SC3B6.14, possible DNA-binding protein, len: 122
FT                   aa; similar to TR:Q9X952 (EMBL:AJ239087) Streptomyces
FT                   coelicolor hypothetical 9.7 kD protein WblE, 85 aa; fasta
FT                   scores: opt: 183 z-score: 243.0 E(): 4.6e-06; 40.5%
FT                   identity in 74 aa overlap and to TR:Q9S426 (EMBL:AF164439)
FT                   Mycobacterium smegmatis WhmD, 129 aa; fasta scores: opt:
FT                   161 z-score: 213.2 E(): 0.00021; 29.0% identity in 93 aa
FT                   overlap. Contains Pfam match to entry PF02178 AT_hook, DNA
FT                   binding domain with preference for A/T rich regions and
FT                   match to Prosite entry PS00354 HMG-I and HMG-Y DNA-binding
FT                   domain (A+T-hook)"
FT                   /db_xref="GOA:Q9FCJ8"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ8"
FT                   /protein_id="CAC01320.1"
FT                   /translation="MQLEAHAPSVPPSDTIPKPCSTEDSTLTPLTALTALDDAIENLGV
FT                   PVPCRSYDPEVFFAESPADVEYAKSLCRTCPLIEACLAGAKERREPWGVWGGELFVQGV
FT                   VVARKRPRGRPRKNPVSA"
FT   misc_feature    278065..278097
FT                   /note="PS00354 HMG-I and HMG-Y DNA-binding domain
FT                   (A+T-hook)"
FT   misc_feature    278071..278109
FT                   /note="Pfam match to entry PF02178 AT_hook, DNA binding
FT                   domain with preference for A/T rich regions, score 17.00,
FT                   E-value 0.23"
FT   CDS_pept        278112..278435
FT                   /transl_table=11
FT                   /gene="SCO5191"
FT                   /gene_synonym="2SC3B6.15"
FT                   /product="hypothetical protein 2SC3B6.15"
FT                   /note="2SC3B6.15, unknown, len: 107 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ7"
FT                   /protein_id="CAC01321.1"
FT                   /translation="MNTAGTIDRPLTYDPQKQAPMKPSTHDLAGTAPEDFTTSDAKDSR
FT                   QNRTREMQLIPEALARAHMHDRLHEAEQERRALRLATARRMQRRAERASMRARRALAMA
FT                   VMQ"
FT   CDS_pept        complement(278569..279978)
FT                   /transl_table=11
FT                   /gene="SCO5192"
FT                   /gene_synonym="2SC3B6.16c"
FT                   /product="hypothetical protein"
FT                   /note="2SC3B6.16c, hypothetical protein, len: 469 aa;
FT                   similar to TR:O53343 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis ABC-transporter ATP binding protein MTV014.41,
FT                   447 aa; fasta scores: opt: 1156 z-score: 1301.9 E(): 0;
FT                   45.3% identity in 393 aa overlap"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ6"
FT                   /protein_id="CAC01322.1"
FT                   /translation="MSDLPRKAVTRTAKLAALPLGFAGRATWGLGKRIVGESAEIVGQQ
FT                   LQQRTAEQLFKVLGELKGGAMKFGQALSVFESALPEEVAGPYRAALTKLQEAAPPMPTR
FT                   TVHSVLAERLGEDWQELFLEFEDKPAAAASIGQVHRGVWQDGREVAVKVQYPGAGEALL
FT                   SDLNQLSRFARLLGPLVPGMDIKPLITELKDRVSEELDYDLEAQAQRTHAEVFDDDPDI
FT                   VVPDVIHQCEQVLITEWIDGIPMSEIISNGTQEQRDRAGQLLAHFLFSGPARTGLLHAD
FT                   PHPGNFRLLPGGPRGEDDWRLGVLDFGTVDRLPGGLPEPIGEALRMTLDGEAEAVYEML
FT                   CAEGFVKESIELAPDAVLEYLLPIIEPARVDAFTFTRGWMRSQAARIGDPRSPAYQLAK
FT                   QLNLPPAYLLIHRVTLSTIGVLCQLGATVRLRDELEEWLVGFVAEGEAEVEEGEEADED
FT                   VYETEGTAAEA"
FT   CDS_pept        complement(279971..281299)
FT                   /transl_table=11
FT                   /gene="SCO5193"
FT                   /gene_synonym="2SC3B6.17c"
FT                   /product="putative secreted protein"
FT                   /note="2SC3B6.17c, possible secreted protein, len: 442 aa;
FT                   similar to TR:O53342 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 31.6 kD protein MTV014.40, 299
FT                   aa; fasta scores: opt: 233 z-score: 233.2 E(): 1.6e-05;
FT                   29.9% identity in 261 aa overlap. Contains possible
FT                   N-terminal region signal peptide sequence"
FT                   /db_xref="GOA:Q9FCJ5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR022291"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ5"
FT                   /protein_id="CAC01323.1"
FT                   /translation="MDNFRRLSAQPGMLALAGGFAADGGPAHGHRETYGGPGMHPMVKP
FT                   ALRRGWRDLNTVQFGMTPAHALTLAPVDTATGSFLELLNGTRGPALLREAGHRMDLPDG
FT                   HVDRVVERLALAGLLDDSRGGGPAADALRAKKEVLDRLRPDLASLSLTTSEPGDAIRHL
FT                   AARRALRVGVRGAGRVGAVLAGLLSGAGVGEIDVRDGGRVEPWDVAPGGLPAEAVGDRR
FT                   DETARRLVRRAAPGRPPRRGPTTPPEESAPGLSLVIVAPRDDVAVYTPDPTAAESLMAS
FT                   GTPHLYAGVVEGTGVVGPLVLPGETGCAGCLHAERTGRDPAFPRLVAQWRSGRRHRVPP
FT                   CDLALATTVAGFAAAQALAFLDGRTPSGTGARWEVSLPGLRWQVRPVRPHPSCPCGAAR
FT                   KGKQEHIPEDGGWRATMAGQGPSAEVRHEAERARPAGTWRAHV"
FT   regulatory      complement(279983..279988)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        281506..282012
FT                   /transl_table=11
FT                   /gene="SCO5194"
FT                   /gene_synonym="2SC3B6.18"
FT                   /product="hypothetical protein"
FT                   /note="2SC3B6.18, hypothetical protein, len: 168 aa;
FT                   similar to TR:CAB72040 (EMBL:AJ391262) Neisseria
FT                   meningitidis hypothetical 26.6 kD protein RNI5, 230 aa;
FT                   fasta scores: opt: 249 z-score: 315.5 E(): 4.2e-10; 41.7%
FT                   identity in 103 aa overlap"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ4"
FT                   /protein_id="CAC01324.1"
FT                   /translation="MRRSARRRRTVSAYREGDRTVVLIPARMSEAEEQRWVSVMLDKLA
FT                   AQESKRVLGDAELAERAERLSGQYFEGRARPASVRWVTNQNTRWGSCTPSEGSIRLSHR
FT                   LQGMPEYVVDYVLLHELAHLLVPGHGPRFWRLLEAYPRTERARGYLEGVVAADRLPHVP
FT                   GARSE"
FT   CDS_pept        282152..283906
FT                   /transl_table=11
FT                   /gene="SCO5195"
FT                   /gene_synonym="2SC3B6.19"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.19, hypothetical protein, len: 584 aa;
FT                   N-terminal region similar to N-terminal region of TR:Q9RSA4
FT                   (EMBL:AE002055) Deinococcus radiodurans tellurium
FT                   resistance protein TerA DR2223, 400 aa; fasta scores: opt:
FT                   552 z-score: 357.3 E(): 1.9e-12; 40.6% identity in 239 aa
FT                   overlap and C-terminal region similar to TR:Q9RWP1
FT                   (EMBL:AE001920) Deinococcus radiodurans conserved
FT                   hypothetical protein DR0625, 254 aa; blastp scores: Score =
FT                   262 (92.2 bits), Expect = 7.4e-22, P = 7.4e-22, Identities
FT                   = 68/208 (32%), Positives = 117/208 (56%)"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ3"
FT                   /protein_id="CAC01325.1"
FT                   /translation="MAREFQRGHKARISDLTSGTDLYVGVQISGPGLNFDISCFGLDAD
FT                   ERLSDDRYFVFFNQPKTPEESIQLLGAQAGDTESFRVTLDRIPQQIQKLSFTATIDGAG
FT                   QMSQVGPGYIRIVAGGEEVARYPFSGSEFSTERAVMLGDFYLKDVWRFAAVGQGFDGGL
FT                   DALLKNFGGEVAEDEAPAPQQAPQPQAGAAPGFAPPAQAAAPPAFGAPAAPAPAAPAPA
FT                   PVPQPAPQGFAPPPAAPPPPAPVPAPGPDVHAAQTIVAPMNTPPGGAPVPPPAPAPAPY
FT                   GQPGQPGQQPPYGQVLGQTAPPPPGYGQPQAPQAPAPPPGYGQPTAPPGYGQQPGPPAA
FT                   YGQQAPPPGYGQQPPQAMPRGAPQGAGVTAALQQFRETPTGQRWTQQNKKLVRVDLGAE
FT                   GQPVLARQGSMVLYQGKVDFSYKGAGFAGRVVGNATGQEMQLMRCTGKGQVFLAENSAM
FT                   LHPIELQGDAVCVSAENVLAFDESLQYEVRRIEGHGIPGGALFTMQFQGTGTVVVKTRG
FT                   VPVVLPVTPTTFADCNAVVAWSAAAQVVVSSQVRMRRNSYAGDTGESVNLQFRAAPGSF
FT                   VVVQPYEI"
FT   misc_feature    282686..283222
FT                   /note="High content in alanine, proline, glycine and
FT                   glutamine amino acid residues region. Also high G+C content
FT                   (84.91%)"
FT   CDS_pept        283920..284600
FT                   /transl_table=11
FT                   /gene="SCO5196"
FT                   /gene_synonym="2SC3B6.20"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.20, conserved hypothetical protein, len: 226
FT                   aa; similar to TR:CAB93731 (EMBL:AL357613) Streptomyces
FT                   coelicolor hypothetical 23.8 kD protein SC5F8.03c, 225 aa;
FT                   fasta scores: opt: 439 z-score: 523.3 E(): 1.1e-21; 37.8%
FT                   identity in 222 aa overlap"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ2"
FT                   /protein_id="CAC01326.1"
FT                   /translation="MNQPLAGYAPAPAGARMENHGNHMLKVAMQTGNDLLARVGSMTAY
FT                   EGFVQYEPNPPAVRQIAKDWMTGEGAPLMKCSGDGLLYLADYGANVVVINLNGDGISVN
FT                   ATNLLAFDAHLTWGVERVKGLAKFAGQGLWNTKISGQGWVALTSRGKPIVVDCGGGEDE
FT                   TYVDPDALVAWSPNLKVKGKRSFKAQSLIGRGSGEAFQMAFSGQGIVVVQPSEDSTDRL
FT                   RVRG"
FT   regulatory      284604..284607
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        284618..285373
FT                   /transl_table=11
FT                   /gene="SCO5197"
FT                   /gene_synonym="2SC3B6.21"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.21, conserved hypothetical protein, len: 251
FT                   aa; similar to TR:CAB93731 (EMBL:AL357613) Streptomyces
FT                   coelicolor hypothetical 23.8 kD protein SC5F8.03c, 225 aa;
FT                   fasta scores: opt: 449 z-score: 539.1 E(): 1.5e-22; 35.7%
FT                   identity in 230 aa overlap"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ1"
FT                   /protein_id="CAC01327.1"
FT                   /translation="MQSPIFAYNDQQTQEAWSLQNKHMLRVALTGHDDVLARKGTMVAY
FT                   QGLVEFDAEYQSNSQSRSRAHTGEGLDLMRCHGQGTVYFSNLAQCVHVVDVDQDGLTVD
FT                   SSYVLAMDSNLHHEVIAVDSLYGISGSGKYQLNITGRGKVALMTSGSPLFMQVTPDKYV
FT                   NCDADAIVAWSTGLRVQMQAQTHSSGVWRRRGNTGEGWELSFMGSGFALVQPSELLPPQ
FT                   NAQVGQGLAAQYGMGQHGARGQSQGNVWS"
FT   stem_loop       285380..285445
FT                   /note="probable stemloop. Score 50: 25/32 (78%) matches, 0
FT                   gaps"
FT   CDS_pept        complement(285433..285948)
FT                   /transl_table=11
FT                   /gene="SCO5198"
FT                   /gene_synonym="2SC3B6.22c"
FT                   /product="hypothetical protein"
FT                   /note="2SC3B6.22c, hypothetical protein, len: 171 aa; low
FT                   similarity to TR:Q9S2D5 (EMBL:AL110470) Streptomyces
FT                   coelicolor MutT domain containing protein, 204 aa; fasta
FT                   scores: opt: 139 z-score: 184.0 E(): 0.0088; 30.8% identity
FT                   in 120 aa overlap"
FT                   /db_xref="GOA:Q9FCJ0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ0"
FT                   /protein_id="CAC01328.1"
FT                   /translation="MSLHDDAVLVLKAYEGQDELRQVYLDHLATHPDGMWKACADGHVT
FT                   ASALVIDPSRERVLLTLHKKLRMWLQMGGHCEPVDETLARAALREGTEESGIAGLALLA
FT                   GGPVRLDRHHTPCAWHLDVQYAAVAPPGAVEAISDESLDLRWFPYAEVADVADDSVVRL
FT                   LEATRARL"
FT   CDS_pept        complement(285945..287408)
FT                   /transl_table=11
FT                   /gene="SCO5199"
FT                   /gene_synonym="2SC3B6.23c"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.23c, conserved hypothetical protein, len: 487
FT                   aa; similar to TR:O53341 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 49.4 kD protein, 472 aa; fasta
FT                   scores: opt: 1382 z-score: 1331.8 E(): 0; 46.2% identity in
FT                   489 aa overlap"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI9"
FT                   /protein_id="CAC01329.1"
FT                   /translation="MSDTPFGFGLPPEEPDDGDEGKKKDQQSGGGQGPANPFGFGMSGA
FT                   GGLGGPGADNPFAAMFGSMNPNDLGAAFQQLGQMLSYEGGPVNWDMAKQIARQTVSQGT
FT                   PDGRKDASVGPAERNAVQEAVRLADLWLDDATALPSGAGTAVAWSRAEWVEATLPAWRE
FT                   LVDPVAERVGNAMGDVLPEEMQAMAGPLIGMMRSMGGAMFGTQIGQAVGVLAGEVVGST
FT                   DVGLPLGPAGKAALLPANIESFGKDLGVPQEEVRLYLALREAAHQRLFAHVPWLRSHLF
FT                   GAVDGYARGIKVDTAKLEDVVGQFDPQNPEQLQEALQQGMFQPEDTPEQKAALARLETA
FT                   LALVEGWVDAVVHTAAKPRLSSADALRETLRRRRASGGPAEQTFATLIGLELRPRRLRD
FT                   ASRLWASLTDAHGVDGRDGLWAHPDMLPTATDLDDPDGFVHREQLDFSELDKMLGEAAG
FT                   KPDLKKKDEGDRGENRSADRDEPKGDDGE"
FT   regulatory      complement(287415..287418)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      287590..287593
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        287601..288722
FT                   /transl_table=11
FT                   /gene="SCO5200"
FT                   /gene_synonym="2SC3B6.24"
FT                   /product="putative membrane protein"
FT                   /note="2SC3B6.24, putative membrane protein, len: 373 aa;
FT                   similar to TR:Q9WX08 (EMBL:AL079345) Streptomyces
FT                   coelicolor putative epimerase SCE68.24c, 353 aa; fasta
FT                   scores: opt: 307 z-score: 353.0 E(): 3.4e-12; 29.1%
FT                   identity in 320 aa overlap. Contains possible N-terminal
FT                   region signal sequence peptide and possible hydrophobic
FT                   membrane spanning region at C-terminal domain"
FT                   /db_xref="GOA:Q9FCI8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI8"
FT                   /protein_id="CAC01330.1"
FT                   /translation="MSSPDPQVRAARNQSTSSARPGARGPVVAVTGAASGVGALLTARL
FT                   AASDEVRQVVAIDERRGGCEAAQWQILDVRDPAIAEKLRGADVVVHLALDLDLETDAAA
FT                   RTAYNVRGTQTVLTAAAAAGVHRVVLCTSAMVYGALPDNELPLSEDAELRATAEATGVG
FT                   DLLEIERLARRAPRAHPGLNVTVVRPAVLVGGMDTALTRYFESPRLLVVAGSRPAWQFC
FT                   HVDDLCSALEYAVLEKADGELAVGCDGWLEQEEVEELSGIRRMELPSAVALGAAARLHR
FT                   IGLTPSPAGDLAYTMYPWVVSGSRLHDAGWRPKHTNEEVLAELLEEVSGRHTVAGRRLG
FT                   RKDATAAGAAGATVALLGAAAVVRRARKARRRI"
FT   CDS_pept        288833..289291
FT                   /transl_table=11
FT                   /gene="SCO5201"
FT                   /gene_synonym="2SC3B6.25"
FT                   /product="moaE-like protein"
FT                   /note="2SC3B6.25, moaE-like protein, len: 152 aa; similar
FT                   to SW:MOAE_ECOLI (EMBL:X70420) Escherichia coli
FT                   molybdopterin [mpt] converting factor, subunit 2 MoaE, 149
FT                   aa; fasta scores: opt: 255 z-score: 317.2 E(): 3.3e-10;
FT                   33.3% identity in 129 aa overlap"
FT                   /db_xref="GOA:Q9FCI7"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI7"
FT                   /protein_id="CAC01331.1"
FT                   /translation="MATTNDHPGERAAADPVKLIGIRETPLSVDEVFGAVGDDASGGTA
FT                   LFVGTVRNHDGGTDVDRLGYSCHPSAEAEMRRIAEKVVAEYPVRALAALHRVGDLEVGD
FT                   LAVVVAVSCPHRGEAFDACRKLIDDLKHEVPIWKHQTFSDGTEEWVGA"
FT   regulatory      289402..289407
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        289650..290744
FT                   /transl_table=11
FT                   /gene="SCO5202"
FT                   /gene_synonym="2SC3B6.26"
FT                   /product="putative secreted protein"
FT                   /note="2SC3B6.26, possible secreted protein, len: 364 aa;
FT                   similar to TR:O53340 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 35.5. kD protein, 340 aa; fasta
FT                   scores: opt: 430 z-score: 467.4 E(): 1.4e-18; 41.3%
FT                   identity in 361 aa overlap. Contains possible N-terminal
FT                   signal peptide sequence"
FT                   /db_xref="GOA:Q9FCI6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI6"
FT                   /protein_id="CAC01332.1"
FT                   /translation="MPRRTATMLASTLMLIALLCAGVFIPVPYSEMSPGPTVNTLGDHD
FT                   GEPVLQISGHKTYEASGHLNMTTVRVTSAEYRMNLVEAVYGWLAHDNSVVPHETLYPDG
FT                   KTEEEATQENAEEFSQSQESAKVAALKALDIPVKSWVVVSAVVKDSPSQGRLHAGDVIK
FT                   AVDGTTVKKPADVAELVTKHEPGQDTVFTIVPAKEQAAAEKEGRTATKTQKITIRTETS
FT                   QDAGAQRAVVGISAGTDHTFPFEIDIKLADVGGPSAGLMFALGIYDKLTPGDLTGGKFV
FT                   AGTGTIDDNGKVGPIGGIGMKTIGAHDKGAQYFLTPADNCAAAAEDTPDGLTLVKVDTI
FT                   DDALGALKDIRSGKTADLPKCTQG"
FT   CDS_pept        complement(290775..291446)
FT                   /transl_table=11
FT                   /gene="SCO5203"
FT                   /gene_synonym="2SC3B6.27c"
FT                   /product="hypothetical protein 2SC3B6.27c"
FT                   /note="2SC3B6.27c, unknown, len: 223 aa. Contains two TTA
FT                   leucine codons, possible targets for bldA regulation"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI5"
FT                   /protein_id="CAC01333.1"
FT                   /translation="MIRQALGFAGPPCAPVIAGPHLCNLLIVYSVPDSGHERGRIVTMS
FT                   NTPMAASPLTRAVLEIDEYVSGLGWDQPARLFALVDTARLRADQPSLADRLGLREEPES
FT                   SGLTPIEQDEIPTDQALDEFLGTIAWPDSVVGCALAVERLMLPPSAEAQVPSGLNEKKL
FT                   AQWVAEHPDRQEVRMTVAVLRDGSRDSALRLREKDTATEVLTGSDLVPGLAAALTATFE
FT                   E"
FT   misc_feature    complement(291372..291374)
FT                   /gene="none"
FT                   /note="TTA leucine codon. Possible target for bldA
FT                   regulation"
FT   misc_feature    complement(291381..291383)
FT                   /gene="none"
FT                   /note="TTA leucine codon. Possible target for bldA
FT                   regulation"
FT   CDS_pept        291482..294484
FT                   /transl_table=11
FT                   /gene="SCO5204"
FT                   /gene_synonym="SC7E4.01"
FT                   /gene_synonym="2SC3B6.28"
FT                   /product="putative integral membrane protein"
FT                   /note="SC7E4.01, hypothetical protein (fragment), len: >220
FT                   aa; similar to C-terminal part of TR:O32904 (EMBL:Z98271)
FT                   Mycobacterium leprae hypothetical 29.1 kD protein
FT                   MLCB1779.46, 277 aa; fasta scores: opt: 236 z-score: 242.2
FT                   E(): 5.1e-06; 33.5% identity in 191 aa overlap. Contains
FT                   possible colied-coil region at aprox. residues 151..172 and
FT                   a 5x degenerate repeat: (G/D/S)DK(2)"
FT                   /note="2SC3B6.28, possible integral membrane protein
FT                   (fragment), len: >815 aa; similar to TR:O53609
FT                   (EMBL:AL021428) Mycobacterium tuberculosis putative
FT                   membrane protein MTV030.07, 979 aa; fasta scores: opt: 992
FT                   z-score: 1094.5 E(): 0; 41.1% identity in 829 aa overlap.
FT                   Contains possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FCI4"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FCI4"
FT                   /protein_id="CAD55225.1"
FT                   /translation="MPDRGGGPPTGPRIRVGRPSRRVRTLLLTLGVLAVLAMAFTMFAG
FT                   FWTDWLWYRSVHYSSVFTTTLWTKIGLFFVFGLLMALAVGFNIWLAHRLRPPLSAMSME
FT                   QQNLDRYRMGIAPYKKWLLLGITALVGLIAGASASGQWRTWLMWVNGVPFGQKDPQFKL
FT                   DVSFYAFDLPWYRFLLGFGFAAVIISVIAAALTHYLYGGLRVTSPGARATAAATGHLSV
FT                   LLGVFVALKAVAYWLDRYGLAVKSSDFKATDNWTGLRYVDANAYLPAKTILFCIAVICA
FT                   LLFFATLWRRTWQLPVIGFGLMVLSAILIGGLYPALVQKFQVQPNEQAKEAPYVEKNLA
FT                   ATRDAYGIEGTQVAEYPGKSETKDKTKLRDDADAAASVRIMDPNIISPTFQQLQQMRNY
FT                   YAFPTNLDVDRYAKDGKDQDTVIGLRELNLAGIPKKNWINNHFRYTHGYGVVAAKGTQV
FT                   DSEGRPVFTESNLPSEGDLGKYEQRIYYGEKTTTYSIVGGPQKEIDYSDDTGEKTFSYK
FT                   GDGGVDLSNPINRAAYAAAFSEPQILYSGAIGDGSRILYNRTPKERVEAVAPWLTIDGD
FT                   AYPAVVDGRIQWIVDAYTTTNGYPYASRTTLGDTTADSLTANNNSRAVVAQQNQVNYIR
FT                   NSVKATVDAYSGDVKLYEWDTQDPVLKTWKKAFPGTVQDKGEISKELMAHLRYPQDLFK
FT                   VQRELLTRYHVKDANTFLSGSEVWQVPDDPTNKSGDAVPPYYLSMKMPDQKAQAFSLTT
FT                   TFTPNGRDNLSAFMAVDAEAGTSDYGKIRILKLPTSTTVDGPKQVQSQFNSEQDIAESI
FT                   RLLRGGDSEVEYGNLLTVPLDGGLLYVEPVYVRGGDLKYPLLRKVLVSYGGNTAFENTL
FT                   DAALNKVFGAQAAETEQPPDEGDDTTEPPPTSTNPTVREALSDAQKAFDAGQKALEQKD
FT                   LAAYAEAQKDLEEALQRAEDAQAKADQGAGGKNGDDKNAGDKNSGDKAGSDKAGPDATP
FT                   TGDAGGGADTG"
FT   repeat_region   294359..294433
FT                   /note="5x degenerate repeat unit translated in SC7E4.01"
FT   tRNA            294562..294635
FT                   /note="tRNA Met anticodon CAT, Cove score 79.35"
FT   stem_loop       294664..294704
FT                   /note="844 CACGAAGGCCCGGATTCC 861 - 867 GGAATCCGGGCCTTCGTG
FT                   884. Score 54: 18/18 (100%) matches, 0 gaps"
FT   CDS_pept        294876..296699
FT                   /transl_table=11
FT                   /gene="SCO5205"
FT                   /gene_synonym="SC7E4.02"
FT                   /product="hypothetical protein SC7E4.02"
FT                   /note="SC7E4.02, hypothetical protein, len: 607 aa; similar
FT                   to TR:CAB83499 (EMBL:AL162752) Neisseria meningitidis
FT                   hypothetical 51.6 kD protein NMA0184, 468 aa; fasta scores:
FT                   opt: 268 z-score: 307.6 E(): 1.2e-09; 29.5% identity in 528
FT                   aa overlap"
FT                   /db_xref="GOA:Q9K4B3"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4B3"
FT                   /protein_id="CAB94590.1"
FT                   /translation="MGDMANLFGTGRFAQPSGQLSGQEEATDEAQEAADEAAEEVRLRL
FT                   AVDCGDVEAMSVLGAMLLRRGDFDAAESHLRAATAAGDRAAANNLGVLLHQRGYADEAA
FT                   GWWRIAAVAGSAAAAHALGRHFRERGDEPAAEYWLCQSAEQGHVLGAYALADLLEHRGD
FT                   DTGSERWMRAAAERGHREAAYRLARTLDRRAGRDGDDKAAARAADEAEQWYRQAAARGH
FT                   RRGALHLGTILEKRGELKEAGRWYLTSAKDGEARAACALGFLLRDAGDTESAAVWWLRA
FT                   AQDGDGNAANALGALHAERGETQTAERWYRAAMDAGDDNGAYNLGLLCAEQGRTTQAEQ
FT                   WYRRAAYAGHREASNALAILLLRAGDESGAEPWFSKAAEAGSVDAAFNLGILHAGRSEE
FT                   RAALRWYERAAAAGHTEAALQVGMARLRGGDEQEAERFLRCAAGGGSAEAAYRLATVLD
FT                   ARRPPEPAHELGEPAQDKSECEEWYERAASQGHRRAQVRVGMLAAARGDVVEAARWYRE
FT                   AAEAGSRNGAFNLGLLLAREGSEPEAVVWWRRAADAGHGRAALRLALVCARRGELAEGQ
FT                   RWADLAVSLGPREVGERAARLRDALRQELSA"
FT   misc_feature    complement(296803..297488)
FT                   /note="previously sequenced DNA fragment. EMBL:AF186372
FT                   Streptomyces coelicolor A3(2) CatR (catR) gene, complete
FT                   cds."
FT   tRNA            complement(296820..296893)
FT                   /note="tRNA Met anticodon CAT, Cove score 79.35"
FT   CDS_pept        complement(296944..297360)
FT                   /transl_table=11
FT                   /gene="SCO5206"
FT                   /gene_synonym="catR"
FT                   /gene_synonym="SC7E4.03c"
FT                   /product="hydrogen peroxide sensitive repressor"
FT                   /note="SC7E4.03c, catR, hydrogen peroxide sensitive
FT                   repressor, len: 138 aa; identical to previously sequenced
FT                   TR:Q9RN70 (EMBL:AF186372) Streptomyces coelicolor hydrogen
FT                   peroxide sensitive repressor CatR, 138 aa. Contains Pfam
FT                   match to entry PF01475 FUR, Ferric uptake regulator family"
FT                   /db_xref="GOA:Q7AKH0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AKH0"
FT                   /protein_id="CAB94591.1"
FT                   /translation="MSDLLERLRGRGWRMTAQRRVVAEVLDGEHVHLTADEVHSRAVDK
FT                   LPEISRATVYNTLGELVSLGEVLEVATDKRAKRYDPNAHRPHHHLVCARCGAIRDVHPT
FT                   GNPLADLPDSERFGFTVSDVEVTYRGTCPNCAAA"
FT   misc_feature    complement(296974..297333)
FT                   /note="Pfam match to entry PF01475 FUR, Ferric uptake
FT                   regulator family, score 99.80, E-value 5.2e-26"
FT   CDS_pept        complement(297547..297984)
FT                   /transl_table=11
FT                   /gene="SCO5207"
FT                   /gene_synonym="SC7E4.04c"
FT                   /product="hypothetical protein SC7E4.04c"
FT                   /note="SC7E4.04c, hypothetical protein, len: 145 aa;
FT                   similar to TR:Q9YFH9 (EMBL:AP000058) Aeropyrum pernix
FT                   hypothetical 15.7 kD protein APE0267, 143 aa; fasta scores:
FT                   opt: 220 z-score: 282.8 E(): 2.8e-08; 34.1% identity in 126
FT                   aa overlap. Contains 2x Pfam match to entry PF00571 CBS,
FT                   CBS domain"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4B2"
FT                   /protein_id="CAB94592.1"
FT                   /translation="MDHRQEVAPPMLVREVMSTVVLTIGPAHTLRQAAALMSARRVGAA
FT                   VVYDPDAGGIGILTERDVLVSVGRGQDPDTERTHGHTTTDVVFAAPTWTVEEAAGAMAH
FT                   GGFRHLIVLDGGEPVGIVSVRDIIRRWAPARSPHNAPAVTA"
FT   misc_feature    complement(297589..297747)
FT                   /note="Pfam match to entry PF00571 CBS, CBS domain, score
FT                   38.90, E-value 1.1e-07"
FT   misc_feature    complement(297781..297942)
FT                   /note="Pfam match to entry PF00571 CBS, CBS domain, score
FT                   32.90, E-value 7.3e-06"
FT   CDS_pept        complement(298087..298887)
FT                   /transl_table=11
FT                   /gene="SCO5208"
FT                   /gene_synonym="SC7E4.05c"
FT                   /product="putative monophosphatase"
FT                   /note="SC7E4.05c, probable monophosphatase, len: 266 aa;
FT                   similar to SW:STRO_STRGR (EMBL:Y08763) Streptomyces griseus
FT                   glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)
FT                   StrO, 259 aa; fasta scores: opt: 316 z-score: 395.8 E():
FT                   1.4e-14; 35.9% identity in 248 aa overlap. Contains 2x Pfam
FT                   match to entry PF00459 inositol_P, Inositol monophosphatase
FT                   family and match to Prosite entry PS00629 Inositol
FT                   monophosphatase family signature 1"
FT                   /db_xref="GOA:Q9K4B1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR011809"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K4B1"
FT                   /protein_id="CAB94593.1"
FT                   /translation="MPDYLDDLRLAHVLADAADAATMDRFKALDLKVETKPDMTPVSEA
FT                   DKAAEELIRGHLSRARPRDSVHGEEFGVAGTGPRRWVIDPIDGTKNYVRGVPVWATLIA
FT                   LMEAKEGGYQPVVGLVSAPALGRRWWAVEDHGAFTGRSLTSAHRLHVSQVSTLSDASFA
FT                   YSSLSGWEEQGRLDGFLDLTREVWRTRAYGDFWPYMMVAEGSVDLCAEPELSLWDMAAN
FT                   AIIVTEAGGTFTGLDGRPGPHSGNAAASNGRLHDELLGYLNQRY"
FT   misc_feature    complement(298183..298290)
FT                   /note="Pfam match to entry PF00459 inositol_P, Inositol
FT                   monophosphatase family, score 29.90, E-value 2.1e-07"
FT   misc_feature    complement(298474..298692)
FT                   /note="Pfam match to entry PF00459 inositol_P, Inositol
FT                   monophosphatase family, score 40.30, E-value 2.5e-10"
FT   misc_feature    complement(298606..298647)
FT                   /note="PS00629 Inositol monophosphatase family signature 1"
FT   regulatory      299070..299074
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        299080..299691
FT                   /transl_table=11
FT                   /gene="SCO5209"
FT                   /gene_synonym="SC7E4.06"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SC7E4.06, possible tetR-family transcriptional
FT                   regulator, len: 203 aa; similar to TR:Q9Z551
FT                   (EMBL:AL035212) Streptomyces coelicolor putative
FT                   transcriptional regulator SC9B2.08c, 192 aa; fasta scores:
FT                   opt: 169 z-score: 206.9 E(): 0.00047; 31.9% identity in 182
FT                   aa overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 24..45 (+3.85 SD)"
FT                   /db_xref="GOA:Q9K4B0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4B0"
FT                   /protein_id="CAB94594.1"
FT                   /translation="MPAARESLLDAAYTALARRPWSAVRMVDVAASAGVSRQTLYNEFG
FT                   SKEGLARALVRREADGYLAGVERALSGPSDPRERLTATAEWMMSAARDNALVRAMLTGC
FT                   WNERLPAPALTAVPSSCAVPAQRRADGPLPSPGDFVGLVRDRAVAVLGGAGPLPPPDAA
FT                   ELARSCELTVRLALSCVAAPPAEGGVADLVRTALPRRLTA"
FT   misc_feature    299101..299241
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 49.40, E-value
FT                   3.7e-11"
FT   CDS_pept        complement(299723..300046)
FT                   /transl_table=11
FT                   /gene="SCO5210"
FT                   /gene_synonym="SC7E4.07c"
FT                   /product="putative molecular chaperone"
FT                   /note="SC7E4.07c, possible molecular chaperone, len: 107
FT                   aa; similar to SW:SUGE_ECOLI (EMBL:X69949) Escherichia coli
FT                   SugE protein, 105 aa; fasta scores: opt: 341 z-score: 449.1
FT                   E(): 1.5e-17; 44.7% identity in 103 aa overlap and to
FT                   TR:CAB88839 (EMBL:AL353832) Streptomyces coelicolor sugE,
FT                   SCE6.35c, 106 aa; fasta scores: opt: 323 z-score: 386.5
FT                   E(): 6e-16; 43.0% identity in 107 aa overlap. Contains Pfam
FT                   match to entry PF00893 DUF7, Integral membrane protein and
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9K4A9"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A9"
FT                   /protein_id="CAB94595.1"
FT                   /translation="MAWLLVIVAGVLETGFAVCLKLSHGFTRLWPTIAFCAFALGSFGL
FT                   LTMSLKKLDVGPAYAVWTGIGAAGTAIYGMIFLGDLVSTLKIVSISFVIIGVIGLQLSG
FT                   SAH"
FT   misc_feature    complement(299768..300046)
FT                   /note="Pfam match to entry PF00893 DUF7, Integral membrane
FT                   protein, score 93.60, E-value 3.9e-24"
FT   regulatory      complement(300053..300058)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(300249..301262)
FT                   /transl_table=11
FT                   /gene="SCO5211"
FT                   /gene_synonym="SC7E4.08c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SC7E4.08c, conserved hypothetical protein, len: 337
FT                   aa; similar to TR:O05873 (EMBL:Z95121) Mycobacterium
FT                   tuberculosis hypothetical 34.9 kD protein MTCY20B11.03, 330
FT                   aa; fasta scores: opt: 1051 z-score: 1176.2 E(): 0; 52.7%
FT                   identity in 338 aa overlap. Contains match to Prosite
FT                   entryPS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9K4A8"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A8"
FT                   /protein_id="CAB94596.1"
FT                   /translation="MRRYGKHTDEDDIRSRPNRKGNRPRTHIRPKHEDAAEGLVLTVDR
FT                   GRLTCLVDDRVVMAMKARELGRKAAIVGDRVALVGDLTGKKDTLARIVRIEERTSVLRR
FT                   TADDDDPYERVVVANADQLAIVTALADPEPRPRLIDRCLVAAFDGGLTPLLVMTKSDLA
FT                   PPDELLELYGALDIPYVVTSREELENGAAADLVREHLDGKITAFVGHSGVGKTTLVNTL
FT                   VPEDRRRVTGHVNAVTGRGRHTTTSALALPLSSAAGGWVVDTPGVRSFGLAHIDPSRVI
FT                   NAFPDLVPGTEGCPRACSHDEPDCALDAWVAEGHADPARLYSLRRLLSTRERKEGD"
FT   misc_feature    complement(300615..300638)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT   CDS_pept        complement(301275..302591)
FT                   /transl_table=11
FT                   /gene="SCO5212"
FT                   /gene_synonym="aroA2"
FT                   /gene_synonym="SC7E4.09c"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="SC7E4.09c, aroA2, 3-phosphoshikimate
FT                   1-carboxyvinyltransferase, len: 438 aa; highly similar to
FT                   SW:AROA_MYCTU (EMBL:X52269) Mycobacterium tuberculosis
FT                   3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)
FT                   AroA, 450 aa; fasta scores: opt: 1236 z-score: 1339.4 E():
FT                   0; 52.1% identity in 434 aa overlap and similar to
FT                   TR:CAB71266 (EMBL:AL138598) Streptomyces coelicolor
FT                   SC1A2.28c AroA, 440a aa; fasta scores: opt: 731 z-score:
FT                   673.3 E(): 6.4e-32; 36.3% identity in 413 aa overlap.
FT                   Contains Pfam match to entry PF00275 EPSP_syntase, EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="GOA:Q9K4A7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K4A7"
FT                   /protein_id="CAB94597.1"
FT                   /translation="MTVNPTHTALWPAPHASGAVDATVHVPGSKSVTNRALVLAALASE
FT                   PGWLRRPLRSRDTLLMAEALRTLGVEIEEGVGPEGTGEFWRVIPAGLRGPATVDVGNAG
FT                   TVMRFLPPVATLADGAVRFDGDPRSYERPLHGVIDALRVLGARIDDDGRGALPLTVHGG
FT                   GALEGGPVEIDASSSSQFVSALLLSGPRFNQGVEVRHTGSALPSMPHIRMTVDMLRAVG
FT                   AQVDTPESGGEPNVWRVTPGALLGRDLTVEPDLSNAQPFLAAALVTGGKVVIPDWPSRT
FT                   TQPGDRLREIFTDMGGSCELTDFGLVFTGSGAIHGIDVDLSEVGELTPGIAAVAALADS
FT                   PSTLRGVAHLRLHETDRLAALTKEINELGGDVTETADGLHIRPRRLHGGVFHTYDDHRM
FT                   ATAGAVLGLAVEGVQIENVATTAKTLPDFPDLWTGMLGA"
FT   misc_feature    complement(301296..302552)
FT                   /note="Pfam match to entry PF00275 EPSP_syntase, EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase),
FT                   score 399.20, E-value 3.9e-116"
FT   CDS_pept        complement(302715..303437)
FT                   /transl_table=11
FT                   /gene="SCO5213"
FT                   /gene_synonym="SC7E4.10c"
FT                   /product="putative integral membrane protein"
FT                   /note="SC7E4.10c, possible integral membrane protein, len:
FT                   240 aa; similar to TR:CAB89063 (EMBL:AL353872) Streptomyces
FT                   coelicolor putative integral membrane protein SC5G8.12, 322
FT                   aa; fasta scores: opt: 126 z-score: 158.5 E(): 0.23; 25.6%
FT                   identity in 160 aa overlap. Contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9K4A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A6"
FT                   /protein_id="CAB94598.1"
FT                   /translation="MDHLATASLTSLWDEVSGIQPDPDLWVVVATLVAALAVVATRGSW
FT                   RIARNAITIAHEGGHGLVALLTGRTLTGITLHSDTSGLTVSRGKPHGVGMILTAVAGYT
FT                   APPLLGLGGAALLAAGRITLLLWLATALLVALLVMVRNAYGVLTVVVTGGTFVLVSWLA
FT                   GPQVQAAFAYAVVWFLLLGGVRPAFELQAKRSRGGAGDSDADQLARLTHAPAGVWFFLF
FT                   HAVSLCSLIGGARWLLEL"
FT   CDS_pept        303488..304303
FT                   /transl_table=11
FT                   /gene="SCO5214"
FT                   /gene_synonym="SC7E4.11"
FT                   /product="conserved hypothetical protein SC7E4.11"
FT                   /note="SC7E4.11, hypothetical protein, len: 271 aa; similar
FT                   to TR:O05872 (EMBL:Z95121) Mycobacterium tuberculosis
FT                   hypothetical 27.6 kD protein MTCY20B11.01c, 252 aa; fasta
FT                   scores: opt: 383 z-score: 460.8 E(): 3.4e-18; 39.6%
FT                   identity in 283 aa overlap"
FT                   /db_xref="GOA:Q9K4A5"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A5"
FT                   /protein_id="CAB94599.1"
FT                   /translation="MCGRYAASRRPEDLAGIFEIEKWEPKESLEPDYNVAPTKEVYAVL
FT                   DRPLKDVEDPEPVRQLRKLKWGLVPSWSKTPEGGARMINARAETVHEKPSYRRAFSTRR
FT                   CILPADGYYEWVTGKQERDLEVEGRKKRPRKQPYFVTPADGSVFAMAGLYEFWRDRTLP
FT                   DDHPQAWWVTCSVITTEAETTPLAVAPADGPHALADIHPRMPLMLTPDRWDDWLDPART
FT                   DPDELTSLLAPPPTGLMRAFPVSTAVSNVRNNGPELLEELEAPEEGTLF"
FT   misc_feature    304262..307169
FT                   /note="previously sequenced DNA fragment. EMBL:SAJ010320
FT                   Streptomyces coelicolor sigR and rsrA genes"
FT   regulatory      304320..304323
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        304326..304961
FT                   /transl_table=11
FT                   /gene="SCO5215"
FT                   /gene_synonym="SC7E4.12"
FT                   /product="hypothetical protein"
FT                   /note="SC7E4.12, hypothetical protein, len: 211 aa; similar
FT                   to TR:P96267 (EMBL:Z84724) Mycobacterium tuberculosis
FT                   hypothetical 21.7 kD protein MTCY22G10.18c, 209 aa; fasta
FT                   scores: opt: 255 z-score: 287.1 E(): 1.6e-08; 29.8%
FT                   identity in 205 aa overlap"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A4"
FT                   /protein_id="CAB94600.1"
FT                   /translation="MTEAVETDAGPARITWHRAKQPRLVLAVSHGAGGGIEARDLKALA
FT                   AALPAHGVSVALVEQPWRVAGRKLAPAPKTLDTGWRGVWPALAAPGLPVISGGRSAGAR
FT                   VACRTAGELGARAVLALSFPLHPPGRPEKSRADELLGAGVPTLVVQGGNDPFGRPHEFP
FT                   EAPGGTYDLIEVPYGDHGFAVPKRAEISQERALELITDGVAQWAGSLG"
FT   regulatory      305212..305217
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        305219..305902
FT                   /transl_table=11
FT                   /gene="SCO5216"
FT                   /gene_synonym="sigR"
FT                   /gene_synonym="SC7E4.13"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="SC7E4.13, sigR, RNA polymerase sigma factor, len:
FT                   227 aa; identical to previously sequenced TR:O87834
FT                   (EMBL:AJ010320) Streptomyces coelicolor RNA polymerase
FT                   sigma factor SigR, 227 aa. Contains Pfam match to entry
FT                   PF00776 Sigma70_ECF, Sigma-70 factor (ECF subfamily) and
FT                   match to Prosite entry PS01063 Sigma-70 factors ECF
FT                   subfamily signature. Contains also possible
FT                   helix-turn-helix motif at residues 171..192 (+2.53 SD)"
FT                   /db_xref="GOA:Q7AKG9"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014293"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="PDB:1H3L"
FT                   /db_xref="PDB:5FGM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AKG9"
FT                   /protein_id="CAB94601.1"
FT                   /translation="MGPVTGTDAGTEHGQAEQPEGRGTGAESTAERSARFERDALEFLD
FT                   QMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKK
FT                   QREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKQALQAIPEEFRIAV
FT                   YLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARDRGLVPAGAGESNEA
FT                   KGSGS"
FT   misc_feature    305363..305530
FT                   /note="Pfam match to entry PF00776 Sigma70_ECF, Sigma-70
FT                   factor (ECF subfamily), score 96.80, E-value 4.1e-25"
FT   misc_feature    305399..305494
FT                   /note="PS01063 Sigma-70 factors ECF subfamily signature"
FT   CDS_pept        305899..306216
FT                   /transl_table=11
FT                   /gene="SCO5217"
FT                   /gene_synonym="rsrA"
FT                   /gene_synonym="SC7E4.14"
FT                   /product="anti-sigma factor"
FT                   /note="SC7E4.14, rsrA, anti-sigma factor, len: 105 aa;
FT                   identical to previously sequenced TR:Q9RL96 (EMBL:AJ010320)
FT                   Streptomyces coelicolor anti-sigma factor RsrA, 105 aa"
FT                   /db_xref="GOA:Q7AKG8"
FT                   /db_xref="InterPro:IPR014295"
FT                   /db_xref="InterPro:IPR024020"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="PDB:5FRF"
FT                   /db_xref="PDB:5FRH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AKG8"
FT                   /protein_id="CAB94602.1"
FT                   /translation="MSCGEPHETDCSEILDHLYEFLDKEMPDSDCVKFEHHFEECSPCL
FT                   EKYGLEQAVKKLVKRCCGQDDVPGDLRAKVMGRLDLIRSGQSVPEHDVAAAPSSSAPQE
FT                   S"
FT   regulatory      306335..306339
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        306345..307670
FT                   /transl_table=11
FT                   /gene="SCO5218"
FT                   /gene_synonym="SC7E4.15"
FT                   /product="putative integral membrane protein"
FT                   /note="SC7E4.15, possible integral membrane protein, len:
FT                   441 aa; similar to TR:Q9X1H8 (EMBL:AE001797) Thermotoga
FT                   maritima conserved hypothetical protein TM1467, 426 aa;
FT                   fasta scores: opt: 471 z-score: 536.1 E(): 2.2e-22; 29.0%
FT                   identity in 352 aa overlap. Contains possible N-terminal
FT                   signal peptide sequence and possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q9K4A3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A3"
FT                   /protein_id="CAB94603.1"
FT                   /translation="MDAVPARARVYVAVVALTALLCLRPLPAVRAPWWAVLLLAGLYAG
FT                   SELVARSRFVGTCYPVLLAGAFLLPPPAAALVALPGALLAPVPRRPLGLRRVWRAAQLT
FT                   LAVWAAACVHWRLGGRDAVVEPAFPYALVPAGAAVLAFCLVLTVLDGGILTLADHVPPS
FT                   RAWRGLLSRSLAPIAVHGLAGLMMAVLWRSPYGPVAALLVLLPMCVAWWAFAQYHRERA
FT                   AHQATIRALVQAVDIKDGYTRGHSERVGQASMMIARELGMDDERVETLRFAGILHDVGK
FT                   LGVPTRLLRKDGPLTPEERRVIELHPEYGHEMVRGIRFLGEARAAVLHHHERLDGSGYP
FT                   YGLAGDRIPESARVVAVADAFDAMTSTRSYSRARPVATALAELQRCAGGQFDPRMVRAL
FT                   VRALGRHGWRPSVTADSPLTRTAGPAPDRGEDARDSVGRGAP"
FT   CDS_pept        307676..308932
FT                   /transl_table=11
FT                   /gene="SCO5219"
FT                   /gene_synonym="SC7E4.16"
FT                   /product="putative lipoprotein"
FT                   /note="SC7E4.16, possible lipoprotein, len: 418 aa.
FT                   Contains correctly situated match to Prosite entry PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site,
FT                   possible N-terminal region signal peptide sequence and
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9K4A2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A2"
FT                   /protein_id="CAB94604.1"
FT                   /translation="MQPPARSSPPAAVLLVPGCAGLLALGCLASVLGAGPAQRPVALAF
FT                   GGLVVLGELTRRTGAEAREAAPLGAAGALAYALLGDVAGQPAHHGVAETVTVVLAASLL
FT                   GSVPYVARGSGPVLDHLARRVLTVGFAAVCFRPLSNQGVFDDWSGPAYALLLLGLLALT
FT                   TLCDAVLAAAPAHARTGWPFGPLLREELRGMVGITSAVCATGAVMALAVSVAGLWALPV
FT                   FSVPLLLAQLSYRRYAAVRATYRQTIASLARATEIAGYTPAGHARRVAGLGVAVGRDLG
FT                   LSGAELTVLEYAALMHDIGQLSLVDPVPAGATAGLPVTEQRRIALLGGAVVRQTGVDAA
FT                   VAVVVERQADPCREQPVAARIVRVVNAYDEKARDAGPGGVLTALEELRLATAGDYAPEV
FT                   VEALARVLSRGSLTEPAAG"
FT   misc_feature    307724..307756
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT   CDS_pept        309047..310027
FT                   /transl_table=11
FT                   /gene="SCO5220"
FT                   /gene_synonym="SC7E4.17"
FT                   /product="hypothetical protein SC7E4.17"
FT                   /note="SC7E4.17, unknown, len: 326 aa"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A1"
FT                   /protein_id="CAB94605.1"
FT                   /translation="MRIFGKARHRPSASWRQATDRAFTLIGDGRYEDAGALLTRAADLE
FT                   PWLSESWFNLALLHKFRHDWEQARAAGLRAVALLDRDIGAPDWWNVGIAATALQDWPLA
FT                   RRAWQAYGLRTPGGATDAGEPLGMDLGSAAVRLSPEGEAEVVWGRRLDPARVEVLSIPL
FT                   PSSGRRWGEVVLHDGVPHGERTTSAGHSYPVFDEIELWAPSPVPTWVVLLEAATESDRD
FT                   ALEQLAADAGFAAEDWSSSVRLLCRMCSESRMPSDEGDGEHLDPHDHSEPGHPGPLGHR
FT                   TDGQLWVPERECGVAAPAGLVKGLLDGWVADSPDSRDWRDLEEVC"
FT   CDS_pept        310107..310757
FT                   /transl_table=11
FT                   /gene="SCO5221"
FT                   /gene_synonym="SC7E4.18"
FT                   /product="putative polypeptide deformylase"
FT                   /note="SC7E4.18, probable polypeptide deformylase, len: 216
FT                   aa; similar to SW:DEF_FREDI (EMBL:Y10305) Fremyella
FT                   diplosiphon polypeptide deformylase (EC 3.5.1.31) Def, 187
FT                   aa; fasta scores: opt: 353 z-score: 430.0 E(): 1.8e-16;
FT                   33.8% identity in 145 aa overlap and to TR:Q9XAQ2
FT                   (EMBL:AL078618) Streptomyces coelicolor putative
FT                   polypeptide deformylase SC10A7.23, 208 aa; fasta scores:
FT                   opt: 680 z-score: 796.7 E(): 0; 59.8% identity in 169 aa
FT                   overlap. Contains Pfam match to entry PF01327
FT                   Pep_deformylase, Polypeptide deformylase"
FT                   /db_xref="GOA:Q9K4A0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K4A0"
FT                   /protein_id="CAB94606.1"
FT                   /translation="MAQQDTDQQHPGVLPVDDEGFVVDSQDCEEREADWRGRGTSRPIT
FT                   VVGNPVLHKECEDVTDFGEEFQQLVADMFASQRTAEGVGLAANQIGVSKKVFVYDCPDD
FT                   EGVRHVGVVCNPRLVELPADRRRLDDSNEGCLSVPTAYAPLARPDYAEVTGQDEKGNPV
FT                   KVRGTGYFARCLQHETDHLYGYLYIDRLSKRERKDALRQMAENEPRYPVVAND"
FT   misc_feature    310233..310667
FT                   /note="Pfam match to entry PF01327 Pep_deformylase,
FT                   Polypeptide deformylase, score 183.80, E-value 2.7e-51"
XX
SQ   Sequence 311000 BP; 44534 A; 115063 C; 108734 G; 42669 T; 0 other;
     ccgggcttct catcctcctc ttacgcgggc cttatcccgt catcacgggc cgtgcctagc        60
     ttgcgcccat gttcttcacc tacctgaggc gcgagctgcg ccgccgccgg aaggcggccc       120
     tcgtcgtcgc ctccggactg gccctgggca tcgcgctggt catcgtcgtc gactcggtct       180
     cctccggcat gggccgggcc caggacaagg tcctgcagtc cctgtacggg ctgggcacgg       240
     acatgacggt caccaaggcc gcggaggcgt cctccgcaag caccgccgaa cggccgcgct       300
     tccgcttcga cgcgcaggac gacggctccg aggaggagca gagcaccgac cgcgtcatgg       360
     tgcagggctt ccagacgctg gcgagttcca ccgtcggcaa ggtcgccgga cagagcggtg       420
     tcgccgacgc ggtgggcggt ctgagcctcc aagtcgtcaa ggtcagcggc gagttctcgc       480
     gcggtcagtt cacgcaggac gcctccggcg gcgccgcggg cggcacgggt cagggcggcg       540
     gcccgggcgg aggccagtcc ccgcagggcc gcgtccaggg cggcggcgcc gacttcgacg       600
     tcaacagcta ctccgtctac ggcaccgacg tcaccgagcc cgccctcggc ccgctgacca       660
     cgtccaccat caccagcgga cgcaccttcg aggagtcgga gaccgacgcc agggtcgccg       720
     tcgccgactc ggcctacgcc aaggagaaga aactcaaggc cggcagcacg gtcaccgtca       780
     aggacacgaa gttcgagatc gtcggcatcg ccacggcgga cagcggtgat gcggcggcca       840
     gcctctacgt gccgctgaag caggcccaga cgctgggcga cgcgaaggac gaagtcacca       900
     cgatctacgt caaggcgacc gactcgcagc ggatcgacgg cgtcaagtcc gcgatccaga       960
     agaacatctc gggcacgacg gtcaccacct ccgccgacct cgccgacacc gtctccggct      1020
     ccctgtccac tgcctcctcg ctcgccaccg gcgtcggcaa gtggctgtcg atcgtcgtcc      1080
     tcgtggccgc cttcctggtc gccggtctgc tcacctcctc cgccgtctcc cgccgggtgc      1140
     gcgagttcgg cacgctcaag gcgctcggct ggcgctcggg ccgggtcacc cggcaggtga      1200
     tcggcgaggc cgtcgtcaac ggcctggtcg gcggcgccct cggcatcgcg ctggggctcg      1260
     cgggcgcgta cgccgtcacc gccgtcagcc ccacgctcca ggcccagctg ggcggcggcg      1320
     cgggcggtgg cgggggtgcg ggcggctctg gcggcggctt cggcggaggc ggcctgggcg      1380
     gccccggaag acaggcggcc gccaagaccc tggacatcgc gctgaccgca cccgtcagcc      1440
     ttaccaccat cgccctcgcg gtgggcctcg ccgtggccgg cggactcgtc gccgggggct      1500
     tcggcggctg gcgcgcctcg cggctgcgcc cggcggacgc cctgcgccgc gtcgagtagc      1560
     gccccccttc cccgtactcc aggagttgca ccatgtacga actcagcggc gtcaccaagc      1620
     actacacccg cggcaaaacc accgtgcacg ccctcgacgg cgtcgacctg accatcgccg      1680
     acggcgaccg gctggtcatc cagggcccca ccggcggcgg caagtccacc ctgctccaga      1740
     tgctgggcgc cctcgaccgg cccagctcgg gccggatcgt cctcgacggc accgacctcg      1800
     ccacgctccc cgaggccagg ctgacccggg tgcgcagcga gagcatcggc ttcgtcttcc      1860
     agtccttcaa cctgatcccg accctgaccg cccaggagaa cgtcgagacc gccctggtcc      1920
     cgctcggcgt caaggcgaag gagcggcgcg agcaggccgc cgaggccctg gcctccgtcg      1980
     gcctgggcga acgcctcggc cacctccccg gcgagatgtc cggcggccag cagcagcgcg      2040
     tcgccatcgc ccgcgccctg gtgaagcagc cgaaggtgct cctcgccgac gaacccaccg      2100
     gaaacctcga cgagtcgacc cgcgacgaga tcatggacgt gctcgaccgc atgtggaagg      2160
     agctgggcct caccttcgtc atggtcaccc acgactcggc gatcgccagg aaggcccccc      2220
     gcgtggccac catccgcaag ggccgcatca ccgtcaagga gaacgcctcg gcgtgacggt      2280
     gtgcggccgg tgacgggccg tcagtcggtg tagttcttac ccgggggccg gccgggcacc      2340
     ggcttgccga cgagggcgac cggggtgaac aggctgaagt ggcccagggc catggtgagg      2400
     tgccagatcc cgtcggtgtc gtagtgccgg gacagccggg cgaacaggtc gtcactcacc      2460
     cggtccccga acgggttcgg ggtgaggacg gcctccgcga gttccagcgc ggcccgctcg      2520
     ggagcggtga agcagggggc gctctgccag gtcgccacgg ccgtgatgcg ccgctcctcc      2580
     tcgccggcct tgcgcagggc gtcggtcgcc gcgacgccgt ggtaggtgct gccgatcacc      2640
     tgtgcggtgc gcaggcgcgt cagagcgagg gtggcctgcg ggaccgggcc gttgcgcagg      2700
     gccttctgca cggcagcgga gagggccgtc aactcggggt agagcccggt ggggtcgggc      2760
     aggcgggacc gcgtcccgtc ctgctccgcg gtggtggtcg tgtccgtggt ggtggtcatt      2820
     gctgagaggc tccttcgagt cggtcggacg tcgttccacc tctccgacac cgtggcggcc      2880
     cgaagtgtga gcccgcgccc cgggcccgcg cgccccggac ccgtgctgcc ccggcccgca      2940
     tgtcacagac ggccgcgccg tcgcgtcgta gaggcgtgag gacacgcgcg cacgcggcag      3000
     aaggagcgtc ggaagcaatg accacccgat ccgcgccggt caccggcgag cgacggcaac      3060
     tgatcaacgt ggcctaccgg atgctcggct cgctgaccga cgcggaggac gccgtccagg      3120
     aggcgtacgc ccgctggtac gcgatgcccg cagaccggcg ggaggccgtc gggtccccgg      3180
     gggcctggct caccacggtc gtcagccggg tctgcctcaa ccacctgcgt tccgcccggg      3240
     tccggcggga gctctacgtg ggtcagtggc tccccgagcc gctggccgac cccgccgagc      3300
     ggaccgccgc ccgcacaccc ggcatcgcct ccgacccggc cgacctgatc accctcgacg      3360
     agtcggtcgg catggccttc ctggtcgtcc tggactcgat gtcccccgcc cagcgggtcg      3420
     ccttcgttct ccacgacgtc ttccgctatc cgtttcccga ggtggccagg atcgtcggcc      3480
     gtacgccggc cgcctgccgc cggctggcgt ccaccgcgcg ccggggcatc cgcaccgcac      3540
     aggagtccgc cgccacgtcg acggcgcagg acgcggtcgt cgtacgcgat ctcaagcggg      3600
     cctgggagac caacgacgtc gacgcgctca tccgactcct cgaccccgag gtgaccgcgg      3660
     tcggcgacgg cggcggtgtg gtgcgcaccc tggagcaccc gctgcggggc cgcgagccga      3720
     tcgtgcgcgg actgctccgg ttcggcccgc ggcagtccgg gcagacgctg ctcgaacgca      3780
     cggtcaacgg gcggcccggc ctggtcggct gtcaggacgg caccgtcgtg acggtgtact      3840
     ccttcggcgt ctcggaccac cgcgtccgcc acctgtgggc gatgcgcaac cccgagaagc      3900
     tgcgctcctg ggcgacggcc ccggccgcgt gagccggggg aggccggacg gggaggccgg      3960
     gcccccggtg cccggtcacg tggccaggtc gagccactcc ccgacggcca gtacgtgtgc      4020
     gcgccgcccg gcgtgcgcgc ggaactcggc ctccgggtcg gccacctcga cgtagcccgc      4080
     gatcttgtcc ggctgctccg gctcgtagtg gatcggcacc gcgaaccggg cgtcgaggat      4140
     ctccgcggcc gcggcggcct gcctcgggtc cagtgcggcg ggcacggggc tcggcggctg      4200
     caggtgcggt gcgtcgacca ccgcgccgtt ggcgggcagg aacaccgcgt cgaacgggct      4260
     gaaccggcgc gcgacgagcc accagaagcc gtggaacatc gtgtcgccgc cgtggaggat      4320
     ccgctgtccg tcggcctcca ccacccagtt cagctgcggg tcgcccagcc cgtcgacggc      4380
     ggggaccgcc gtgacgcgga acggccccag gtcgcgcgtg gaccagacgt ccacgacctc      4440
     gacggccagc cggtgccgga ccagctcgcg ctcggccaga agcgtcgtca cgttgtccac      4500
     gtcgtcaccg tgaccgggcg ccggtcgcag caccggcgcc ccctgcgtca gcacctccga      4560
     gagcgcggac gcgtcggtgt ggtcccggtg caggtgggtg acgagcgcgg cggacgccct      4620
     cccgcccggc accgccacgt tctcgccggg cttccacccc gtgaacagcg gcgagaggtc      4680
     ccgcacgtag tcgatcacca tgcgctcgcc gcccgcctcg atctccagtc cggcccagcc      4740
     cagtcgtcgc acccgcatcc cgcactcctt cgttccggtt tcgttccggt ggaacccgga      4800
     cgttagcgta cgggcgttcg ctaaatcaat agcgaacgcc cgtacgctat ctttgccgta      4860
     tgtcaccacg acgttcagct gccgaagcgc aggccacccg gggccggatc ctcggccgtg      4920
     ccgccgagat cgcctccgag gaagggctgg acggcatcac catcggccgg ctcgccgaag      4980
     agctggagat gagcaagtcc ggggtgcaca agcacttcgg caccaaggag acgttgcaga      5040
     tctccaccct ggacaaggcc ttcgtggact tctggcaccg ggtggtcgag ccggccctgg      5100
     ccgagccgcc gggcctgcgg cggctgcgcg cggtgtgcgc caactccgtg ggctacctgg      5160
     aagaacccct gctgcccggc ggctgcctgt tgaccgcggc actcagcgag tacgacggcc      5220
     ggcccggccg ggtccgcgac gcggtggccg aggtgtggtc gcgctggcgg gagcagctgc      5280
     gggcggacct gaccgcggcg gtggacaagg gcgagctgcc cgccgggttc gacgtcgagc      5340
     aggcgctgtt cgagatcgtc gcggccgggc tggcgctcaa cgcggccatg cagctccagc      5400
     acgaccgcac ggccgcggac cgggcccgcc gcgcgatcga acgggccctg gcccagtcct      5460
     gaccctcacc gtccgctccg gaccgccggg gcggcgggtg tccggacgtc gtcgagcggc      5520
     ggctctcccg ccggctcgca ccggaccgcc ctgcgatccc cgcgctgctc cacgccccac      5580
     cgcggcgccg gcgcgtcgag gagggcgagg ccgcgcccgg actcgtcggt gacaccggcc      5640
     ggtccgggga ggaggggcgg gacccgtggg tcggggtcgg tgacccccac gcgcgtgtgg      5700
     ccgctgggca ataccgtgag gcggacggtc gcgggggtgc cctgcccctc gtggtcgatg      5760
     acgtgcgtca gcgcctcggt cacgcaccgg cgggcgtcgt ggtcgtgacc gcactgagcc      5820
     ggggcgctcc cacggcgtga ccgaggccgc cgtcacgtcc gtcattcagt gggcggctcc      5880
     gcacgtgccc tcaccggccg tctggccggc cgcgcgtgtt cgtccaccag gtcatcttcg      5940
     acggacgtac ccggcggtgt gcgtcacgtc agacggttgg gccgttggtc ccggtccggg      6000
     cgagggaaca tgtgctccac ggcggtcacc agtgcggcgc ggcgggcggt gacagagggg      6060
     tccacggcct ggtccgcggc agcggcggcg atttcgggct gacctgccca ggtcatggcg      6120
     atctggttga tcagggcgag gacgtcgacc gggtcccagg ccgggtcgag cagcccgatg      6180
     cgctgcgcgt cgcgaagttt gtcgagcttg ccggcgatcg tggcctgaag ggggccgctg      6240
     gtgttgtccg cggactcggc cagctccagg cggccccacg tgatcaggcg gtagtggtcc      6300
     ggacgggccg cgaagtggtc gaagaggatg ccggcataac cgggcaggtc ggccggatcc      6360
     agctgagtcg cctcgatgag tgcggtcgtc tcgcgttcgg cgacgtgcgc gtaaagggct      6420
     tccttgctgc ggaagtaggc gtagacacgt tccttgctcg tcctggcctg cttggcgatg      6480
     cggtccacgc gggcaccggc gatcccgtgc cgggcgaact cctccttggc cgcggcgacg      6540
     atgcgctggc gcgtggagtc ggtggacccg ccccccgagg tgggggcgtc cggggtctga      6600
     ccagggctgg gggagcgagg catgggtcca ggataggcga ccaaaccgtt cggttttgct      6660
     cagcacgccg gaccggcgta gggtcacacc aaacagtttg gtttggtcgg ctatcggcta      6720
     tcggctatcg gccgccgaca cgacacgaca cgaggagcga tctcatgcag caccgcaccc      6780
     tggggcaaca gggactgcgc gtctccgcgc tcggactggg cgtgatgggg atgtccctgg      6840
     cctacggtcc ctcgaacgac gaggacggca tctccaccat tcaccgcgcc cacgaactcg      6900
     gagtcgactt cttcgacacc gccgagctgt acggccaagg caccggcagc aacgagacgc      6960
     tgctcggcaa cgcggtcaac gacttccgcg acgaggtcgt cctggccacc aagttcggct      7020
     tcgacatgac cagcaagtcg ttggggagcg gcgtcaacag ccgcccggag aacatccgcg      7080
     aggtcgctga gaacagcctg cgctacctcc ggaccgatcg catcgacctc ttctaccagc      7140
     acatctccga ccccgacgta ccggccgagg aggtcgccgg cacggtgggt gacctgatca      7200
     ccgagggcaa ggtgcggtac ttcggcctga gcaacgtcgg cccgcggtac atccggcgcg      7260
     cccacgccgt caccccggtc acagcccttc agtacgagta ctcgatcttc gagcgcgagg      7320
     tggaggacga gatcctgccg gtcgtgcggg agctggggat cggcctggtg ccgtactcgc      7380
     cgctcggccg cggcttcctc tccggtgtgg tcaggccggc cggcgagtat cccgaggacg      7440
     acatgcgccg ctgggacgag cgctggcagg gcgagaacta cgcctacaac ctgaacgccg      7500
     ccgagcagct ccgaaagctc gccgccacca agggcatcac cccggcgcag ctcgccctgg      7560
     catggctgct cgcccagggc gaggacgtcg tcccgatccc gggcacccgc agcgccgcac      7620
     ggctggagga gaacgtcggc gccatcgacg cggaactcac cgaggccgac ctggcccgta      7680
     tccgggaggt catcccccag ggctccgcag gcagccgcta cccggcctcg atgatggccg      7740
     gcttccgcac cgactgacag cccgtgctcc acgttcggcg gccccgggca aacggcggcg      7800
     agcagcggca gcgtgtcttc ccggcggggc tgttccgccg cggctggtcc gagctcacgc      7860
     cggcagggaa gccgccgcgt ccgtccccca gctcgccagc agacgcagtg cgtccgccga      7920
     cggcgagccg ggttccgcgt ggtacgtgat gaaggcctgt tcgtcgtcgt cgaccaggcg      7980
     gaacgtctcg aaggacaggg tcaggtcgcc gaccagcggg tgccgcatcc gcttgacgcc      8040
     gtagctcttc tccttgacgt cgtgcgtggc ccacaggcgg cggaactcct cgctcttcac      8100
     ggagagttcg ccgaccagcg cggacaggcg cgggtcgtcc ggatggcggc ccgcgtccat      8160
     gcgcaggaag ctgaccatgt cgtacgcctt ctggtcccag tcgacgaaca gctcacggta      8220
     gtccgggttc aggaagacca gccgcgccca gttgcgctcg gcggccggga gcttgcccca      8280
     gtcgccgaag agggccgcgg ccatccggtt ccaggcgaga atctccgagc ggcggcccga      8340
     cacgtacgcg ggcaccgtgt cgatcgaatc cagcaactgg agcagcgcca cccgcaccgg      8400
     ctgcttgccc cgcgcggccc cggcccgccg gcgctgctgc ttcggccgtg ccagatgggt      8460
     caggtgcgcc tgctcggcgt cggtcagccg cagcgcccgg gcgatggcgt ccaggacctc      8520
     cgccgacacg ttctgcccgt tgccctgctc gaggcgggtg tagtacgcca ccgacacccc      8580
     ggccagctgc gccagctcct cgcgccgcag cccgggcacc ctgcgctgcc gtccgtacga      8640
     ctccagaccc acgtcctccg gcttgagccg ggcccgccgg gtgcgcagga actcgctcag      8700
     ttcggcccgc cggtcaagct gtccatccat accctccagt atcaccggac gtattcccgg      8760
     tcgtacgtac acgagcctgt ccccgtcggt ggtacgcacg ccggtcgtac gcaaagccgt      8820
     ggtctgggtg gatcagcggg cgccaggcag ggtggaagca tcacccagtc acgtcaagag      8880
     aatcccggag aacccggcat gaccactgtc gccgcgtacg cagcacccgc cgccaaggcg      8940
     ccgctggagc gcaccaccat cgagcggcgc gaggtgcgtg aacacgacgt cctgatcgac      9000
     atcaagttcg ccggcatctg ccactccgac atccaccagg cccgcgaggg ctggggcgag      9060
     gccatcttcc cgatggtccc cggccacgag atcgcgggca tcgtgtccga ggtcggcccc      9120
     ggcgtcacca ggttcaaggt cggcgaccgg gtgggcgtcg gctgcatggt cgactcctgc      9180
     cgcgagtgcg agaactgcaa ggccggccgg gagcagtact gcaccagcgg caacaccggc      9240
     acgtacaacg ccgtcggcag ggacggcgag gtcacctacg gcggctactc cgagaaggtc      9300
     gtcgtcgacg agaacttcgt cctcggcatc cccgagggca tcgccctgga cgaggccgcc      9360
     cccctgctgt gcgccggcat caccacctac tccccgctca agcgctggaa cgcgggtccc      9420
     ggcaagaagg tcgccgtcgt cggcctgggc ggcctcggtc acatggccgt caagctcgcg      9480
     cacgccctgg gcgccgaggt gaccgtgctg tcgcagtccc tgcgcaagaa ggacgacggc      9540
     ctgaagctgg gcgccgacca ctactacgcc accagcgacc cggccacctt cgaggagctg      9600
     tccggcacct tcgacctgat cgtctccacg gtctcggccc cgctcgacct cggcgcctac      9660
     ctggggctgc tgaagacgga gggcacgctg gccaacgtcg gcgcccccga ggagccggtc      9720
     tccctcaacc tgttcgcgct gctcggcggg ggcaagtccc tctccggctc catgatcggc      9780
     ggtatcgccg agacccagga gatgctggac ttctgcgcgg agcacggcat cggtgccgag      9840
     atcgagctga tcgccgcctc cgagatcaac gaggcctacg agcgcgtcct gtccagcgac      9900
     gtgcgctacc gcttcgtgat cgacaccgcg acgatctgat ccctcccggg agagcccggg      9960
     gaagttttct cggattcttc cccgctccct gtcacaccgc cgccccgccc cgggtcatac     10020
     cgccacgaca cacacggcgg acacccgggc ggggcggccg tgcttcggca ccggccccgc     10080
     tccccggacg ccacggacac cgggagcagc cagtcatgac gtaccacgcc tcgaccccca     10140
     gcacgcccct cctggtcacc ggaggcaccg gcaccctcgg cggccacgtg gtcccgctgc     10200
     tgcgggaggc cggccacgac gtccgcgtcc tcacccggcg gacccgcccc gccaccggta     10260
     acggcatcac gtacgtcacc ggtgacctgc gcaccggcga gggcgtcgag gccgccgtcg     10320
     acggcgtgca caccgtgctc cacctggcgg gcggccccaa gggcgacgac gaggcgaccc     10380
     gcaccctggt ccgcgccgcc gcccgcgcgg acgtacggca cctcgcgtac atctcggtcg     10440
     tcggagccga ccgcgtcccc ctcgcctggc tgcggaccaa gctggagtcg gagcgggcga     10500
     tcgccgactc gggcctcggc tggacggtgc tgcgggcggc ccagttccac gagctgaccc     10560
     tgacgatgat cgagaagatg acccggctgc ctgtgctccc ggtgcccggc gggctgcgtc     10620
     tgcaaccggt cgccgcccgc gaggtcgccg tacgcctggc cgagctgacc ctcgccgagc     10680
     cgtccggccg ggtgcccgac atgaccggac ccgaggtcct cgatctggcc acgctggccc     10740
     attcctatct ggacctgcgc ggcgggcgcc ggcgcccgaa gctgccggtg cgcattcccg     10800
     ggaaagcggg gcgcgcgtac cgttctggcc agaatctcac cctggaagac gcgctggtcg     10860
     gcaaggtgac gtggaccgaa ttcctggcgg agagggcggc cgtatgagtt ctccgggcct     10920
     ttctggccga aagtcggcgt agctgaagaa tatgcgcatg acaacaatgg caaagtggac     10980
     caaaaccttc tccccctcct ccgcaaaggc tgaagaaata ccgtttctgc agtggattcc     11040
     ggcgagatgc tgaatgcggc acacagcgtg cccgcccaat tccggcgggc actgctccgg     11100
     cgcgttcgca aggagatggc agcgtggtgc gaagcagggc gaaggccgtg gccgacgccg     11160
     ctgaccggct tctgaaggca ggtcagctgc tgcggaggtc ccctaccacc ctcgatctga     11220
     gggccgtgta ccgcacggac cagaacgtca acgaccgtcc ttatcgtgag cggtgggcgc     11280
     atgacaaagt cgtgcgctcc acccatggcg tcaactgcac gggatcgtgc tcgtggaagg     11340
     tgtacgtcaa ggacggtctg atcacctggg agacccagca gacggattat ccgagcgtcg     11400
     gtcccgaccg gcccgagtac gagccgcgcg gctgtccgcg cggcgcctcc ttttcctggt     11460
     acacctattc gcccacccgt gttcgccatc cgttggcccg gggcgtcctc gtggaaatgt     11520
     accgggacgc caaacgccgg cacggcggcg accccgtggc cgcctgggcc gagctgacct     11580
     ccgaccccga gaagcggcgt cgctaccagt cggcccgcgg ccgcggcggc ttcgtccgcg     11640
     tcgactggga cgaggcgctg gagatcgccg ccgccgccca ggtgcacacc atcgccgagt     11700
     acggccccga ccgggtcgcc gggttctccc cgatccccgc catgtccatg gcctcgcacg     11760
     cggtcggcgc ccgctaccac tccctcatcg gcgccccgat gatctccttc tacgactggt     11820
     acgccgacct gccgatcgcc tccccgcagg tcttcggcga ccagaccgac gtaccggagt     11880
     cgggcgactg gtgggacgcg gcctacctga tgctgtgggg ctccaacgtc cccgtcaccc     11940
     gcacccccga cgcgcactgg atggcggagg cccgctaccg gggccagaag gtcgtcgtcg     12000
     tctcgccgga ctacgcggac gccaccaagt tcgccgacga gtggctgcac ccgcaccccg     12060
     gcaccgacgg ggcgctcgcc atggccatgg gccacgtcct gctcaccgag ttcttcgtgc     12120
     gccgtcaggt gccgtacttc accgactacg tcaagcgctt caccgacctg cccttcctcg     12180
     tcgccctcga cgagcacgcg gcgggccgct ggacgcccgg caagttcgtc accgccgccg     12240
     acctcgggct cggccggcac gccgacgccg gggcgcgggc ctggatgccg gtgctgatcg     12300
     acgccgacac cgacgacgtg gtcgtcccga acggcaccct cggcgaccgg tggggcaagg     12360
     gcggcgaggg gcgctggaac ctcgacctgg gcgggaccga cccgctcctc accctgcacg     12420
     gacacacggg cggccgcggt gacaacggtg tcgaggtggt gctgccccgc ttcgacgaac     12480
     ccggcgccac cgtcgtgcgc ggcgtaccgg cccgggagat cggcggccgg ctcgtcacca     12540
     ccgtctacga cctcctcctc gcccagtacg ccgtcgcccg ccccggcctc gccggccact     12600
     ggcccaccgg ctacgacgac gccgagcagc cctgcacgcc cgcctggcag gagcgcctca     12660
     cctccgtccc ggccgaggcg gcggtccgcg cggcccggga gttcgcgcgc accgccgagc     12720
     agacccgggg ccgctgcatg atcgtcatgg gcgccggcac caaccactgg ttccactccg     12780
     acaccatcta ccggtccttc ctctcgctgc tcatcctcac cggctgccag ggcgtcaacg     12840
     gcggcggctg ggcgcactac gtcggccagg agaaggtccg cccgtacacc ggctggcagc     12900
     agctgtccac ggccgccgac tgggtccggc cctcgcggca gatggcgggc accccgtact     12960
     ggtacctgca caccggccag tggcggtacg agtcccacgc cgccgacgcc ctcgcgtcgc     13020
     ccaccgcccc cggcaccctc gccgggctcc acaccgccga cctggtcgcc cagtccgccc     13080
     ggctcggctg gatgccgtcc tacccgacct tcgacgccaa cccgctcgac ctcggccgcc     13140
     gcgcccgcga gagcggccag gagcccggtg actggatcgc ggagcaactc ggttcgggcg     13200
     ccgtggactt cgcctgcgag gaccccgacg cgccccgcaa ctggccgcgc gtgctgaccg     13260
     tgtggcgggc caacctgatc ggctcctccg ccaagggcaa cgagtacttc ctgcgccacc     13320
     tgctcggcgc ccgcgacggc gccaccagct ccgaggcacc gcccgagcac cggccgcgct     13380
     ccgtggcctg gcgggacgac gcccccgagg gcaagctcga cctgctgctg agcctcgact     13440
     tccggatgac ctccacgacg ctcttctccg acctcgtgct gcccgccgcc acctggtacg     13500
     agaagcacga cctgtcctcc acggacatgc accccttcgt gcacgccttc agtcccgcga     13560
     tcaacccgcc ctggcaggcc cgcaccgact tcgagatctt ccactccctc gcccgccgcc     13620
     tgagcgaact cgccgccggc cgcctcggca cggcccacga cctggtcgcc accgccctcc     13680
     agcacgacac ccccggcgag acggctcagc ccggcggccg ggtcaccgac tggcgggacg     13740
     gccgcactcc catcgagccg ggccgcaacg cccctcaggt ctcgctggtg gaacgggact     13800
     acacggccgt cgccgaccgg ctcgccgcct tcgggccgct ggccgaggag cacggcatga     13860
     ccgtgaaggg cgtgaccgtc aacccgcacg aggagtcgcg ctggctcgcc gcccgctgcg     13920
     gcaccgcccc cgccgggccc gcccgcggcc gccccctgct cgacaccgac gtcaagttct     13980
     gcgaggcgat cctcgccctg tccggcacca ccaacggccg cctcgccgcc gagggcttcg     14040
     accgcctcgc cgaccgcgtc gggcccggcg ccgggctcgc cgagctcgcc gcgtcggtgg     14100
     gggagcggcg cgtggtcttc tccgacaccc aggagcgccc cgtgcaggtc ggggcgagct     14160
     tcgagtggtc cggcaaggag gcgcccgacc ggcgctactc gcccttcacc gtcaacaccg     14220
     agcacaagaa gccctggcac accctcaccg gccgccagca cttctacgtc gaccacgact     14280
     ggatggccga gctgggcgag cagctccccg tctaccggcc cccgctgaac ctggccgagc     14340
     tgggcgacgc cccgatcccg accggcgacg gccgcgcggt gaccgtccgc tacctcaccc     14400
     cgcacgccaa gtggtccatc cacagcgagt accaggagaa cctgctgatg cagaccctgg     14460
     cccgcggcgg ccccgtcgtg tggatgagcc ccgccgacgc cgacgcgatc ggcgccgccg     14520
     acaacgactg ggtggaggcc gtcaacgcac acggcgtcgt cgtcgcccgc gcgatcgtct     14580
     cccaccgcgt cccggacggc acggtgctca tgtaccacgt ccaggaacgc ctggtgaacg     14640
     tgccgaagtc ggaggcgaac ggccgccgcg gcggtgtcca caactccctg accaagctgc     14700
     tcgtcaagcc cacccacctc atcggcggct acggccagct ctccttcgcc cccaactact     14760
     acggcccgac cggcaaccag cgcgacgccg tcaccaccat ccggcgccgc tcccaggagg     14820
     tcacgtactg atgcgcgtca tggcacaggt ggcgatggtc atgaacctcg acaagtgcat     14880
     cggctgccac acctgctcgg tcacctgcaa acagacctgg accaaccgca ccggcaccga     14940
     gtacgtctgg ttcaacaacg tcgagacccg tcccggccag ggctaccccc gcggccacga     15000
     ggaccaggag aagtggaagg gcggctggca cctcaagggc gggcgcctcg tcccgcgcac     15060
     cggcggccgc gcccgccgcc tcgcccgcct cttcgccaac cccgaactcc ccaccctcga     15120
     cgactactac cagccctgga cctacgacta cgagaacctc accaccgccc ccctcggcga     15180
     cgacatcccc accgccccgc cccgctcggc gatcgacggc cgccccaccg agatcacctg     15240
     gggccccaac tgggacgacg acctcggcgg cggccccgca cagctcgccg cggaccccct     15300
     cctcgcccgg atgagcgagc aggtccggct cgactacgag cgggcgttca tgttctacct     15360
     gccccgcatc tgcgagcact gcctcaaccc gtcctgcgtc gccgtctgcc cctccggcgc     15420
     cctctacaag cgcgtcgagg acggcatcgt cctggtcgac caggaccgct gccggggctg     15480
     gcggatgtgc gtcagcggct gcccgtacaa gaaggtctac ttcaaccact ccaccggcaa     15540
     ggccgagaag tgcaccttct gctacccgcg gatcgaggcc ggcgacccca ccgtctgctc     15600
     cgagacctgc gtcggccggc tgcgctacct cggcgtcatg ctctacgacc ccgacaaggt     15660
     cggtgccgcc gcctccgtca ccgacgagaa ggacctgtac gaggcccagc tcggctgctt     15720
     cctcgacccc gacgaccccg aggtggcccg cgcggcccag gcgtccggca tcccgcacga     15780
     ctgggtcgag gccgcgcgcc gctccccggt ccacgcgctg atcacccggt accgcgtcgc     15840
     gctcccgctg cacccggagt accgcacgat gccgatggtc tggtacgtcc cgccgctctc     15900
     cccggtcgtc gacgccctca ccggcaccgg gcacgacggg gaggacccgg ccgcgctgtt     15960
     cggcgcgatc gacacgctgc gcatccccct cggctacctc gccgaactct tcaccgcggg     16020
     cgatccgggg cccgtcgagg ccgccctgtg ccggctggcc gcgatgcgct cccacatgcg     16080
     gcgcgtcaac ctcggcgagg aacaggaccc gcggatcgcc gaggcggtcg ggctggacga     16140
     gccgggcatc ctggagctgt accggctgct cgccctcgcc aagtacgacg agcgctacgt     16200
     catcccgacc gcctacaccg gctccgtccc cgaccccggc ggcaccgggg cgggctgcag     16260
     cctggacggc gtgggcgggc cggggatgat gccggagggc gcgggcggcg gccccggctt     16320
     cggggagttc gaccccgaag ccttccacgc gccgccgacc gccgggtccg gcacgtcgtc     16380
     cgcgctgcgc ggccgggtca acctcctgaa ctggaacggg aagggacgcc cgaacggcct     16440
     cttcccgcgc gcccgcggcg ccgtgcggac ggagcccgag ctgtgagccg tagcctcggc     16500
     cgcgccgcga cgaccaccaa cgcaccggtc gtcttccagg ccgccgccct gctgctggcc     16560
     tacccggacc gggactggcc gcgccgcccg cacaccgtcc gcgacacggt cgccgcgctc     16620
     cccggccccg agatccagct cctgctctcc ttctgcgacc gggcggaacg ggaggacccc     16680
     ctcgccgtgg ccgcccgcta cgtcgccacc ttcgaccgca gccgccggcg ctgcctctac     16740
     ctcacctact acaccgacgg cgacacccgc cgccgcggcg ccgcactcgc ccgtatcaag     16800
     tccgtgtacc gcacccacgg ctggctgccg ccggacgacg aactgcccga cttcctgccg     16860
     ctgatgctgg agttcgccgc ccgcaccccc gaggcgggca ccgcactgct gacggaacac     16920
     cgggcggcga tcgaggtcct gcgctacgcc ctcgaagccc accgcagccc ctacgccgcc     16980
     ctcctccagg ccgtcggccg gtgcctgccg ggccgggcac cggccagccg cgaggaggcc     17040
     ctgcgcctga cccgtaccgg cccgccgacc gaggcggtgg gcctcgacgt cctgggaccc     17100
     ttccccgccc agccccggcc gcacgacgac ggagcccgcc gatgaggcac ctgcacaccg     17160
     ccctgtgggg cgtcctgccg tacctgaccc tggtggtgct ggtggcgggg acggcctggc     17220
     gctaccgcta cgaccgtttc ggcttcacca cccggtccag tcagctgcac gagagccggc     17280
     tgctgcggat cgcgggcccg ctcttccact acggcctgct gttcgtgatc gccggccacg     17340
     tggccgggct cctggtcccc gagtcgctga ccgaccgcct ccacgtcagc gagcacctct     17400
     accacgccaa cgccctgatc gcgggcggca ccgcgggcct ggcgaccctg gcgggcctcg     17460
     ccctcctcct gtaccgccgc ctgcgcaccc ccgcgatccg ggccgcgacc agccggagcg     17520
     accgagtggt ctaccccctg ctgctcacgg tcgtcctcgc cgggctgacg gccaccgcgt     17580
     ccggtgcgac ggcggcgtcc acgtacgact accggctcgg cgtctccgtc tggttccgca     17640
     gcctgttcgc gctggacccg gacgtgaccg ccatggccca ggccccgctc gtctaccgcc     17700
     tgcacgcact cctcgccatg gccctgttcg ccctgtggcc ctacacgcgc ctgatccacg     17760
     ccttcacggc gccgctcggc tacctggtgc ggccctacgt cgtgtaccgc taccgggggc     17820
     gcggcgaggt gggagcgggc cggccggggc gctgacggct cggcgtccgc cccggggcgg     17880
     acgccggcgg ccgccgttca gccggccgcc ggccggcgcc gccggcgcag cgccgggtcg     17940
     agcagcgcgg gcgtggcgtc gaacttctcg tgcgcggcga ggtcggtccc cggcgcgacg     18000
     acggcgtcga ccgcgtcgag cacgtcgtcg gagagcaccg tgtcggcggc ggcgagctgg     18060
     gagtggaggt ggttcagggt gcggggcccg acgagcgcgg cggtgacggc ggggtgcgcg     18120
     gtcacgaagc cgagcgcgag ctggatcagc gtgagcccgg cctcgtcggc gaccgcggcc     18180
     agcttctcga cggcgtcgag ccgggcccgg ttggcgggca gcgcggtgtc gaagcgctcg     18240
     ggcagcaccg ccgaccggtg cgtggcggcc tcgcgccccg cgcgcaccgc cccggacagc     18300
     cacccggagg ccagcgggct ccacaccagc acgccgagcc cgtactgctc ggtcaccggc     18360
     agcacgtggc tctcgatccc gcgctgcagg agggagtagc tgggctgctc ggtgacgtag     18420
     cggctcagcc ggtgctcgcg ggcggcccac tgggcctcga cgatgcggta ggccgggaag     18480
     gtggaggacc cgaagtaccg gatcttcccg gcgcgctgca gatcggtgag cgcggacagc     18540
     gtctcctcgt cgctcgtggc cgggtcccac cggtggatct ggtagaggtc gacgtggtcg     18600
     acgccgaggc ggcgcaggct gttgtccagc gcggtgacca gccagcggcg cgaggagccc     18660
     tggtggttgg gctcgtcgct catcggcatg ttcgccttcg tggccagcac gatgtcgtcg     18720
     cgacgcccgg cgatcgcctt gccgaccatc tcctccgact cgccgcggcc gtacatgtcg     18780
     gcggtgtcga tgaggttgat cccgccctcc agggcggcgt cgacgatggc ggtggcctcg     18840
     tcctgggtgg tacgcccgat gctgccgaag ttcatggcgc cgagcgcgag cgagctgacc     18900
     tgcacaccgg tgcggcccaa ggtgcggtac tgcatgacgg ttcctccagc gggggcatga     18960
     cttggtggcg ggctcggtgc tctggcatca tgaggacacc aagcggaacg ccgtcccgtt     19020
     tactcgcccc acaatacgga acggtgtccc gtttatcaat cggtgaaggg aacggcacgg     19080
     tgaaggacgg cgaagcggca acgggacagg cggcctcccg gcccaagcgc gcggacgccc     19140
     ggcgcaacga gaagaacctg ctcgacgccg ccgccgcggt gttcgtcaga tcgggcgtgg     19200
     aggcccccgt gcgcgacatc gcggccgagg ccggggtcgg cacggccacg atctaccgtc     19260
     acttcccgac ccgggcggac ctcatcatcg gcgtctaccg gcaccaggtg gaggcctgtg     19320
     ccgaggccgg tcccgccctg ctggcgagca gcccgacccc gtacgcggcg ctcgcgggct     19380
     ggatcgacct gttcgtcgac ttcctggtca ccaagcacgg cctcgccgcg gtcctccagt     19440
     ccgacagcgc cggcttcgag accctccacg cgtacttcct cgaccgcctc gtccccgtct     19500
     gcaccgacct cctcgccgcc gccaccgact ccggcgagat cgacactgac gtaccgcccc     19560
     tggcgctcat gcgcggtgtc ggcaacctct gcatcggcgc ggagaccccc aacccgagtt     19620
     acgacgcccg gcaactggtg cgcatcctga tcgcggggct gcgcgcggcg gactgatccc     19680
     cgcccggccg tgaagggcgg cgagtggatg tgcgcggcag ccattgctgg ataaattccc     19740
     ggcgctgacg gaactggggc aactccgggt ctccgacggc cgcccgcacg agaccgccct     19800
     ggtcctcggc tccttccgcc gcaggtccaa cggcgactgg gacttcgtcg tgggcggcaa     19860
     gggctactcg ggcggcctgg aggagctgct gcgcgacttc ggcgtcgagg tggactgacg     19920
     cgtccacggc ggcagcaccg tcacggccgc aggttgctca gcagttcctc cgcggcggga     19980
     tacggctgct cccggggcag caggcgccgc gccgcgtcga ggtcgccgtc ccggacgagg     20040
     ccgtggatct cgtgggcgag tggagtcacg tcgcggatgg cgaccgtcca ctcgtcggcg     20100
     taccggcgcg cggcctcgcc ggccaggccg agctgcaggg agcggtaggg caggggctgg     20160
     aggcgcaggt cgcgttcggg gtcccactgg acgcgggtgg gcgagcgctt cacctcgcgc     20220
     tgccaggtgg cccggtcggg gtggacgccg ggctggtagc tcgacaggca cgcgtggcgc     20280
     agggcccact cgaagccctc gcggccgatc tccacggcca gaacggtctc ctgccccgcc     20340
     ttggcggccc acccgcagcg gtacatcatc cacaggaacg acggcttgat ccatgtcatc     20400
     ctgtcccgct tccaggcggc ggggaagcgt ccttcgcgga tggccgggag gccgatctcc     20460
     ggggagtacg cctggtagac ggtgacggtg gacgcggtgt ggacggcccg gacctcgcgc     20520
     tggggctgct gcatggcgta cagcgtgggg ccggtccgcc ccgcccggcc agtggttttt     20580
     gtcgccgtgc cggtcggggg cgagggcggc cgtcctcggt gttctcggtg tcctcgtcgt     20640
     cgtacctggt cgtacgaggt cgtactagac gaagccgttg agtccccacc actccccgtg     20700
     ggtgggtacg ccggacgtca gaaaaccgtt gccgcggccc cggtaggtga ccagccagcc     20760
     caggttgccc gggtagccgt ccagtacgta cttctcgttg gtcacggtgg ccaggtccgg     20820
     cacgccgtcg ccggagaagt cgccgaccgg gaggaagtgc gccatcgcgt tccagccgcc     20880
     ggtcccgacg agcgtgcggg aaccgagggt gcccgtcgag gtgcccgggt agagccacag     20940
     cttgccggtg gacgcctcgc gtgcgtagag gtcgggccgg ccgtcgccgg tcacgtcgcc     21000
     catgccgatc agcgcgttca tggcgttcca gccgctcttg ccgatcagct tgcgggcgcc     21060
     gagggtgccg gtggaggtgc ccgggtagag ccagagcctg gccgtggcct tctcgaccgc     21120
     gatcaggtcg gagcggccgt caccggtcag gtcaccgaaa gcggtgaccc ggttcatggc     21180
     gttccagcca ctcttgccga tcagcttgcg ggaaccgagg gaaccggttc cggtgccggg     21240
     gtagagccag agcttgccgg tcgaggcctc gcgggcgatc aggtcctcgc gcccgtcgcg     21300
     gctgaagtca ccgtgccggg tgagggcgct catggcgttc cagccgccgg tgccgatcag     21360
     ccggccggtg gtgtcgcccg gggagaacca gagccgtccg gcctcgtcgc gggtgacgac     21420
     gtcggccctg cggtcaccgt tcaggtcacc gaagcccagg gccttcggtg aggtctcgga     21480
     ggaccagctg ggataggcgg gctgactgca ctcgcgctcg gtgcggacga acttgaccga     21540
     gctggtggtc gcgaccgggt ccccgttgta ttcgccgggc gagttcggct cctgggccca     21600
     gtaaccgccc cacggcgtgt agttcttgtc ctcgtagacg caggcgacac tcgtcgtgcg     21660
     gttgacgtac gagcggatct tgttgtccca gccgcccagg tccgcgacgc tcttgttcgt     21720
     cttccacatc gagccgttgg cgctctcgcc cgtccagccg cagaagtagc ccgacggaca     21780
     gtcgtacgag ccggccgccg ccggagcggt gcccacggtg gccaggcccg caccggcgag     21840
     cgcgaggccc acgaacgagg ccaagccatg cttgagatgg atcttcacag gttgtactcc     21900
     cctccccttg ccatgatcat atggccggtc ggacgggtgc ggaatcgtcg ggagccctcc     21960
     cgtgttgagg ggggtgggcg accgagccga gagattttgg agggccgcaa tggctgcgca     22020
     gacacagagg gccgtgctgg cgggcggatg cttctggggg atggaggagc tgatccgtcg     22080
     gcttccgggc gtgaccgcga cccgggtcgg atacaccggc ggtgacgtgc cgaacgcgac     22140
     gtaccggaac cacggcacgc acgcggaggc catcgagatc ctcttcgatc ccgaggcgac     22200
     cgactaccgc gcactcctgg agttcttctt ccagatccac gacccgagca ccaagaaccg     22260
     ccagggcaac gacatcggcc tcagctaccg ctcggcgatc tactacgtgg acgacgagca     22320
     gaagcggatc gccgaggaca cgatcgccga cgtggacgcc tccggactgt ggcccggcaa     22380
     ggtcgtcacc gaggtggagc cggtcggccc cttctgggag gcggagccgg agcaccagga     22440
     ctacctgcag cgctacccgg acgggtacac ctgccacttc ccgcgcccgg gctggcggct     22500
     gcccgcccgc agcggcagcg agggctgagc gtccggggct gagggcgacg aggccgacag     22560
     gacgcggtct ggccggtgac ggccggaccg cgtcgtcgtg agcgcgcccg gcgctcagcg     22620
     cggcagcgtg ctcagtgcgg cagcgtggcc gggctgccgc cgttcgcctc gtatcccgcc     22680
     accgcgagcg cgcggtacac cgcgaactcc gccgccgggt cggtggacag cgtccagggc     22740
     agggcgccca cgtggccgtc tatgaccgtc agctggttca tggcctcggc ccagcgctcg     22800
     ccgcgtacca ggaagaacac cagaaggtgg cggacgtgcg cctgcatggg gtcgtccggg     22860
     cgggccgagt ggaccgcgtg cagggcgccg tggacggcct tggtgacgac ctcgctctgg     22920
     tagaaaccgc tgaccaggtt gacctcgggc aggtgctcga agaccgcgaa gagcggcatc     22980
     gccgcgagca acgagccccg cggggcgcgg gcggccgccg cctccgcgaa ggagtacgcc     23040
     agctgccgcg agccgtgcca cttctcgcac cagtactgca acgcggccag gtgcgcgccc     23100
     atgtggttgg gggcgcggtc caggatcttc agccagagct gctcgaactc ctcgcgcgag     23160
     tacccgaggc cgcgggccac cgacagctcg acgatgtacg ggaccgggtc cccgggtgcg     23220
     aggagggccg cctcgccgca ggccgccctg gcctcctcca tgatgatccg gaagtcgtcc     23280
     gagcccggcg tcgacgtccg ccacgcctgc tgcaccagga actcggcgtg caccgccgcg     23340
     ccgcccgcgt ccttgggcgc ctcggcccgc cacacccgca gccactgccc gcccggcgtc     23400
     tccccgacac cgccgggccg ctgccgcagc tccagcgacg cggctcccgc gaaggcctgc     23460
     acgcgctgcc agcgccgctc gccctccgcc tccgtcccgg cgaggagctg catcgccccc     23520
     cggtagtcct gggtgcgctg caccaggtcc aggacgtcga gcaggtcctg gtcggggccc     23580
     ggcatccgga tgtccagctc ctcctcgcgg gcgaagccgt agttcgcggg gtcggcggcg     23640
     tccgggtggc cgggctcgac caggccgacc gcgccgcgcc ggcgccgcga gacttggagc     23700
     agcacgaagc cgagcatgac cagtgccatc aggacccaga gaatctccat gtctcaagcg     23760
     aaccagacgc cgccgacaat tggccaaccc gtcccccgcc ctgtggaaaa cccgcgaggc     23820
     gttccgcacg gctaccctcg gtgcccatga gcgacaggca catcagtcag cacttcgaga     23880
     cgctcgcgat ccacgcgggc aacaccgccg atcccctgac gggcgcggtc gtcccgccga     23940
     tctatcaggt gtcgacctac aagcaggacg gcgtcggcgg attgcgcggc ggctacgagt     24000
     acagccgcag cgccaacccg acccgtaccg cgctggagga gaacctcgcc gccctggagg     24060
     gcggccgccg cggcctcgcg ttcgcgtccg gactggcggc cgaggactgc ctgttgcgta     24120
     cgctgctgcg ccccggcgac cacgtggtga tcccgaacga cgcgtacggc ggcaccttcc     24180
     gcctcttcgc caaggtcgcc acccggtggg gtgtggagtg gtccgtggcc gacacgagcg     24240
     acgccgccgc cgtgcgggcc gccctcaccc cgaagaccaa ggcggtgtgg gtggagacgc     24300
     cctccaaccc gctgctcggc atcaccgaca tcgcgcaggt cgcccaggtc gcccgggacg     24360
     ccggcgcccg gctcgtcgtc gacaacacct tcgccacccc gtacctccag cagccgctgg     24420
     ccctcggcgc cgacgtcgtc gtgcactcgc tgaccaagta catgggcggg cactcggacg     24480
     tcgtgggcgg cgcgctgatc gtgggcgacc aggagctggg cgaggagctg gcgttccacc     24540
     agaacgcgat gggcgcggtc gccggaccct tcgactcctg gctggtgctg cgcggcacca     24600
     agaccctcgc cgtgcgcatg gaccggcaca gcgagaacgc gaccaaggtc gccgacatgc     24660
     tctcccggca cgcgcgcgtg acgagcgtgc tgtacccggg gctgcccgag cacccggggc     24720
     acgaggtcgc cgccaagcag atgaaggcgt tcggcggcat ggtgtcgttc cgcgtcgagg     24780
     gcggcgagca ggccgccgtc gaggtgtgca accgcgcgaa ggtcttcacg ctcggcgagt     24840
     ccctcggcgg cgtcgagtcg ctgatcgagc acccgggccg gatgacgcac gcctccgcgg     24900
     cgggctcggc cctggaggtg cccgccgacc tggtgcggct gtcggtcggc atcgagaacg     24960
     ccgacgacct gctggccgac ctccagcagg cgctgggcta ggaaagcggg ctcaccagcc     25020
     ctcccagccg gtcacgggtg gggtcgtctc cgagggcggc tccacccagg gctgcacggt     25080
     cagcgcccac accgtgaacg ccacggccgc ggcgcccagc agcagccaca tcaggcgccg     25140
     ggcggcggtc ctgcgccgca gcatgcggcc gccccggcgg acggcctccg cgtagaggtc     25200
     ggccggcacg cgcgggggcg actgctccat gatccgccgt gcggcggcct cgcgccgggg     25260
     gcggttcacc cgcgcctccc cgggtgcgac gcgcgcgtgc cggtcgtcgg gtccgtcatg     25320
     gcgtcgccgc cctcgcgtcc gccgtcaccg ggcgggcggg tgacggcggc gggcgcagca     25380
     gagcggcggt cgcccggtcg cagatcgtcc gtacccgctc cacgggcagg cccagcagcg     25440
     cggccgtctg ctcctcggcg acgccctcgt acagcctcag caccaggagc aggcgttcct     25500
     gcggggcgag cccgcccagg ggtccggcgg ggtgccggcg ggtccggccg agagcgccgt     25560
     accggtgcca ggccgcacgg gcgaagcggg tggccaggtg ctggcgggcg cggtcgtacg     25620
     ggtcctcccc gtgcagacgg tcccagtccg cgtacgtgtg ggccaggctc agggccagca     25680
     ggcgccgcgc gcgcgggttg gcgtccgggg cctcggcggt gagcagcgtg gcggcgtgca     25740
     gaagccgccc ggccgcgccc gcgacgaacg cctcgaactc gcgggcccgg cgggcattcc     25800
     gggacgcatg ccgttctcgc accgcgcctc ccgcccagac ggcgacgacc cctgaggtct     25860
     catatcaggc caggggcggg ccgccggtca agggttcggt gcgaaccccg ttccggaaag     25920
     cccgggaaag ccagggaaag ccggggaaag cccgggaaag ctctgaaaag cccgggaagg     25980
     ctccggaaat gcgggaaggg tcgttcagga gcccgagggg gcgtccgtgg gcgacacgcc     26040
     ggaaggggcc atacgggcgg acagggctcc gttgaagcgc gcgaggagcg cacagaacgt     26100
     ctcgcgctcc tgcggcgccc agtcgtgggt cagctcggcc atgagctgac gccgggagga     26160
     gcggacctcc tccagccgcg ccacgccgcg cggcgacagc tggaggacca ccgcgcgtcc     26220
     gtcctcgggg tgcgaggtcc gcttgacgag tccggtgtcg acgagcgggg ccacctgccg     26280
     ggtgaccgtc gaggagtcga tccccatgct ggcggcgagc gccttcacgc ccatcgggcc     26340
     ttctttgtcg aggcggttga gcagcaggta ggcggcgcgg tccatggagt tgcgcacctg     26400
     gccgaccccg ccgagccggg tctgttcggc acgtcgggcg aagagcgcga cctcgtgctg     26460
     gagcgtctcg agaagaccgg tgtcaccggc ggtcgtcatg tccatcgaca tttcaggtgt     26520
     tgtgggcatg gccgggggct cacttcgtgg agggctgcta attgggggac agggtacgcg     26580
     gccgggcggc agggcgtacc ggcgctgggc aaagcgggtc tcggaggttg gtcacaacgg     26640
     cgcacggcgt ccgtgaactg cgatgctgga gctatgagct acagcacagc gtcctgcgtc     26700
     gctcccgtca ccctcgacga cgtgcgcgga gcccagaaga tgctctcggg cgtggcgcgg     26760
     gtgacggcca tggagggcag caggcacctc tcccagctgg tcggctcgcc ggtgcacctc     26820
     aagtgcgaga acctccagcg gacgggctcg ttcaagctgc gcggcgccta cgtgcggatc     26880
     gccgggctgc tccccgagca gcgggccgcg ggcgtggtcg cggcgagcgc gggcaaccac     26940
     gcgcagggcg tcgcgctggc ctcgtcgctg ctcggtgtgc gctcgacggt gttcatgccg     27000
     cagggggcgc cgctgcccaa gatcagcgcg acccgggact acggcgccga ggtgcggctg     27060
     cacggccagg tggtggacga gacgctggcc gccgcgcagg agtacgcgga gcggaccggc     27120
     gcggtcttca tccacccctt cgaccacccc gacgtcatcg cgggccaggg cacggtcggg     27180
     ctggagatcc tggagcagtg ccccgaggtg cggaccgtcg tcgtcggcat cggcgggggc     27240
     ggactggcgg ccgggatcgc ggtcgcggtg aaggcgctgc ggccggacgt gcggatcgtc     27300
     ggcgtgcagg cggagggcgc ggccgcctac ccgccctcgc tggccgccgg acgcccggtc     27360
     gccgtgcaga acccggcgac gatggccgac gggatcaagg tggggcggcc cggcgacgtg     27420
     ccgttcggga tcgtcggcga actggtggac gaggtccgca cggtctccga ggacgcgctg     27480
     tcgaccgcgc tgctgctgtg tctggagcgg gccaagctgg tcgtggagcc ggccggagcg     27540
     agcccggtgg cggcgctgct gagcgagccg gacgccttcg agggaccggt cgtcgcggtc     27600
     ctgtccggcg gcaacgtgga cccggtgctg atgcagggtg tgctgcggca cggcatggcc     27660
     gcgcagggcc gctacctggc ggtccggctg cggctgacgg accggcccgg cgccctggcc     27720
     acgctgctcg gggtgttgtc agtggtcgac gctaacgtcc tcgatgtgag ccacgtccga     27780
     acccatccgc ggctcgggct cacggaggcg gaggtcgagc tgcacctgga gacgaagggc     27840
     ccggagcact gcaccgaggt cggccgcgtg ctgcgggaag cgggatacac ggtcatcgcc     27900
     tgagtccggg cggggcaccg gcggccactt cgtcactcgt tcgagcaact gcattgtgag     27960
     acgcgataca tcgcgttatg gtgtgtcgta aatcgctcgc tgagcgcggc gaaacgtaca     28020
     aacctaggct ttccgaagaa tccccgacga cgtggagact cacatgccag gcgccatcta     28080
     tgccgaaggc ctggtgaaga ccttcggtga cgtaagggct ctcgacggcg tcgacctcga     28140
     cgttcccgag ggcacggtcc tgggcctgct cgggccgaac ggcgcgggca agaccaccgc     28200
     cgtccgctgc ctcacgaccc tgctgcgccc cgacagcggc aaggcggtcg tcgcgggcat     28260
     cgacgtcctc aggcagccca acgaggtacg ccgctccatc ggcctctccg gccagttcgc     28320
     cgcggtcgac gagtacctga cgggccgcga gaacctgcac atggtcggcc agctctacca     28380
     gatgaagggc aaggcggcga aggcgcgggc cgccgagctg ctcgaccagt tccacctctc     28440
     ggacgccgcc gaccgcccca ccaagacgta ctcgggaggc atgcgccgcc ggctcgacct     28500
     ggcggccgcc ctggtcgtct ccccgcccgt catgttcatg gacgaaccca cgaccggcct     28560
     ggacccccgc aaccggcagg agctgtggga ggtcatcaag cagctggtcg cgggcggtac     28620
     gaccctcctg ctcaccaccc agtacctgga agaggccgac cacctcgcgc acgacatcgc     28680
     ggtcgtcgac cacggccgcg tcatcgcccg gggcacctcc gaccagctca aggcccgcac     28740
     cgggggagag cgcgtcgagg tcgtggtcca cgaccgcggc cgcatggcga cggcctccga     28800
     cgtgctcgcc ggattcggca agggctcgac cacggtcgag gagcacaccc gcaagctgac     28860
     cgtgcccgtc acgggcggcg cgaagctgct cgccgaggtc atccgcgaac tcgacgtccg     28920
     cggtatcgag atcgacgaca tcggcctgcg ccgccccacc ctcgacgacg tcttcctctc     28980
     cctcaccggc cacgtggccg aggcggcgga cgagacgaac ggctcggcgg acgacgccga     29040
     ccacgagcag gagaaggaga ccgccaagtg agtgccgcca ccgacgccgc gccggtcacg     29100
     gcgtccgcca accccatcgg ccagtccgtc cgtgactcgc tggtcatcgc ccgccgaaac     29160
     ctgatccgga tgacccggat cccggagatg gtcctgttcg ggatcatcca gccggtgatg     29220
     ttcgtcatcc tgttcacgta cgtcttcggc ggttccatca aggtcggcag caccaccgac     29280
     tcggacgtct acaaggactt cctgatggcg ggcatcttcg cgcagaccgt caccttcgcc     29340
     accgccggat cggcggccgg tatcgccgac gacatgcaga aggggctcgt cgatcgcttc     29400
     cggtccctgc cgatggcgcg aggcgcggtg ctgaccgggc ggacggtcgc ggacctggtg     29460
     cagacgtcga tcaccctgct cgtcctggcg atcgtcgcgc tgctcgtggg ctggcgcacc     29520
     ggatcggcgg agccgaccaa catcgggagg gtgctcgcgg gcttcgggct gcttctgctc     29580
     ctggggtacg ccttcacgtg gatcggcgcc ctgatcggcc tgtccgtacg gacgccggag     29640
     gcggcgacct ccggagggat catctggctg ttccccgtca ccttcgtgtc caacgccttc     29700
     gtcgacccca cccagatgac gccgtggctc cgccatgtcg ccgagtggaa cccgttcagc     29760
     gcggtcgtcc aggcgtgccg cgagctgttc gggaacccgg gcgtcgtgca gtcggacgcc     29820
     tggcccatgc agcacccggt ctgggcgacg cttacctact cgatcgtgat cgtcctgatc     29880
     ttcaggacac tggcagtgcg caagtaccgc agagcggccg gctgacggcg aggccgagag     29940
     gcacgaccga tcggcaaggc ggcaggacgc cgacgagccc ccggcgtcac ggggacaccg     30000
     ggggctcgtc ggcgatgggc gacgggtcag ccgttgtacg gctcggcctt gaggatcctc     30060
     accgaggcag gcttgccgtt gggcagctcg tactgcgcgt cgtcgccgac cttgtggccg     30120
     aggacgcccg agccgagcgg ggactgcgga gagtacgtct cgatgtccga gctcgcgtac     30180
     tcgcgcgaag cgagcaggaa ggtcagcgtg tcgtcctcgt cgccgtcgaa ggcgatggtg     30240
     acgaccatgc cgggcgccac gacgccgtcg gcagccgggg cctcgcccac cttggcgctc     30300
     tcgagcagct gggtcagctg gcgcacgcgg agctcctgct tgccctgctc ctccttcgcc     30360
     gcgtggtacc cgccgttctc ccgcaggtcc ccctcctcac gagccgcggc gatcttggca     30420
     gagatctcgg tgcgcgcagg accagtaagg tattcaagct cctccttgag cttgttgtac     30480
     gcctcctggg tcagccaggt gacgttctcg ctggtctggg tcacgggtgc tcctcgttgg     30540
     tactgggaat acaaatcaac gccctaccca gaaggatgtt ccttcacgga agggcgaaac     30600
     cacgagccta acaattcagt ggccaaaggg ggaggacata agccaccaga ttcctgtcat     30660
     cgcaggtcag gtggcaggta ttggcgccag tggggctcgc cgcatcactc cggatggcag     30720
     ccgagcagct cggccgtcgt cccggcggcc ttggtccgca gcgtgacgac cttgtcgatg     30780
     cgggtgtcgt ccccgtcgaa gcggaagtcg gcccggccca cctcgtcgcc gtcctccgcc     30840
     tgggagcgca ccgtgcagta gccggtgacg ccggcgtcct tgcggacctc caggtgcacc     30900
     tgcaccgagt cctcggcgag ttcgaagccg atcagctcgc cgctgatctt gttctggccg     30960
     acgtagtggt agccgaacca gccgatcagt gcgagcagga gcgcgccgag cacggcgccg     31020
     acgatcttga gcgtgcggtc ggcctgctcg tccgaggagc ggccgtagcg gccctgcgga     31080
     gtccgcgtgc tcgccgtact catgatcgtc ctctccgcgg tagcgggtcc gggttctcgg     31140
     gccccggaat tattccgctc ccgattcggt cactatagaa gcctgcgatt gcgccgctgc     31200
     acgccggggc gccgactgac cgaggattga gtcttgactg accagctgcg actgatggcc     31260
     gttcacgccc accccgacga cgagtcgagc aagggcgcgg ccaccatggc gaagtacgtg     31320
     tccgaggggg tggacgtgct ggtggtgacc tgcacgggcg gggagcgcgg ctccatcctc     31380
     aacccgaagc tccaggggga cgcgtacatc gaggagaaca tccacgaggt gcgccggaag     31440
     gagatggacg aggcccggga gatcctgggc gtggggcagg agtggctcgg cttcgtcgac     31500
     tccgggctgc ccgagggcga cccgctgccg ccgctgccgg agggctgctt cgccctggag     31560
     gacgtcgaca aggcggccgg cgagctggtg cggaagatcc gctccttccg gccccaggtg     31620
     atcaccacct acgacgagaa cggcggctac ccgcaccccg accacatcat gacccacaag     31680
     atcacgatgg tggcgttcga gggcgcggcg gacaccgaga agtacccgga gagcgagtac     31740
     ggaacggcgt accagccgct gaaggtctac tacaaccagg gcttcaaccg gccccgcacc     31800
     gaggcgctgc accacgcgct gctggaccgc ggcctggagt cgccctacga ggactggctc     31860
     aagcgctggt cggagttcga gcgcaaggag cgcaccctca ccacgcacgt gccctgcgcg     31920
     gacttcttcg agatccgcga caaggcgctg atcgcgcacg ccacgcagat cgaccccgag     31980
     gggggctggt tccgggtgcc gatggagatc cagaaggagg tctggccgac cgaggagtac     32040
     gagctggcca agtccctcgt ggaaacctcc ctccccgagg acgacctctt cgcgggcatc     32100
     cgggacaatg cctgacatga gtgcaagcgc aagcctggca atgacgcacc tcgtcaccct     32160
     cgccgagctc gacgaggaca aggtcacccc cggtgtcctc ggcttcatcg tgttcgcggt     32220
     gatggccctg gcggtgtggg gtctgatgaa gtccatgaac cggcacatgg gcaaggtgga     32280
     cttcaaggag ccggcggagc aggacgcctc cgccggcccc gaggcgaagc cccagcgggg     32340
     ctgaccccgg tcggccgccc cgaggcgggc ggccccggcc tcacgccgtg accgccacgc     32400
     ccatcacctc ccgcgcctgg cggcccggga ccatgcccag gcgccaggcc tgccagcccg     32460
     cctccagctg cacgccgcgc tccagcagga gctggtaggc gtccacgtag tcgtccagct     32520
     tggtgtcgcg ggcgggatgg cgggcgcggg acagctgggt cagctcctcc tgcgccaccg     32580
     ccgtgccgat ctccaccccg ccgggggcgg cgtagggcag cagcgtgcag cgcaggaagc     32640
     gggcccagtc ctcgccgcgc cggtcgccgt acccggcgaa cagtgcggcg gcctcgtcgc     32700
     acagggccag cgcctgcggc gtacgcgcgt tgcccgcgtc cacgaccgcc agctccaggc     32760
     aggtccacgc ctcgccgtgc ccgacgccga tgcgctggaa gtcggcgcgc gcgtcgacca     32820
     ggagctggcg ggcgaagccc gagttgcgca gggatccggt ctgggcggcg cgctggtccc     32880
     gggtgacccg cgccgagtgg tgccgggcgc aggccaggcc gtacacgtcc cgcatccggg     32940
     agaacatcgt gcgggagcgt tccagtgcgc gcaccgactg gtccagggcg cccgtctcct     33000
     ccagtgcctg gccgaggtag tagatgctcc acgccttgcc gcgcgcgtct gcgttctccc     33060
     ggtgccgggt ctccgcccgt cgcagcccct ccaccgccgc ggacacgtcc ccgtccacca     33120
     gccgggcccg cgccagctgg gtcagcgccc aggcctcgcc gcgggcgtcc tgggtgcggc     33180
     cgtacaggtc cagggcgacc cgcagatccg actccgcgcc cggcacgtcg cccatccgca     33240
     ggtgcagctg gccgagctgg aagtgggccc acgcctgccc gtgcaccgac tcgcccgcgc     33300
     ggtgcagcac cagcgactcg gtgagcagct ccagggcctc ggccagccgg gcccggtcgc     33360
     gctgcaccgc cgccagcgcg tgcagcgtcc aggcccggtc cgtggccagc tccggcgcgg     33420
     cctggaggcc cagtgcctcc tggagcttgg ccgccgcgtc ggtcagattg ccctggtggt     33480
     gcagcgtgat ccccagcgag cacagcgccc gcgccgcacc ggcgtcgtgg tgggcgtccc     33540
     ggtacaggtc gaccacggag gccagcgtcg tgcgcgcctt gtccagctcg cccagctgcc     33600
     gggccgcgat accggtgcgc cactgcaccg agcgcaccag cagcccctgg tccacggact     33660
     gcgccagctc gctgatctcg cccagccggt acaggtcgcc gcgcagcagg cagtagtcgc     33720
     acagcgcgcc cagcaggttc agcaccgtgc cctggtcgac gccctccgcg tgcctgagcg     33780
     tcgccgtgat gaagctcgac tcgtcgtcca gccagcgcag cgcctcgtcc agggacgtga     33840
     agccgtactg cccgaactgg ttggagcggg tcgacatgtt gccgtcgacc aggcgcagta     33900
     cggagtcggc cagctcggcg tagttggcga tgagccgttc ctgcgcggcc gtccgctcgc     33960
     cgggctcctc ctcgtcggcg aggcgggcgc gggcgaaggc gcgcaccacg tcgtgcaggc     34020
     ggtagcggct gccccggacg tggtcgagca gtcccgcccg cgacagcgcc gcgagttgcc     34080
     ggttcgcctc cgtctcgtcc gtggccagca gcgcggccgc ggccgcggca cccagcgagg     34140
     tgcgtcccgc cagcgccagc cggcgcagca gccgccgggc cggctccgac tggtcggtgt     34200
     agcgcagcca cagtgcccgc tcgaccggct ccaccgggcc gtaggcggcc aggtcggtcg     34260
     ccagcgcgcg cggcgagcgc gggcccagcg acgacccggc gacccgcagc gccagcggca     34320
     gcccgccgca cagctgccgg atctgctcgc tcgactcggc gtcgtacggg cccgacgcgt     34380
     cctcggcggc ggcgcccagc agctcctccg cgcccgccgc gtccagcgcc tccacgggca     34440
     ggtcgtacac ccgggcgggc aggtcgggcg ggagccgcag cgcctggcgg gcggtgacca     34500
     gcaccaggct gtccgaccgc tccggcacca gcgtgcacac ctgctcggga tccgaggcgt     34560
     cgtcgagcac gacggtgacc gggacacccg tcagatgctg gtggtacagc tcgctgagcc     34620
     gcttgacctg ctggtccgcg gaggagcgct cccggaacag cagctgctcg cgcggcgccc     34680
     cgagccggtt cagcaggtgc agcagggcgt cccgggtgct cagcggcgac tccccgccct     34740
     ccacggagcc ggccggtccc ggtccgccgg acccgccgcc gcccgccgtg gagccgcccg     34800
     ccgccgaccc ggccccgcgc aggtcgacca ggcaggcccc gcggaagtag tcccgcagct     34860
     cgtggacggc ccggaccgcg agcgtcgtac ggccgctgcc gggcgccccg tgcagcacca     34920
     ccaccgtcgg tttggtctcc gtgctcgcgc gggccgcctg cacccactgc cgcagccgcg     34980
     ccatctccgc ccgccggccc gcgaacgcgt cccccggttc gggcagttgc ccgaacgact     35040
     gctccagcgc gctgcgtccc cgggcggccg cgctcttgtc cgcgccccgc agcttcggcc     35100
     cggtcttggc cggtccggtg gacgcggcga gcatccgctg ctggtccagg aacggccgga     35160
     tgccgcgcac ctccagcgcg gtgagccact gcagccgcaa ctgctcgggc ccgccgggct     35220
     ggctgaccgc cccggcccgg tggtgggcgg ccggcacatg ggccccgacc accttcacca     35280
     cggtcgccgc cgcgccgacg accccgaccg tcacgcccgc gcccaccgcg gtgccggtgc     35340
     cggtgcccag cgccacgtcg gccaccgccg cggcgaccgc cgccacggcg gccaccagca     35400
     ggggcgtgcc ggcgccctca cgggcgtagc gctggcggaa ggtgagctgc ccggccgccg     35460
     cctcgtcgag ggcgtgcgtg taggccgagt actcctcgcc ggccgtgccc gccatcgcgt     35520
     ccagcgccgc tcgagcccgg gagagcagta cgttcccgtc cgtgcgtccg cccgaacgcc     35580
     gtacctcctc ctccacggcc cgcctgagca gcccttcggc ctccgcccga tgactgtccc     35640
     gcatgtcgcg ccccctccgg cggcatcggt gtcctgccgg gtcgccccgg gcgcccccgt     35700
     ggccccaagc gtcccagggg cctttccggc ccatccccgg gtccttcccc ggttgtgcgc     35760
     gggtcaagtg tcctgcgacg aggagaccct ggggaggggg gtccgcaccg gccgggaaaa     35820
     tcgacgaatt ccgctcttga ccccggtgac cgcagccact aatttgcgag ggaagcagac     35880
     ccatgactac cgacaggagg cgaccggcag atgtgcacca actctgacct gagtcgcctc     35940
     gcccgccgca ccgtgtgggt ttcgggccgg gtcgcgcacg gctgctgaca cgccgttccg     36000
     ctgtgccccc gtgtggcaca ttccgggttt ctccttcact ttcaccactt cacggcatgc     36060
     ccttgtcgcg tgccgatgtg cgctcgcctc tccagcgcgg cgcgtccgga catagaaagc     36120
     tgcctgaaat tggcgaacac gatgaataca cctgccccga atcgccctgc cccgattcga     36180
     attgaaggtc tgacatggtg accgcacgga tcacggtcaa cggaaaagaa tcgcccatcg     36240
     caccggccgc cccgcacacc acggtgctcg acttcctgcg cgagcgcggc ctcaccggca     36300
     ccaaggaggg ctgcgcggag ggcgagtgcg gcgcctgttc ggtcctggtg gcgcgcccgg     36360
     gggtgaacaa gcccaccgac tgggtgccgg tcaacgcctg cctggtgccg gtcgcggcgc     36420
     tcgacgggca ggaagtcgtc acctccgagg gcctcgccac cgtcgaggcg cccggcacgc     36480
     cgcccgtcct gcacccggtg caggaggaga tggcggtccg cggcggctcc cagtgcggtt     36540
     actgcacccc ggggttcgtc tgcagcatgg cggccgagta ctaccgtccc gaccgctgcg     36600
     cgcacgccga cccgggcccg gacgcgaccg ccgccgccga cggcgccgaa ggcggcgacg     36660
     ccgagcacgg tccgaacggc ttcgacctgc acgcgctcag cggcaacctg tgccgctgca     36720
     ccggctaccg gccgatccgc gacgcagcct tcgccgtcgg cacgcccacc gacgaggacc     36780
     cgctggcccg gcgccgcgag caggacccgc ccgcaccggt cgccaccgaa taccgccagg     36840
     acgacagcgc cttcctgcgc cggagcaccc tggccgagac cctgcggctg ctgcgcgagc     36900
     ggccccaggc ggtggtggtc gcgggcagta ccgactgggg cgtcgaggtc aacatccgct     36960
     cccggcgggc ggattgcgtg gtcgccgtcg accggctgcc cgaactgcgc gatctgcggg     37020
     tcgagtccga ccacgtcgag atcggggccg cgctcacgct caccgagatc gaacgccgcc     37080
     tggacggcag cgttccgctg ctggcgcagc tgttcccgca gttcgcgtcc cggctcatcc     37140
     gcaacggcgc gaccctcggc ggcaacctgg gcaccggctc gcccatcggc gacagcccgc     37200
     cggtgctgct cgcgctggag gcgtcgctgg tgctcgccga cgccgacggg gagcgcgagg     37260
     tcccgctggc cgactacttc accggctacc ggcagagcgt gcgccgtccc ggcgagctga     37320
     tccgcgccgt acgcgtgccg ctgccgctgt ctccggtcac ggccttccac aagatcgcca     37380
     agcggcgctt cgacgacatc tccagcctgg cggtcgcctt cgcgctcgac gtcgagggcg     37440
     gcaccgtccg caaggcccgc atcgggctcg gcggcgtggc cgccaccccg gtccgcgcgc     37500
     tcgccaccga ggccgccctg gagggccggc cctggaccac cgggaccgcc gaggccgcgg     37560
     ccgaggtgct gcggggcgag ggcacgccga tgagcgacca ccgggccagc gcccgctacc     37620
     gggccgcgat gctcggccag agcctgctga agctgtacgc acagaccacc gaggcggtgc     37680
     cgtcatgagc cacctgtccg agcgtcccga gaagcccgtc gtcggcgtct ccatgccgca     37740
     cgagagcgcc gtccagcacg tcaccggcgc cgcgctgtac accgacgacc tggtccagcg     37800
     caccaaggac gtgctgcacg cctacccggt ccaggtgatg aaggcccgcg gccgcgtcac     37860
     cgctctgcgc accggggccg ccctcgcggt gccgggcgtg gtgcgggtgc tgaccggcgc     37920
     cgacgtgccc ggtgtgaacg acgccggcat gaagcacgac gagccgctct tccccgacga     37980
     ggtcatgttc cacggccacg cggtcgcctg ggtgctcggc gagacgctgg aggccgccag     38040
     gatcggcgcg gcggccgtgg aggtggacct ggaggaactg ccctcggtca tcacgctcca     38100
     ggacgccatc gcggcggaca gctaccacgg cgcccggccc gtcatgacgc acggcgacgt     38160
     cgacgcgggc ttcgccgact cggcgcacgt gttcaccggc gagttccagt tctccggcca     38220
     ggagcacttc tacctggaga cgcacgcggc cctcgcccag gtcgacgaga acgggcaggt     38280
     gttcatccag agcagcaccc agcacccgtc cgagacccag gagatcgtgt cccacgtgct     38340
     cggggtgccc gcccacgagg tgaccgtgca gtgcctgcgg atgggcggcg gcttcggcgg     38400
     caaggagatg cagccgcacg ggttcgcggc aatcgccgcg ctcggcgcca agctgaccgg     38460
     ccgcccggtg cggttccggc tcaaccgcac ccaggacctc accatgtccg gcaagcggca     38520
     cgggttccac gccacctgga agatcggctt cgacaccgag ggccgcatcc aggccctcga     38580
     cgccacgctc accgcggacg gcggctggag cctggacctg tccgagccgg tgctcgcccg     38640
     cgcgctgtgc cacatcgaca acacctactg gatccccaac gcccgtgtcg ccgggcgtat     38700
     cgccaggacc aacacggtct ccaacaccgc cttccgcggc ttcggcggac cgcagggcat     38760
     gctggtgatc gaggacatcc tgggccgctg cgcgccgcgg ctcggcgtgg acgccaagga     38820
     gctgcgggaa cgcaacttct accggccggg ccagggccag acgacaccgt acgggcagcc     38880
     ggtcacccag cccgagcgga tcgccgccgt ctggcagcag gtccaggaca acggccacat     38940
     cgccgaccgc gagcgcgaga tcgccgcctt caacgccgcg cacccgcaca ccaagcgggc     39000
     cctcgcggtc accggcgtga agttcggcat ctcgttcaac ctcaccgcct tcaaccaggg     39060
     cggcgcgctg gtgctgatct acaaggacgg ctccgtcctg atcaaccacg gcggcaccga     39120
     gatgggccag ggcctgcaca ccaagatgct ccaggtggcc gcgaccacgc tgggcatccc     39180
     gctgcacaag gtgcgcctcg ccccgacccg caccgacaag gtgcccaaca cctccgccac     39240
     tgccgccagt tccggcgcgg acctgaacgg cggggcggtg aagaacgcct gtgagcagct     39300
     gcgcgagcgg ctgctgcggg tggccgcctc gcagctcggc acgaacgcct ccgacgtacg     39360
     catcgtcgag ggcgtcgcac gcagcctggg cagcgatcag gagctggcct gggacgacct     39420
     ggtgcgcacc gcgtacttcc agcgggtcca gctctcggcg gccggttact accggaccga     39480
     ggggctgcac tgggacgcca agagcttccg cggctccccg ttcaagtact tcgccatcgg     39540
     cgccgccgcg accgaggtgg aggtggacgg cttcaccggc gcctaccgca tccggcgggt     39600
     ggacatcgtg cacgacgtcg gcgacagcct gtccccgctg atcgacatcg gccaggtcga     39660
     gggcgggttc gtgcagggcg cgggctggct gacgctggag gacctgcgct gggacaccgg     39720
     tgacggcccg aaccgcggcc gcctgctgac ccaggccgcc agcacctaca agctgccgag     39780
     cttctcggag atgcccgagg agttcaacgt caccctcctg gagaacgcca ccgaagaggg     39840
     ggcggtcttc gggtccaagg cggtgggcga gcccccgctg atgctggcct tctcggtgcg     39900
     cgaggcgctg cgccaggcgg ccgccgcgtt cgggccgagg gggacggccg tcgaactggc     39960
     ctcgcccgcc acgccggagg cggtgtactg ggcgatcgag tcggcccggc agggcggcac     40020
     cgccggggac ggccgcaccc acggcgcggc ggcctccgac gccgtcgcgg tccgcaccgg     40080
     cgtggaagcg ctgagcggtg cctgacatga cctggatcgc cgcggtcgcg cggttgcggg     40140
     cccgccggga gcccggcgtg ctggtgaccg tcgcgaccgt gcgcggccac gccccgcgtg     40200
     acgccggtgc caaactcgtc gtggggcgga ccgggacctg gggctcgatc ggtggcggca     40260
     acgtcgaggc agtcgccgtc gaccgggccc gggagatgat cgcggcggcc gcaccggaac     40320
     cggagatgct ggacttcgcc ctcaacgaca aggtgaccaa ccggcacggc gtgcagtgct     40380
     gcggcggcac cgtcgccgtg ctgctcgaac cgctgccggt ggtccgggcg gtggcggtct     40440
     tcggcgtcgg gcacgtcggt ctggaactgg cccggatcct ggcccgtcag gacatcgacc     40500
     tccacctggt cgacagccgc gccgagctcc tgaccgagga gcggctcggc gtgctgtcgg     40560
     acgccgtggc gcaggtgcac acgcaccaca cgccgctgct gccggaggag gtgctggccg     40620
     agctgccgcc cggcacccac gtcctgatca tgacccacga ccacgccgag gacgccgccc     40680
     tgtgcgacgc cgccctgcgc acggaccatc tggggtccat cggactgatc ggctcggcgg     40740
     ccaagtgggc gcgcttccgc aagcgcctcg ccggcgaggg cgaccacgac gacgccctca     40800
     tcgaccggat caagaccccg atcgggctgg ccgacatcac cggcaaggag cctgcgacca     40860
     tcgccgtgag cgtggcggcc gacctgctgc gcaccttcga ggcggacttc gaggcggacc     40920
     ggccctgacc cctccggggc cctcgcgggc ccttgtggga atctacgaag caccggtcgc     40980
     agcctgcccg tagttcatgt attcggcccc tggccgggtc tcgtcggcga gctgtgtact     41040
     gctcctacgc atcctccccg tgaagcgcac cggcccgcac gccgtactcc cgcacgctgc     41100
     ccgcccaaga aggagcacgc atgacgaccg acaccctcga aaccggcatc cgcgagttcg     41160
     agcgcgcctg gatggacaag gccatcgagc tggccaccac cagcgtccgc aacggcggcg     41220
     gccccttcgg cgccctgatc gccaagggcg gtgagatcgt cgccctcggc aacaaccagg     41280
     tgaccgccgg cctcgacccc accgcgcacg ccgaggtcag cgccatccgc gccgcctgca     41340
     aggcgctcga cacgttcagc ctggaaggct gcacgctcgt cacgtcctgc gagccctgcc     41400
     cgatgtgcct ctcctcggcc ctgtgggccc gggtcgaccg cctcgtcttc tccgccgacc     41460
     gccacgacgc cgccgtggcc ggcttcgacg accgcaagtt ctacgacctg ttcgagaagc     41520
     gcccgcaggc gaactggccc atgaccgtgg aacacctcga cctgccccac cgcacccagc     41580
     cgttcgacgc ctggatcgcc aagaccgacc gcgtcgacta ctgagcccaa gcctccccga     41640
     gactccggcc gccccacccg tacgcccctg cacccgtggc gtatgggcgg ggcggcggcg     41700
     cgtgcgcaag gatggaggca tgcccaaccg acttgcgcag gcgacgtccc cctacctcct     41760
     ccagcacgcg gagaacccgg tcgactggtg gccgtgggag gccgaggcgt tcgaagaagc     41820
     ccggcggcgc ggcgtccccg tcctgctgag cgtcggctac agcgcgtgtc actggtgcca     41880
     cgtcatggcg cacgagtcgt tcgaggacgg gcccaccgcc gagtacctca actcgcactt     41940
     cgtcagcgtc aaggtcgacc gcgaggagcg ccccgacgtc gacgccgtct acatggaggc     42000
     cgtgcaggcg gccaccggtc agggcggctg gcccatgacc gtgttcctca cgcccgacgc     42060
     ggagcccttc tacttcggca cctacttccc gcccgagccc cggcacggca tgccctcctt     42120
     ccgccaggtg ctccagggcg tccagcaggc ctgggcggaa cggcgcgacg aggtcgacga     42180
     ggtcgccggg aagatcgtgc gggacctcgc cggacgggag atctcctacg gcgacgccga     42240
     ggcgccgggc gaggagcagc tcgggcaggc gctgctcggg ctcacccggg agtacgacga     42300
     gcggcgcggc gggttcggcg gggcgccgaa gttcccgccg tccatggtga tcgagttcct     42360
     gctgcgccac cacgcccgca ccggcgccga gggcgcgctc cagatggcgg ccgacacctg     42420
     cgagcggatg gcccgcggcg gcatctacga ccagctgggc ggcggcttcg cccgctactc     42480
     cgtggaccgc gagtgggtcg tgccgcactt cgagaagatg ctgtacgaca acgcgctgct     42540
     gtgccgcgtg tacgcccacc tgtggcgggc caccggctcg gacctcgccc gccgggtcgc     42600
     gctggagacc gccgacttca tggtgcggga actgcgcacc gccgagggcg ggttcgcctc     42660
     cgcgctggac gccgacagcg acgacgggac agggaagcac gtggagggcg cccactacgt     42720
     gtggacgccc gcgcagctca ccgaggtcct cggcgccgag gacgcggaac tggccgcgca     42780
     gtacttcggc gtgacccagg agggcacctt cgagcacggc gcctccgtgc tccaactgcc     42840
     gcagcaggaa agcgtcttcg acgccgcgcg gatcgcgtcg gtgcgggagc ggctgctcgc     42900
     ggcgcgggac gggcgccccg ccccgggccg ggacgacaag gtggtcgccg cctggaacgg     42960
     cctggcggtc gccgccctcg ccgagaccgg cgcctacttc gaacgccccg acctggtcga     43020
     ggccgccgtc gccgccgccg acctgctggt gcgcctgcac ctggacgagc aggtcaggct     43080
     cacccgcacc agcaaggacg gccgggccgg agccaacgcc ggagtgctgg aggactacgc     43140
     cgacgtggcc gagggcttcc tcgcgctggc gtcggtcacc ggggagggcg tctggctgga     43200
     cttcgccggc ttcctgctcg accacgtact cacccgcttc acggacgagt ccggctcgct     43260
     gtacgacacc gcggccgacg ccgagcggct gatccgccgc ccgcaggacc ccaccgacaa     43320
     cgccaccccg tccggctgga gcgccgccgc gggcgccctg ctctcgtacg cagcgcacac     43380
     cggctccgca ccccaccgcg ccgccgccga gcgcgccctc ggcgtggtga aggcgctcgg     43440
     cccgcgcgtc ccgcgcttca tcggctgggg gctggcggcc gccgaggcgc tgctcgacgg     43500
     cccgcgcgag gtcgccgtgg tcgccccgga cccggccgac cccgccgcgc gcgggctgca     43560
     ccgtacggca ctgctcggga ccgcgcccgg ggcggtcgtc gccttcggga ccgagggcag     43620
     cgacgagttc ccgctgctcg ccgaccggcc cctggtgggc ggggcaccgg ccgcctacgt     43680
     ctgccggaac ttcacctgcg acgcaccgac caccgacccg gaccggctgc gcacggcact     43740
     gggcgtcgcc ccgaccggct gaggcggccc gctcacgcgt cccgggtgct gctcacggcg     43800
     cgctccacga tcgcctccag ttgctcgtgg tgcgcgcccc gccagtaggc gcggccgcac     43860
     gcggtgcact gggcgaagac gtcgtacgag cgccgggtgc cgccctcgag ctgctccgcc     43920
     acctcttcct tggtggccgt cctgagcagt ccgttgcagg cggtgcaccg cgtccagggg     43980
     ctgagcgcgg gccggaaccg gtccaggacc tcctggagct gctcctcggg gcgggtgctg     44040
     tagacgtagg cgccggccca cagctcgcgg cggcgcagca gtccgcggtc gcggctgagc     44100
     aggacccgct tctcggccgc cgacagcgcg gcgagcgccg ggtcgccgag gtccgtcgac     44160
     tcgtacgccg tgtccacgcc gagcagccgc agccggcggg cgagggtacc gaggtgcacg     44220
     tcgagcagga accgcagggg agcgccggga acccgctggg ggtgccggac gggccgtacg     44280
     cgcaccgact cgccgcccgc cgggatgtgg ccgggcggca cctcgcggcc gtcgacgagc     44340
     agggcaccga cctcggtcag cgggacgccg agggactcga cgagatggcc gagggtggag     44400
     acgccgtcgg tggccgcgct ggcgacgccg gtggggcggg cgcgcgggac gaacaggtgc     44460
     agctcggggg cgaactcgac gtggatctcg ggaccgttca cccggtcagg atgccacggg     44520
     gccgggtccg ggcctcagtc ttttcgaggg ccctcccgac ggtcctcccg atggcctccc     44580
     cggtcgccct cccgatcgct ttcccggtcg ctttcccgga gggcggggag cccgttctcc     44640
     agggcgtcca gggcgcggtc gaccagctct gccaggctct cctcgtggtc gtgctcggcc     44700
     cagtacctgg agacctccat caggccgccg accagggaca tcgacacgat cctgacctcg     44760
     aggccgtccg ggtcgagacc ggtgcggtcg gcgatggcgc gggcgagcat ccggccggtg     44820
     tccgacatgt tctccagcat gcgcgcccgc accgcgggga cctcggccag cagccgtgtc     44880
     cgcagccgga tcagctcggc ctcctcaccg gcgccgaggc cgagggcctt gcgcagcacg     44940
     tgccgcaggg agtccgacca cggttcgccc gcgggccggg cggcgagttc cgcggccatg     45000
     accgggtcgt actcgtccgt gaggacgatg tcctccctgg tcgggaagta gcgcagcacg     45060
     gtcgacggcg acacttcggc gcgctcggcg atctgctcga ccgtcgtggc ctcgtacccc     45120
     tgctgacgga tcagcccgta ggtcgcggcg cggatcgcct cacgggtcct ggtcttcttc     45180
     cgctcccgca ggcccggccg cggggccccg gcgggggagg gggcggaacg tgcggcggtc     45240
     atggggatca ttgtcggcca cacgacggcc cagaggcgac cgtgcgacga caccccctag     45300
     tacgcgacca gcgagatccc cacgtagtgc gcgatgaagg cggccagcgt gaaggagtgg     45360
     aacacctcgt ggaagccgaa ccagcgcggt gacgggttgg ggcgcttgag gccgtagatc     45420
     acgccgcccg cgctgtagag caggccgccg acgatcacca ggaccaggac ggcgacgccg     45480
     ccggcccgca tgaactcggg caggtagaag acggccgccc agcccatggc gaggtagcac     45540
     ggggtgtaga gccagcgtgg ggcgccgacc cagaagacgc ggaagacgat gccggccgcg     45600
     gcggccgccc agatgcccca cagcagccac tcgcccttgg caccgggcag cagcagcatc     45660
     gtgagcgggg tgtaggtgcc cgcgatgatc aggaagatgt tggcgtggtc gaggcggcgc     45720
     aggacgccgt ccatgcgcgg gctccagtcg ccccggtggt agagcgcgct gacgccgaac     45780
     agcaggcagg cggtaaggac gtagacaccg caggctatgc gggcctcgga cgtctcggcg     45840
     agggcggtga gcaccagtcc ggcgaccagg acggcgggga acatgccgag atgcagccaa     45900
     ccgcgcagct tcggcttgac cggatgcggg agagagagcg ttacgggccc gcggccgccg     45960
     gccggcaggt ccctgggcgc gtcggggacg gacgcagtca tgagcgcatc gtacctacgg     46020
     ttccgtaagt tacgtatcag tacggacgta tgacgaacgg cgagtggcca tcgtctcacg     46080
     ggagacccgg tggggcacct ccggtccgga cacgtggcga tcctcactcc gctcagttgt     46140
     gacgccctct ggacagatgg gcgcacacgt cggatgatca aatgagtgcg gtcgacaccg     46200
     gatgagcgcc cacgaggcac acgtcacgca tccgggtcgc agcccccacg gggcctccaa     46260
     caaaaaaccc ctcatctagg agcaatcgtg gcgcgcgaca tcgcggctcc ccccgtcccc     46320
     accaaccacc aggaactgat ctcgtgggtg aacgagatcg ccgaactgac ccagccggac     46380
     gcagtggtct ggtgcgacgg atccgaggcc gagtacgagc gcctgtgcgg ggagctcgtc     46440
     gagaagggca ccttccgcaa actcgacccg atcaagcgcc ccaactcgta ctacgcggcc     46500
     tccgacccca ccgacgtcgc gcgcgtcgag gaccggacct tcatctgctc cgccaaggag     46560
     gaggacgccg gccccaccaa ccactggaag gaccccgccg agatgcgggc catcttcacc     46620
     ggtgacaagg gagaaggcgg gctgttccgc ggctccatgc gcggccggac catgtacgtc     46680
     gtgcccttct gcatgggccc cctcggctcc ccgctctccg cgctcggcgt cgagatcacc     46740
     gactccgcgt acgtcgccgc ctccatgcgc accatgaccc gcatgggaca gccggtcctg     46800
     gacgagctgg gcgacgaggg cttcttcgtc aaggccgtgc actccgtcgg cgccccgctg     46860
     gagcccggcc aggcggacgt cccctggccc tgcaacagca ccaagtacat ctcgcacttc     46920
     cccgaggacc gcgagatctg gtcctacggc tccggctacg gcggcaacgc cctgctcggc     46980
     aagaagtgct acgccctgcg catcgcctcc gtcatggccc gcgacgaggg ctggctcgcc     47040
     gagcacatgc tggtgctgaa gctgacgccg cccaccggtg cgcccaagta cgtcgccgcc     47100
     gccttcccgt cggcctgcgg caagaccaac ctcgccatgc tggagcccac gatctccggc     47160
     tggaccgtgg agaccatcgg cgacgacatc gcctggatgc gcttcggcga ggacggccgc     47220
     ctgtacgcca tcaaccccga ggcgggcttc ttcggtgtcg cgcccggcac cggtgagcac     47280
     accaacgcca acgccatgaa gaccctgtgg ggcaattcgg tcttcaccaa cgtcgccctg     47340
     accgacgacg gcgacgtgtg gtgggagggc atgaccgagg agaccccggc ccacctcacc     47400
     gactggaagg gcaacgactg gacgcccgag tccggcaccc cggccgcgca ccccaacgcc     47460
     cgtttcacca cgcccgccgc gcagtgcccg atcatcgcgc cggagtggga ggaccccagg     47520
     ggcgtgccga tctcggcgat actcttcggc gggcgccgcg ccaccgccgt accgctggtc     47580
     accgagtcct tcgactggaa ccacggcgtc ttcctcggcg ccaacgtggc ctccgagaag     47640
     accgccgccg ccgagggcaa ggtcggcgag ctgcgccgcg accccttcgc catgctgccg     47700
     ttctgcggct acaacatggg cgactacatg gggcactggg tcgacgtggc caaggacaag     47760
     gaccagtcca agctgccgaa gatctactac gtcaactggt tccgcaagga cgacgcgggc     47820
     aggttcgtct ggcccggctt cggcgagaac ggccgcgtcc tgaagtggat cgtggagcgc     47880
     ctggagggca gggccgacgg cgtcgagacc ccgatcggcg tgctgccgac caaggagtcc     47940
     ctcgacaccg acggactcga cctcgccgac gccgacctgg agttcctgct cagcgtggac     48000
     aaggaggtct ggcgcgagga ggcggcactc gtccccgagc acctgaacac cttcggcgac     48060
     cacacgcccg ccgagctgtg ggaccagtac cgggcgctgg tgcggcgcct gggctgagca     48120
     ccgtccccac ccagctccgt ggccggtccg actagccctg acccgcgaag tcgtcacgaa     48180
     ggccggtcac gtagggggtc tccccgcgct ccagtagctc ttcgcacccc ggagcgcggg     48240
     gaagccccgc tcgggccggg tccccgcaca acggcgtgcg acggacccgg cccttcggca     48300
     cgtccggatc cggcccttcg gcgcgtccgg tcccgcccgg catcgcggcc ggtacggcgg     48360
     tcggcgctcc gagcggtcct ccgggcgccg gtggtgccgt cagacccggc cctcgtccgc     48420
     ggccgccggt ccgtagtcct ggtaccagtg gacgtcgaac cagcgggccg tggagaacgg     48480
     gtggtccggc tcggtgagca tgcggtggac gaactccccg gtcggaccgt cgaaccgctc     48540
     ccaggagtcg gggacgtcct ccttcgccag tacgggccac ctgtccgggt cggggtcccc     48600
     ggtgagccag tagaacccgt ccgcctgctc ggtgctcgcc cactgcagca gcccgccggg     48660
     agccggatac accgggtacg gctcccacag gcggctgccg tgcgtgcggg cccactcccc     48720
     gagccactcg gtgtgccgga cgaggtccgt gctccggtcg tgcgcgtcgg gcacctggag     48780
     ttgcaggtag ccgtcgaagg caccggcgcc gccgaagatc tcgacgagcc gcttgtagtc     48840
     gccgggcagc ggcgtcccga gccgtgcctc caccgccggc cagtcgaccg cccgggcccg     48900
     cgccgtctcc cacccggtga cggcgacgat cccgtccacc caggtcgcgg gcgcgctcgc     48960
     ccctgccgcg gggtccgccc gctcggcgac gagcaccacg ggccggacgg caccgtccgc     49020
     gtcgtcggcg cgcaccgtgc cgcagccgat ccaccggtcc ccgtacgccc acgcccgcat     49080
     ctcgacgatc cgctccccga acggcgtgcg gagcggcagc ccggccgacc cgcccgccgc     49140
     ctcggtggtg gtgccggtga cgaggcggag cggctccccg aaccgcgagc cgatcgcttc     49200
     ctcgataccg ggcagcccgg cccccgcggg cggcaccagg cacacgtgcc ccgtgccgtg     49260
     ccccgccgtc ccgcacaccg gcgggcccat gcgctgcgcg gtcagccggt ggacggccgc     49320
     cagcagcccc tcgagaccgt ccccgctcac cgggcgccgc cctgcgccgt ccggtcggtg     49380
     tccaggtcgc cttccaggac cgtccggctg atcagcgggc ggtcccacag ggacaggagc     49440
     tcgttggcga gggcgatgat ccgcggcggg tggtgttcgc cccgcacctc gatgtgggcc     49500
     gccagcagac tccgggggac ggcgcccgcg tcgagcagca cgcgccactc ctcggggccg     49560
     aggcgcaggt actccagacg cgtcagcccg gcgatctcca gcgggtcggc gagcgcgccc     49620
     gggcaggcgt ggagggtccg cagccggggg agtccggcga gcggggcgag gctgcgcggc     49680
     tcgccctccc gcccgccgag cacgagtacc tccagctcgg gacgggcgac ggccgacacg     49740
     tcgtcgccga ggacgttcag ccgggcgacc accggcggtc tgtcccagtc ccggcccggg     49800
     tgccactccg cccggccgtt caccaccatg tcggtgaggg actcggcgag cagtccggcg     49860
     ccgatgctgt cctcgtggcc gatcatgacg acctgcccgg tgtgcccgcc cggccccggg     49920
     gtcaggtcga gggcgagccg gtcgccgccg ccgttgtcgc cgaaggcgat ccagccgggc     49980
     gagccgacga ggccctgcac ggcggcgtcc ggtgcggtga cggcggcgtc cgtggcggcg     50040
     aactgccaca ggcacgggcg ggaccgtgcg tccgcgacgt acaactggtc cagggggagc     50100
     agctcacagc cgaccgcgtc gacgacgcgc tcctgtgccg cgtagtcgcc gcgccagtcc     50160
     tgccaccgtg cccggaccac gcggtagagc gccttgagct cgtcgggcag cgtgacaccg     50220
     aggcgggtct gagcctcggc gatctccgcc tcggtcgcac cgacggcgtc gggtagccgc     50280
     tcgcgcaggg tccgctccag cagcgcgggg tccgccgacg gtgccgggag cgcccccggc     50340
     accgcttcgg gcagccgccg ccagggctcg gggaccgccc cctcgaccag caccagggtc     50400
     ccgacgaagg ggctgacgag gccgtgctcc acggcggggc cggagtcgac gacgtggagc     50460
     gcggtcctcc cgtccacgcg cgtctcgacc atgaacgaca cggattgcct gccgtgggcc     50520
     ctcagggcgg cctggaccgc ctccacggcg gtgaactcgt cctgcatgtc ctccaccagc     50580
     gacgcgcgcc ccggtgcggg gtgcggccgc cgcacgggca cgctccaccc gccgagaccg     50640
     atctgcccca tgacgtgacc cccgggcccg gcgagccgct ccgggtggga cgcccgcacg     50700
     agccgcagca acggctccca ggtcgcgaag tcgtgtatcg aggacaacgg cgttctccgt     50760
     ccgctcgctc ggtgggccgg ccgccgggcc gccggcgccc ctgatcacct tgacgcgggg     50820
     cgatcctagg cgcgcccacc gacaacgccc cggtgggcga cgggcatgcg ccgctctgcg     50880
     cgcggtaccc gaggggccgg aaccgcggag aacaggaaga ggaaggaggg acccgccatg     50940
     gcagacggtg gtgacttcta ctcgcgtgac cggccgcggg agcccgaccc gcaactgagg     51000
     gaggaccgcc cgcgcggtgg tggcccggag gatccgcacc agcggggcaa ctggcccgtg     51060
     tgggcgatcg ttctcgcgat catcctggtc ttcgtcgtcc tgacggtgat cttcggctga     51120
     ccggcggacg gagaatgtgt ggcacccggt ccgcgcgtcg ctgcgggtgc gcgcggaccg     51180
     gggccgttcg ggggcccggg agggctcagc gggacgcgag cgggcgcggc tccagggccg     51240
     cggagtgcgc gtccatgcgc tcggcggtca ggatcgcgac cgccgtgtcg gcgcgggagg     51300
     ccgcgaccac cagggcgcgg gccgccaggg tgtgcgcccg ccggtgcagg gccgccggac     51360
     gcggctcctg gcgggtggcg gcgacctgca gccggaccgg cgcctgacct ccccgcagcc     51420
     gggtcacctg ctcggccagc cgctcggcgg cggcgtccag gccggtgtcg ggcgccagcg     51480
     cgcgcagttc gtcggtgacg gcgagcagcg ccgcgagatg gccggcgagc tggatgtcca     51540
     gctcatcgtc ccgggatcgg ccggggaagt ccgtggtggt gccggccatc gtgctgtgga     51600
     ccgacttgct gcggatcggc tcgtacatgg atggcctcct gagtgcttca ggaagccatc     51660
     ctacattaga tctaatctaa agttgatggt gttcggggtt cagggctggc tgtacccgtc     51720
     caggaagttc ccgatccggt ccaccgcctc gcgcaggtcc gcggccgtcg gcagggtcac     51780
     cacccggaag tggtcgggct cgggccagtt gaagccggtg ccctggacga ccatgatctt     51840
     ctcctggcgc agcaggtcca ggaccatccg ccggtcgtcc ttgatcttga agaccttggg     51900
     gtcgagccgc gggaagaggt acagcgcacc cttcggcttc acgcaggtca cgccgggaat     51960
     gctggtcagt gcctcgtggg cggcgtcgcg ctgctcgcgc agccgcccgc ccggcagcac     52020
     cagctcgttg atggtctgcc gcccgctgag cgccgcgacc acgccgtgct ggcccggcat     52080
     gttggcgcac aggcgcatgt tcgccaggat cgtcaggccc tcgatgtagg actcggcgtg     52140
     cgcgcgcggc ccggagatcg acatccagcc gacccggtaa ccggccaccc ggtacgcctt     52200
     cgacatgccg ttgaaggtga gggtgagcag gtcgggggcg atcgcggcgg tcggggtgtg     52260
     ggtggcgtcg tcgtagagga tcttgtcgta gatctcgtcc gagcagacca gcaggttgtg     52320
     ccggcgggcg atgtccgtca gtccgcgcag catcgcgtcg tcgtagaccg cgcccgtcgg     52380
     gttgttcgga ttgatgatca ccagggcctt ggtgcggtcg gtgatcttcc gctccacgtc     52440
     cgcgaggtcg ggcatccagt cggactgctc gtcgcagcgg tagtgcaccg ccgtaccgcc     52500
     ggacagtgag acggcggccg tccacagcgg gtagtcgggg gccgggacga ggacctcgtc     52560
     gccgtcgtcg agcaggccct gcatcgccat cacgatcagc tcggagacgc cgttgccgat     52620
     gaagacgtgc tcgacgtccg tctcgatgcc gagggtctgg ttgtgcatga cgaccgcccg     52680
     gcgcgccgcc agcaggccct tcgcgtcgcc gtagccgtgc gccgtggaga cgttgcggag     52740
     gatgtcctcc aaaatctccg gcgggcactc gaagccgaag gctgccggat tgccggtgtt     52800
     cagcttcagg atgcggtgcc cggccgcctc cagccgcatc gcctcctcga gcaccgggcc     52860
     ccggatctcg taacagacgt tggcgagctt ggtcgactgg atcacctgca tgtccgcgag     52920
     cttacgaccc ggttacggcc catgggccgt gtcttccacc acgtgagatg ccccgtccgg     52980
     gtggtcgcgg ccgccggtga cggtgcccgg cgggccggtt cgcgccaact ggcggccggt     53040
     taccggccct tgtccgcgcc cctctccgtc atgagaatgc tcatgacaat acggcgccgc     53100
     ccggacgacc tccggccggt gccctccaaa gaggggaccc ccacatgaac aagcctctcc     53160
     ttgccgcgct cgccaccctg gccgtcaccg gggtcggcgt ggcaccggcg gccgcgtcac     53220
     ccgcggctcc cgcggcttcc gcgtcacccg cggctcccgc cgtccgcgcc gtgtccttcg     53280
     ccggcaccgt cgcgctcagc aactgctccg gctcggtcgt gcgcctgccc gcctccgagg     53340
     acgacgaccc ggcgctggtc atgtccaacg gccactgcct ggagaccggc ttcccggcgg     53400
     ccggcgaggt cgtcgtggac cagccctcca gccgcacctt cgggctgctc aacgcctccg     53460
     gcacccgcgt cggcaccctg cgggccggca agatcgccta cgcgacgatg accgacacgg     53520
     acgtctcgct ctaccagctc accagcacgt acgcccagat ccgcggctcc tacgggatca     53580
     gcccgctcac cctcgacgac acccgtccca cggccggcac cgcgatcacc gtcgtctccg     53640
     gctactggaa gcgcacctat gcctgcaacg tcgacgggtt cgcctaccgc ctgaaggagg     53700
     gggaatggac ctggaaggac tcggtccgct acacctccgc ctgccggacc atcggcggca     53760
     cctccggatc accggtcgtc gacaacgcca ccggcaaggt cgtcgccgtc aacaacacgg     53820
     gcaacgagga cggcgggcgc tgcaccgaca acaacccctg cgaggtcgcc gaggacggca     53880
     ccgtcacggt ccgcgagggc atcaactacg gccagcagac ctatcggatc cccgcctgct     53940
     tcgccctcga caacaagctc gacctctcgc gcagcggctg cgccctgccc aagccgtagg     54000
     ggcaggcccg gcgggccccg ccgggcctgc ccgggctcag cgcggaaccc ggcgcaccga     54060
     ccgtccggcc agcacgtcgg tgcgccgccc gtcctccatc acgaaacgcc cgtcgaccag     54120
     cacgtacggg atgcccgtag gcagcacccg cggctcgtcg aacgagctgc ccgcggccac     54180
     cgtggccggg tcgaagagca ccaggtcggc ccggtacccc tcgcggacca gaccccggtc     54240
     cggcagccgc agccgggccg ccgggcgtga ggtgaggtgg gccacgcact cctccagcgg     54300
     gagcacgccc agctcgcgca cgtagtggcc caggtagtgc gggaaggtgc cgtaggcgcg     54360
     cgggtgcggc ttggcgccct ggaggatgcc gtccgagccg ccggtgtgga cccggtgccg     54420
     catgatcgcg cgcacgttct cctcgtggcc gacgtgctgg aggatggtcg gcgccagccg     54480
     gtcggcgagc agcaggtgcc gggcgaccgt ccacgggctc tcgccgcgca gccgcgccga     54540
     ctccagcacc gtgcggccga cgtactcggc gagcgccggg tcgcccgtgc cggagatctc     54600
     gatcgtctcc cactccatgg gcacgccgtg ggagccgtcg gagccgatca cctccatgtg     54660
     gtgccggatg cgctcggcgg tgtcgtcgtc cgccagccgc ttcaggatct gctccggtcc     54720
     gccctcgctc gcccagctcg gcagcagtgc cacgagggtg gtgcagccgg gggtgtacgg     54780
     gtaggtgtcg agggtgatgt cggcgccgcc cgcgagtgcc tcgtcgagca gggtcagcag     54840
     ctcgggcgcc ttgcccttgt tcacgccgaa gttcatggtg gcgtgcgcca ggtgcagcgg     54900
     gcagcccgcc tcccgggtca gctccaccat ctcctcgtac gccttcaggg cccccgcccc     54960
     gtacgagcgg tggtgcgggc agtagtagcc gccgtacgac gccaccaccc ggcacagctc     55020
     ggtcagctcg gcgtccttgg cgtacatccc gggcgtgtag gtcagccccg acgacaggcc     55080
     gaccgcgccc tgctccaggc cctcggcgac caggcgccgc atgtgctcca gctccgcctc     55140
     ggtcgcctcc cggtcgtccc agccgacggc gagggcgcgc accgtgccct gcgggatcag     55200
     gtacgcggcg ttgaccgcga tgccccggtc gagccggtcc aggtactcgc cgaccgaccg     55260
     ccagtcgaag tcgacgtcgt ccccgtggcc gttccacccg gcgatcgccc ggcgcacctc     55320
     gccgagggtg cggtcgtcga ccggtgcgta cgacagcccg tcctggccga tgacctccag     55380
     ggtgacgccc tgggcggcct tggcgctgtg gtccgggtcc cgcagcagcg ccaggtcgct     55440
     gtgggcgtgc atgtcgatga agccggggga caggaccagg ccctcggcgt ccagctcccg     55500
     gcgtgcctcg gggcgctggc agccggcggc cgccgcctcc ttgacgatcg agacgatccg     55560
     gccgccgtcg accacgacgt cggctcggta ggagtcgccg ccggagccgt ccacgacgtc     55620
     ggcgtccctg atgaccagct cttccatgcc tgactcctcc tgggtcccgg gtcctctaga     55680
     agaacgtgcg gatgtagtcg acgaccgtcc cgtccgcctg tgcgaccggg atcagctgcc     55740
     acttgtcgaa ggaggtgcac gggtgggaca ggcccgcccc gacccagtcg cccaccgcca     55800
     ggtccgcctc cccgctcgtg cgcagccagg cgtgctggtc ggacaggccg gtcacctcga     55860
     cgccggtcgc agggcgctcc gggccgccgt ccgcggggcg caccacctgg gcgaagggca     55920
     ggtgcaggtc gtacgccgcg tcccgcttgc ccgcgttggt gaacgcctgc tcgggggagg     55980
     ggcgggagac gacctggctc cacagccgga acgcgggttc cagggcgccc tcctcgggga     56040
     cccggttgaa gggggtcagc tcgcggtagt ggccgtcgtc gtgggagacg tacgcgcccg     56100
     agcgcagcag cttcaggacg ggcagcgaga ggccggggac ctcggcgaac acgtcggcga     56160
     ccgcgtcgaa ccaggcgctg ccgcccgcgc tcagcacgat ctcctccagc ccgtcgaacc     56220
     gcccggccct gtcgaagtcg acggccagcg cgaccagccg ccgcagccac gcgtgcacgc     56280
     gctccgggtc ggcgtccggc acctcgccct cgtacccggc gaccccggcc agccgcagcg     56340
     tccgcgcgcc ggccaccgcg tcggcgaccg ccgcgcaccc ggcctcggtg cgcacgccgg     56400
     tccgggcacc cgcaccggcg gccagctcga ccacgacgtc cagcgggcgg gcggcgcccg     56460
     cgtccgtcag ggccgcgtcc atcagctcga cgccgcgcac ggagtcggcg tagcagacga     56520
     agcggaagcc ggggtcggcg tccagctcgg cggagatcca gcgcagggcg gcggcgtcga     56580
     ccagctcgtt ggccaggaag acccgctgga cgccgaacgc ccgcgccacc cgtacctggt     56640
     gcggcacggc cagggtgatg ccccaggcgc cgtgctcgat ctggcggtgg aagagctgcg     56700
     gtgccatgga ggtcttgccg tgcggcgcga aggcgaggcc gtgccgggcg gagtacgtct     56760
     ccatgagctt caggttgtgc tccaggcgct cggcggacag cgcgaggacg ggggtggtga     56820
     aaccgccggt gaagaggttg cggcgctgtc cggccagctc ggcgagggtc aggccgtagg     56880
     cgtccggcgg gaggcccttg aagcggtggt cgacacgctc ctcggccagc tcggcgaggg     56940
     cttcgcggcc gcctgcgggg ccgttgtcga gggccatgga gcctccctgg tctgatccgt     57000
     tgcaaatcct gcaacgatcg ttgcgtatat cgcttactgc tgtctaacat ctcggcgaac     57060
     gcggggtcaa cggagcagcc gcccgcgaga cgcgaagagg agccaggacc atcgtgaccg     57120
     ttgacggacc ccgcagcacc gcccccgacg tcgtggacgt cgtcgcgctc ggcgagtcca     57180
     tggtcacctt cctgccctcc cggcccgggc gcctcgccga cgtcccctcc ttcgaccgcg     57240
     ccataggcgg cgccgagtcc aacgtggcct gcgtgctcgc cgccgccgga cactccgccc     57300
     gctgggccgg ccgggtcggc gccgacggct tcggcgacca cctcgtcgag gcgatcggtg     57360
     cctacggcgt cgacgtctcc gccgtgcgcc gcgaccccgc ccgccccacc ggcgtctact     57420
     tccgcaccgc gggcgaccgc gccaccgacg cgcacgaggt ggcctactac cgggcgggct     57480
     cggccgcctc cgcgatgtcc gtggacacca tggacctcga cgcgatccgc tccggccgcg     57540
     tcctgcacct gtccggcatc acccccgcgc tctccgccgg ctgcctcggc ctgatgcgcg     57600
     agctgaccgc ccgccgaccc ggccggcccc tcgtctcctt cgacgtcaac caccgccccg     57660
     gcctgtggcg cgacgcccgg cacggacacg gccccgaggt gctcctggaa ctggcccgcg     57720
     gcgccgacct cgtcttcgtc ggcgacgacg aggcacggga cgcctggggt ctcggcggac     57780
     ccgaggccgt ccgcgccgcg ctgcccgagc cggagctgct cgtcgtcaaa cagggtgcga     57840
     gcggcgccac cgccttccac ggcaccgacg ccacctccgt gcccgccctg cacgtcgacg     57900
     tcgtcgccgc cgtcggcgcg ggcgacgcct tcgccgccgg gttcctctcc gccaccctgc     57960
     gcggaaagcc cgtacgcgag cgcctgcgcc acggccacct ctgggccgcc gccgccctca     58020
     ccgtccccgc cgacctcgcc gcaccccccg cgcgcggtca cgccgaccgc ctcgtcgccc     58080
     tcgacgacac cgcgtggggg agactgcgac tcggccccgg ctggacacac gccgaggaag     58140
     gggccgagga ggaggtacgt acgccatgag ccagaccgtc gaccgtgcgc tcagcatcct     58200
     gccgctgctc gccgagggcc ccgccgacct gggccgggtc gccgaccgcc tgggcgtgca     58260
     caagtccacg gccctgcggc tgctgcgcac cctccacgac cacggcttcg tctaccgcca     58320
     gtccgaccag cgctaccgcc tgggcgcccg gctgatctcc ctcgcccagg aggcgatgga     58380
     gaacctcgac gtccgcgaga tcgcccaccc ccacctcgta cgcctcaacg aacaggtcgg     58440
     acacaccgtc cacctcgccg tccacgagga ggacgaggtc ctctacatcg acaaggtcga     58500
     gagccgctac ccggtccgca tgtactcccg gatcggcaag cccgtcgcca tcaccgtcgc     58560
     ggccgtcgcc aagctgctgc tggccgacct ccccgaggac gagcgccggg ccgtggccga     58620
     gcagctcgac taccccatgt acacggcccg ttcgacaccg aacgccgacg ggttcctcaa     58680
     ggaactcgcc aaggtgcgcg aacagggctg ggccaccgac ctcggtggcc acgaggagtc     58740
     catcaactgc gtcgccgcgc ccatccgggg cgccgacggc cgggtggtcg ccgccatgtc     58800
     ggtctccgcg ccgaacgtgg tcgtcaccgc ggacgaactc ctcaccctgc tcccgctggt     58860
     gcgccgtacg gcggacgcca tcagcggcga gtactccggc aggaccccag tcaaggaagt     58920
     caccgcatga ccgacaagat cgctctcgtc cccgcgaccc acaccgtccc cccggcgaag     58980
     ttcagccacg gcgtgaagaa gggcaacatc ctccaggtcg ccggccaggt cggtttcctc     59040
     ccccacgagg agggcaaggc ccccaccccg gccggtccga ccctgcgcga gcagaccctc     59100
     cagaccctcg ccaacgtcaa ggcgatcctg gaggagggcg gcgcctcctg ggacgacgtg     59160
     atgatgctcc gcgtctacct cacggacgtg gaccacttcg ccgagatgaa cgagatctac     59220
     aacgcctact tcgcggagca gggcctcacc cagccgcccg ccgcgcgcac gaccgtctac     59280
     gtcggtctgc ccgccggcct cctcatcgag atcgacgcgc tcgccgtcct cggctgaccg     59340
     tcccttccgc tccacccgcc cgactgcctt gaacggcacg gcgccccacc cctcggggcg     59400
     ccgtgccgcg ctcctccctg cccgaaagct ccatgtactt atccagagga cccccgtatg     59460
     tcctactcgt ccctccgtct tgccgccgcc gaggccccac cccacaccgg cggtctgctc     59520
     accctgatcg acggcaccgc cggtctgctg accgtcgccg ccatcggcat cgcgctgctg     59580
     ctcttcctca tcatcaaggt gcggcttcag cccttcgtcg cgctgctcgc cgtctccata     59640
     gccgtcggcc tgctcgccgg cctgtcggtc accgaactct tcggcaccgt gcagaagtcg     59700
     gacgccgtct cgaccatcga gtccggcatg ggcggcatcc tcggccacgt cgccatcatc     59760
     atcggcctgg gcaccatgct cggcgcgatc ctcgaagtca gcggcggcgc ccaggtgctg     59820
     gcctcccgcc tgctcggcct cttcggggag aagcgggccc cgctcgccat gggcctcacc     59880
     ggtctgatct tcggcatccc ggtcttcttc gacgtgggca tcttcgtcct cgcgcccatc     59940
     gtctacgccg ccgccaagcg ctccggcaag tcgatcctgc tctactgcct gccgctgctg     60000
     gccggcctgt ccatgaccca cgccttcctg ccgccgcacc ccggcccggt ggccgccgcc     60060
     ggactgctga acgtcaagct cggctggatc atcctcatgg gcatcgtctg cggcatcccc     60120
     gccgtcctcg ccgcctgggt gttctccgcc tggatcggcc gccgcatctt cgtgcccgtg     60180
     ccgcaggaca tggtcgaggc gtccgaggag gccaagcagg ccgtcatcga ggagcagcgc     60240
     aaggccggcg tcgcgccgaa cgagagcccc gtcgcgctcg gcaccgtcct cggcatcatc     60300
     ggcaccccgt tggtcctgat cctcgccgcg accttctcct ccatcgccct ggacccgtcc     60360
     accctccgct cggtgatcga gttcttcggc aacccgttcg tcgcgctgac catcgccctg     60420
     ctcctcgcct actacctgct cggcatccgg cgcggctggt cccgcaagtc cctggagacc     60480
     gtctcgacgg cctcgctgaa gccggtcggc aacatcctgc tggtggtcgg cgcgggcggg     60540
     gtcttcggcg ccgtcctcaa ggccagcggc gtcgcccagg cactctccga caccttcaac     60600
     gacgtcggcc tgccggtgat cgtcctcgcc tacctgatct ccgtggtgct gcgggtcgcg     60660
     cagggctcgg cgacggtggc catcgtgacg acggcgggca tcgtggcgcc gctgctggcc     60720
     gagggcgacc actcgcaggc gttcgtcgcg ctggtcatca tggccatctc ggcgggctcc     60780
     atcttcgcct cgcacgtcaa cgacggcggc ttctggatgg tcgccaagta cttcggcatc     60840
     agcgagcggg acacgctcaa gacgtggacc gtgctggaga gcgtcctgtc cgtcgccggg     60900
     ttcgtggtgg ccgcggtggt gagcctgttc gtgtaggcgg gtacggctcg tacgggcggc     60960
     tcgtgtaggc gtctgataac gaagttgggg ctggctgtgc ccggcacagg atcgtcgacc     61020
     atactgcccg cgtggagcag cgcagaggat cgacgagcca gcccctggaa ggcgccggat     61080
     tcgacccggc attcatcccc gggctcaccg cacccgtgtc cggtgagccc gaggacgtga     61140
     gacgcgccga ggacgaggcg gagaaggacg ccgacgcgga gaccgaggag tcgtcgcact     61200
     ccccggccgc cgacgagccc cccgccgaag acgccgagga cgccgaggaa ccggatgccg     61260
     aggcccccgt ggacggcccc gtcttcgagg cctccgaccg ccgtgccaag atcgtcgccg     61320
     accacagggg cgtacgtctc tccctcgacg accaggcctg tgagttccgc tgggacgagg     61380
     tcggggcggt cgagacggag accggccgct tcggcaagcg gttcacggtc acggtgcaca     61440
     cgccggaccg ccgctggtac ccgatcgaga tcgaggccgc ctcccgaagc cgtttcgccg     61500
     agtgggaatc ggccctggac gaggtcctgg acgcgtactt cgaagacggc gaggcggagt     61560
     ccgaaaccga agcggaggcc gtagaggcgg cagagacggc cgatacggcg gacacggcgg     61620
     agaaggacgc cgaggacgcc gagggcgccg aggaggccaa ggcccgcgcg gagtaagcgt     61680
     ttcgggtgaa gatccgtgca cgccctcttg tcgcaccggc ggccatgggc tttcttgacc     61740
     cccatggcgg acaccacggg caacacctca gacgcaggcg tatcggtcgg ggccgatcag     61800
     gccccccgta agtccagttg gcgctacatc ggcccgggga tcgtcgtcgc cgcgaccggt     61860
     gtgggtgccg gcgacctcgt ggccaccctc atcgcgggca gcaacttcgg ctacaccctg     61920
     ctgtgggcgg cggtcatcgg ctgcctcgtg aagatctccc tcgccgaggc gtgcggccgc     61980
     tggcacctgg ccaccggccg caccctcttc gacggctggg cgagcatcgg ctcctggacc     62040
     acgtggttct tcgcgatcta cgccgtgatc tggggcttcg tctacggcgc cgcggcgatg     62100
     tcgtccagcg ccctccccct ccaggccctc ttcccggacg tgatggacct cgaatggtgg     62160
     ggcatcgcct gcggcctggt gggcctggtc ttcgtctggt tcaacaagta caacgtcttc     62220
     gagaaggtca tgaccgtcct ggtgggcgtc atgttcgtca tcacggtgta cctggcgatc     62280
     cgcgtcaccc cgaacctggg cgacgccttc gccggactcc tcccggtcct cccggacgag     62340
     aaggactcgg tcctcaacac cctgggcctg atcggcggcg tgggcggcac catcacgctg     62400
     gccgcctacg gctactgggt caacgccaag ggctggacca ccaccggctg gatgaaggtc     62460
     atgcggctgg acaaccgggt cgcctacgcc accaccggca tcttcgtcgt cgcgatgctc     62520
     ctcgtcggcg ccgagctgct gcactccgcc aacatcgcga tcgcgagcgg cgacaagggc     62580
     ctgatccagc tcggcgacat cctggagcag gagtacggca cggcgaccgg caagctcttc     62640
     ctgatcggct tcttcgccac cagcttcacc tcgctgatcg gcgtctggca cggcgtgagc     62700
     ctgatgttcg ccgacttcct ggcccgccgg cgcggtgaac gggaggcgcg gggcgacgag     62760
     ttggcctcgg gccgccgcga acgctcctgg gccttccgcg cctacctgct ctggctgacc     62820
     ttcccgccga tgatcctgct gttccaggac gagcccttcc gcctgatcat catctacggc     62880
     gtcctgggcg ccgccttcat gcccttcctc gccctcaccc tgatgtggct cctcaactcc     62940
     tcgcgcacac cccgcgaatg gcgcaacggc agcctcagca acggcatgct cgccatggcc     63000
     gggctgctgt tcctggtcct gtgcgtgaag cagatctggg accagccgtg gtcggagttc     63060
     ttctgagccc agctgtcctt tcgggcacgc ggccatgacc cgaagggtgc tcttcccgtc     63120
     cttcccgggt gtcgacgagt cgcataggtc tgaagctgga gaactctggc cacccgggcc     63180
     aggcactggc gtccctcgga gggaacagca tgcgaggaca cgaccggcag tccgaccacg     63240
     agctcacagg ccggcgcagt gctggggacc gtggtccggt cgtacggacg gaccgggccg     63300
     cgtcgacggc gggccaggcg tggtcggcgg gcgacctctc gccccatgcg gtgtcggacc     63360
     tccagaactc ggccgggaac gcggccgtcg cggcgtcctt ggcggggcag cggcagcagc     63420
     acgggtcgca gccgcccgtg cagcgcatgt tccagaagat gaagaacgcg gtgagcggaa     63480
     accgctcggc ggcgcagcag gaggtgaacg tgcgcgtggg tgaggatgac atacccatga     63540
     cgcgacaggg cgcgttctac gtcttccgga cgccacaggg cggcagggcg tacatccacg     63600
     atgtcgccgt cgtaaacggt gtactcaacg acgacctcac accgcatgtg atgaagtacc     63660
     ggatgggtgg actcgccctg taccgcggga tcccccgcca tcacgagacc tggcacgacg     63720
     tcaacggtgg cggagtgatc cccccgctcg gcagtgggga gcttcccgac tacgccacca     63780
     acaacacgtc gttcatcccg ttcagcccga gcgagagagt cgcgcgcggg tccgcggtcg     63840
     ccacgagggg gatggccgaa cgcaaccgcg ccgagtacgt gcaggggtac tcgcggagca     63900
     acgagaactt cttcgtcggc ctggtcgcga cggtcgtggc cggccccaac ctcgacgtcg     63960
     gcttcttcaa cggaggcgag gtacagatcc ggggtccggt gcacggcttc gaaacggatc     64020
     acatccggat gggtaccgat gtgcaggagg ctctgaccgg caccccgggg gacccgcggg     64080
     aaccgatcag cgagaaccgc cccaacacgc cgaacgagga gcagaagaag gagttcgaga     64140
     aggagcacgg catgctgccc tgagtcgacg gccccgccgg cctgcggggc agcgggcgcg     64200
     tgatgctgcg gcagccgtca ccgcaaccgg tcccactccc cactgagcgc gatcttccgc     64260
     agctgctcca tggtcagcgc aggggcgtcc cgggtggcgt ccttgttctg gtcaccggtg     64320
     ttgaaggcgc tgatcaccac gcggaagccc gccggcccgg gacgcagcgt gtccacggtc     64380
     cacatcacca cgccggaacc ggccttctcg ccgggcccct gccgggtcgc gacgcgcgtg     64440
     ccgtcgggca gggtctcgcc gtcggcgtac aactgcccgg cgacgtcggc catcccgtgc     64500
     tgcacgttga tctggaccag gctgcggccc cgcccgtcgt ccacgacgac gtaggcgtac     64560
     tcggactcct gcccaccgcg cgagacgacg tccagcttcc gggggagcag cgcggcgagc     64620
     gtgtcgccga ccgacttccc cgagacctcg ggccgctcgg tgcggggcgc ggccgaccgc     64680
     ggcggcttcc ggctcttggg aacggcgtcg accacctcgc gccacacccc ggcggtgacg     64740
     agctcccgca gccgctccgt cgacagggga ggctcctcac gactgaccgg cgcgcccttc     64800
     tccgcggggg agttccactc ggagacgctg acgtgctgtc cctcggcggt gaccaggtcg     64860
     gcggtccagc gcttggtgtc cacgcgcagg tccgggtact cgtagccctg gtacagcttg     64920
     agcagcgagc cgtcggggag ccggtcggag gagcagtcgt cgtacggcgt gatgttgtgg     64980
     tcgggacacg ccatcaactc ccgcacctgg gcgctccccg gctccacccg cgcgaagccc     65040
     atgccgatcg cggcggcccc ggccccgtcg tcgtagacga gctgcgcggt cgggcccagc     65100
     tggtggtccg agccccgggc cgactcctcg ccgtaagtcc ccggaggaag caggcccttg     65160
     agctcgtgca gcaggtcgtc gccggtgaag gaggcggcgg cggtggtcgc gtcgccggcg     65220
     gagggggcgg aggccgtgcc ggaccggtcg gggccggccg ggtggtccgc cgggaggacc     65280
     agcaccccgc ccaccccggc cagcgcgacc ccggccaccc cgcccaccac ggccgccctg     65340
     cgccgcagca gggcccgccg cccccgggcc cgccccgcgg tgacgagggc cgcccgatcg     65400
     gcctcgaagc cgtcaccggc gtcgcgcagg gcggtgccca gccggtcctc gaaggggtcc     65460
     tgacgttcgt tttcgagcat ggtgaaccac cctttccaca cgtgagtcga aatgagccgc     65520
     tcagagcggc gagcgagaga cggtccgggc aggggccgcc tagggtctgg cgtactccga     65580
     gaggtcctcg cccagcagct cccgcagccg gccgagcgcc cgcgagcacc gggtccgcac     65640
     cgccgccgaa ctgacgccga gcacgtcggc ggtctgctcg accgagcggt cgtcccagta     65700
     ccgcaggacg accacggccc ggtccttggc gggcagccgc gcgagcgcgt ccagcagcgt     65760
     cagccgcagg gacgcgtccc cgtcaccggc gccgggcaga tcggggaaca cgtcggtcgc     65820
     ccgctccccg ctgctgcgcc gccgctgatg ggcgaggaag gcgcgggtga gcacggtctg     65880
     cgcgtaggcg gccgggttct ccgcccgcga cacccgcccc caccgcacgt agagccgccc     65940
     gaaggtctcc tgcacgagat cctcggccag atgcgtgtcc ccggcggtga gcagacacgc     66000
     ggaccggtac agatgcccgg cccgcgccac cgcgaactcg gcgtactcgt ccgcccgccc     66060
     ctgcctcatc cgcccgctcc cccgaagtcc ccgccgtggt gtaccgcctt cacctcattg     66120
     atgcggtgga ccccggaaaa tgtttcatac ggacttcaca gcagggttca cagcaggtgg     66180
     tcggccttcc ccgccttgat gtcgaggatc atccgccgca gcgcctcccg gctgtcggtg     66240
     agggcggcgt cctccgcacc ggctatggcc acgtaggcgt tgccagtggc gtcggtgccg     66300
     aggcggaagc agctcgctcc ctccccgcag aacggttctt cccacgtgat gtcatccatg     66360
     gtgcgtctcc tcacaggccg ttggcgacgt cccggatgaa gtcgcgggat gcctgcggag     66420
     acagggcgat gcgctccatc cggtccaggt gcgtacggta cttcgcgagt tgggcctcgc     66480
     cgctgaggaa ttccggcccg tgcgtgctgt cgatctggac ggtgtccaac tgaggcaccg     66540
     gtccctccag gtagttgaag atctgcccgg aacccgggaa ggccccggcg gtgaagggca     66600
     cgaccagcag ccgtacggtc ggccgctccg agaccgcgac cagatgctcc aactgcgccc     66660
     gagcgacagt ggggccaccg aactgcatcc gcacggcagc ctcgtggaca acggcgacgt     66720
     actctggcgg gtcgtcgcct tcgagtaccc gctgccgctc gacgcggtac gccagccgta     66780
     gcgcgacctc gtgctccggc agcagcggca ggactgcccg gaagagttcg agggcgtggt     66840
     cgctggtttg cagcagtccc gggatgtgcg cgatgtggat agtgcgcatg cgcgttgcct     66900
     gcgcctcgaa ctcggcgatg tcgagcagcc ccgcggacag cgaaccccgg taacgctccc     66960
     accacccgcg cgcgccaggc cgggccatgc ggaccagcgc ctcgacgtac gcctcgtcgg     67020
     aacagtcgca gttgcaggcg agagtgcgca gccgctcagg gctgatggtg cggatgccgg     67080
     tctcgatgtt ggagaccttc gcccggtcca gcccgagcag cccggcggcc tggtcggccg     67140
     ttatgcccgc cgcggtccgc atcttccgca gttcggcgcc caatcgcctc tgacgctcgg     67200
     tcggtgtcgt cctcggaggc atgcccttcc ttccctgcgg ttccgcagca gtctgccgcc     67260
     cctccggacc tgcgcaccac gatcgggtct ttttctctga gtgagtggca atttacccac     67320
     atcgaaaact accgtgagtg aggtaatcga cacgcagagg tcggcagtgc atcgcgcaag     67380
     cctgcccgcg cgacggagcc accgaccgcc caccggcccg acgaaggagt cgccatgccc     67440
     acaacccgtt gccccgccgc ccccacctac ccggctgacc cgacgccccc catccctgaa     67500
     accctggcct acagcctcac gctccccgcc gcactggcca gcgcagcgct cgcacgggcg     67560
     acgaccaggg aggtcctgcg cgcgcacggc ctgacggaca tgctggaccc cgcgctgcag     67620
     gcggtaggcg aattgacggc cgtcgcaagc caattcacgg agtcctcgaa ctactacctg     67680
     accctccgct accgcttctc caccctccgc ctgatcgcct acgacagtca cccccgacac     67740
     accagccctc acttggccac cgcctgcgac acccgacgtc gcgcggccct ccgcgtcctg     67800
     gcctgcgtct gccgcgcatg cgacggcact tggggcttcg gcgaggcgag ggaaccgggt     67860
     ggcggcacac gcatgtgggc gaccctgccg agggcgagcg cggcggcgta cggggcgtct     67920
     tgacggcggg acgggggtgg gactggctcc tgtcttctcg ggcttggctg gccagggaga     67980
     atttcgtccg gcagcacttg agttgggcat cccgggcgac gggaccagca gattcagccg     68040
     gcacctccgt ctgtcgatcg gcaccccacg gcgcggccgc ctcggtgtgc gcgtccagca     68100
     cgggcacggt ccactccccg cccacgcgtc gcgcggacgc gatctcctgc gcgaatctcc     68160
     tgcggaactc gggctccgag gcgagtcctg tggcccatgg gacacttctg catcccgctc     68220
     gtgacctgcg gtcgcgttcg ctgctgttcg atcgaggccg gcggacagcc gcagcgcggt     68280
     caagcagcgg gaaggtggga accgggtgtc ctttctgaag ttcgcggaag ccgaggttaa     68340
     ggacatggca gccaagctgg agaccagcgg aggccatatg aagagcgcgt cgaaggagat     68400
     gaagagcgcc gacacgaagc aggtcggtca ctcgggcctg gaatccgcgt gcgacgactt     68460
     cgcggactcg tgggactacg ggttcgggca gctctccaaa atcaccaagg gcgtgtcgaa     68520
     attcgccaac aaagccgccg aggagttcgc cgaactcgac cagaagctgt acgacgagct     68580
     tcggaaagcg cgtgaggaaa agggagagaa gtgagccttc ggcgccacct cgggaagctc     68640
     ctgcgcgcga cgggagagga cggtcggccc agtgggtccg ctcacgcacc cggctcgtcc     68700
     ggtgaaaccg tggcgtcctt cacgacagag gtcccgtggc cgtcgctgcg gaagttcgct     68760
     cagttcgcgt acatcgccga gcagtacgga taccggtact ccggcctgga tccggacctg     68820
     cgggactccg gcacgccgtt cttcgtcttc cggcgcctgc cggacgcggg cgaacgcgcc     68880
     gctcgcacga gggggagttt ccccggcgct cccgagaacg gccgactgcc gggaatgcgc     68940
     gcatggccgc tacccgtgct gacgctgccg gcggcacgga gcgaggtgaa gctgctgctc     69000
     gcccggatcg tcgtcgacta ctacggtgcg ttgggacggc agcggatgcg tccgtggctc     69060
     atcggcattc cggtggtgtt cctgctcttt ctgctggtga atggcgagct gcacgcgaca     69120
     ggactgcgcg tcgcggccgg tatggccgtg gcgttgatcg tggtgctgac ggcttccagg     69180
     gtcttcatgc gccgtcgccg tgcgacgtac cggcggctgc ttgagcggtc ggggctcggc     69240
     ccgcctccgt gagcggggtc ggtgcctcga agacgaaggt ccgtccgatg tgtgcgagtc     69300
     gctcggtgta ggagtcgagg aggtagaccg acggtgtcgc gatcgtgatg tacgtgcagt     69360
     agtcccgcgg cgcggggcag atcagctgga gcactgccat ggggatcttc tgcgcggccg     69420
     catcctcacc acccgaggct gcctgcccgg cggtgcgcag ctcgacggtc cgcagggacg     69480
     ccgacatcac gccgggcccg cccgggagct tggccgcgag cagcatgtcc tgctgccccc     69540
     ggccgccctt gcccagggcg aagtccagct cctccacctc ggcttcccga gtgaagaaga     69600
     ggcgttcctt ggcccggtag atgccttcgg cggccagcag tctgtcgtcg tggccgctgg     69660
     gacgtacgga gacgacgagc agcccgtacg acagcttgtc ctcgtctcgc acgcgttcgg     69720
     cgcccaggca catggcgatg tcgacgagcg tgtcgtcccg atcgaggaac atggggaggc     69780
     tgtggcgcat ccgctcggcg gactgcacgc gttccagcgc gtcggcgccc ggcatcagtt     69840
     ccgccatcag gtgcgggttt cctgcagggc cccggcgaag ggagggctcg cgagcgggga     69900
     cggccgcaca cgggcatccc ccgcccggac cttcgcgggc gggggaagcg gccggtcgtg     69960
     ggttacggca gggcgtgtac gtgcgcgccc accgagttcg accacgcgtt gcccgccgtc     70020
     gcgtcccagt tggtggacca ggtcatcgca ccccggaggt cggggtacgt cttggacggc     70080
     ttgaaggagc cgcagttggt cgccttggtg aggcagtcca gggcggcgtt gaccaccgac     70140
     ggggagacgt agccgccgcc cgccgctcgg gtcgaggccg gcaggccgag gcccacctgg     70200
     gacggggcga ggccgccctc gagctggatg caggccaggg cggtgaggaa gtcgacggtg     70260
     ccctgggcgt acaccttgcc gtcgcagccc agcatcgtgc cgctgttgta gtactgcatg     70320
     ttgacgacgg tgaggatgtc cttcacgttc agcgcggtct ggaagtagcc gccctgcgtc     70380
     gactgcatgt cgatcgtctg cggggccatc gtgaggatca tgtccgggcc cgccttcgcc     70440
     gacagggcgc gcagggcctg ggtcatgtac gtcgggttga gaccgttctc caggtcgatg     70500
     tcgacgccgt cgaagccgta ctcccgcatc accgagtaca cggagttcgc gaagttcgtc     70560
     gcggaggcgg agctgttcac cgagacggtg cccttctcgc cgcccaccga gatgatgacc     70620
     ttcttgcccg cggcctgctt ggcccgtacg tccgccttga actggtcgac ggtgtagccg     70680
     ccgaggccgg ccgagtcgag gttgaaggtc acggcgcccg gcgtcgtggt cgcgtcggcg     70740
     aaggccaccg cgatgatgtc gtacgcggac ggcacgtcgg agatcttctg gaccgtcgcc     70800
     ccgttgttga agttctgcca gtagccggtc accgcgtgct tgggcaggtc accgccgttg     70860
     ccgccgtcgt ccggcgccgt ggtgcgggcc gtgaccgccg ccgacttcac cgactcaccg     70920
     gccgcgttcg tcgccgtgac ctggaaggag tacgacgtcg aggccgcgag gccggtcacc     70980
     gtcgccgacg tgccggtcac cgcggtcacc ttcgtgccgt cgcggtagac gttgtagccg     71040
     gtggcgccgg acaccgtgtt ccagctgagg gaggccgagt tcggggtcgt gccggagacg     71100
     ctcaggccgg ccggggccga cggcaccgtg gggtcggggt tcccgccgtc gccgccaccg     71160
     ccgtcggggc cgaagacgga caggtcgtcg acgtagtacg ccgcctgccc gtaccagccg     71220
     tgcgtgtaca cggacacgga ggtcgtcgag gagccggtgc tgaaggtggt cttcagctgc     71280
     ttccacgccg tcgagtccgg ggtccaggtc gacacgtccg tcgtccccgt gcccgtcacg     71340
     cccaggtagg agtacccgcc ctgcacccag gcgctcagcg tgtacgtcga gttgggcttc     71400
     accgcgacgc tctgcgaaca gcgggcgttg tcctgccccg ccggggtggc cttcagcgcg     71460
     gcggagcccg cgtgcgccgg agaggcgacc gtcgtaccgc tgttcgccga gcaggcccag     71520
     ttgctcagtc ccgactcgaa accggcgttc ttggcgttgt tgacgtcggc ggccgaggcc     71580
     gggccgacgg cggtgaaggc gagtgccagg gcggcggtga cggcgcccgt caaggagccg     71640
     agacgtcttc cgcggctgcg tctgcgtacg gggtccactg ctgcctccgg gggtggggtg     71700
     gggcggaatg ggggacggcg gccaccgctg acgtacaagg tggtccagac caattgaagg     71760
     tgtcaagagg taggtacgga ccaagttggc ggcctggtcg ctgccgtccg gaatggggcg     71820
     gctcgccatc gaaaatgctc aacctgccct gatttggcgc gtcttgtgca acacaagttg     71880
     ttccacaggc tggagaaacg ctgttctccg gtcacagagg cgtggataca gtgctcaggt     71940
     agtcacgcag tgaagtcatc cgggtgtgcc ggagtaacac cggcgggccg acgggcatgg     72000
     gagacgggga gccgcgcgtg ccaactgcca ttgccgtgac cagtgccgac ctggcactgc     72060
     cgccacagga cgaacgcacc ctgcccgcgg ccgtgctcca ggacgtcgac cggcgccccc     72120
     tggagagcgt cctggccgag ttgcagacgc tggtcgatca gtgcgggcac gtgatcgtcg     72180
     tgtgctccca ggccgtcccc gcgagcgtgg aacgccgcct gcacaccgtc cgcgccctcc     72240
     tggagaccga ccgcatcgcc ctgttccggc cgccgctgcc gccgctcggc atcgcggtgc     72300
     tggcccgcca gttgcgccag ctggcctcct gcgacctcag cccgggtgtc ctcgcctccg     72360
     ccggccggct gctcacccac tacatccacg ccggtgcgct gctcggctcc gtcgcccggc     72420
     tcgaccacgt ccccgtgggc ctgaaggcgc acgccaggtc ctgggtgccc ggcagccagt     72480
     tcggcgtcgt cgcccacccc gtgccgcaac tggtgcggat cggccccgaa gccgccctgg     72540
     ccgggcccga gttcggcacc tggctgctgg tcgccaaggg acagcacccg accgactggg     72600
     tcaccggctc gctcgccccg tcctggcacg tccaggggct gcgtgagacg gccctgcccg     72660
     ccgagtccgc cacctggtgg gggaccgggc ggctgaccga gttctgcgcg tacctccccg     72720
     acctctcggt cctctaccaa ctcgtcacgt ccgtacggcg gggcacctgc cactggtgcg     72780
     gcatcgacgt catcggcgac cgctgcgtgt tctgctccgc gacaccaccg gtctacgacg     72840
     acggcggtgc cgggggcggc ggccgggacc gcgcgctcgc cccccgccgc gatcccgccc     72900
     tcggccgccg tcgtgagaga cgagccctga ctgggtaggt ccgtagcgcc ccgtccgctt     72960
     ccgcgagcca gacctcgccc gcccggcccc tcgcccccgt ccgcccgcca ccagtccgct     73020
     ccccgcccgc cccccgtccg ctccccgttc gtccgccacc tgtccgccca cccccgtccg     73080
     tccggacgtc cgacccccca atgaggttgc acggcccatg aactcccgtc acgccgcggc     73140
     atcatcctgc tgatcctgtc ggtcctctgc gccctgggcg ccttcgccgg cgtgctgtcc     73200
     gtcatcaacg acgtgaagtc caaggtcggc cccgaggtga ccgcgtaccg ggtgaagtcc     73260
     gacatcgagc cctacacgga gctcggcgcg actcagttcg agaaggtcga gatgcccgag     73320
     cgctggctgt ccgagaacgc cgtcaccgac ctgtcccggg tccgcggaaa gatagccgtg     73380
     accacgctga aggcgggctc gctgctccag accgacatga tcgtcgacac gcccgccctg     73440
     cggcccgggc agcaggaggt cgccatcatg atcgacgcgg cgaccggcgt cgccgggaag     73500
     atcaccccgg gttccaccgt caacgtgtac gccaccttcg agggcccgcg cgagggcgac     73560
     cccgaccagt cgaagatcat cgtgaccggt gccaaggtca tcgacgtcgg cgaactcacc     73620
     tcgctcgaac ccgacgagga cagccgcgac cgcgaaccca ccgacgccgt ccccatcacc     73680
     ttcgccctgt ccaccatcga cgcgcagcgc atcacctacg ccgagtcgtt cgcccggcgc     73740
     gtccggctcg cgctggtggc ccccggcggc gacaccacgg tccccgacaa ggaccggacg     73800
     tacgaactcg cgaaggacaa gtgagagccg tatggccacg aggatcctcc cggcagtcgg     73860
     cgacccggac gccgtacggt ccctcacgac cctgctcagc cagctgccgg aggccgaacc     73920
     ggtcgccccg gtcaccgact ccacgcagct cgtcgacacc ctcgcccgcc tggccgccga     73980
     atcggtcgac gaactgcccg aggtcgtgat cgtccacgag cgcatcggac cggtcccggc     74040
     cctcgagctg atccgcgagg tcgccctccg cttcccggcc gtcggcgtca tcctcgtcac     74100
     ctccgacccc ggccccggcc tcttccaggc cgccatggac cacggcgccc gcggcctggt     74160
     cgccctcccg ctcggctacg aggagctcgc cagccgcgtc caggcggtgg cccagtggtc     74220
     ggcgggcgta cgccggcacc tcggcggcgc cgtcgacgtg ttcaccggaa ccggcggcac     74280
     cgtcgtcacc gtcagcggcg cgaagggcgg cgtgggcgcc accctgaccg ccgtccaact     74340
     cgccctggcc gcacaggcct ccggccggtc cacggccctg ctcgacatgg acctccagac     74400
     cggcgacgtc gcctcctacc tggatgtcca gttccgccgc tccgtggccg acctggccgc     74460
     catcaccgac ctctccccgc gcgtcctggc cgacgccgtc ttccgccacg acagcggcct     74520
     ggccctgctg ctcgcccccg gcgagggcga acgcggcgag gagatcaccg accgcgccgc     74580
     ccgccagatc gtgggcgccc tgcgctcccg gtacgaggtc gtcgtcgtcg actgcggcgc     74640
     ccagctcggc ggggccggcg cggccgccgt ggagagcgcg gacacggcgc tgctggtcac     74700
     caccccggac gtggtcgccg tacggggcgc caagcgggcg gtgcggatgt gggaacggct     74760
     gcagatccgc aaggcggcgg agaccaccgt ggtcgtcaac cggcacaccc ggggtacgga     74820
     gatccagccc ccgctgatcc agaagatcac cggcaccgcg atcgccgcca ccacggtccc     74880
     cgccaacttc aaggaactcc agggcgccgt ggacgcgggc cgggtccacg aactggacgg     74940
     caggagcacc gtgaaacagg cactgtgggc cctcgccggt gaactgggcc tggccggcgt     75000
     gcccgacgcg ggccggaagg gacacggccg gctcaagggg gaccggggcg cgtccggctt     75060
     ccggcgccgg aaggacggtg ccgggtgagc gggttacgcg ggcgggaccg cgcccgggac     75120
     ggcggtcagg tcaccatcga gttcctcggc atgacgccgg tgatcatcgc gacgctggtg     75180
     gtgctgtggc agctcgtgct cgtgggatac acgtacacgc tcgcggggaa tgctgcggac     75240
     gaggcggtac gggcggcgac ggcggccgag cgaggggcgc ggcagggggc ctgccgggag     75300
     gcgggcctgg acaagctgcc aggctcgtgg gagggaggtg ccagtgtcgg ctgcgacgcc     75360
     gcgggcggtt tcgtcaccgc cgacgtgcgc atcgaggtcc ccctcctctt cccgggcacc     75420
     ctcagcctcc cgttcaccgt gcacggccac gcgggggccg tggaagagga ggacgactga     75480
     catgccgtac tcccgaagga agaagccgac cgggacgccg taccgccgcg gggcgcgagc     75540
     cggggaccgc ggccaggtgg ccatcgagta cctcggcttc ctcccgatcc tggtgctggt     75600
     cggcatggcc gccgtacagc tcggcctgat cgcgtacacc gcccagcagg ccggtacggc     75660
     ggcccgcgcg ggggcccgca gcgcctcgct ccgggagagc gcggagacgg cgtgcgcggc     75720
     ggccgtcagc agctggctgg cggacggcac cgactgcccc gcgtcctacg gcggcgacga     75780
     ggtgacggtc accgcgaccg tcgagatccc ctcgatcgtc cccggctggg agttcgaccc     75840
     cgccacccgg accgccacca tgccgctgga ccactgaccg aggagcgaag gacgcatgag     75900
     cctgcgcgca cgcatccact cccccgagga gcacggcagc cggggcgagg acggacacct     75960
     ggtcgcctcc taccgggcca aactcctgga ggagatcgac ctcgccgaga tgagcgcgct     76020
     cgcgacggcc gagcgccggg cccgcctgga gcgggtcctc gggcacatca tcagccgcga     76080
     gggcccggtc ctgtcgacgg tcgagcgctc ccagctgatc cgccgggtcg tcgacgaggc     76140
     cctcggcctg ggcatcctgg aaccgctcct cgaagacgcg tcgatcacgg agatcatggt     76200
     caacggcccg gacgcgatct tcgtcgaacg cgccggccgc gtcgaacagc tccccctccg     76260
     cttcgcctcc cacgaccagc tgatgcagac catcgagcgc atcgtctcga cggtcaaccg     76320
     ccgcgtggac gagtcgaacc cgatggtcga cgcccgcctc ccctccggcg agcgcgtcaa     76380
     cgtcatcatc ccgccgctct ccctcaccgg cgccaccctc accatccgcc gcttcccccg     76440
     ctccttcacc ctccaggagc tgatcggcct gggctcgctc gacgagaaca tgctctacct     76500
     gctggcaggc ctcgtgcagg cccgcttcaa catcatcgtc tcgggcgcga cgggcaccgg     76560
     gaagaccacc ctcctcaacg ccctctccgg cctcatcccc gaatccgacc gcatcatcac     76620
     catcgaggac tcggccgaac tccagctcca gcaggcgcac gtcatccgcc tggagtcgcg     76680
     tccgcccaac gtcgagggcc agggccgcat caccatccgc gacctggtcc gcaactcgct     76740
     gcgcatgcgc cccgaccgca tcgtcgtcgg cgaggtgcgc ggcggtgagt ccctggacat     76800
     gctccaggcc atgtccaccg gccacgacgg ctcgctggcc accgtccacg ccaacagcgc     76860
     ggaggacgcc ctgatgcgcc tgcagaccct ggcctcgatg tccgacgtgg agatcccctt     76920
     cgtcgccctg cacgaccaga tcaacagctc cgtcgacgtc ctgatccagc tcacccgctt     76980
     cgccgacggc gcccgccgca tcaccgagat cgccctgctg gccagccacg gcggcgagcc     77040
     ctaccgcctg gccacggtcg cccgcttcaa cgcccgcccg atgtccgccg acggccgcgt     77100
     cgtcggcgcg tacgagtacc acccgctccc gcaccgcacc gccgaacgcc tctacatggc     77160
     gggccagccc atcccgcagg ccttcggcgt ggcccacaca ccggaccagc tcaccacccg     77220
     agaagccagg taggaccgcc cgatggaacc ggaactcgac acgctcgtca cgctcaccac     77280
     cggcgtcacg ctgctgacct gcgtcctggc gatcgtcggc ctgcactcct acgccgccgg     77340
     caaggcccag cgcgcggccc tggtcgaccg cctcaccgcg accggccagg caccgtcggc     77400
     cggacgccga cgccgcttcc cgaccctgga ccgccgcctg cgccgcaccg ggctgggccg     77460
     gaacctggaa cgccgcctgt cggcgaccgg cctggacgtg acccccggcg agttcttcgc     77520
     gtacatgctg gcgacggtcg ccggcctgtg gctgatcggc caggcggccc tggccccctt     77580
     cttcggcccc ctggcgggcc tcctcggcat cggcgtggcg atccagttcc tcaactggca     77640
     acgtcagaaa cgcatcgaga agttcatcaa ccaactcccc gaactcgccc gcattctcgc     77700
     caacgccacc caggccggac tcgccctgcg caccgccatc ggcatggccg cggaggaact     77760
     ggaggccccg gccggcgagg aactcggcaa ggtggccgac caactcgcca tcggcgcctc     77820
     catggacgac gccctcggcg aactcgccgg ccgcctcccc tcccgcgaac tggtggtcct     77880
     ggtcaccacc ctcgtgctgt ccaaccgcgc cggcggccag gtggtcggcg cgctgcgcaa     77940
     cctgacggag accctggagg aacgcaagga gacccggcgc gaggtccgca cccaactctc     78000
     ccaggtcacg atgacgtcgt atgccgtccc cgtcctgggt atcggctcgt tgctcctgat     78060
     gaacggggtg aaggacggcg ccctggaacg catgacgggc tccccggccg gccaggccgc     78120
     cgtgatcacc gccttcgcgc tctacgccgt cggcttcgtc ctcatccgcc gcctgtcccg     78180
     catcgacgtc tgagaggagg gaagagaccg ccatgccccc cgcactcccc gcagtcctcc     78240
     tggccctcct catggccctg gccgtctggg gcgtcttcgc cggcgtccgc atgtaccgcg     78300
     ccgaggccaa gctccccgac gacctcgccc tcgccctgga ggtcggcgcc acccgcaccg     78360
     gcgcggcgca ctccctcatc gaccgcatgg gcatgcgcta cgcccccgcc gtactgcgcc     78420
     tgatgggccc ggccctggtc gcccggtacc gccgcaggat cgacctggcc ggcaaccccg     78480
     gcggcctcac catcgaccgc tacgccgccc gccgcgcggt ctacggcttc ctgggcgcgc     78540
     tcggcttcct ggtcttcctc ctccgcggcc agtacctggt ggccctcctc ctgctggcct     78600
     tcggcgcgtt ctggacggag gcgggcatct ggtccgcgat ccgcatccgc aaggacgtca     78660
     tcgagcgcac cctccccgac ttcctggacg tcctcgcggt cgtggtcagc gcgggcctgg     78720
     gcttccgcca ggccctggac cgggtgtcca cccgctacga aggtccctgg gccgacgaac     78780
     tgcgcatcac gctccgccag atggacctcg gcatgagccg ccgggaggcc ttcacggagc     78840
     tgcgccggcg caacgactcc gagcaggtgg ccatgttcgt gacggcactc cagcagggcg     78900
     aggaactggg cgcccccatc gtcgacaccc tggtctcact ggccaaggac atgcgccgca     78960
     cggacgccca gaacgcccgc cgcaaggccg cccgcgcggt ccccaaggcc acgctgatga     79020
     tcacgacctt catggtcccg gccacgatga tcctcctcgg cgcaggcctg atcctgggct     79080
     cggggacgga cttcggaacg atcacgggtg agtaggggag tgcgactgca catgaacagg     79140
     agaagacaac tcgcagcgct ctacgaccca ttggcctcac ttcgccgcaa tacctttcgc     79200
     attcgcaatc cgttgtggga cagtcgacac ctggtactcc cgacaggtcg aggtcccaac     79260
     cgagcgcgag ggaggtggag atcgtggatg ccctgacgtc cggcacgacc agccagcaga     79320
     tcaccgccgc ccacccgcac gaggaacacg gcttcgtcca ccctggaggg gaacaccatg     79380
     accaactggc tccacaccgc agccgcatac ctgcacaccc gcctcaccac ccggcacgac     79440
     aagggccaga cggcggtgga gtacctgggc atcatcgccg tggtggtggc gatcgtcctg     79500
     gcgatcacgg ggacggacat cggcgagacg atctacaacg cgatcacgga caagatcgac     79560
     gaggtcatcg actgacgttg tactccagcc aacgggacgc agggcaggct ttccccatct     79620
     acatcacagt ggtggcgggt ctgctcttcc tcgcgctcgc gtacttcgcg gtcggccaag     79680
     ccgcgacgaa ccgcaacggg gcacagacgg cagctgatgc ggccgccctc gccgcagcgc     79740
     aggaaacccg cgatcagctc gcgggggagt gggtggacaa cctgtcggac cccgcttcgt     79800
     gggaacgcat cttcgacggc ttggggacag ggcccagcga ctcgtgctgg cgtgcttctg     79860
     aacttgcggc acagaacgac gcccaagtcg acagttgtga gccggacggc ccgctcggat     79920
     tcaaggtcga ggtcacgtca gacgatccgg tcggggactc gattgttccc ggtacagagg     79980
     acaagcacgc gcaagcatct gccactgccg tgatcgaacc caattgtgaa ttcgagctgc     80040
     ccgacgggga cgggaaggac gatgtgcttc ccaggatcac ctgcgatgat caggactggg     80100
     aactggatcc ggaggatctc ccagagttgc cgaagcccca ggacctgttc gacgttcatc     80160
     tggccgacag ttaatcggga cgacgagtga cgaagggagc ggaatcatgg gcatccggtt     80220
     cgccgtgaag gtccgcaacg gagcgaccgg cttgactgtc gcggtcgggt tggccctctg     80280
     cgtggtcggt tgcagcagtg ggggcggtga cgacaacaag gctgaggcat cggcatccgc     80340
     tacagcaggg gagcagtcgg atcccacggc tcaggagggc accgactctc ccctggccga     80400
     actcaaaggc gaggacggcc tactgctgac catcgactcc gccgaacgcg acgcgggggg     80460
     tttcgtgacg gtgagcggcg agatcaagaa cgacggtgct gaggcggcgc gcgtcccgat     80520
     tcagaccagg ggggacgaga cggagatcat gcgccacggt ggatcactcg gcggcgccac     80580
     tcttgtggac ccggcgaaga agaagcgcta ttacgtgttg cgtgacaccg acggccgacc     80640
     cttgacgacc acagacatgc ctcggatcaa gccgggagcg tccattcccg tcttcatgca     80700
     gtttccggca cccccgaccg atacgggcaa ggtcaccttc caactcccca ctttcgcctc     80760
     cgcgcccatt gagatctcgg gatgaagcga acaatgcaca acagccgcgt cgcagtgctc     80820
     ctcacgacgt ccgtactgac ggccgcaagc gttggcgtga gccagtccta cgcagctgac     80880
     gaccccccgg gcaccgaacc ctccgcctcc gcccccgtgg aggtggaccc caacgacccc     80940
     gacctgaagc tcccggacgg ggccacgctc gcgcaggcga aggtgctgga catcaagtcg     81000
     gtggtggaag agcagagcgg tgacgaacgc cgcgaggaca ccaacaccag cgtgacgctc     81060
     gcgctccagg ccgaggtgct gttcggcaag gacagctcga agctcggcgc ggaggcgaag     81120
     tcccgcatca gaggcatcgc cgacgagatc aggacccaga acgccacacg agtccgcgtc     81180
     ttcggcttca ccgacgacct cggctcctcc gcccacggcg acgtactctc caaacgccgg     81240
     gccaacgccg tacacgacgt cctgtcccag tccctcaacg acgccggcat cacctacgag     81300
     gtccgcggct acggcgagca gtaccccatc gccgacaact cgacggaagc cggccgcaag     81360
     aagaaccgca gggtcgaggt ctccttcccc cgcacggagc cctgacgcac cacgaggtac     81420
     cgaacgccct cccgcccaca ccccgccctg agggccctcg cggcgctgac gccctcacga     81480
     cggccgcgtc ccctcgcgta tgtcaccccg tgctgacgtc gatcagcagg ttcttccgcg     81540
     cggacgcgaa caggcggctc tgctcggcca gccgctgcga tgtcgcctcg gtgtcgacca     81600
     gcaactggta cacgtagccg gccttcccgg cgacgaagac ctccaggcgt ttgcgcggtg     81660
     cgctctgctt ctcccagtgg tagtcgatct ccagccagag agcgtcccga ccgttctggc     81720
     gcgtcttgtg cgtggtgacc tcgacgccgg ccatcgacga ctcggaggtg tcgcgatacc     81780
     aggccagctg cccggcggag gccgcccgag cggtcgtgcc gtacgtcctg tcccgcttga     81840
     cggtcaggtc gtacacgccg tccggggaac cccaggagct ctgcagttca ccggcgggct     81900
     tctcgcccca tccgcccggc cgaccgaagc agacggtcag cgcggggacc tcgacccgcc     81960
     gccacccctg gggaagagac gacgagcagg acgacgccga cgccgaggag cggggctcgt     82020
     ctcctccggc aggaggttgc ccagtcggcg cggagcccga aggcgcggtc gaagagggca     82080
     ccttcgagga accagaagcc gaagccgacg cggatgccga cgccgatgcc gaggcccctt     82140
     ccgaacccgc atccgcagtc gaatgcgacg cggccggggc tgcaccggaa gtcgggccgg     82200
     agtccgccac actccgcccg atcggcgagg agttcccgac gagaggtatc ccgaagaccg     82260
     ccaggaggag ccccgcgacg gccgtgatcg ccgagaccac ggccgccacc tcccccatcc     82320
     gccgccccgg tgaggcgccg ccacccgaac cgctcaaatc tcctaccgag cctctctgtc     82380
     accgatcggg ctcacctccg tcgggtacac ccgcaccccc tgtcctcggc cgagcgcgca     82440
     gacatccttg acgatcggcg caggacggcc cgaactcccg aactgaccgg ccgaccgctc     82500
     ccgcatggcc ggacagcggc ggacaatgcc gggagacgag caaccgcggc gggggcggag     82560
     acacacggag cgggggacag cggtggagca gaccggaacg tgggatgcct cggtgttcct     82620
     ctccacggac agcgtcagcg gcccggaggg gttcggctgg tggggcgaca tggtcagccg     82680
     ggcggtgatg ccggtgtcga tcgccagcga acacgccggc cacttcaagg gcgaggtcac     82740
     cacgctggaa ctggtggaca ccgacttctc ggccttctcc ttctccccga tgtcggcgcg     82800
     ccggaccccg gaccacatcc gggcgtccga cccggagaac tactacctct tcctcgtcca     82860
     cggcagcccg atcggtctgg agcagcgtcg caacaacgcc ctcctccggg cgggagacgt     82920
     ggccctcttc gacacctcgc agcctctggc ctgcgagttc caggaccagg gccgcccctc     82980
     gcgggtgagc gtgctgcggc tgccccggac cgccctgccg ctgcccggcg acagaacgga     83040
     ccgtctggtg gccacgccgc tgcccgcccg caccggttcg ggcgcgctgc tcacctccta     83100
     cctggccgga ctgcgggaga acgccgcgca ctgcggcccg acggagctgc gccgcctggg     83160
     aaccatggcc ctcgaactcg ccgtcacctt cctcgccgcc cgcctggaca gccctccggc     83220
     gttaccggcc gagagccgca ggcgggtgct cctcgcccgt atcaacgcct acatcgacca     83280
     caacctgcac gatccggacc tcggcccggc cacgatcgcc gcccaccacc acatctcgat     83340
     acgcctgctg cacgccctct tcgaggagga gccggaaacg gtcggcgcca cgatccgccg     83400
     ccgcagactc gaacgcagcc ggaccgacct cggcgacccc cgcctacgac accgcacgat     83460
     cggcgagatc gccgcccgat ggggcttccg ccaccccgcc gccttcagcc gcaccttccg     83520
     cgaggcctac ggcatctccc cgaccgaagc ccgaaccgca ctccacgaca aacagccctg     83580
     cactccccgc cgaggaccgg ggcatcgaac cctggcacct tgaaacggcg agactgcacc     83640
     gagcggggga gaagtccaag acatgacacc gaacgacacg ggggagcccg agggcagacg     83700
     cccctgggaa cgttcgccgg cccgaagcgg accaccgcac ggcggccccg gcggcccggg     83760
     cgacccccgc ccggtgcacg gtgacagttc atggcacacg acgcggagcg tgccgtcgat     83820
     cgtggtcgtc gtcctcatcg tcatctggac ggtcttcgcc gtgcagtgga aggagaagga     83880
     ctgtgccttg gtgccgacct cgtacctgct cgtgatcacg cacggcacgc cgagcgtctt     83940
     cgagggttgc ggcgaccacg ccatcgacgt cacggacgac tagccccgcc gactagccca     84000
     gccggcctgc gccgtccgcc gactcggccg agccctccac gacctccacc cgcgccccca     84060
     cccgcacccc ccactcatcc atcgccccgg cctccgcctc cagcacgtgc cgcgcccgca     84120
     accggggcag ccccagcctg cccggccgca tcgtgcgcac ggcgatgacg ttgagccgcc     84180
     ggtcgagata ggccacgtcg atggccatcc gcatccggaa cgtgtgcacg ctgttggcgg     84240
     gcgtcagcag catcgcccca tcgaccgagc cgcgccccaa cagccccttg gtacgcgcgc     84300
     ggtacgagcc ggcgatctcc agcggaacgc acgcaccctc gccgctctgc cccaccacga     84360
     ccagagcccc cgccccgtcc cgccaccgct gtcgtcccat tccgatgccc tccgtgcaaa     84420
     actgcttcgc tgacgagaag ccccgcccca cccaggagcc gatagtgagt gcccgttgcc     84480
     ccgccctctt cacagcgctc acgctgaccg ccacggcggc cttgacgctg tccgcgtgcg     84540
     gcagcgacga cagccccggc aaggggaagg acgcggttgc cgaggcggat atgggcacca     84600
     cttccccgtc tgcctcgccg accgagtccg agtcgtcgaa ggccggtaga ccgaagatcg     84660
     agctcccggc cgacctctcc tactcgttcg agtggccgaa gtcgggagac caggtcaagg     84720
     acgcgatcct tgcggatgcc gagcagtcca tcaaggccgt ggacttggcg atcgtcaacc     84780
     aggacgcact cgacaaggcc tatctctact actacgaggg cgaggctgcc gccggcacgc     84840
     agaagttcat ccagaactat gtggatcaaa aggcgggtat cacgggacgc taccgcttct     84900
     acgcccctga agtggcggtc gatgaagacg gcacggcgtc cttcacgtac tgcgaagacc     84960
     aaggcagggc gtacgtgaag tacctcgaga ccaacaaggt gagaagaacc gaagtatccg     85020
     cacagagcta cgtcatctac cacacttcac tgaagaagaa cggtgaaggt gtgtgggaga     85080
     tccaaaagat cgactcgcag agtgggagcg ccaagtgccg gccctgacgc atgcggggca     85140
     ggcgccgccc gtcgcgccac ggtgagccgg tgcggcaaaa gaggttcccg gacggtggcg     85200
     gacaactctc ctgcaggcgc cgcctggtca cgaggtttca ctctggtgtc cctcggcctc     85260
     gctggatagc gttgcttcgc tgaagagaag cctcgtcccc tccaggagtt gaccgtgaat     85320
     cgccgccgac ccaccctgct cgcagcgctc acgctgaccg ccgcagcggc cttgacgctg     85380
     tccgcgtgcg gaagcgacgg cagcccgggc aagggggagg gcgagatcgc gggatcggac     85440
     gtgggggacg agtcgtctgc ctcgccgagc ccctcctcct cgtccactgc ggcagccggc     85500
     cgaccgaagg tgaagcttcc gccggacctg aggctgacct tcgaagacgc agagaccgga     85560
     gacccggtca aggacgccgt tctcgccgac aacgcagagc ggatgcgtgc cgtcgacgct     85620
     gccatcagcg gtacggaccc taagggcaag gcgcttggct tctacaacac gggcaaggcc     85680
     ctggaagcag cagtgtcgtg ggtcgggcag ttcgaaaagg ccaacgctac cgtgaccggt     85740
     cacgttcggt tcttcgatcg ggacgtgaca ctcaagggca caacttcggc tgttctgacg     85800
     ttctgcgccg acgagagcaa ggggttcagc aaggacaagg agaccggcga ggtgaccaag     85860
     acgcccgtca ccaaggacag ctacgtccag tacaacacca ggctcgacaa gaatgctgac     85920
     ggtgtctggc agacatcgca gatcctctcc acgagggggg cggcccagtg ccaggcctag     85980
     cggccgacac gcgaccgacc ggcgacgcct tttgtccggg tgtgggtgcg aggcgtgtcc     86040
     agtgaaactt gggtcaccag tgcctgtgtg gtgatgtgct gttcgaccga aggtgcctgg     86100
     tgggcggccg agtcatcgtg tggtacccgt catgaccacc gcttcactct ggtgtccctg     86160
     ggccccggtg gatagcgttg cttcgctgaa gagaagcctc gtcccctcca ggagttgacc     86220
     gtgaatcgcc gccgacccac cctgctcgca gcgctcacgc tgaccgccgc agcggccttg     86280
     acgctgtccg cgtgcggaag cgacgacgac ggtgccgcaa aagacagcga caagatcgcg     86340
     ggtgctgaca cgggtagtga gacgtcagct gccccgagtc cgagcgagac ggacaccgca     86400
     ggccgaccga agattacctt tccttccgat gcgaagaatg tcttcgagta cgagaagacg     86460
     ggtaacgcga cgaaggatgc agccctcgcg gacagcacac tgagtgtcaa ctctgttgat     86520
     gaggcgatct tcgaggggag taccgacacc aaggcacttg gcttctacaa tgccgagtcc     86580
     gccttgagtg actcgatcac gtatgtgttg gggtacatca acaagaatca cacttgggtt     86640
     ggtgagacgc ggtacttcga ctacaaggtc agtctctcgg gggagcttga ggcgtacgtc     86700
     acttactgct cggacgagag caagtcattc atcaaggaca agaagacggg aaaggtcaag     86760
     gacacgccga caacggcgga cagctacgtc ctttaccacg caaagcttgc gaagaacgct     86820
     cagggcgtct ggcagacgac cgacatcgca tcaactcggg ggagtaaaga atgccagccg     86880
     taagtaaatc tttgaggtgt gcgaccgtag ccgcgatcgt tctcgtctcg gtgatatcgg     86940
     ccccgatggc cttcgcgggc gggcgaggcg agggcggcag tcgcggctcc acggatcaac     87000
     aagccaacgc cgacggtaat ggcaccgttt cagtcacggt aggcggtgtc gtcttcgacc     87060
     gttcgaagaa cgggagcggc gattcggtcg gtgcggtgac gtcgtccacc tcctggagcc     87120
     cgccggcgtg ctggtacgcc ccgaagtaca cgcccgagga gttgcaggat tacctggaac     87180
     ccatctggga ggccgagtcc acggggtacg agtgggatgc caagcagcgg gagaagtaca     87240
     acgcgaagga tgagaagaag ggcttcaaca aggacaagac gggcaagggc ttctggtggg     87300
     gctcgtacgt gaacgagagc ttcccgcccg gctgggacaa gtgcgacacg gactatttct     87360
     gggtggacac gggtgacccg ccgcccgcgg acaaggagaa cgcggtcacc ccggaggtcc     87420
     tcgccgaact cgcctacgcg gagatccgcg tccccgggac cgaggtgacg ctggcgcccg     87480
     ccgaggcgac caaggtgaac cttccgacgt gggcgtggct ggacggtgcc gagttcaagc     87540
     cggtctcggt caccgcgtcc gtgaaggaga tcggcatcga ggcgacggcc acggccgagc     87600
     cggtctcgct gcagatcaag ccgggcaccc cggacgccga gacctacccg gcgtcgggag     87660
     tctgcgagat caagaacggc cgtatcggcg ctccctacga gaagggcagg gcggacgacg     87720
     cacctccgtg cggcgtgaag tacctgcgtt cctcgggcga cggcacgttt ccgctccagg     87780
     cgacggtcac gtgggagatc cactggaccg gaaccggcgg cgcgggcggc gaccttcccg     87840
     acggtacgtt cggcgccacc caggacgtcg tcgtccagga gatccaggcc gtcaaccggt     87900
     gaccgtgccg aagcatgtgg cctgagcccg acgtgtcccc cgtgagcccg gcgcgtcccc     87960
     ggggcgatgg ccccgaaatg gtgttgaacg ggggctcggc cgggggtagg aaggcgccat     88020
     gactggactc ggtgccgtat tccgccccca gctcgccccc gagcggctcc gtgccgtggc     88080
     tcgggtcgcc gatgaggtgg ggctcgagga gctgtggctg tgggaggact gtttccggga     88140
     gggcgggatc tccacggccg cagccgccct cgcctggacc gagcgggtgc gggtcggggt     88200
     cgggctgctg cccgtgccgt tgcggaacgt ggccgtcacc gcgatggagg ccgccacgct     88260
     gcaccggatg ttccccggcc gccccgtcct cggcgtggga cacggcgtgc aggactggat     88320
     gggacaggtc ggggcccggg ccgagtcgcc cctgacgctg ctgcgggagc atctcgtggc     88380
     gctgcgggag ttgctgaggg gcggacgggt gacgtcgacg gggcgctacg tccgactcga     88440
     cgacgtcgcg ctggactggc cgccggagca gcccgtcgag gtgctcgccg gcgccaccgg     88500
     gccgcgctcg ctgcggctgg ccggtgaggc cgccgacggc accgtgctca ccgcgaacac     88560
     tccgcccgac ggggtgcgcc gcgcccggcg gctcatcgac gaagggcggg cggcgagcgg     88620
     gcggacggag gcccacaggg tcgtcgtgta tctcctcgcc gccaccggat ccggtgccgc     88680
     tgaacggctt cggaacgagc tggtcgccga aggcgtcggg gcggtgccgg atctcggggt     88740
     cgccggagac gcccaggccg ttgccgacgc cgtgcggcgg ttggccgagg ccggggccga     88800
     caccgtgatc ctccagccga ccggggacga gcccgatccg gaggggttcg tccggttcgc     88860
     cgccgagcgg gtccggccgc tggtggcctg aggctggccg gcggtggcct catgccgtac     88920
     gggttgcacc ttccgtagcg gcatgtgatc cggtggacct acgtcccgat gccgtgagga     88980
     agggtccctg tccatgcgtt cgtccttcat gccaccccgc caggtcaaga tcggtgacgc     89040
     ggcggccttc gtcggcagca cgccacgggc gatccggcac taccacgaga tcggcctgct     89100
     ccccgagccc gagcggggca gcgacggccg ccgccgctac gggtacgagg acatgatccg     89160
     cctgctgtgg atccgcagga cggccgacgc agggatcgcc ctggacgaca tccgtgacgc     89220
     ctttgccacc ggcacggatt ccgccggcgc ggagagcgga gaagatgtcg cgggcatcct     89280
     ggagcggttg gaggaaaccc tcgccgaacg ggaggcggaa ctgcggcggc agcgggccgc     89340
     cgtgcggcgg atgcgcaccg aaggcagccg gacgggcctg ctctccgact tcgtcaccga     89400
     acgcctcaag agcgcgcccg agggctccct gcgccaggcg gacctggaca gtctgctggt     89460
     caccgagcgg atcctcggcc cgctcggcgc ggccgtgcag gccacccgct tcgtcgtcct     89520
     ggccacgcat cccgctctgc gggaggagtc cgaccgcgtc gacgacgccg aggaggcact     89580
     cgacgacggt gtcgccgtcg atgacccacg ggtggctcaa gtggccgccg agcggcgcgc     89640
     cttcgaaagc gccctcgagg ccgtcatcga ggagtccggc ccgggtgcgg acgacgatgc     89700
     cctcttcgac gcctgggaca ccttgcaccc tgccgccgac ggcgcgggcg aggccgactc     89760
     cgtcagcgcg ttcgaagcca ccggctggat gccctacgac ttctccccag cccgcctgcg     89820
     ctgtatggaa ctggccgcag aactcgccgc agacccgtca gcccgcgaca acaccgctgc     89880
     ccagagctat cgagcggagc cttcttcatg acgccccccg cccaccccgg aacctttgag     89940
     cgcctcgtgg ccgaaggcgc cgccgtcccc accgaagggt gggacttctc ctggttcgag     90000
     gggcgggcca ccgaggcccg gccctcctgg gggtacgcgc ggtccatggc cgggcggctg     90060
     gccggggcca ccgccgtact ggacgtgcag accgggggag gggaggtgct ggacttcgcc     90120
     ctcgaagccg ccggccccca ccgggccccg ctcgtcgccg ccaccgaggg ctgggcgccc     90180
     aacgtcgccc aggccacccg gctgctgcgt ccgcgcggag tcccggtggt cgcctcggcc     90240
     gacgacgcgc ccctgccctt cgcggacggc gccttcgacc tggtcgtgag ccggcacccc     90300
     gtcgagccgc actgggacga ggtggcccgc gtgctcatgc ccggcggcac ctacttcgcc     90360
     cagcacgtcg ggcctgccag cgtcttcgag ctcatcgagt acttcctcgg gccgctgccc     90420
     gaggacagcc gccggcaccg tgaccccgag cgtgagcgcg ccgacgccga ggcggccggc     90480
     ctggaggtcg tcgagctgcg ggcggagcgg ctgcggatgg agttcctcga catcggtgcc     90540
     gtggtccact ttctgcgcaa ggtggtgtgg atggtccccg gtttcaccgt cgaggcgtac     90600
     cgggaccggc tgcgcgacct gcacgaacgc atcgaggccg acggaccctt cgtcgcacac     90660
     agctcccgtc acctcttcga cgtgcgcaag ccggatgcca cgagcgggcc cgacgcgcgg     90720
     ccctgacacc cgccggacgg gcccggaccc gcgtcctcac gcgtgcgccc ccaccgtcac     90780
     ctccccgatc accagctccg ccgccgcctc cagtacggcc cccacccgtt ccacgcagtc     90840
     cgccagctcg cgttcctgcc gtgccgtcaa gcgggccagc ggttcgaccg tgaccgtcgt     90900
     acggcggccc cggcggcgct ggtgccagac gcccgccgcg accccgtcga ccaggagcac     90960
     ggggaagttg cccgcctgcc cgcccgccag cgcccgccgg taggcggccc ccgggaagag     91020
     cagttcccgc ggctgcgcgg cgacgacgta cgcgtcgaag tacggcagca accgcacccc     91080
     gcgcagcagc tcgtcccgtt ccggggcgtc ggggaaggcg gtgtcgcccg ccgccaccca     91140
     cgccggggcg ccctcgaagc ggacctcctc gatctcgccc gcggctgcca gctcggcgta     91200
     gcgggccttc gcccagccgg gtggtgcggc cagccagcgg gcgaagtgct ggggcgtcgc     91260
     cggtccgtac gcgtacaggt atcggcgtgc gaggagccgt gacgcctcct cgggcggcag     91320
     cggggtgaag cggggcggcc gggtgtacgt caccctgcgg ccgcggttcg ggccgaagga     91380
     cagggcgccg cactggccgg cccggtgcag gacctggcgc cagcggggcc acatggtctg     91440
     gaatgcgggc atgaccaggt cgccggccca cgggccggtg cgcgcgacga cctcctcgcc     91500
     gagttcgtcg acggtcagga aggtgccgtc gagcgcgtcg gcgatcgcgg ccaccacctg     91560
     cccggcctgc tccccggtga ggcgtacgtc ggtggggaag gcggccgggc cggccgggat     91620
     cgcggggagc gcggcgcacc acatcgggag gtcgcgggcc gggagcagat gcaccgtccc     91680
     gcgcgggccg tgcgtcttca ccagcgcggg cgcggggggc gcgagcggag cggtgggcca     91740
     cagggcgtcg cgtacgtccg tgcgggtcac gccgtcggcc cgcaggccga ccgacagctc     91800
     ggccgcggac agtacctggg cgtggacgcc cagcatcgcg gcggccacgt cggcgacggg     91860
     cgtgcccgtc cgggcccgcc tggccaggaa ctgccgttcc aggcgtcgtg cgctcgccgc     91920
     ggcccaagtg atccccgtcg acttcgtcat gaggcgacgt taggtcagga gtaggacagg     91980
     tttcgtcctc gatcgtccat ggtcgccgtc ggtcgtcctc ggccgccctc ggtcgtccag     92040
     aggtggatct tccgggctta agtggcacac cttcgcaaac atccccttgc gcggaggcag     92100
     ggtacgcaat cacccgccga tcctcacagg gtttccacat cgttattcat cgatgtcctc     92160
     ttcgagtcga aaacgccctg cccggtcgcg taagttcgga gccaggtaat tcgcgtgagc     92220
     aaagctgcgc gcgtggcacc gcgcagtgga gggggctgcg cggtgccgga tcaaccgccg     92280
     ggccgggcgc cgcggccgcc gggccgaccg ccggaccggc cccggtcaag ccggccgtgc     92340
     gggtcgtgtc acccggacgg gggaagcggg cttccgcgcc gtcacgccgg tcggcggaca     92400
     ccgccgcgcc actccagccg cacgcgcatc accgcccacc cggaggtacg cggcgatttg     92460
     gccaccgttc aggccggaat aagggcttcc gtggtcatcc gggcgtcgcc gggcgactcc     92520
     ggagagtagt tgtggcacgc cgatgcacgc agcatcactt acgaagggtt atggtggaac     92580
     ccccccctcg ggccggtccg tctccccccc cacggaccgg cccgtttttt ctgcccgggc     92640
     ggacggcgcc tgcgagcggt acgcccgtaa cgaggagttc accggtgcgc cgtcctgtgt     92700
     cgtggcatgg cggcgcttgt tcgagggcat agaccaagca ggccgacgcc cgaaccacgg     92760
     gtgtcggatc tcagcggacg gcacggagcc gtccgcccgg gaggcccttt gcaccagccc     92820
     caccgtgcgg tcacggcacg gaagacgcgg cggaggaccg gtccccggtc cgcgccagtg     92880
     cagggcggcc ccagggacct gcctgacgac gaccgtccgg cggccccccg accggtcggc     92940
     tcgttcccgc cctcccggcc cagcgtccac tccgtcgctc cccgacctct tccgaggggg     93000
     tacgtccttc cgtggtgacc agcacaaagc gccacaagcc agataggcgc acctacgttc     93060
     tcgacaccag cgtcctgctg gccgacccga acgccctgaa ccgcttcgac gagcacgagg     93120
     tcgtgctccc catcgtcgtg gtgacggagt tggaggccaa acggcaccat cccgaactcg     93180
     gctacttcgc ccggcaggcc ctgcgcctgc tcgacgagtt ccgggtgcgg cacggtcgcc     93240
     tcgacgcccc catcccgatc ggggacctcg gcggcaccgt ccgcgtcgag ctcaaccact     93300
     cggaccccag cgtgctgccc accggctacc gcctggggga caacgactcc cgcatcctcg     93360
     cggtcgcccg caacctccag gcggagggat tcgacgtcac cgtcgtctcg aaggacctcc     93420
     cgctccggat caaggcgtcc tccgtcggac tcctggccga ggagtaccgc gccgagctgg     93480
     ccatcacgga cgcctccggc tggaccggaa tgtccgaact caccctgccg ggtgagcagg     93540
     tggacgtgct cttcgaggag ggccgggtct acgtccccga ggcggccggc ctgcccgtgc     93600
     acaccggtct gaccatccag tcggagcgcg gcaaggccct cggccgggtc acgcccgacg     93660
     gcaacgtccg gctggtgcgc ggcgaccggg aggcgttcgg catcaagggc cgcagcgccg     93720
     agcagcggat cgcgctcgac ctgctcctcg acccggacgt cggcatcgtg tcgatgggcg     93780
     gccgggccgg cacaggcaag tcggcgctcg ccctgtgcgc gggcctcgaa gcggtcctgg     93840
     agcgccggca gcaccagaag gtgatggtct tccggccgct gtacgcggtg ggcgggcagg     93900
     aactcggcta cctgcccggc tccgaggccg agaagatgag cccgtgggcg caggcggtct     93960
     tcgacacgct gtcggccgtc accagccgcg aggtcatcga ggaggtgacc gcgcgcggga     94020
     tgctggaggt actgccgctc acccacatcc gggggcgctc gctgcacgac gcgttcgtga     94080
     tcgtggacga ggcgcagtcg ctggagcgga acgtcctgct gaccgtgctg tcccggatcg     94140
     gggccaactc acgggtcgta ctcacccatg acgtggcaca acgggacaat ctgcgggtgg     94200
     gccggtacga cggagtcgtc gccgtcgtcg agaaactgaa ggggcatccg ctcttcgcgc     94260
     acgtcaccct gacgcgctcc gagaggtccc agatcgcggc gctcgtgacc gaaatgctgg     94320
     aggacggtca catctgacac ttccgtgaag tccggcccgt aacgggtcga ttgcccgtag     94380
     gagagccggt tacccgccgg ttcggcgccg tccggaaagg cccagagcct agccgggcgg     94440
     cgcctcggtg tgtgccgatt tccgtgaatc ccctgggcca aacgagatgt gagctttcac     94500
     acgcaacaca gaattgcctc accccgccgg gttacggcag agtctcactc ctgtcaggcc     94560
     ccgcatacga cacaggcgta cccccagcgg tacggcgccc cagaagcacc agatccaact     94620
     ccatagcaga gtcgtatgcc gcccgagcac cacgcggcgc tcccgcccag ggagttgtcc     94680
     accgggcccg tgcctcccgt gacccgtagt tggggaggcc agtgccaggg gcacgattgc     94740
     gtccgcgagg gtcaccgaag cgggcgatgc tggaaggaaa ccgtgtgagc cggatctcgg     94800
     tccggggatt cgcagtggcc tcggccacgg cggtcaccgc cgtcggaagc gtcgtcggag     94860
     ttgcctcggg cagcgtcgcg cagaacaacg acgacgcgga ggcgacggca gcaggcacga     94920
     ccctgcttgc cgacatcccc atgggtgagc aggcgcaggt gcagaccgcg tccctgacgc     94980
     agcaggccga cgtgcaggcc atcgccgcgg acgcgagcgc caagaaggac gccgaagagg     95040
     cggcccgcaa ggcagccgcc aagaccgccg tggacaagca ggagaaggcc aagaaggcgg     95100
     cccaagcggc gaagcagcgc gaggcgcagc aggaagcggc cagccgcgac gccaagcggg     95160
     agtccaccag cttcgccgtc cagagctcct acagcaccag ccagatccag gcgatggcgc     95220
     gccagatggt gcccagtggc cagttccagt gcttcagcaa catcgtgaac cacgagtcga     95280
     gctggaacta ccaggccgtc aacgcctcct ccggcgccta cggcctcttc caggccctcc     95340
     cggcgggcaa gtacgcctcc gcgggcgccg actggcggac caacccggcc acccagatca     95400
     agtggggcct cagctacatg gacaaccgct acggcagccc gtgcgacgcc tgggccttct     95460
     ggcaggccaa ccactggtac tgagcccgta gtcgcccgcc ttccccggcg ccgcggtcca     95520
     cgctcaacct cgcgcagccc ctcaccgtct tgtggtgagg ggctttcgcg ctcccgccat     95580
     gtacggtcgg accggaacga ctccaggggg gagtggtggg gaaggacggg ggaagaggac     95640
     ggatcatgtc acgagtgcca gggtggctcg gccggctcgg cgccggactg acgcgggcga     95700
     gcgagcggtt ggagcagcgc cgcgaggaag cgcggcgcga cgacgccgac gacggacccg     95760
     ggccggtctc cgaccacgag cgccggcccc tggacgacac ggctgaggac tccgcggtcg     95820
     agcacctcgc cgcccaccgc ccggtcgcgc tcgcccaccg tcccgatccg gctcaggccg     95880
     tgccgtgggg agtacgggtg gccgcggagg cggggtggcg gctgctggtg ctcgcgggca     95940
     ccgtgtgggt gctgatgcgg gtcatcagcg ccgtacagct cgtggtgctg gcgttcgtgg     96000
     ccgcgctgct gatcaccgcg ctgctccagc cggccgtggc ctggctgcgc cggcacgggg     96060
     tgccgcgggg gccggccacc gccctgaccg cgatcctcgg gttcgtggtg atgggactga     96120
     tcggctggtt cgtcacctgg caggtcatgg agaacatcga caacctctcc gaccaggtcc     96180
     aggacggcat cgacgaactg cgcaactggc tgctgaacag ccccttccac gtcaccgaca     96240
     agcagatcaa cgagatcgcg aagaacctgc gcgacgcggt gggcgccaac accgaccaga     96300
     tcacgtcggc cggactcgaa ggcgtcacgg tcgtcgtcga ggcgctcacc ggcatcctgc     96360
     tggccgcgtt ctcgacgctg ttcctgctct acgacggcaa gcgcatctgg cagtggtcgc     96420
     tgaagctggt gcccgcggca gcccggccgg gcgtcgccgg ggccggcccg cgcgcctggc     96480
     ggacgctgac cgcctacgtg cgcggcacgg tgatagtcgc gctgatcgac gccatcttca     96540
     tcggcctcgg catctacttc ctggacgtgc cgatggccgt cccgctggcc gtgttcatct     96600
     tcctgttcgc cttcatcccg ctggtcggcg cggtggtgtc gggtgcgctc gcggtcgtgg     96660
     tggcgctggt gacacagggc gtgttcgcgg cggtcatgac gctcgtcgtg gtgctggcgg     96720
     tgcagcagat cgaggggcac atcctgcagc cgttcatcct cggacgcgcg gtgcgggtcc     96780
     acccgctcgc ggtggtgctg tcggtggccg ccggcggcat ggtggccggc atcggcggcg     96840
     ccgtggtcgc cgtaccgctg gtggcggtga ccaacaccgt cgtgggctac ctgcgggcgt     96900
     actcccgcga ggccgccctg cgccggacgc cgagaccgca cggagccacc tcgaccgacg     96960
     ccgccccggc cgtcgaccgc gtgccggggc cgccgaagcc cccggcaccc ccggcggacg     97020
     gcccgccgtc ggacgccccc taggggtgtc gtttggatct tgccggggtc gcggggtctg     97080
     gcacgcgcat ctgcggcgtt gtcgtcggtt gccagggctc cgccctgtcg ccctcctccg     97140
     ccttgcagct gcacgcacca gaccccgctc gggtcggcca caaggcaccg tcggccgcgg     97200
     ccggcctgat ccaaacgaca cccccctagc ggcgcgccgc cggggcaccg gcacgtgaac     97260
     gggccccgcc cacctctcgg tgagcggggc ccgtgccgtg cgtgccgcgc cgggacggat     97320
     cccgtgcggg actactcggc ggcgaggacc gcctcggcgt ccagcgtgac gccgacggcc     97380
     tcgaccacgg cggcgatctt gaacgcctcc tggatcgtct cgcggtccac accggccttg     97440
     cggagcacct gctcgtgcga gtccaggcac atgccgcagc cgttgatggc cgacactgcg     97500
     aaggaccaca gctcgaagtc gaccttgtcg acgcccgggt tgccgatgac gttcatccgc     97560
     agaccggcgc gcagggtgcc gtactcgtgg tccgacagca ggtgccgggt gcggtagaag     97620
     acgttgttca tcgccatgac ggcggcggcc gacttggcgg ccgagtacgc ctcgggcgag     97680
     aggttcgcct tggcctccgg ctccagctcg cgcagcacga tcggggagcg cgaggcgatg     97740
     gcggtcgcca gcacggtgcc ccacagctgc tgcgccggga ggtcggagtt gccgatgacc     97800
     gaacccaggt tgagcttcag gtccttggcg tagtccggga cggcggactt cagggagtcg     97860
     agggacatgt cagatcactc tcccgagagc agcgcgaccg ggtccagggt ctcgtcgccc     97920
     ttgctccagt tgcacgggca gagctcgtcg gtctgcaggg cgtcgaggac ccgcaggacc     97980
     tccttggggt tacggccgac ggagccggcg gtgaccatcg tgaactggat ctcgttgttc     98040
     tggtccacga tgaagaccgc gcgctgcgcg aagccgtcct cgccctcgat gccgaggtca     98100
     cgcatgagct cgtgcttcga gtcggccagc atcgggaagg gcaggtcggt caggtccggg     98160
     tggtccttgc gccaggcgtg gtgcacgaac tcggagtcgc cggagaagcc gaggatctgg     98220
     gcgtcacggt cggcgaactc gtcgttcagc ttgccgaagg cggcgatctc ggtcgggcac     98280
     acgaaggtga agtccttggg ccaggcgaag acgaccttcc actgaccctc gtaggtcttg     98340
     tggttgatct gctggaactc cttgcccttc tccagcgaga cgcaggcggt caggtcgaac     98400
     tcggggaact tgtcaccgac agtgagcacg tgctctccaa aaacgcagcg aagaaacacc     98460
     cattttgcga gtgtttccca tgggttggac gttagtgatg ttggcacagg gtgcattgat     98520
     tagtgaaata gctacactcg gtcgagttga tcggaggtag ctattagtgt ccagtaagaa     98580
     gagacagccc agcctcgctc agctgcgggc tttcgacgcg gtcgccgagc acctgcactt     98640
     ccgtgacgcc gccgccgcga tcggcatgag ccagccggcg ctctcgggtg ccgtttccgc     98700
     cctggaagag gcactgggtg tcaccctcct ggagcgtacg acgcgcaagg tgctgctctc     98760
     cccggccggc gcacggctcg cggtgcggac caaggcggta ctggcggagg tcggcgcgct     98820
     cgtcgaggag gcggaggcgg tgcgggcgcc cttcaccggc gcgctgcggc tcggcgtcat     98880
     cccgaccgtg gcgccgtatc tgctgccgac ggtgctgcgc ctcgtccacg agcgctatcc     98940
     cgacctcgac ctccaggtcc acgaggagca gacggcgagc ctcctggagg gcctgacgac     99000
     cggccggctc gacctgctgc tgctcgcggt gcccctcggc gtccccggcg tcaccgaact     99060
     cccgctcttc gacgaggact tcgtcctggt cacgccgctc gaccaccgac tcggcggccg     99120
     ggagggcctg gagcgctcgg tgctgcgcga gctgaagctg ctgctgctcg acgaggggca     99180
     ctgcctgcgc gaccaggcgc tcgacatctg ccgggaggcg ggccgcgcgg gcgtcccggc     99240
     gacgaccacg gccgccggtc tgtcgacgct ggtacagctg gtggcgggcg gcctcggggt     99300
     gacgctgctg ccccgcaccg ccgtccgggt ggagacctcc cgctccagcc agctcctcac     99360
     cgcgtccttc accgacccgg cccccacccg ccgtatcgcc ctcgccatgc gcacgggcgc     99420
     ggcccgctcg gcggagtacg gggaactggc ggcggccctg cgcgaggcga tggcggacct     99480
     gccggtgcgg acggtgcacg actgagggac cgggcgacca cccggccggg cggtccctcg     99540
     gtccctcgga gcctcgcttc ctcagaccct cggccctcgg tgccccggtc gggcacccgc     99600
     gggcgccccg tcgcctcggg cacccgcggg gcctactccg tgcgcagccc ctccggccgc     99660
     atcagccgca gcagcggcgg caggctgcac agcgtcacca ccaggaccac cgcggcgccg     99720
     atgccggtca tggcgaggac gccggtccag tcgacgctga ccggggtgct cgtcatcttc     99780
     agcagcaccg tgcccagggt cagacccacc accgaggcga gcagcaggcc gagcacgatg     99840
     ggaatcgccg tctgccagag caccgacagg ctgagcgtgc ggcgccgggt gccgaaggcg     99900
     accagggccg acagcagctt cttgcgctcg cgcagctgct ccagctgcga gaccagcaga     99960
     ctggcgccga tcagcgccag cacacacgcc gcccccacga acaggccggt gcggatggcg    100020
     tcgaaccggt cggtccgctc ggtcgccgcc caggccaccg cgtccgccag cgggtcgatc    100080
     gccaccgtgg tgttccgtac caggtcgtgc acgtccggca ccgactggtc cagccggagg    100140
     taggcgtgtc cgtccagcgc cggcgcgagg gcctccggca tcgccttacg ggtgatcagg    100200
     aggccgcccc ggtcggtccc ggccagcaga ccggtacgcg gcttcgcggc cttgacgccc    100260
     tgcggcaccg tccaggggat ctcatggcgc ttcgggatgc cctcgtagga cgggtcgacg    100320
     tagagcttcc ggcccggcgc ggccagcttc gtcacgtcct cctcggcgtc ccactcggcg    100380
     ccgtggacga cgaagacgtc cccttcggcg cacgacgaca gcctggcgat ctcccgcagc    100440
     gaggcgcagt cccccacggt cagtgtcgtg ccgtggtccg ggtccttggg gcggtcgccc    100500
     agccagccct cggagaaggc gttgaccgcc tcgaccccct tggtgtcgcg gaacttcgcg    100560
     gccgcctggt ccatggggac cccgctcggg aggatcgcct ccatctgtgc ccacgacacg    100620
     tcctgccccg tggacttggt gtagtcgtcg tccacgccgg cgaacagcat ctgcagcgcg    100680
     atcgccccgg cgacggccac cgcgatgccg ttgaccatcc gggccgccgt cccgctgctc    100740
     agctgcagcc tgcgcacggc cagttgccag gccacgccgc cggagccgag cctggcgacg    100800
     acgctctcca cgacccacgg cagcagcgcg gtcacgccta ccaggagcag gacgacgccg    100860
     ccggtcacca ggtactggtt gaagtcgccg ttctcgcgcc cgttgccgat catcgggtag    100920
     agcatcgcca gtccggccag cggcagaatc agccgccacc acagttggcg ccgggccggc    100980
     cggcccgcgc gcaccacgcc gagcggctcg atgaccactc cgcgcagcgc gagcagcgtc    101040
     accagcaccg ccgccgtcgg cacggccacc gccaccagca gcgccagcac cggtgagggg    101100
     ttgagatagc tggggaacac gctgatgcgg aacacctcgg cactgcccgc cagttgccgt    101160
     ccgaccatga agaacccggc accgaagagc agcccgagcg ccgcgccggc catcgcctca    101220
     ccggcggcga tgcgccgggt catgcggctg tcggagccga ccaggcgcag cgccgcgagc    101280
     cgccggtccc gacgctcgcc gccgaaccgc acggcggcgg cgatgaacac cgcgaccggc    101340
     atcagcagca ccacgaagac gacgaggatc agcaggatca gcaccgggtc ggaccgctcc    101400
     tccccggggt ccgggtcgcc gaaccggtcg atacgctcga tcctgcccga ggtgatgtgc    101460
     tccgcgagcc cctccgcgcc ccggtagtag gcgagttcgg ccgagccgat cagcccctcc    101520
     tcggcgatcg tgccgacgac ccggtccggc agccgctcgc gcagcagcgc gccggagtcc    101580
     gagttcagca gcttcttcag cgcgggggag accaccatct cgcccaccgc cgggaacttc    101640
     tccagccccg gcggcagcgg tgcccgcggg ccctcgggct ccagggcccg gccccggacg    101700
     tcgtcgtcgc ggaaggtgtc gtcgagcctg gcgagcacga gcgtgtcgtc cgccttcggc    101760
     atcgggtcgg tggcgaaggt gatgtcggag cgcgccgcct cccggtcgtg ccgcacggtg    101820
     agcgcgttcg ggagcgccgt cgtcagcagc agcagcgcca cgccgagccc gacgcccacg    101880
     gcggtcagca cggcccgggt ccagccctcg cggccgccgg tgaaggcgaa gcggacgccc    101940
     agcatcaggt cggcggccca ctggcgcacg ttcatacggc ccgctccatg tcccgggact    102000
     tgccgtcgcg tacgacgatc tcgcggtcgg agtaggccgc cacccgtgcc tcgtgcgtga    102060
     ccagcacgac cgcggcgttg gtggagcggg ccgcgtccgt gagcagctcc atcacgcgct    102120
     ccccgttgag ggagtccagc gcgccggtcg gctcgtccgc gaagagcacg cgcgggttgg    102180
     tgaccagcga gcgcgccacc gcgacccgct gcccctggcc gcccgagacc tcgccgggcc    102240
     gcttcttcct gaggtcgtcg acctccagcc gctccatcca gctcagcgcg gcccgctcgg    102300
     cctccttgcg ggaggtgccg ttcaggcgca gcggcagggc gacgttctcg acacaggtca    102360
     gctccggcac gagctggccg aactggaaca cgaacccgaa gtccgagcgg cgcagcgcac    102420
     tgcgctgggc gtcggacatc gccgacagct cgcgcccgtt gtacgtgatc gtccccgagt    102480
     cgggcggcac gatgccggcg aggcagtgca gcagcgtcga cttgccggaa ccggaggggc    102540
     ccatgacggc gaccacctcg ccggggtgga tggagaactc ggcgccgtcg agggcgaggg    102600
     tggggccgta ggccttgcgg agctggtccg ccgagagcag ggaacctgcg gggggagtca    102660
     tcgggttacc gcctcacgga gcttgtcgag gcgcgcggcg gtcagttcca gccagcgcag    102720
     gtcggcctcg agatggaaga gggcgtggtc gcagatcagc tggtccgcga gatcgccctt    102780
     gcgcttgcgg tcggtgagga tgcgcatgct gcgcaggtgt tccgaacgct gggtgtcgag    102840
     gatgtcggcg gcgtcgcggt gggtgagcag cgcgaggacg accttggtgt acagcgtcga    102900
     ctggaggtac ggctcgggct tctccggcgt ggcgagccac cgctgtacgt cggtgatccc    102960
     ctcgtcggtg atcgcgtacc gcttgcgctc gggaccgccg cccgcctcga tgccgtcgac    103020
     caccacaagg ccgttcttca gcaggcggga catcgtcgag tagacctggc cgtagtgcag    103080
     cggccggtcg tgaccgaact tctcgtcgaa ggcgcgcttg aggtcgtaac cgtggcgcgg    103140
     cccggactcc aggagcccca ggagggtgtg accgatggac atgcggagca ctctacacac    103200
     ggtgtatacg caccatgtat acgcacggtg cagagatcgt ggcggcgggt acgggacggg    103260
     agcggcccgg gcacaggacc gcaggtgagg gccgattgtc acggttccgc tacgacggag    103320
     gccgcgcctc cgcccggtgg cggaggcgcg gccggcgagg atcgctcacg ggggtggcgc    103380
     ggcccccggg ccgccgcccc ccggcgggcg gccgcggcgc ggcagcggtc cggtgccgcc    103440
     gggcagccgg ccggcctcgg ccagcgccct gcggagcagg aactcgatct gggcgttggc    103500
     cgagcgcagc tcgtcgcccg cccagcgggc cagcgcctcg tagacctggg ggtccagccg    103560
     cagcagcacc tgcttgcgct ggtgcggccg acgcttgggg gccgggccct cggacggcgc    103620
     ggaatcccgc acggaatcct cgggcgcgga atcctcgggc gggctcgtca ctggtagagc    103680
     gtccccgtgt tcaggaccgg ctgggcggcg cggtccccgc agagcacgac catcaggttg    103740
     gacaccatcg ccgccttgcg ctcgtcgtcc agttccacga tgtcctgctc gctgatccgg    103800
     gcgagcgcgg cctcgaccat gccgaccgcg ccgtccacga tctgccgccg cgcggcgacc    103860
     accgcaccgg cctgctgccg ctggagcatc gccgaggcga tctccggcgc gtacgcgagg    103920
     tgcgtgaagc gcgactcgat gatctgcacg ccggccgcct ccacgcgcgc gtgcagttcg    103980
     acggcgagct tctcggtgat ctcctcggcg ttgccgcgca gcgagaggcc gtcctcgtcg    104040
     tgggcgtcgt aggggtactc gatggcgatg tgccgcacgg ccgcctcggt ctgggtggag    104100
     acgaactcga cgtagtcgtc cacctcgaag gtggcctgcg cggtgtcctc cacccgccac    104160
     accacgaccg ccgccagctc gatcgggttg ccgtaggcgt cgttgacctt caggaccgcc    104220
     gtctcgtggt tgcgcacccg cgtcgagatc ttggtgcggg aggtgaaggg gttgacccag    104280
     cgcaggccgt cctggcggat ggtgccccgg taccgcccga acagctgcac cacgcgggcc    104340
     tcgcccggcg ccaccatgtt caggccgcac atcgcgagga aggcggccag ggcgatcagg    104400
     atgccgccga tgatcagcac ggccttgccg ccggtcgagt cgaccgccgt ggcgccggcg    104460
     atcagaccgg cgccgacgag cagtccgacc agtccgagca gcagcgcgaa accgccgccg    104520
     atgctgtgcg cctggttctc gcgcacccgc ggcgccggca tctcgggcac atccgcggtg    104580
     acctgcgggg catcgtgcgt ggacatgggt ggtcccccgt tctctctttg ctttctaagt    104640
     gatatcactt taccaccgga tcacaacctt gaaccccgct cgtacgtcgg ttcctgtgga    104700
     gcgggtgctg attctcacgt ccgtacaagg ctggatcggt tgccgtttgt cacatctccc    104760
     ggtgttagct ttctgagctg acctgagcga cgaacctgtg tgacgcgtga gcgagacgtg    104820
     cccacagatg accgaagcgg agcggatcgg acccatggga cgagcggaag agagaaaagc    104880
     gcggcagcgc ggtggacgcc gcgcggcgcc gaaacgccgc cgttcgtcgg gcgcgggcgc    104940
     ggccgcgggc gggaagagcc ggatacgccg gctgttcacc tggaagaaga tcctcggcac    105000
     gttcttcggc ctctgcctgc tcggcatggg cgccttcatc gtgctgtaca tgatgatcga    105060
     catccccgag ggcaaccccg aggccgatct gcagagcaac gtctacaagt acagcgacgg    105120
     cagcatcatg gcgcgcacgg gcgagcgcaa ccgcgagatc gtcgacctcg ccaagatccc    105180
     caaggacgtc cagcgcacct tcgtcgccgc cgagaacaag accttctaca acgacgccgg    105240
     cgtcgacctc aagggcaccg cgcgcggcgt gctcaacacc ctctccggca agggcgcgca    105300
     gggcggttcg acgatcaccc agcagtacgt caagaactac tacctgaccc aggaacagac    105360
     ggtctcgcgc aagctgaagg aactggtcat ctccctcaag ctggaccggg agaagtccaa    105420
     ggactacatc ctcgccggct acatcaacac cagctactac ggccgcggcg cctacggcat    105480
     ccaggccgcc gcacaggcct actaccgcgt cgacgccgag gacctgacgg tcgaacaggg    105540
     cgcgtacctc tccgcgctgc tccaggcgcc gaaccagtac gactgggcga tcgccagcga    105600
     gaccggcaag aagctcgtcc agcagcgctg gaactacgtc ctggacaaca tggtcgagca    105660
     gaagtggctc ggcgcgggcg accgccaggg catgaagttc ccggagccca aggaacccaa    105720
     ggccgccgcg ggcaaggagg gccaggtcgg ctacctggtc gacgcggccg accacgcgct    105780
     caagaagcag ctcgtcgccc agggcgccgc cgaggacatg gagcaggcca aggccctggt    105840
     ggacctcggc ggctacaccg tcaccctcaa catcgacaag aagaagcagg ccgcgctgga    105900
     ggcggcggtc aagaagcagc tcacgagcaa gctggacccc gacgagcgca aggtcgacgc    105960
     cgacgtccag gccggagccg cctccgtcga cccgaagacc ggctccgtcg tggcgatgta    106020
     cggcggcgtg aactacctga agcacttcac caacaacgcc acccgcgacg actaccagcc    106080
     cgcctccacc ttcaagccgg tcatcctcgc cgccgccgtg gaccacgacg ccgagaccca    106140
     ggacggcgtg ccgatcacgg ccaacaccct ctacgacggc gacagcgagc gccccgtgat    106200
     ggacggcgac aagaaggtcg gcttcgcacc gcccaacgag gacgaccacg actacggcga    106260
     gatcgacgtc caggaggcga tgaacaagtc cgtcaactcc gtcttcgccc agatgggcat    106320
     cgacgtcggc atgcccgagg tcatgaaggt cgccgccgac ctcggcatgg acaccgaggg    106380
     cgagcaggcc gtgcccgcgc agaccctggg cagtatgggc gccagcccgc tggagatggc    106440
     aggcgtctac gccaccttcg acaaccacgg caagaaggtc accccggcga tcgtgaagtc    106500
     ggtcgagcac aaggaccgca aggtcgagat gcccgacccg atcggcgagc aggtcatcag    106560
     ccgggaggcc gccgacacgg tgacctcggt gctcaccggc gtggtcaacg acggtacggc    106620
     caagaagtcc gtccgggaga acccgctgcg cgacggccag aaggtggccg gcaagaccgg    106680
     tacgtccgac aacaacaagt ccgcctggtt cagcggcttc acccccggcc tcgtcacctc    106740
     cgtcggcctg ttcggcgagg acgacgagcc gccgcacaag caggtcccga tgtacaaggc    106800
     ggccggggtc gactaccgcg tcaacggtgg tggcccgccg gcggagatct gggccgcgta    106860
     caccttcggc gtcatggacg aggtcaccga gttcgacctg gagaccaagc agggcgccgc    106920
     ggtgcggccg agcaagtcgc cgacggcccc cgagtcgccg accaagtcgc cgacgcggga    106980
     ggagacctcc gaggcgccgc cgccgtccag cgacccgacg accgaggcgc cgccgtcaag    107040
     cgacccgacg accgaggaac cgccggagtc gccgacgaac tcgccgtcga acagcccgtc    107100
     caccgaacca ccgccggacg gcgggtccac cgagtcgggg gacccggagc tccccggcgt    107160
     ggactggggg cagtaggccg tccgcggtcg ctgacgcgcg cgaagggcgc ccggtgctca    107220
     ccgggcgccc cttcgcgcga cgccgttccc ggccgcggac cggccgttcc cctgccgcgg    107280
     accagctgcg gaccggccgc ggttcagccg cggttcagcc gcggttcagc tcgaaccaca    107340
     ccaccttgcc ggtgctcagc cgcgtcgcgc cccagcgccg ggccagccgg ttcaccaggt    107400
     acagtccgcg accgccctcg tcggtcgccc gcgcctgccg cagccggggc agctgcggca    107460
     cgtcgtcgcc gacctcgcag cgcagcacgt ccgtgcgcag cagccgcagg gtgaccggct    107520
     tggaggcgta ccgcaccgcg ttggtcacga cctcgctgac gagcagctcc acggcgtccg    107580
     tgaggtcctc catgccccag cgggccagcg cccgccgggc cagccgccgg gccttgccgg    107640
     gggccgcgtc ctccggatcc aggaaccagt acgacacgtc gctgggcgcg atgccgtcga    107700
     agcgggcggc gagcagcgcg atgtcgtcgt cccggtcacc cgggccgagc atgtccagca    107760
     cctcgtcgca cagggcctcc aggggcggcg gatggtccgg cccggtcagc tgcgcggtcg    107820
     ccgccaggcg ctcccgcaac tgctctatgc cggtccacac gtcccgcagc cgggactcca    107880
     ccagcccgtc ggtgtagagc agcagggtcg cgccggccgg cgcgtccagt tccacggcct    107940
     cgaagtccac gccgcccacc ccgatcgggg caccggccgg cacccgcagc acctcggcct    108000
     cgccgcccag gtgcagcagc acgggcggcg ggtggccggc gttggcgacg gtgatgcggt    108060
     gcgagaccgg gtcgtacacc gcgtacagac aggtggccat ccggtcggtg cccaggcgct    108120
     gcgcctgctc gtccaggtgg tggagcacct cctgcggcgg caggtcgagt ccggccaggg    108180
     tctgtgccgt ggtccgcagc tggcccatga tggccgccga cgtcatggag tggcccatca    108240
     cgtccccgac gaccagcgcg acccggctgc ccggcagcgg gatggcgtcg taccagtcgc    108300
     cgcccacccg cgcggtctcg gcggccggga gatagcggga ggccagccgt acgccggtgc    108360
     agcgcgggag gttctccggg agcatcgtgc gctgcaactc gtcggcgatg tacgcctccc    108420
     gcccgtacag caccgccttg tcgatgccca gcgcgctgtg cgtggcgagc tgggcggcca    108480
     ccagcaggtc gtcggcctcg aaggggatgc gctccgggcc gcgcaggaac agtgcggcgc    108540
     cgatcacccg gcgtcggccg cgcagcggcg cgaggatcgc cctgcggccg tcgggcaggg    108600
     cgaagtcgcg ttcctcgccc agcagttcgg gcagcgcggc gcgggcggcc ggggtgtccg    108660
     tgaagaccgg gcgcaccccg cgcagcacct cggccagcgc gctgcccggc cgtacctcgc    108720
     acagctcggc gccgaccgtc tccagctcgg agggctccgg ctgggccgcg ggtgcgaagc    108780
     cgccctcggt gtcccgctcg gccggtatgc ggtcggtgcg ccgcagccgc agcaccaggg    108840
     ggccggtggg ccgctcgtcg ccgaccggca gcggctcgcg cagatagacg aggatggcgt    108900
     ccgcgaaggt gggcacggtg gcccggcaca gccccatcac gatctcgtcc aggtccatgc    108960
     cccgggcgat ccgccgggtc gcggcgccca cgaagcgcag ccggtccccg tcccgccgca    109020
     tgggcgtggg ctgtccgggc gcggtgggct gcccggtacg ccggtccggc tccgccgggg    109080
     cgtcgcggcg gtccgtggcg ccggccggca cctcggaccc cggccgcacc tcagcggcct    109140
     gcccgccgcc gggcatgccg tccagggccg agccgtccga gggcgcgaca cgtggcgccg    109200
     cgccggccgg cacaccgccg ggctgcccgc cgcccgcttg cccgccgtcc ggttgcccgc    109260
     cgtccggctg tacgggaacg ccctcggccc cgggccgcgg gcggtgcgtg tcgggctccg    109320
     ccgcctgctc ggcgcccggt tgggagtgct cgaagacccc cggggagtcc tcgcccgcgg    109380
     tgggcggcgt ctccccggtg cgcccctggg ccggtaacgc ggacccggag gcgcgcggcg    109440
     gcactggggc aggcaggagc gccccgcggg gatccgtggg gtcggcgccc gtcgaggggc    109500
     ggtcgaagga ggtcgggtgc tccgtcacgc gtgtcgaatc catccgtccg ggactgcgcg    109560
     cggcgcgtgc agttcgtccc gcagaaatcc cgatacccgc aatccgtgcc caaggaacgg    109620
     ggttcccgcg tggtcagagg ctgttcctgt gtcaccggcg ggccgtccgc ggcccgtctg    109680
     cgtgttgccc tcgtacccct cgctcacgtc ctgccgcccc tcggtgacga tcggtcaagc    109740
     acagcgcacg ctccgccggt tgccgctgcc gcgctcattg cggaggacga tcctacgttt    109800
     cttgccgggg gcacatcaag ggtctcatga ggagacgtgc gcgggcgtgc gatcccagtc    109860
     ccccggcagc gacggtaccg gccacgccgg atcgggccgc cagtgctccc agccgtcggc    109920
     gaacggtgac ccccaggcac ggatctccgc caccgcggac cgccccgccc ggcgcacccg    109980
     cccggccgac gcggggtcca tcagaccgtc ccgcagggcc tgcgcgaact cgtcctcgtc    110040
     gcgccagtgc caggtgcggt ccgggtggac ggagatgtcc aggaaatggt cctcggagtc    110100
     gaccccgccc tcccaacggg tcagcggccg ctccaggttc acgtaccagt tcttgaagcg    110160
     ccagcccggg tcccagaaca gccacaccga ccaggcctcg ccgggccgcg ccagcttcag    110220
     cacccccgtg ccgaaccact ggtcgcgctg cacggtgcgc ggcttggtgt agcgcgtggc    110280
     cagcggttcc aggtgcacgg gcgtgccgtc ggccaggacc ggcttcacac actcggtgcc    110340
     gggcgccagc cacacggcga gcaggtcggc gtcgtcccgt acgacggtga cggggcgcgc    110400
     gatgtggacg tgcgggccgc cgttctcccg gtaccgccac aggatgtggc tgccgggcgc    110460
     ccagtgtccc accgggcccg gcgggccctc cgctcccggc cccgccgccg cgctcaccgc    110520
     ttctccgtct gtcatggaga gatattaggt gccatggcca atcgacgcgc cgaagatcgc    110580
     gagagcgtgc gccggcgtac gcccccgtga tcacccgccc ctctcacggg cgggtcatcc    110640
     gcagcacgtc cagggcctgg tccagttgct cccgcgtgag gtcgccgcgt tccacgtagc    110700
     cgccctccag cacggtctgc cggatcgtct tccgctcggc cagcgccctc ttggcgacct    110760
     tggcggcctc ctcgtacccg aggtacttgt tgagcggcgt gaccacggag ggcgaggact    110820
     cggcgtactc gcgggcccgc tcggggtgcg ccacgatccc gtccacggtg cggtcggcga    110880
     gcagccggga gacgttggcg agcagccgca ccgactccag cacgttcttg gcgatgaccg    110940
     gcagcatcac gttcagctcg aagttgccgg ccgcgcccgc cgcggcgacc gtcgcgtcgt    111000
     tgccggtgac ctgggcggcg accatgagga ccgcctcggg gatcaccggg ttgaccttgc    111060
     cgggcatgat ggacgacccg ggctggaggt cgggcagcga gatctccgcg agcccggtgc    111120
     gcggaccgga cgccatccag cgcaggtcgt tggcgatctt cgtgagcccg acgccgatgg    111180
     tccgcagctg cccgctggtc tcgacgatgc cgtcccgggc gccctgcgcc tcgaagtggt    111240
     cgcgcgcctc ggtcagcggc agccccgtcg cgcgggccac ctcctcgatg acggcggcgg    111300
     agaagccggg cggggtgttg atgccggtgc cgaccgcggt gccgcccagc ggcagctcgg    111360
     cgagccgggg cagtgaggcc tgaagccgct cgatgccgta ccgcacctgg gccgcgtaac    111420
     cgccgaactc ctggcccagg gtgacgggcg tggcgtccat gaggtgcgta cgcccggact    111480
     tcaccacgtc ggcgaactcc ccggccttgc gctccagggc gccggcgaga tggtccaggg    111540
     ccgggatcag gtcgcgggtg acggcggcgg tggcggcgat gtggatcgag gacgggaaga    111600
     cgtcgttgga cgactgggag gcgttgacgt ggtcgttggg atgcacgtcg cggccgagcc    111660
     gttcagtcgc cagggtggcg acgacctcgt tggtgttcat gttggacgag gtcccggacc    111720
     cggtctggaa cacgtcgacg gggaagtgct cgtcccactt cccctcggcc acctcaccgg    111780
     ccgcctcctg gatcgcgccg gcgacgtcct cgtcgagcac tcccagctcg gcgttgacct    111840
     tcgccgccgc gctcttgatc cgcgccagcg cctcgatgtg cgcgcgctcg atgcgctgcc    111900
     cggagacggg gaagttctcg acggcgcgct gggtctgggc gcgccacttg gcgtccgcgg    111960
     ggacgcggac ctcgcccatg gagtcgtgct cgatgcggta ttcgctcata ccgggtacag    112020
     cgtgcggggc gacgcggatg ttccggggcc gggccgaacg ggtgccgtct cacgccgtgg    112080
     tccggcaccc gcccggcggg tcagcccgcc agcaggctca cgtcgtccag gacgaagccg    112140
     gtctgcaggc tgccgtcctc gctgccggtg aagctcaggg ccacctgccg gccggcgtac    112200
     gcgccgaggt cgaccgtgcg ctgcacatag ccgtcgcggg cgtccgcgtt ggacagggtg    112260
     gcgagcgtgg tgccgtcggc cttcaccttg aaggtgtcgt acgccgtcgt gcccgactcg    112320
     tcggtgtcga tgtgcagcca gtaggccagc cgggtgcatc cggtcggcac ggtcaccgtc    112380
     tgggcgaccg actcggtgtg cgtggaaccg taaccggcga gccacgcgaa gcgggtcccg    112440
     gtgtgcgccg actgacccga gtgggcgccg atggtgccgg tgtccccggt ccacggcgag    112500
     ctgccgctct cgaagccgcc gttgacgacg gggtcggtgt cgcacccgtc gccgccgccg    112560
     tcgtcgccgg tgcccacggc gcgctgccag atggtgtacg cgatgccgtc cgacgcccgg    112620
     tccaggccgg tggtgttgat gttgtcgagg ttgtcgcacg accggtggta gcacgggtcg    112680
     tacgaggttc cggcggtgcc gccccacttg gcggcctgcg cggaggtctt gcgggcactg    112740
     gcgcccatcg cgtagccgga ggtcgggatg ccgtactgct cgaaggagta gtcgtcgctg    112800
     cgcccggcgc cctcggtgtt ctcctcgggt tgcaggccca gcgagtccca gtacgccttc    112860
     atgggcgcgg cggcggccga ggtgacgtgg ttgacgaagt agcccccgtt ggtggaggcg    112920
     atcatgtcga agttgtagta cgccgtgatc gcggaccgct gcgccgagga gagcgagcgg    112980
     acgtagaagt cggagccgtt gaggccctgt tcctcgtcgg tccaccaggc gaagcggacc    113040
     cggccctgca tcgtcgggtt ctgccgcgcc agggtcaggg cgttctccag gagggcggcc    113100
     gagcccgagc cgttgtcgtt catgccgggg cccgccgaga cgctgtcgag gtgggcgccg    113160
     aacatgtaca catcgttcgc gtcgccgtgc ggccactcgg cgatcaggtt ggggccggcg    113220
     ccgctgctgc aaccggaggt gcacggctgc tcggtgacgg tgtaaccggc cgcctgcagc    113280
     ttgcccttca cgtaggcgac ggagtcgcgg tacccctggc cggtcgagcg gcgggtgccg    113340
     ccgttgcgtc cggctatgga gtgcagctcg gtcaggtgcg ccttcacctt cgtcacgtcg    113400
     acgtcgggcg actgggcggc gggcgcggtg ccggcggcga cggcggggag tgtgccgagg    113460
     ccgagcacga cggcgaggga caggctcgcc acggcgaatc ttcgtttcac cttggtcctc    113520
     cagaagtggc tgaggggtgg ccacgcaggg catgtacgca tggcgtgtac atgtcggagc    113580
     ggcgaaagac tcacaggggg agccggggcc gtcaatggaa cggacgcccg ggaaggcagg    113640
     ttgtccgaaa gaagaaccgt ctgttcgata tccggacggc ggggggaagc gaaaggccgg    113700
     cccggacgga gccggaccgg cctgctgccc aggagtgagg gttacgccag gcccggcccc    113760
     cgtaccggaa tcgtcgtgaa cgtcggcgcg ggcgccgggt cctggaagaa gtcgttgccc    113820
     ttgtcgtcca ccacgatgaa cgcggggaag tcctcgacct cgatcttcca gaccgcctcc    113880
     atgccgagct cctcgtactc gacgacctcg accttcttga tgcagtcctg tgcgagccgc    113940
     gccgcgggcc cgccgatcga gcccaggtag aagccgccgt gcgcgtcgca cgcgtcggtg    114000
     acctgcttgc tccggttgcc cttggccagc atcaccttgg agccgcccgc cgcctggaac    114060
     tgctcgacgt aggagtccat gcgcccggcg gtggtcggac cgaaggaccc ggaggcgtag    114120
     ccctcgggcg tcttcgcggg gcccgcgtag tacaccgggt ggtccttcag gtactgcggc    114180
     atctcctcgc ccgcgtccag ccgctccttg atcttggcgt gcgcgatgtc gcgggccacc    114240
     accagcggac cggtcagcga cagccgggtc ttgaccgggt gcctggtcag ctcggcgagg    114300
     atgtcgtcca tcggctggtt gaggtcgacc ttgacgacgt cgccctcctc ctccagatgc    114360
     tcgtccgtgg tctccggcag gaaccgcgcc gggtcggtct ccagctgctc caggaagacg    114420
     ccctcggcgg tgatcttcgc gaccgcctgc cggtccgccg agcaggacac cgcgatggcg    114480
     accgggcagg acgccccgtg ccggggcagc cgcaccacgc gcacgtcgtg gcagaagtac    114540
     ttgccgccga actgagcgcc gatgccgatc ttctgggtca gctcgaagac cttctcctcc    114600
     agctccttgt cccggaagcc gtgcccgagc tccgagccct cggccgggat ctcgtccagg    114660
     tagtgcgcgg aggcgtactt cgcggtcttc agcgcgtact cggccgacgt gccgccgacc    114720
     acgatcgcca ggtggtacgg cgggcaggcg gccgtgccga gcgagcggat cttctcctcc    114780
     aggaacttca tcatggagga ctcgttcagg acggccttcg tctcctggta gaggaaggac    114840
     ttgttggccg agccgccgcc cttcgccatg aagaggaact tgtaggcgcc gccgtcggtc    114900
     gcgtacagct cgatctgggc ggggaggttg gagccggtgt tcttctcctc ccacatggtc    114960
     agcggggcca tctgggagta gcgcaggttc aggttcttgt acgcgtcgta gatgccccgg    115020
     ctcagggcct cctcgtcacc gccctcggtg agcacgttct ggccgcgctt gcccatgacg    115080
     atcgccgtgc cggtgtcctg gcacatcggc agcacgcccg cagccgcgat gttcgcgttc    115140
     ttcagcaggt ccagggcgac gaacttgtcg ttgccggacg cctccgggtc gtcgatgatg    115200
     cggcgcagct gtgccaggtg cgccgggcgc aggtagtgct ggatgtcgtg aacggcctcc    115260
     tcggccagct tgcgcagggc ctccggctcc accttgagga aggtccgccc gtcggcctcg    115320
     aaggtggcga caccctcggc ggtcaccagc cggtacggag tggtgtcctc gccctggggg    115380
     agcagatcgg tgtacgcgaa ctcaggcatc tcgcccattc ctcactcgac atcacgcgcg    115440
     gctggattcc tcagcaacga cggctggcct ccattggcag cgccaaccag cgtaaaacct    115500
     gccgacgacg ccgagcttgt gaggtaaggc tcagtagggc ccggtaaggc cgagtggagc    115560
     cggccccggt ttcggcccgg ccccggaccc ggttcgcgac aaggttgtcc acagggctag    115620
     tcgcgatcta tcgcgtttcg gtacgctacc gccgtggacc ttcacaagca cgccccagcc    115680
     gccgccccgc gcacctccga gctgcgcgcc tcggacgccg accgcgaccg cgtcgccgac    115740
     atgctgcgcg aggccctcgc cgagggacgg ctcaccgccg acgagcacgc cgagcgcgtc    115800
     gagggcgtgc tggccgccaa gaccgtgggc gagctggacg tcttcgtgcg cgacctgccc    115860
     gccgcccacc gcggccggga gaccaccgcc ccggctcccc accgccccac cgccggcgcc    115920
     atcccggcgg aacccgacga gaacgtggtg gcggtcttca gcagcgccgt ccgcaagggc    115980
     cgctggcggg cgaaccgccg catccacgcc tacgcggtct tcggcagcat cgagatcgac    116040
     ctcagcgagg cggtcttcga gtaccagcag gtcgtcatca aggcgttctc cgtcttcggc    116100
     agcgtcgagg tgcgcgtccc ggagaacgtg tcggtgcgcg gcgccggcgg cagcgtgctc    116160
     ggcagcttcg aggtccacac cctcgactcc agcgaggccg aggcccccgt catctacgtg    116220
     gacggctggg ccgtactggg cagcgtggag gcccgcccca agcgcggcaa ggtcgtcgcc    116280
     gacatcctcg accgggtgca ccgacgcgtc gagaagggtt tgcgcaagca cgtgtaggac    116340
     ggcaccggca gcggtcggga acccagtgca taggcgcgcg tacaacgggt aagccttgac    116400
     gcatcgtctc tcgctagcga agccgtcgtc aggagtagac ccgtgctgca accgccgcat    116460
     tcgtccctgc aggtagctgc cgttccggcc cagcgggtgc ccgtgcggga cagggaccaa    116520
     gacgctccct ggcacaccga ggcggtgtgc cggcgcgacg aggccggact gttcttcgcc    116580
     ccctccaagg aaccgaccgc cgcccggctc tcccgcgaag aggccgccaa gcgcgtctgc    116640
     gcgcgctgtc cggtcatggt cgagtgccgc gagcacgccc tcctgcaacc cgagccctac    116700
     ggcgtctggg gcggcctcac cgccgccgag cgccgcgtgg tcctggcccg acgccgccgc    116760
     cgcgacgtgg aactcaggaa cgccgcccgc acgacgggcc gcatagcggc ggccggctag    116820
     aacccagaca cccgaaaggg caccctctcc gcacagaggg tgccctttcg acgccgggcc    116880
     gccgccgacc cgggggcgcg gggctgtgcc cgatctgcgg ctccgccccg tgggtgcgac    116940
     gggcggcaac ttcccgacgc cggggcgcgc agccaaccaa ggggcgcggg gaaccgcgcg    117000
     acaagccacg acgcacccgc acccgccttg cgacaggcgc ccccggctca ataggcgccc    117060
     cgcgaaaccg acggagtcac ttcgcccggt cgaaatccac cgcgctgtac gcccgcagct    117120
     tgctcagccg gtgctcggag tcgatccgcc gcaccgtccc cgacttggac cgcatcacga    117180
     tcgagtcggt cgtcgccgtc tccgagcggt accgcacccc gcgcagcaac tcgccgtcgg    117240
     tgatgccggt ggcgacgaag aagacgttgt ccccggagac caggtcgtcg gtggtcagca    117300
     cccggtccag gtcgtgcccg gcgtcgaccg cgcgctgccg ctcctcggcg tccttgggcc    117360
     acagcttgcc ctggatggtg ccgcccaggc acttcacggc gcaggccgag atgatgccct    117420
     ccggcgtgcc gccgatgccg agcagcaggt cgatgccggt gccctcgcgc agggccagga    117480
     tggagccggc cacgtcgccg tcggagatca gcttgatgcg ggcgccggtc tcccggacct    117540
     ccttgatgag gccctggtgc cgcggccggt cgaggatgac gacggtgacg tcctcgggcg    117600
     tgcgccgctt ggccttggcg atccggcgga tgttcacggc gacgggcgcg ttgatgtcga    117660
     cgaagtcggc ggcctcgggg cccgtgacca gcttgtccat gtagaagacc gcggacgggt    117720
     cgaacatgga gccgcgctcg gccgcggcca gcaccgcgat cgcgttggtc atgccgttgg    117780
     cggtcagcgt ggtgccgtcg atcgggtcga cggcgatgtc gacctcggcc ccggtgccgt    117840
     cgccgacccg ctctccgttg aagagcatcg gggcctcgtc cttctcgccc tcgccgatga    117900
     cgacgacgcc gttcatcgag acggtgtgga cgagggtccg catggcgcgt accgcggcac    117960
     cgtcggcgcc gttcttgtca ccgcgcccga cccagcggcc cgcggccatc gccgcggcct    118020
     cggtgacccg cacgagctcc atggcgaggt tgcggtcggg ggcctccgag gggacgtcca    118080
     gctcggacgg gagatgatgc tcggtcatcg gaacgcacct ttctgatacg acgacggccg    118140
     gatgagggta tggccacgac tctatcgtca gtccgacaaa atgagcaggg gaccccacgt    118200
     atgagcggag cgggcacctg cgacgatagg gggcgtggca ggtatgaaag gcaagcagaa    118260
     gtcggcccgg gacatgattc tgtccctcgg ggtcatcgtc ctcgcggcgg gcgtgatctg    118320
     gatcttcatc ccgcacgacg acggcgaacc ggacgtcaag cgggtcgact accgggtcga    118380
     gctgctgacc gcgcagcgcg ccgcgtcgta tccggtggcg gcgcccgagg ggctgtccga    118440
     ggactggaag ccgacctccg tgcgcttccg cggtgacgac tccgacgcct ggcacctggg    118500
     gttccggacc ccggacggcg agtacgtggc ggtcgagcag tccacgaaga agccgtccac    118560
     gttcatccac gacgccagcc agggcgggca ggcgaccgag cggaccgagg agatcggcgg    118620
     ccggacctgg acgcggtaca cgggcggccg gtacgacgcg ctggtgctgg acggcaccgg    118680
     cgacatgaag ggcgcgacga cggtcgtggc cggcaccggg tcgttcgagc agctcggcaa    118740
     gatggcggcg gccctgaaac tggcctgacc ggccaccggc caccggccac cggccaccgg    118800
     ccaccggcca ccggccccgg tgccgcgtga ctcagaccgt ggtgacgacc tggtcgtagg    118860
     ccagccgcgg ggagcgcggg aaccaggcgt ccgggcccgg acggccgatg ttcacgacca    118920
     tcagcggggt gtggtcgtcg tccaggaact ccttgcgcac gccctcgaag tcgaggccgg    118980
     tcatcggtcc ggcggccaga cccgcggcgc ggacgccgac gatgaagtac gcggcctgga    119040
     gggcggcgtt cagggtggcc gcgccctcgc ggaccggacg ctcgctgaag aaggcgtcct    119100
     tcgcggcggg gaagtgcggg aagagctccg gcagctcctc gtggaactcg ttgtccgcgg    119160
     acaggatggc gaccagcggg gcggcggcgg tcttgggccg gttgccctcg gccatgtggg    119220
     cgaccaggcg ctcgcgggcc tcgggggagc ggaccagcgt gatgcgcagc ggcgactggt    119280
     tgaaggcggt cgggccgtac ttgaccaggt cgtagatcgc ctgcacctgc tcgtcggtca    119340
     ccggctcgtc ggtgaaggtg ttcgccgtgc gggcctcgcg gaacagcagg tcctgggcgg    119400
     cggggtcaag aacgagagac atgcgtgatc tttctccggg ggtgcgtcgg ctccgcgcgg    119460
     tgtggggacc gggggccgtt gacgccgacg acactacggc aaagaagttc aagcttcaac    119520
     caaaagggga ttgcggtgat ccgcttcaca cgcccgcccg ggtgaagggg ccctgtcgtg    119580
     tgcggcggca tgtgtgtcgg ggaaaccggc ctccgtgcgg tgcgtctata tgacgaaagg    119640
     tgaaattcaa gtcggacagt tcgcactttg atgtatccgg accaaccgtc gcggtcgtcg    119700
     ggctcggcta cgtgggcctg cccaccgcac tcgccctctg cgacgcgggc gccaccgtca    119760
     tcggcgtcga cagcagcccg gagcggctgc gggacatcgc acgcggagcc gtggacctgc    119820
     tcccgctgca ccacgcgcaa ctggcctgcg cctcggcagg cgaccgcttc cggctcaccc    119880
     cggacgccac ggcggtgcgc gacgccgacg ccgtggtcat ctgtgtgccc acccccgtcg    119940
     acgcccggcg ccggcccgac ctcgccgcgc tgtccgccgc ctgcgcctcc gtggtggagc    120000
     acgccgtgcc cggccagttg atcgtgctca cctccaccag ctacgtcggc accacccgcg    120060
     acctgctggt cgaaccgctg cgggcccgcg ggctcaccgt cgacgaggac gtgtacgtcg    120120
     ccttcgcccc cgagcggatc gaccccggca acgaacgcca cacccccgaa cgcaccccgc    120180
     gcctggtcgg cggcgccgga ccgcgcagca gccgcgccgc cgcggacctg ctggccccga    120240
     cggcctccgc cgtccggacg gtccccgacc ccgagaccgc cgagatggcc aagctctggg    120300
     agaacaccta ccgcgccgtc aacatcgccc tggccaacga actcgccgac gcgtgccact    120360
     ccctcggcct ggccccggcc ccggtgatcg aggccgccgc gaccaagccg tacggcttca    120420
     tgcccttcta cccggggccc ggcgtcggcg gtcactgcat cccgtgcgac ccgcactacc    120480
     tgctctggca gctgggcaag gtccggcagc aggcgccgct ggtcgccacc gccctcgcgg    120540
     ccaacagccg ccggcccgca cggatcaccg aacgcgccct cgacctgctc gcggactccg    120600
     ccgtccccgc gcacggcgcc cgcgtcctgc tgatcggcgt cgcctacaag gagggcgtgg    120660
     ccgacgtccg ggagagcccc gccctggaga tcctcgccgg gctcgccgag gccggcgcgc    120720
     acgtcgccta ctgcgacccc ctggtgccct cgctccgcgt cggcgcggac gcgctgcacc    120780
     acctgcccga cccgcacacc cggccctggg acctggtcgt cctgaacacc gtccatcccg    120840
     tgcacgacct gacctggctg tgcgccgacg acgccccgcc cgtcctggac acccgccagc    120900
     gcggcccgct caccaaggcg gcggcgcggg ccgccaccgg cgtccctccc gcggcggagg    120960
     ccaccgcatg accgtcctgc gccccggcca cggccccgcc gcccccgtcc gctccgccgc    121020
     ccgccaccgg ctcggcaccc gcctcgacgc cctggacccg cgcgtccgcc gcgacgtcgt    121080
     gcggctgctc accctgctcg ccctgctgcc cctcctcctg ctgctggccc gcggcgccgt    121140
     ccgcctgccg cacgccttcg acccgctcgc gctctacggc ctggcggtcc tggccggcac    121200
     cgtctgcctc ctccacctcg cctacagccg ctacgacgac ccggccgtac gcccgttgcg    121260
     cagccgcccg cgccacgccg aggcctttcc cgccctgccc gcgcggcccc gggtgagctt    121320
     cctgctggcc gtacgcaacg aacgcgcgca catcgaggcc tgcgtgcgct ccatggccgg    121380
     cgtggactac cccgacgtgc agctcgtcgt ggtcgacgac gcctccgacg acggcacccc    121440
     tgacgtactg gaacgcctcg ccgcggagct gccgctcacc ctgatccggc tggaggagaa    121500
     cctcggcaag aagggcgcgc tggtccgcgc ctgcgccgtc gccgacgggg acgtgctgct    121560
     gttcaccgac tccgactgcg tcgtcgcccc ggacgccgta cggcactgcg tgaccgccct    121620
     ggtccggcac cccgaactgg gggcggtcgg cggacactgc cgggcactca acaccgacgc    121680
     cggtctgctg gcccgggtcc aggacatctg gtacgagggg cagttccgca tcagcaaggc    121740
     cgccgaggcc gccttcggct cggtgacctg cgtctccgga ccgctcgccg ccttccgccg    121800
     ggaagctgtc tggaactacc tgcccgcctg ggccgaggac cgcttcctcg gtgccccctt    121860
     ccgcttcgcc accgaccgcc agctcaccgg ctacgtcctg ggacaggcct ggcacggccg    121920
     cgccctcaag gaccggcacg ccgactcccc cttcgtccgc gaccacgact accccgagct    121980
     gcgctgggag gtcggctaca cccgtgcggc ccgcgtgtgg acccgggtgc cgtcccgccc    122040
     cggctccttc ctgcgccagc agatccgctg gaagaagagc ttcatcagga acctcttctt    122100
     caccggccgc ttcatgtggc gccggggccc ggccgccgcc gccctgtact acgggcacgc    122160
     cctgtgggtg atcgcggcac cggtcctggt cgtccggcac ctgctgtggg ccccgctgca    122220
     cctggccggc ccgctgaccc tgctgtacct gggcggggtc gtcctcaagg gctgcgtctg    122280
     gggcctcgcc taccggctcg accaccccgg ggaccgcgcc tggcgctgcc gccccctgat    122340
     gagcctgctg tcctgctgcg tactggcctg gctgctgccg tacgccctgc tcacgctgcg    122400
     ccgcggcgtc tggtcgagga gtgccgcatg agagtcctgc tgcgcggact gggccgctcg    122460
     ctcgccgtcg gcctcacctg cgccgccgtc gccctggtct acgtgttcgt cgtcacccgg    122520
     ggacggtggc tgtgagcagc gacggctccc gtggaaaccg gccccggcgg atgccggacg    122580
     ggcgccccct gctgcgcgcc gccctcggac tgctcacggc ggccgtcgtg gccctgccct    122640
     tcaccgccgc ctggcagtac gacaccctcc ggcgcgcggt ggccgaacag gccgcgcctc    122700
     ccgcaccgtc ctccggtgac ggcggccccg gcctcggcgc ggacgccgag ccggcgcccg    122760
     cccggaacgc gcccgtggtc ctcgcctacc acgacgtggg ccccgacgac cgcagccgct    122820
     acaccgtctc cccggagcac ttcgacgccc agctgcgtgc cctgcgggac gccggctacc    122880
     gcacgctgac cacccgggag ttcaccggct tcctgcgcac cggccgcacc ccgggaccgc    122940
     gcaccgtcca cctcaccttc gacgacggca cgcacggact gtggacgcac gccgacccgg    123000
     tcctggccag gtacggaatg aaggcggccg cctacctgat caccggacag gtgggcaccc    123060
     accggccgta ctacctctcc tggcccgagg tggaacggat ggcgcggtcg gggcgctggg    123120
     acttccaggc ccacacccac ctcagccacg aacgggcggc cgtggacgcc gccggacacg    123180
     agcggtcggt gttcaccaac cggctgtggc tcgcggacga ggggcgcgtg gagacctccg    123240
     acgagtaccg gcgccgggtc gcggcggacc tcgaccggtc gatccgcgac ctcgtacggc    123300
     acgacctgcc ccgcccccgg ctcttcgcct accccttctc ggaacggctg gacgagtcca    123360
     acctgggcgc gcgcgacgcc gacgccctgc gctccatgct gcgggagcgt ttcacggcca    123420
     cgctcaccaa cagcgcggcg cgtccgctgc cggccggtcc gcgtgcggcc gccgccggac    123480
     aggtgcagcg cctcgaggtc acccgggaca ccaccgcggc cggtctgctg cgcgaactgg    123540
     gccgatgggc cacggtgacg ccgcaggacg ccgaccggcc gctggcccac ccggcgcact    123600
     ggcagacgac cggcgccacc gggcaggccg ggcccgggat gctcaccggc ggcagccgcc    123660
     ccccggccgg cacggcgtac gcctcggccg actaccgccc gttcgccacc gccgactgga    123720
     ccgactaccg actgcgcgcc gccgtcggag gcctgcacgg cacctccaac agcgcgggaa    123780
     tcaccctgcg ggcgggcagc ggacatcccg tgtcgctctc cgtcggccac cacacggcga    123840
     gcctcaccac ggcggacccg gagacaaccg gcgaccggcg gagctgccgg ctgaagccct    123900
     ccgccaccca ccggatcacc gtctccgtga ccccgcggca cgtgcgggtg agcgtcgacg    123960
     gcgagacctg cgcggcggtc cgcgcgggcc ggtggcgggt cgcggagggc gccgggggct    124020
     tctcgctcag cgtgcgcaac gacgggccgg agcggcagtg gccccgcttc acctcactga    124080
     aggtcaggtg acgcgcatca catgcggccg ccgatcactt cccgcgccgg ccgcggtccg    124140
     aagagcacga caccactcgt gacccgtacc ccgcacctcg tccccaggga gcgcatcgac    124200
     atgaccgcca ccgtgaaggg cccggcctcg tacttcccgt ccatcgagaa gaagtacggc    124260
     cgcccggtcg cggagtggaa ggacctcatc cggtcctcgc cgctcaccaa gcacatggaa    124320
     ctcgtcgcct ggctcaaggc cgagcacggc ctgggccacg ggcacgccaa cgccctcgtc    124380
     gcgcacaccc tggccgaggg cccggcgaag ggctaggccc cgccgccgtc cgcgccggag    124440
     gctccgtcct ccgggtccgc ctcctcggcc agcgccgcgt ccaggcgggc ccgcgcgccg    124500
     tccagccggc ggcggcacac ctccgccagc tcctcgcccc gctcccacag ggcgagggac    124560
     tcctccagcg tcgtaccgcc ggcctccagc cgccggacga cctcgatcag ctcgtcccgc    124620
     gcctgctcgt acccgagcgc ctcggacatc gccgtcggct gctccacctc gctggtcatc    124680
     cacccaccct atgcgtcgac tcgtacggag aaatcgccct cggacacccg ggcccgcagg    124740
     gtctcgccgg gctccacctc accggggtcg cggaccgcgt ggccgtcggc ccgctggagc    124800
     accgcgtacc cgcgcttgag ggtggcggcg ggggagaggg ccaccacgcg cgcgtgcgtg    124860
     tgcgtcagct cggagtcggc ccggtcgagg tggtgccgca gcgaacggcg tccccggtcc    124920
     aggagcgccg tcacctgctc ggcccgctcc tcgatcatcc ggtgcggatc ctgtatcgac    124980
     ggccgggcca gcgcgtgggc cagcccgcgc tcctcgcggt cgacgaacgc cgccacacac    125040
     cgccgggcgc ggtcccgcag cagccgtacc cgctcgtact cctcgccgac gtccggcacg    125100
     accttcttcg cggcgtcggt cggcgtggag gcgcgcaggt cggccaccag gtcgagcagc    125160
     gggctgtccg gctcgtggcc gatcgccgag acgaccggcg tgcgacaggc ggcgaccgcc    125220
     cgcaccagct gctcgtcgga gaacggcagc aggtcctcca cgctgccgcc gccccgcgcg    125280
     acgacgatca cgtccacgtc atcccgcgcg tccagctcct tcaccgcctg caccacctgc    125340
     ggcaccgcgt gcacgccctg caccgggacg ttgcgcacct cgaagcggac ggcgggccag    125400
     cggtgccggg cgttctccag gacgtcccgc tcggcggccg aggcccgccc gcacaccaga    125460
     ccgatcagct gcggcaggaa cggcagcggc tgcttccgct ccgccgcgaa cagcccctcg    125520
     cgcgcgagcg ccttcttcag ctgctccagc cgcgccagca gctcaccgac gcccaccggc    125580
     ttgatctcgg cggcccgcag cgacagctgc ccccgcggcg cgtaccactc cggcttcgcg    125640
     tgcacgacca cccgcgcgcc ctcgccgacc acgtccgcca cggcgtcgaa cacctgccgg    125700
     tagcaggtca cgctcacgga gatgtcgtac gacgggtcgc gcagcgtcag gaacaccaca    125760
     ccggcgcccg gccgccgcga caactgggtg atctgcccct cgacccagac cgcgccgagc    125820
     cggtcgatcc agcccccgat cagccgggac acctcgccca cgggcagcgg accttcaggg    125880
     gtcgagttgg cagccatgcg cccgagcgta acggccgggt ccgacaatcc ggccccagcg    125940
     atcccgttcc ccgcacccac cgaccgcacc accaccccct gccgcgcccc ggcccccccg    126000
     ccccgccgtc cctccaccgc cacgcccgtc gtccccgggc ccgtggtctt gcagcgcgtg    126060
     ccgcgcgtgt gtcgcccccg tccgtggctc tcgcggccgt ggcccttcgg ctcgcgccgg    126120
     gcccgtgtcc ccacgcccgt cgtccccggt ccatggccct tcagcgcgtg ccgcgcgtgt    126180
     gttgcccccg tccgtggctc tcgcggccgt ggcccttcgg ctcgcgccgg gcccgtgtcc    126240
     ccacgcccgt cgtccccggt ccatggccct tcagcgcgcg ccgcgcgtgt gtcgccgtgg    126300
     ctgtgggtct tgcggcccat ggcctttcag ctcgcgccgg cctgtgtccc tgtgtccccg    126360
     cgtctgtcgg tccttcggag cccggccggc ccgtgagccg cgccgggccc gtgtccctgc    126420
     ggtccggcca cctgtcagtc gcgccgagcc gacgggcgcg cgcggcccac gcctcacgcc    126480
     cccgtcgtct ccgcgtcgcg ccgccccctc cactgcgccg ccagcaccac cagacccacc    126540
     gccagccaga tcgcgccgac cacctgggcc gtccccgacg cctccacgat caccgcgatc    126600
     gtgatcgccg cgccgagcac cggcaccagc agatgccgcc accagatcac ccggcccccg    126660
     ccgcgccgca ccacgaacca gcccaccacg ctcgcgtgca gcagcgtgaa cgcggtcagc    126720
     gcgcccacgt cgaccaccga gaccaggtgg tcgagaccgt cgtcccggcg tgccgcccac    126780
     accgccgccg ccatggtgat caccgccgac accagcagcg ccacgcgcgg caccccggcg    126840
     tccgtccgcg ccagcacccc cggcagccgc cggtcccggc ccatcgcgaa cagcagccgc    126900
     ccggccgccg cctgcccggc cagcgccgcg aacgccgcgc cgatcgcctt gctcaccgcc    126960
     accagatcgt gcagccacgt gcccaccgac acgtccacgg cgtcgtagaa cgccgacccc    127020
     tgccgctccg gctccgccgc cagctgcgcc gacgacaccg gctccagcag cgccaccagg    127080
     tacgtctgcg ccacgaacag cacgcccgcc agcgccagac agaacagcag cgcccgcgcg    127140
     accttcgccg aacctccggt gacctcctcg gcaaacgtgg cgatcgcgtc gaagcccagg    127200
     tacgacagca ccgccaccga caccgccccg accaccgccg acagcgcgaa cgccccctgg    127260
     gtgccgtccc ccgacagcgg cgacagccag tcgcgctcgg ccccgtcctg cgccaggacc    127320
     acgatcgccg tcgccacgaa gacgagcagt acgacgatct ccatggcgag caccaggaag    127380
     cccacccggg ccgccgtccg caccccccac aggttcagca gcgtcgtgac gaccaccgcg    127440
     atcgccgtcc acacccaccg cgacacctcg gggaccaggg cctccatcgc gatcccggag    127500
     aacaggtacg ccaccgcggg gatgaggatg tagtccagca tcgccatcca cccggcgacg    127560
     aacccggccc cgttgccgag ccccgcgcgc gcgtaggcga acaccgagcc cgcctggggg    127620
     accacccgca ccatctgcgc gtagctgaat gcggtgaacg ccatcgcgac cgtggcgacg    127680
     aggtagacga gggcgaccgc accgtgcgac ttggcgtcca gcgtgccgaa cacgccgacc    127740
     ggcgccatgg gcgcgatgaa cagcagcccg tagacgacca ggtccctgaa gcccagactg    127800
     cgcctcagcc gctcttcccc accggcctcc ggggccgtcg taccgctctg cgccatggtg    127860
     cctccgccag tgcctcggtc ctcgccccgg tttccgcttc gggctccgcc tcggaacgtt    127920
     cccgccagtc tccccggcaa cgccgcaccg ccgcgatctc tgacccgccg aacgcggcct    127980
     tacgatgggt gccatgactg cttcgcctgg ccgccgtgtc ctgctcgccg ccccccgtgg    128040
     ctactgcgcg ggtgtggacc gcgccgtgat cgccgtcgag aaagccctgg agcagtacgg    128100
     ggctccggtg tacgtccggc acgagatcgt ccacaacaag tacgtcgtcc agaccctgga    128160
     gaagaagggc gcgatcttcg tcgagcggac ggaggaggtc cccgagggga acatcgtgat    128220
     gttctccgcg cacggcgtgg cccccgtcgt ccacgaggag gccgagcgcg gcaagctcgc    128280
     caccatcgac gccacctgcc cgctcgtcac caaggtccac aaggaagccg tccgcttcgc    128340
     gaacgacgac tacgacatcc tgctcatcgg tcacgagggc cacgaggagg tcatcggcac    128400
     ctccggcgag gcccccgacc acatccagct cgtcgacggc cccgaggacg tcgcgaaggt    128460
     cgaggtccgc gacccgtcga aggtggtctg gctctcccag accaccctct ccgtcgacga    128520
     gacgatggag accgtcgacg cgctcaagga caagttcccg cagctcatct cgccgcccag    128580
     cgacgacatc tgctacgcca cgcagaaccg ccagctcgcg gtgaagcaga tgggtgccga    128640
     ggccgagctg gtgatcgtcg tcggctcccg caactcctcc aactccaagc gcctggtcga    128700
     ggtcgccaag caggccggct cccgcgcggc gtacctggtg gacttcgccg acgagatcga    128760
     cgagacctgg ctggacggcg tcaccacggt cggcgtcacc tccggcgcct ccgtcccgga    128820
     cgtgctggtc gagcaggtcc tggaatggct gtcgcggcgc ggcttcgagg acgtggagat    128880
     cgtcaaggcc gccgaggagt cgatcatctt ctcgctgccc aaggaactgc gccgcgacct    128940
     gcgcgaggag gcggcgtccc tggtggcgga gcggggcggc tccgggacgg cgggggcctg    129000
     accggccggg gcaccgcctg ggtgaccgtc agtggtccgt cgtaacgtag ggccatgcag    129060
     atcttcggcg tggacatcgg cggatccggg atcaagggcg cccctgtgga cctcgacagg    129120
     ggcgacctgg cccaggagcg ctgcaaggtg ctgaccccgc acccggccac ccccgacggc    129180
     gtggccgacg gggtcaagca ggtcgtcgag cacttcggct ggaccggacg ggtcggcctc    129240
     accttcccgg gcgttgtgac gggcggcgcg acggtgcgca ccgcggccaa cgtcgacaag    129300
     ggctgggtcg acaccgacgc gcgggcgctg ttcgccgagc ggctgggcgg gctcgacgtg    129360
     acggtcgtca acgacgcgga cgcggcgggc gtcgccgaga tgcacttcgg agccggccgc    129420
     ggccgcaagg gcacggtggt cctgctcacc ttcggcaccg gcatcggcag cgcggtgttc    129480
     accgacggcc tcctggtccc caacaccgag ctgggccacc tggagctgga cggtcacgac    129540
     gcggagaagc gcgcctccag caaggtcaag gacgaccacg acatgtcgtg ggagcactgg    129600
     gcccaccgcg tccagaagta cctcgcgcac gtcgagatgc tgttctcgcc ggagctcttc    129660
     atcatcggcg gcggggtcag ccgcaagtcc cagaagttcc tgccccacat caaggacgtc    129720
     cgggccgaga tcgtccccgc ccagctgcag aacaacgcgg ggatcgtggg cgcggcgatg    129780
     cacgcggccg gctgagcggg agcggtcacg cggggggccg gttgcgggcg gcggcggccc    129840
     ggcgccgcat cagccggatc cggcggacga tcacggtcga cccggcgacc agcgtcccgc    129900
     cgtacagcca cccggcctcg gtggccagcg cggtcacgat ccccatcagc cgtccgccga    129960
     gaccgccgtc cccgctctcc gccacgggca ccaggcccac ggcgaaggcg atcggcacga    130020
     cgacgggggc ggtcagcagg tcgccccggc gcacccagag cgcggtgagc agactcaccg    130080
     gcacgaacag caccccgtac gcggtgaggg acgagccgaa cagcagctcg tccaggaagc    130140
     ccagcagggt catcaccgcc gcgcagaaca ggccgctgcc cagccccgtc aaccgcggat    130200
     tgggcatccc gcgcagggca cgcaccaccc tcgccaccgg cgaaggggcc cccggagccg    130260
     gccgcaccgg ttccgggcgc cgtcccgcgg gcggcccgac ccgccccgca ggcggccgcg    130320
     cgacggcacc gccccgcccc tgtgcgggca gcggcgcccc gcttcgtcgc ggtccgtact    130380
     gggcaggtcg cgtcctgtgt tgctccactg gaccaactta ggtcggttta tgtgccgaat    130440
     aggccgacag acacgccgcc gggcgtgtct tggccaagcg ttcgactccg cgcgggtccg    130500
     gtacggcaca ccccgtagac tggtggatcg gcccatgcct ggcccgcccc atcccacccg    130560
     cccctccgca tctcacgtac gggaagtcgc aacgtgtcgc tcacgatcgg aatcgtcggt    130620
     ctgccgaatg tcggcaagtc gaccctgttc aacgccctga ccaagaacga cgtgctcgcg    130680
     gccaactacc cgttcgccac gatcgagccc aacgtcggcg tcgtgggcgt ccccgacccc    130740
     cgcctgacga agctggccga gatcttctcc tccgagaaga tcctcccggc cacggtcgac    130800
     ttcgtcgaca tcgcgggcat cgtgcgcggc gcgagcgagg gcgagggcct gggcaacaag    130860
     ttcctggcca acatccgcga gtccgacgcg atctgccagg tcatccgcgc cttcaaggac    130920
     gagaacgtcg tgcacgtcga cggcaaggtc tcgccgaagg acgacatcga gacgatcaac    130980
     accgagctga tcctcgccga cctccagacc atcgagaagg tccttccgcg cctccagaag    131040
     gagtcgcgca tcaagaagga cgtcgctccc aaggtcaagg cggtcgagga ggccaaggag    131100
     atcctggaga agggcgacac cctcttctcc cagggcatcc tccagggcag cgagcgcgcg    131160
     gagctcctcc acgacctcca cctcctcacc acgaagccct tcctctacgt cttcaacgtc    131220
     gacgaggacg agctgaccga cgacgacttc aagagcgagc agcgcgccct ggtcgccccc    131280
     gccgaggcga tcttcctcaa cgccaagctg gaggcggacc tcgccgagct ggacgaggac    131340
     gaggccctcg aactcctcca gtccgtcggc caggacgagc ccggcctcgc cactctcgcc    131400
     cacgtcggct tccgcaccct cggcctccag acctacctga cggccggccc caaggaatcc    131460
     cgcgcctgga ccatcaagaa gggcgccacc gcccccgagg ccgccggtgt catccacacc    131520
     gacttccaga agggcttcat caaggcggag gtcatctcct tcgacgacct ggtcgagacg    131580
     ggctcggtca ccgaggcccg cgcgaagggc aaggcccgca tggagggcaa ggagtacgtg    131640
     atgcgggacg gggatgtggt ggagttccgc ttcaacgtgt gacgtttcgt caagaaccgt    131700
     gcccgacccg cctgttgctg ggtcgggcac aagtctttgt ccgcggggag ccctcgccct    131760
     cgtcatgagg ggcagtgacg ggtctggtcg acgtgagacc gcctcagacc ttgacgaccc    131820
     ccacggaagg gccgcagagg agtgtcagat cctcggggtc ggacgtgagg acggtgaccg    131880
     gccgggacgc gtcgcgggcg atgacggcga aggcggcatc gatggcgtac gtgtggccgt    131940
     gcaggcgatg ggcgcgcagg agcgcggcgg cctggtcggt gatctccttg gtgacgtcgt    132000
     ggacgtcgac gcgggagagg atccacttga tgcgggccgg gtggatgcgc tcgtagtctg    132060
     cctcaagcgt ggtcatggcg ctggtggcca cgcgtacacc ctcttccgcc gccgcctgga    132120
     ccagggccat gacggtacgg tccttgcggt agagcttcga gagcccttcg ctgtcgagca    132180
     ggagggtgcc gggcatcagg cggcggcccc gccggcctgc cggtggtcgt ggcgcagcag    132240
     cgcccgggcg gcctcgacct cctcgtgggt gagagcttcg ttgtcggtct cgaagtcggc    132300
     gacgatctcc cgcagcttgt ccatggcgac ccgctgttcg agagcctcgg cgacataggc    132360
     ggagaaaccg ccgggcccga catgagcgcg tacggcctcg gcgagatcct cgggcaggct    132420
     gatcgaatac ttcctactac cgctcatggt gccgatccta ccggcggtcg taagcctggg    132480
     gggtgaatgg ctgccccgag gttcggttga tcagcaggga gctgtgaatg cccgtcgagg    132540
     ccccgtgtgg gcggtggaaa gatgcgggga gggccagaga ggggcgggaa gcgtggggcg    132600
     tggcgagcgg gacacagtcg cgaggggaac gcgactgtac gaggcggcgc aggcagtggt    132660
     cggtgaccat gcacgggcag tggaggcggt acgggcagcg ctgaaaccga tccacgatga    132720
     ggcggtgaag cgggagctcg acgccattcc cgtcgctcgg ctgcaggacg tcaccgaagg    132780
     gcggctgcgg ctggggagcg tcgagaagag cggactgcgc accctgggca gggttctcga    132840
     agcgggcccc taccggctgc ggcagattcc cggtgtcggg cagcgcaccg tcgaccagat    132900
     actcgccgcc gcccgccggc tttccgaggc cgtgcacgag accgtggccg tccacatcga    132960
     cgtggaccgg ccggaaccgc gcaccaccgc gctcgtcatg gccctgcacg tactggtgga    133020
     agccggcccg gaggcccggc gtgcggtcga caaggccacc gtcctgacgg aacggctcgg    133080
     tccgctgctg gccgacgctg ggcccgccgc cggaagggtc cggatgctgc tggccggccg    133140
     ggagaagaag gctcgcgcgt gggcggcggt cgccgcgacc cggtcgctgg tggacgaggc    133200
     ggagcaggcc ggcctgcccg ggctgctcgc ccaggcgtcg gtggacctgc tccgggggac    133260
     tgcgtccgac gttgcggcct gggtggactt cgaactccgc tccgccgagt actacagcct    133320
     gctcgccgag atctccggac ggccgccgga cgcggctgcc gtagaggggt tcttgccgga    133380
     cgaggttgca gagcgggtac ggacccagca cctcgacgac acgcaccggc gggtctccct    133440
     gcgcggctac caggcgttcg gcgcacggtt cgcgcttgcg cagcgcaagg tgatactcgg    133500
     cgacgagatg ggcctcggga aaaccatcca ggcgatcgcc gtcctcgccc acctggccgc    133560
     cgagggacag agtcacttca tggtcgtctg ccccgcgagc gtcctcgtga actggacacg    133620
     ggagatcgag gcccgcagtg ccctgcgcgt catggtgctc cacggtcccg accggcacta    133680
     cgcgttcgcc gactggaagg ggcggggtgg cgtcggggtg accacgttcg acgcgctgcg    133740
     cggctttccc gctccgggcg gcggggaggt cgggctgctg gtggtcgacg aagcgcactc    133800
     cgtgaagaac ccgaaggcca agcggtccca ggcggtcggt ctgtgggcgg agcgttgcga    133860
     gcgcacccta ttcatgaccg gaaccccgat ggagaacagg gtcgcggagt tccgcaacct    133920
     ggtccagatg ctcgacggcg atgtcgcgga ctccctcggt gaacgggacg cgttggccgg    133980
     atcggtcacc tttcgcaagg ctgtggcccc ggtctatctg cggcgcaacc aggaggacgt    134040
     gctgacggaa ctcccgagcc ttcagcagac cgacgagtgg gaggagttga gcgcttcgga    134100
     cgaggaggcg taccgcgaag ccgtgcgcgc gggcaacttc atggccatgc gcagggccgc    134160
     gtacatgagc tccgggaatt cggccaagct ggaacggctt cgggagattg ttcaggaggc    134220
     cggcgagaac gggcagaaga cggtggtctt ctccaacttc aaggacgtac tggccgtggt    134280
     gaaggaggcc ctcgcggtcg aaaccaccag ggtcactccg gtgttcggtc cgcttaccgg    134340
     cggcgtcccg gcccagcgcc gccaggagat cgtcgacgac ttcgccggtg tccagggtcc    134400
     ggcggtgctc ctggggcaga tccaggcagc gggtgtcggc ctcaacatgc aggccgcttc    134460
     cgtcgtcgtc atctgcgaac cccagatcaa gccgaccatc gagcatcagg cggtggcccg    134520
     ggcccaccgt atgggccagg tcaggccggt tcgagtgcac cgtctcctcg ccaccggggg    134580
     cgtggacgaa cgcatggtga agatgctgga ggccaagacg cgcctgttcg atgcctatgc    134640
     tcgccgcagc gccgtggccg aagccacccc ggacgcggtc gacgtgtcgg acaccgagct    134700
     ggcacgtcgg atcgtcgagg aggaacaggc tcgcctgggt atgacggacg agaggcccac    134760
     gtcatcggag tggggtgtcc cgcggtccgc agccagtccg caggaccccc tgaacggccg    134820
     tcgggagtcc acgaatgcca acgagtaatc ccaggtcagg gccatgcgtg gggctgtgcc    134880
     gcaggtcaga gtgtggcctc ggacgttccg cttccacgtc taaccggtga gccgcgtcac    134940
     tgcgcggacc cggtggcctg cagggcgtcg tcgagcaggt cgcgcagttg tgcgcgggcg    135000
     gtgatgccca gtttggggaa gacccggtag aggtgtgagc cgaccgtgcg cggggagagg    135060
     aacagcctct ccccgatctc gcggttggtc aggccgtggg ccgcgagccg gacgatctgt    135120
     tgctgctggg ggctgagttc ggtgagggcg ccgggtgcgg cggcgtccgc ctcgatgccg    135180
     gcggcccgca gttctgcctt cgcgcggtcg atccacggtc gggcgccgag tcgccggaac    135240
     gtgtcgaggg ctccggtgag cagcggtcgg gcctccgcca cacgacgctg ccggcgcagc    135300
     cactctccgt agtccagccg ggtctgcgcc cgctcgaagg gccactgctc gcccgcttcc    135360
     cccgccagcg ccgcccggaa gtggcgttcg gcacgctccg gttcggcgag cagggcgcgg    135420
     cctcgctcga ccagcaggaa gaggcgcgcc gacatgccgg ggcccaggtg ccgggccgag    135480
     cgctccagca gtcgcgcggc gggttcgcgg tgtcctcggc ggacggccgc cgcggcgagt    135540
     tcggccagga cggtggggga gacgtggtag tggaccaggt ctccgtcctc ggtgaaggcg    135600
     gcgcggaact gcgcgtacgc gctgtcgtag tcgccctcgg ccaccgccgc cagccccagg    135660
     gcacggcggg ccaggaccgc gacggagcgg ctctccaggg gggcgacgag ggccagcgcc    135720
     cgctcggcgc tgccgcgtgc ctcggccggt tcaccgagca gcgccagcac ggtcgcgtcg    135780
     agggtgcgtg cgcacgcctc ggcgtgatcc aggccggccc ctgaggccac ctccgcgatc    135840
     tcggcggcca ccgagcgggc gtcggcccag cggccctgct ccagataggc ccagccggcg    135900
     gcgcaggcca gaccggccgg cagcgggcca tgggcctgcc aacggccgaa cgcctcgtcg    135960
     aaggtcctgg ccgcgagcgg ggtccggtcg aggagccagg ccacgacggc gagcgccgtc    136020
     agtgacccgg cctcgccctt ggccgcggcg atcagccggg gcagcgccgg ggcgagggac    136080
     gctccggcgc cgctgggatc ggagacggcc agtacccagg cgcgcagcgc accacccgcg    136140
     gcggagtccg gcacatcggc gagcagggcc tcgatccgct gccgctggga ctcctcgccc    136200
     gagtagtagc ggaccaccgc cgccgcggcg agcgcgtcca gcagccgggg cgaccgggtg    136260
     gccgccgcct cgtcggcgac gcgcgacagc agtgcgaagg cggccgtgtg gtgcggaccc    136320
     agggtcagga gccgccccgt cgccagcgcg gcccggccga tcagcgccgg gtcgtcactg    136380
     cgctcccgtg ccccggcggc caggtgttcc acccagccga gctgaccggt gaagacggcc    136440
     gtgtccgcgg cgtcggccag cagtcgcgcc tggtccgccc ggtgcgggct gagttccgcg    136500
     gcgcgctcca gagcggcggc ggcggccgcg tgaccgcccc ggcgcctggc ccggcccgct    136560
     gtttcccgga gggccgccga cacctgctcg tcgggccgta cggccgcggc ggcgaggtgc    136620
     caggcgcggc ggtcgggctc ctcgcccagc tgccgggcga gggcgaggtg ggcccgcctg    136680
     cgctgctcga agggcgcggc gtggtagacc gccgagcgga cgagcgggtg gcggaaggag    136740
     accccggtgc cgtcctgccg tacgagaccg gcccgttcgg cgggcgccca caccgtgtcg    136800
     gccgcctcgg gcaggccccg tgcggccgcc ggggcgtccg ccgcgtcggc ggcggcgagc    136860
     agcagcaggg cgcggcgggt ggcttccggc aggtgccgca cgtggcgcgc gaagatcccc    136920
     tccagccggt cggtgacggg cagcgggccc tccactccac tgccctccgg ctctctgtcc    136980
     gccgtggcgc gggcgagttc gaccagggcc agcggattgc ccgccgcctc ccgcagaatc    137040
     cgggcccggg tacggccggt gggccgcttc ggctgctcgt cgagcagccg gttggccgcg    137100
     tcaccgctca acggcccgat ctccaggcgc tcgtagccct tgtcgaaccc gggcagtacg    137160
     gccgcggcac gcacgcccat cagcagcgtc acgggctcgc cggccatgcg ccgggccagg    137220
     aaggagagga cgtccagtga cgcgcggtcg atccactggg cgtcgtcgac caccacgagc    137280
     agcggtgccg gttcggacag gtccgacacc agggtcagca cggccaggcc gacgagcagg    137340
     gcgtcggggg tatcggcggc gtcttcggcg tcttcggcca gtcccagggc ggttcggagc    137400
     gcggagcgct ggcgggccgg caggccgccc aggtcatcca gcactgggcg gagcatctgg    137460
     tgcaggccgg cgaacgcgag agacgcctcg gactcgctgc ccaccgccct cagcacccgc    137520
     tggccggtac cgcgggtcag ccgcacggcg aggtcgagca ggacgctctt gccggcaccg    137580
     gggtcgcctt cgacgatcag taccgagctg tgggagcggt cggcggcgat gcggctcctg    137640
     atctccgcga tctcggcctc ccggcccacc acggtcggac cgggggcagg cgccgggccg    137700
     gggcccgcgg tcggaccggg ggccgccggc gagccgtggc ccgcgcgagc gcgttcacca    137760
     ttcttcacgg atgctccagg aactgagaca gccctgacgg caacgtggca ggaccgcggc    137820
     cgtattcctg ccgcccccgg ccgcacacgg tcgattacgg ctggtcaccg ccgctcaccg    137880
     ccgctcaccg ccgctcaccg ccgcacacca cgagcccggg cggacgccac gagcccgggc    137940
     ggacgccgcg agcccgggcg gacacgggtg cagtcacgtg acgcataccg ccgcccgcca    138000
     cccgcgacgc acccttgcgg aacaagggcg tgcgttcacg cccgaccttc tggagatctt    138060
     tcgaactgga gcaccccttg gacaccatca ccctgggcga tgtcaccgtg acccgggtcc    138120
     gggagtacta cggccccgtc ggcatgacgc ccgaggcgtt cgtcccggac agcccggccc    138180
     aggcgtggga cacgcaccgt tcctggctgg ttccggactt cctggacgcc gagacccgca    138240
     tcgtcaacac cgcgatccag acctgggtcc tgcgcagcga gggccggacc atcctggtcg    138300
     acaccggcgt cggcaaccac aaggaccggc cgtacgcgcc cgtctggagc cgcctcgaaa    138360
     cggactttct ggccaacctc gcacgggccg gcgttcagcc cgaggacgtg gacatcgtga    138420
     tcaacacgca tctccacatc gaccacgtcg gctggaacac ctacctggac ggccggacct    138480
     gggtaccgac gttccccaac gccacctacc tcatggccaa ggcggacttc gactactgga    138540
     acccggccaa cgagatcaag accctgctcg gccgcggcaa ccagaacgtc ttcgaggaca    138600
     gcgtcgcccc cgtgcacgag gccggtctca cccggctgtg ggaggacggc caccgcatcg    138660
     actccaacct gcgcctcgag ctcgcacccg gccacacccc cggctcgtcg gtgctgcggc    138720
     tggagtccgg ctccgaccgg ggcctgttcg tcggcgacct gatgcacagc ccgatccaga    138780
     tccacgagcc cgacgccaac agctgcttct gcgaggaccc cgccgaggcc cgtgccaccc    138840
     gccgccggct cctgggctcg gcggtggaca gcaacgccct cgtcttcccc gcgcacctgg    138900
     gcggccacgg cgctgccgaa gtcgtccgcg agggcggcaa gttcgccgtc aagggctggg    138960
     cgcccttcac cccgtacacc ccgtcggtct gaggcccgca aaaggacacg cgtgatgaac    139020
     caccaccccg agcccgtcgt gaccaccgcg cagggcgccg tccgcggcct gcgccaggag    139080
     gacggcaccg ccgccttcct caacatcccg tacgccgccc cgcccttggg cgccggccgg    139140
     ttcgcgcccc ccaggccgca cgagccgtgg gacggcgtac gggacgccac agtccccgga    139200
     cccaacgcgc cgcagtccga gcgcaggctc ggcagcatcg acatggcccc ctacttcggc    139260
     accggctgga gccgcggcga ggactacctc accgtcaacg tcttcacgcc cgccaccggg    139320
     gccggcgacc tgccggtcat ggtcttcgtg cacggcggcg gcttcgtcgc cggatcgaca    139380
     cggtccgcga tgtacgacgg ctccgccttc gcccgtgacg gcgtcgtcct cgtcaccctc    139440
     aactaccggc tcggcatcgc cgggttcctc gacatccccg gggcgcccgc caaccgcggc    139500
     ctgctcgacg tcgtcgccgc gctgcgctgg gtgcgggaga acgtctccgc cttcggcggg    139560
     aacccgcacc acgtcaccct cttcggccag tcggccgggg cgaccgtcgt cggcggcgtc    139620
     ctcgccaccc ccgaggccga cgggctgttc cggcgcgcga tcgtgcagag cggcagcggc    139680
     ctgggcgcgt tcacacccga gcaggccgcc cgcgtcaccg cggccgccgc ccaggccctg    139740
     ggcgtcgagc cgcacgtcga cgcgttcgcc ggcatccccg acgagcggct ggtcgaggcg    139800
     gcgtccgggc tcgcgggcat cgacctgcgg accgggaccc acttcgaccc gctgatcggc    139860
     ctcagcccct tcagcctggt cctcgacacc cagcccgccg catccgtcgc cgccggccgc    139920
     gccgccgacg tcgacctcct cgtcggcacc aacaccgaag agggcaacct ctacctggtc    139980
     ccggtgggca agtacgccac ctcgaccgcc gccgacgtcg acgaggccgc cgcacgtgca    140040
     caccccgacc cggcacagct cgtagcggcc taccgcacgt cacgccccga ggccaccttc    140100
     gcggaactgc gctccgccgt catggccgac gccctcttcg gcgcgggcag ccgcgcgctg    140160
     gcgagcgccc atgccaccca cccgcgggcc gccacctacg cctacgagtt cgcctggcgc    140220
     tcccgcgccc tggacggaga actcggcgcc acccacgcgg tcgaactgcc cttcgtcttc    140280
     gacctcgcgg accggcccga actcaacggc cccgccgccc tgctcggccc ggagcaggcc    140340
     cccgccgacc tcgccgcccg cgtccacgcg acctggatcc ggttcgcccg gaccggcgac    140400
     cccggctggg acccctacga caccgaccgc cgggccacca tgcgcatcga cgccgaatgg    140460
     agccagaccg acgacccccg cagcaaggaa cgggaggtgt ggagctgacc gcgggtcacc    140520
     cctgggggcg gggcccgggc gcgcccaggc ccccgagggc gatccccatg agccgggtgg    140580
     cgtggtgggc ggcgtcgggg gtgtgctcgg ccgcgaggga caccgcgttg gcgagggaga    140640
     gcagttcgag ggcggtcacg tcgtcgcgga cggttccgtc ttcctgggcg cgggccagca    140700
     ggtcggcgcc ggcctccgtc agcagttgct cacagcgcga atccagcgcg gcccccgtgt    140760
     tcgtgccggt cgccggcaac agggaacggg cggcgccgcg cgtgacggca ccgaagaccg    140820
     ccagggacgt cagccatcgc gtcagagcgg tcgccggcgg gtgttcggcc gccagggacc    140880
     gggcctcgtc gcacagctgt gccacgcgct cctggaagac ggcctggagc aggccccacc    140940
     gggaggggaa gtggcggtgc agggtggccg agccgacgcc ggcccgccgt gcgatctcct    141000
     ccagggaggc gtcggcaccg tgccgggcga cctcggccgc ggcggcctcg atgatccggt    141060
     cgtagttgcg gcgtgcgtcc gcgcgcttgg gcgggcccgg gttctcccag ctcacactcg    141120
     tggtcttctt cctcgccgac gaaacggggt gacaccccat tcttgcaccg ccgccgggct    141180
     gcgtcgtttg acaggaagtg gggggtggcc ccatattcga aaaagcggag gggcaccccg    141240
     tttctgccgc acgacacagg agacgaaggc atgcgcgccg tacagttcga ccgttttggc    141300
     ccgcccgacg ttctgcgcgt caacgacgtc cccgcgcccc gacccgggcc gggagaagtc    141360
     ctcgtcgagg tgcgcgccgc gagcgtggac gccggtgaga ccgccttccg ggcgggcagg    141420
     atgcgccggg tgacccgcgt ccgcttcccc cgcggcctgg gcagcgactt cgccggccgg    141480
     gtcgcggccc tcggcagcgg cgtacgcgcc tggagcgtgg gggacgcggt gtgggggctg    141540
     atgccgcacc tcaccttcgg ggcaatcgcc gactacgtcg cggtgcccga gcagcggctg    141600
     gcccgggctc cgcagaacct ggacctgctc gaagccgccg ccctgccggt ggtgggcacc    141660
     accgcgatga cggccctgag cggcaaggcg cgactccagc ccggggaacg gctcctggtc    141720
     cgcggcgcca ccggcggcgt cggcagcgtc gccgtgcagc tgggcaaggc gctgggcgcg    141780
     cacgtcaccg ccctcgccgc cgcccgcaac ctcgactgga tcacccggct gggggcggac    141840
     gaggccgtgg actaccgcac gacccggccc gaagacctcg accggttcga cgtgatcgtc    141900
     gacgtcgtcg gcaccgacct gggtgcctac cggaagcggc tggcccgcgg cggacgtctg    141960
     gtcgccctct ccttcgactc ggaccgcgtc gtctcctcca tgctcggcat cgccctgcgg    142020
     gcggccgcca ctccccggcg cgtcaagatg ttcagcaaca acccctcggc cgaccggatc    142080
     gccgaactca cccgggccgt cgaggcgggc acgatccggc cggtggtcga caccgtcttc    142140
     cccatgcggg acatagcggc ggtccaccag cggctcgaag ccggcggcgt ccgcggcaag    142200
     tacgtcgtcg acctgcggct tccctagctc acggtcggcc gatccccagg ttcggcgcgg    142260
     cagcgcgtca gggtgtcagc gcgcactccg ccgccgccac gaccgtgcgg gcctggagtt    142320
     ccacctgggc gtgcacgggg acccagcgca gccgcaggga cgtctcgaag tccgtgcacc    142380
     aggcggtgaa gagggcgtcc agctcgtggt ggagcccggc ggcggccggg gcgtcggccg    142440
     cgtgcagcag ccgcagcagg agtcccgccg cgcgtagcgg ctgacggcgc gcgacgacct    142500
     ccagggcgcc gatccccgcc gtcgtcaacg cgggtgagcc gtcggtgcgc ggtcccgcct    142560
     ccgcctgccg gaccaggggc ccccaggagt cggccaccag gtcgtacagg tcctcggcca    142620
     tccactccag tacgcgtacg ggtgggctgt cctcgggtgc cggcaggagg ccgcgggccc    142680
     tctcgaacac ggcggtcacc tgccggccgc cctcccgcac cagcccggac agcgcgcgca    142740
     gggcccgggc ggggtccgcg tgcggggtcg ggtcgtccgc cggggcggtg gcccacagcg    142800
     gtacctcgac gatcgccgtg gcaccgccgt accgctgggg cgcgcaccag gtggacaggc    142860
     cgatgtcctc ggacccggcc gccggccgcg cggtgctgcc cggcggcggc aggacatgga    142920
     tgccgggggc cggattctcc cagtacaggg cgtcgtacgt gccgtgctgg accgggaccc    142980
     ccagggcggc ggcggacgcc gcgaaggggg cggcgagtcc ggggaggtcg cgggtcagct    143040
     gggcccaggt gccgcccgcg tcgacgttgt gcagggagca ctggaggacg gggcgcaggt    143100
     cgtcgatcac gtcgaacagg gcacggctct ccgggagtgg ccggccgacg atcggggccc    143160
     actccggctg ctccgcggcg accgggcgga aggcggcacg gtagtacgac gccagggacg    143220
     gggcggggcc ggccgtcgcg gtctcgatgc cctcgctcag cgcggcgccg tccgggtcga    143280
     ggcacaggac gatgtcccag gtgacggcct cggggtcggt cgccggggag cgccggtcgc    143340
     cgcctgcgac cagctccgcc agcgccagtg ccgtcgcgcc gcccaccggc tcgtccgggt    143400
     gcggccgggc caccaccagg acgtgccggg gtccgtggcc caccgacagc atcaggagcg    143460
     gccggcccgc ccgggacgtg ccgacacgac acaggcggcc ggtgcccggg aaacgggaga    143520
     ccagccgtcg cgccgactcg gtgacctccg cgaccgtggg gtatcggttc atcgggcgtg    143580
     tccggtcagg ctccgccgtt gccgctctcg tccgccatgc cgtctccttc cgacggtgcc    143640
     cgtgggtacc cgtgggtacc tgtgctgctt ttcgcgcctg tgctgcctgt ggtgtgcgag    143700
     gcgcgtcgtg ccgctgtcag cgtccgttca ccggatcacc gctgtcaatg gccggtgccg    143760
     cccgcgcagt cgggggcggc gaagccggcg cgaaggcgag ggtgcgcgtc aggccgggaa    143820
     gacgtggtca tgggtgacgt ggcgggagcg cagcagcaac tcgccgtccg ccccccggac    143880
     caggacgtcg tgcacgaggc aactcggccc gaactccggc gccttgacgt cggcgtggac    143940
     ggtgagcacc aggcagtagc tggtcgccgt gatcgagccg tcggacgcct ggctcagcgc    144000
     cgtgtggtcg aaccagtgcc tgcgctggat tttgcgggcg tcgaacttgc ggtggaagtc    144060
     ctccaggacg gcggtgatcc cggcacgggt gtgggcggca ggcagcgagg gcgagtgcct    144120
     gaactcgccg tcctcggtga aggtcgcggc gtagccggcg aagtcacggc cgtccagctt    144180
     ctgcatctgg tggccgtaga acgacaggac ctcggcgtac aggccggtgg gaagcgcggt    144240
     gatggtcata cggccacggt cgcccggtgg cctcgaagtt ccctcgagcc gggttcgagt    144300
     gggcgctgcc aggctcgtcg ccatgagcac cgtgacagtg atcggggcgg gcacgatcgg    144360
     cctgggatgg atcaacctgt tcagcgcccg cgggctgacc gtacgcgtca acagccgtcg    144420
     gcccgacgtc cggcgcgtcg tgcacgaggc gctcgagctg ttctccccgg ggcgggtgga    144480
     cgagctggcg gcgcgcatcg agtacgagcc ggacgtcggc cgggcggtgg ccggggcgga    144540
     cgtcgtctcc gagaacgccc ccgacgacct gccgctcaag cagcggttgt tcgcagagat    144600
     cggagcggcc gccccggacc acgccctcgt gctgtcctcg acgtcgaagc tgcttcccga    144660
     cgagctgagt cgggacatgc cgggaccggg ccggctggtc gtcgcgcatc cgttcaaccc    144720
     accgcacatc gttccgctgg tcgaggtggt ccgcggcgag cgcaccgacc cggaggccgt    144780
     cgaacggaca ctggccttcc tggcgtcggt cgggcggacc cccgtcgtgg tgcgcagggc    144840
     gctgcccggc ttcgcggcca accggctgca gtcggcgctg ctgcgcgaga gcatccacct    144900
     cgtcctcgaa ggcgtggtga ccgtcgagga gctcgaccgg atcgtcaccg actcgatcgg    144960
     cctgcgctgg tccaccatcg ggccgttcca cgcgttccac ctgggcggcg gtcccggcgg    145020
     cctgcgcaag tggctcgagc acctcggcag cggcctcgaa cagggctggc gtgggctcgg    145080
     acagcccgcc ctcaccccgc aggccgtcga ggctctggtc gcacagaccg aagccgccta    145140
     cggacaccgg ccctacgccg aactggtccg ggaccgtgac gaccggcacc tcgccgtact    145200
     ggccgccctg gagcggaccg agcagcccca ggaggagacc aagtgatgcg tgccgtgcag    145260
     ttcgaccggt acggggaccc cgacgtgctg tacgtcgccg agcgtcccgt ccccgaaccc    145320
     ggccccggcc aggtgagaat cgccgtcgac gccgtgagcg tcggccacgc gcagacccag    145380
     atgcggcgcg aggccttccc cgcgccgatg tggcggcccg tcttccccgt cgtcctcggc    145440
     ggcgacgtgg tcggcaggat caccgcggtg ggaccgggcg tcacggccct gcggccggga    145500
     gaccgggtcg gtgcgttcac cctctacggc gcctacgccg agcaggtcgt cgtcgacgcc    145560
     gtcaccgtcg tacccgtgcc cgaggagctg gacgccgccg aggccgcggt cctcccgggc    145620
     accggactga tcgccctcgg catcctgcgg accggacgac tgcgcaaggg cgagacggtg    145680
     ctgatccacg cggcggccgg cggggtgggc cacatcgcgg tccagctcgc ccgggcggcc    145740
     ggcgccggcc tgatcatcgg caccgcgggc gcggccgcca aacgcgagtt cgcccgcgcg    145800
     acgggcgccg acgccgtcgt cgaccaccgc tccgcacact gggccgacga ggtccgggaa    145860
     ctcaccgggg ggcgtggccc cgacctgatc ctggacggca tcggcgccga ggtcctggag    145920
     cagggagtcg gtctgctcgc tccgggcggc cggctggtgt tctacggctc gtccggcggc    145980
     gagctggcga tcccgaaggt gtcggtgatg gacctcatcg gcatcaagta cgtcaccggc    146040
     ttcgccctgt cggcctggcg cggtggccgc ccgcaggagt acgaggcggg cgtcgccgaa    146100
     ctcacccgac tgctggccga aggacaggtc acgtccgcgg tgcacgcccg gctgccgctg    146160
     gagcgggcgg ccgaggcgca cgccgtcgtc gaggccaggg cccagctggg ccgggtcgtg    146220
     ctcgtcccct gaaacgacca ggcattcctc cgaagtgtcc aagcattcct gatccaagag    146280
     cccgaaggag acctttccat gacctcgtcg ctgcaccacg cgatacgtct gaccaccgcg    146340
     tccgccatcg ccctgggcgg actcgtgacc ctggggacca gcgcgcacgc cgcgagcgtc    146400
     gccgtgccgt acgagtgccg cacctgggtg cagggcaaca cgcacccggt ctacgactac    146460
     gcgcgcggct tcgacgtcag cgtgcccgcc tcggtccgcg cgggcaagaa gttcaaggcc    146520
     acctacgatc ccgacccgat caccgccttc gccgagtaca accagatcgt caacgacgtg    146580
     cggatcgcct accggatccc ggacggcgcg aaggtccaca aggtgcggct caccggcggc    146640
     agcggtctcg gcgactccga cgtccgggtc caggtcaagg gccgggacat cgtcgtcagc    146700
     gcctccggcc ccttccaggg cggtgtcgag ttcgacctgc cgacgctgaa ggtcacctac    146760
     aaggcgccga agaccaccgg cccgctcaac ttcgtctcgg gcggctcggg ttacgaggac    146820
     cccggcttct actggtaccg ctaccagccg atcctggacg agtggggccc cttcgagtgc    146880
     ttccccgacc cggcgaagcc cgaggccgtc ctggccagca cccaggtcaa gaagcacaag    146940
     tagacacagc ggggtcggac gaacaatgga gaacgcatgc ccaaggccgt agccatccac    147000
     cagttcggcg ggccggacgt actgggcctc gtcgatgtcc ccgagccggt gccgggaccg    147060
     ggccaggtga ccgtccgagt gcgggccgcc ggagtcaacg ggttcgactg ccgggtgcgc    147120
     tccggcggca tgcgcggtcg ctatccggtc gagttcccgc agatcatcgg caacgagttc    147180
     gccggggtcg tcgagcggac cggaccggag gcgaccgggt tcgcgcccgg cgacgaggtg    147240
     ctcgggttcg ccgtgcttca gtccggcacc gagctgctcg ccgtcggcgc ggaccagatc    147300
     accgtgaaac cgccggagct gtcgtgggag gtcgcgggat ccctctcggc cgtcggacag    147360
     accgccgaca tcgccctggc cgaactgcgg gtcggccccg gggacaccgt gctcgtgcac    147420
     gccgcggccg gcggcgtcgg cagcctcgcc gtccagctcg tccgggagcg gggcggcacg    147480
     gcgatcggca gcgccggcga gcacaaccac gactacctgc ggtcgttggg cgcactgccc    147540
     gtcgcctacg gcccgggctt cgccgaccgg gtgcgggccc tggccccgaa cggcgtcgac    147600
     gccgccctcg actgccacgg cggaccggaa gccctcgccg tgtcgctcga actcgtcgcg    147660
     gaccgggccc ggatcgccac cgtcgccaac ttccgcgccg cggcccagga gggcatcgtc    147720
     atgccacggg tggtgcggtc cgccgagcgg ctcgccgcgc tggccgcact ctgcgccgag    147780
     ggccggctgc ggccgcacgt cgaggccgtc ctgcccttcg ccaaggcggc cgaggcccat    147840
     caccggctgg agcagggcca tgtccggggc aagctcgtcc tggtgccgga cctgtgacgg    147900
     cgaaccccgg ccgtccgggc ggcccggcgg accagggcca cccgcgccgc tgggccatcc    147960
     tcggggtgct ggtcctcagc ctggtcggca tcatcctcga caacaccgtg ctcaacgtga    148020
     cgctgcgcac cctcaccgac cccgagcagg gcctgggcgc ctcgcacagc caggtggaat    148080
     gggtgctcag cgcctacacc ctggccttcg cggcgacgct gttcacctgg ggagtgctgg    148140
     gcgaccgact gggccgcagg cgggtactcc tgctgggcct cggcctgttc ggactgtcgt    148200
     ccctggccgg ggcctacgcc gggtcgccgg agcagctcat cgccgcccgt gcctgcatgg    148260
     gggtgagcgg cgcggcggtg ctgccgagca cactcgccac catcgccgcc gtcttcccgc    148320
     tgcgcgagcg gcccaaggcc ctcgggatct gggcggcctc ggtcggcttc gccctcggca    148380
     tcgggcccgt caccggcggg atactgctcg cgcacttctg gtggggctcg gtcctgctgg    148440
     tcaacgtgcc cctcatggcc gggtgcctgg tcgcggtggt gctggtggtg cccgagaccc    148500
     ggggcacggc gggcaggcgc gtcgacgcgg ccggactgct gctctcgatc gcgggtgtcg    148560
     tgccgctcgt ctacgcgatc atcgaggccg gccggagcgg cggggtcacc cggcccgcgg    148620
     tctgggcagc cggcctggcg ggcctcggcc tgctcctcgt gttcctgtgg cacgagcgcc    148680
     gtaccccgga accctcgctg gagctcggct tcttccggat gaaggccttc tccaccgccg    148740
     tcgcggccgt cggcttcgtc agcttcgcga tgatgggctt cctcttcttc agcgccttct    148800
     acctgcagag cgtgcgcggc tacacacccc tgcaggccgg gggatgcacc gtggcactgg    148860
     ccgtcgcgaa cgtggtctgc ggaccgctca gcacggtcct ggtgcgttcg atcggccccc    148920
     ggaacgtgtg cgcggcgggc atgctggccg tcaccgcatc gctctgcggg gtcaccttcg    148980
     tgacccagca cgcacccgta tggctgatcc tcgtcctgtt cgccgcgctg ggggcgggcg    149040
     tagcatgcgt catgccgacc gcggccgtgt ccatcatgaa cgcgatccca cgcgagaagg    149100
     cgggcgtcgc ctcggcgatg aacaacaccg tgcgccagct gggcggcgcc ctgggcgtcg    149160
     cggtgctcgg ttccctcatg ggcgccgcgt accgccgcgg catcgaggac gagctcgccg    149220
     tactgccgcc ctccgcgcgg caccaggccg gcgagtccct ggatgccacc ctgctggccg    149280
     cgactaggct gggggagagc ggacttgtcg gccccgcgcg ccaggcattc ctggacgcca    149340
     tgcacctggc cgccggggcc gctgccgcgg tggcgctcgt gggggccctt gccgtgctcc    149400
     gctggctgcc ctcctccgtc acgactccga cgcccccggc aggggccgtg cccggccggg    149460
     agcattccga tcacctcaag gtccaaggaa gctgacatgc ctttcactcc tgacgagctc    149520
     gagtactacg cctcccagaa cctcggccgg ctggccaccg tggcgcccga cggccagccc    149580
     caggccaacc cggtctcgtt ccgcgtcaac accgagaccg gcacgatcga catcggcggg    149640
     cacaacctga ccgccagcaa gaagttccgc aacgtcacca agcacgacca ggtcgccttc    149700
     gtcgtcgacg acctgatctc cacgcagccg tggaacgtac gcggtatcga agtgcgcggc    149760
     cgggccgagg cgctgaccga cgcgcagccg ccgcacccct acttcggtac cgcgatgatc    149820
     cgtatccacc ccaagcgcat catcacctgg ggcctcggcg gcgacgccgc ccagcgcggc    149880
     cgcgacgtct gacccagcac ccttcgactc cgcttcgagc ggacctcgac gccctcttgc    149940
     caaggtggag cccgtaggac gggtacacca cggggagggc ggctggatga gtacagagat    150000
     cttccatgag gagttcgccg gggggctggt gaccgagggg ccgggcgcgc cgtggcggct    150060
     tcgcccggtc gacggtctcg aggcgggaga cgggctggtc cgcgggggac cggacggcct    150120
     ggtggtcgtg ccgagcgccg cccacccggg gacccggcgg ccggcgttca ccgagcccaa    150180
     gcccgggccg gacggcaccc cgctgcatct gcggtggggt gccttcacca ccggcggcac    150240
     caccggcggc accgccggcg cgcgggcggc gttcaccgcc gtgcccggcg aacggctctc    150300
     ggtcagggcc gagatggggc tgcgcggctt cggtctgcgc tcccatccgt acgacgacgt    150360
     gaccgaaccc gacgcggacg cccggctcgg cgcgggcggt ctgatctcgg tcgatctcga    150420
     gtccgggatc atcttcgact tcttcctcac acacagccgg ctctacgcgg tctacgagcg    150480
     gctcgcgctg cggccggacg ccgagttcgc ggccttcacc tactgcgtcc cggtcgcgga    150540
     ccgcaccccc ggcacgctcc accggctcga ggtcggatac gacgtcgcgg ccggcaccgc    150600
     ccactggacg gccgacgggc aggaggtcct gtccgtggac cggatcggct tccgcgcact    150660
     ggacgcgcgc tggctccggc gggacaacgg cggccgcgag gaggccgtac ggccgcgcgg    150720
     actcagcttc ggcctcgggc tcttcctgga gcgccacttc ggccaggggg tgcggctgtc    150780
     ggtgcgaagg ctgtcggtgc tcacctcgcc cgccggctcc cgcgactcgt gacgacgacc    150840
     aacgaaaggc actgcgatgc ccgatgagaa caagcccgta ctggtcctcg gcgccaccgg    150900
     aaagcaaggc ggctccgcgg cccggtacct gctggaacgc ggctggacag tccgggcctt    150960
     cgtccgggac cccggcgcgc ccaaggccaa ggagctgcgt gagctggggg cgagcctgca    151020
     caccggcgac ctggaggacg ccggctcggt gcgcgccgcg atgaagggtg cgtacggcgt    151080
     gttcagcatc caaacgccga tgacaccggc cggcgtggag ggcgaggagc ggcagggcaa    151140
     gatatgcgcc gacgccgccc gcgacctcgg cgtccagcac tacgtccaca gctcggtggg    151200
     cggcgcggaa cggccggagg gcgtgaactg gcggctgtcc aagctcgcga tcgagcagcg    151260
     gatccaggag aacgcgctcc ggttcacctt cctgcggccg tcgtacttca tggagaacct    151320
     gaaccacgac atgtcgcccc tcgtcatgga ggacggcgtg ctgaccttcc ggagggggct    151380
     cgggccggcc aacaccctgc agatgatcag cggccccgac atcgggtact tcgcggccga    151440
     cgccttcgac gaccccgaca ccttcggcgg cgccaagatc gagctggccg gggacgagct    151500
     gaccggcgag cagatcgcgg ccgcgttcgg ccggcacacc gggctgcccg cccgcttcgt    151560
     gtcggtgccg ataccggagc tgcaccgcac ggggttcgag tggcaggcga tctcgtacac    151620
     ctggctcaac ggcatcggct atcacgccga catccccacg ctgcgcgccc ggttcccgca    151680
     gctgctcacc ctcgaccagt ggctggccag gaccggctgg accccgaggg acccggcatg    151740
     agcgaggaca cgatgaccca ggagcggccg tccctgacgg cacacgcccg ccggatcgcc    151800
     gaactcgccg ggaagcgggc ggccgacgcc gaacagcagc gccggctgag ccccgacgtc    151860
     gtcgacgcgg tccttcgagc cggtttcgcc gcccacttcg taccggtggc gcacggcggc    151920
     cgggccgcga cgttcgggga gctggtggag cccgtcgcgg tgctcggcga ggcctgtgcc    151980
     tcgaccgcct ggtacgcctc gctcacggcg agcctcggcc ggatggccgc ctacctgccg    152040
     gacgagggcc aggccgagct gtggtccgac ggccccgacg ccctgatcgt cggtgccctg    152100
     atgccgctgg gccgggccga gaagaccccg ggcggctggc acgtgtcggg cacctggccg    152160
     ttcgtcagcg tcgtggatca ctccgactgg gcgctgatct gcgccaaggt cggcgaggag    152220
     ccgtggttct tcgcggtgcc gcgacaggag tacgggatcg tcgacagctg gtacccgatg    152280
     ggtatgcgcg gaacgggcag caacacgctc gtcctcgacg gggtgttcgt gccggatgcg    152340
     cgggcctgca cccgtgcggc catcgcggca ggtctcggtc cggatgccga ggcgatctgt    152400
     cacaccgtgc ccatgagggc ggtcaacggg ctggccttcg cactgccgat gctcggcgcg    152460
     gcccgcgggg ccgcggccgt gtggacctcg tggaccgccg gaagactggc cgggccgacc    152520
     gggcagaacg ccgtctcgtc ccaggaccgc gtggtgtacg agcacacgct ggcccgggcc    152580
     acgggtgaga tcgacgcggc ccagctgctg ttggagcggg tcgcggcggt cgccgacgcc    152640
     ggctcggcga ccggcgtact ggtcggccgc ggggcgcggg actgcgccct ggcggcggag    152700
     ctgctgaccg ccgcgaccga ccggctgttc gcctcggcgg gcacccgggc acaggcccag    152760
     gacagcccga tgcagcgcct gtggcgcgat gtgcacgcgg cgggcagcca tatcgggctg    152820
     cagttcgggc ccggggcggc gctgtacgcc ggagagctgt tgaggaggag caacgatggc    152880
     tgaagtgaac gatccccggg tgggcttcgt cgcggtcgtc accttcccgg tggacggccc    152940
     cgccacccag cacaagctgg tggagctggc caccggcggg gtgcaggagt ggatccgcga    153000
     ggtgcccggc ttcctgtcgg ccacgtatca cgcgagcacg gacgggaccg cggtcgtcaa    153060
     ctacgcccag tgggagagcg agcaggccta ccgggtgaac ttcggcgccg acccgcgctc    153120
     ggcggagctg cgggaggcgc tgagctcgct gcccgggctc atggggccgc cgaaggccgt    153180
     gttcatgact ccgcgggggg cgatcctgcc gtcctgacct ggtcgtccgc ggcctcgccg    153240
     gccccggcca gcaggccggc gatgatgatc tcgaggccga gctcgaaccg gcggtcggag    153300
     tcgagcgagg tgatcgggcc ggccaggtgg accaggttcg ggaaactggt ggccggcagt    153360
     gacttcaggt agccgtggag ctggtcggcg aacacgccgg cctgctcccg gccctgttcc    153420
     gttccggggt tgcgggacga ctgctccagg gcctccgccg tgacgaaggt cgacagcagg    153480
     tcgcccccgt aggcggcgag ttcgtcgtgc aggcccccgg agcgcagcag gttcatggtg    153540
     cgctccatcc ccaccatccc gttgggtccc agcggcaccc ggtcgatcgc gatccgtgcc    153600
     aggtcccggt gggccaggaa catcctccgc agcgaccggc acatctcctt gacctgctcc    153660
     gcccagcggc cgggttccgg ttccgggacc tccacctcgg tcagcacgat gtcgaagacg    153720
     aggtcgagca gctcgtcccg gttccccacg tgcgcgtaca gcgaggcgtg tccggtcttc    153780
     agctcctgcg cgagccgccg catgctcagg gcgtcgagtc cctcggcgtc gaggatgccg    153840
     agcgccgtga cgacgatccg gtcctgggtc aggggcatgc gcggcggcgc cttcttcggc    153900
     cggcgccacg gaggcacggg aatctcctcg ggcatgggcc tcccttcctc gcttcgcgac    153960
     acgtgctcct catcgtatgg catgaacggg ccaccgtttc ttgacgcgac caccgttcca    154020
     ttgtagaacg gtggtcgttc gtggaccaat agtcgaggac ccgggggacg ccatgagttc    154080
     cgttgaagcc gacgagccgg acagggccac ggccccgccg tcggcgttac tgcccgagga    154140
     cggccccgga ccggacggaa ccgcggccgg acccccgccc tacgcgcgcc gttgggccgc    154200
     gctgggagtc atcctcggcg ccgagatcat ggacctgctc gacggcacgg tcatgaacgt    154260
     ggccgcgccc gccgtccgcg cggacctggg cggcagcctc agcgtcatcc agtggatcac    154320
     cgtcgggtac acgctcgcgt tcgccgtcct gctcgtggtg ggcggccggc tgggcgacat    154380
     ctacggccgc aagcgcatgt tcgtcgtcgg cgccgtcggc ttcaccgcgg cctccgtgct    154440
     gtgctcggtg gcggccggtc ccgagatgct caccgcggca cgcttccttc agggcgggct    154500
     cggcgcgctg atgattccgc aagggctcgg tctcatcaag caaatgttcc cgcccaagga    154560
     gacggcggcg gcgttcggcg cgttcggacc cgccatcggg ctgggcgccg tgctcggccc    154620
     gatcgtcgcc gggttcctgg tcgacgccga cctgttcggc acgggctggc ggtccgtctt    154680
     cctgatcaat ctgccgatcg gcgtggccgt gatcgtcggc gcggtcctgc tgctgcccga    154740
     gggcaaggcg cccgtgcggc cgaagttcga cgtcgtcggc atggcgctgg tgacgtccgg    154800
     gctcaccctg ctcatcttcc cgctcgtcca ggggcgcgaa cgcggctggc ccgcctgggc    154860
     gttcgtgctg atgctggccg gagcggccgt gctcgtcggc ttcgtcgccc acgaactgcg    154920
     gcaggagagg cgcggcggcg ccacgctcat cgagctcagc ctgctgcgca ggtcccgcta    154980
     cgccgcggga ctggcggtgg cactggtgtt cttcaccggc gtctccggaa tgtcgctgct    155040
     gctcgccctg cacctgcaga tcggcctggg cttcagcccc accagggccg cgctgaccat    155100
     gacgccctgg tcggtgttcc tcgtcgtcgg cgcgatcctg accggggcgg tgctgggatc    155160
     gaagttcggc cgcaaggccc tgcacggcgg gctcgtggtg ctggcgctgg gcgtgctgat    155220
     catgctgttg acgatcggcg accaggccgg cgggctgacc agctgggagc tcgtccccgg    155280
     tatcgccgtt gccgggctcg gcatgggcat catgatcgga ctgctcttcg acatcgccct    155340
     ggccgacgtc gacaagcagg aggccggtac cgcctccggc gtcctcaccg cggtccagca    155400
     gctcggcttc accgtgggcg tcgcggtgct cgggaccctg ttcttcgggc tgctcggctc    155460
     acaggccacg gcgagcgtcg acgacggcgc gagccgggcc cgcaccgaac tcgccgccgc    155520
     cggggcgagc acgaccgagc aggaccggct cctggccgac ctgcgggtgt gcctgcggga    155580
     atcggcgagt cagcaggact ccgaacggac gccggacagc tgccgaaacc tccagcaggc    155640
     ccggccggcg gtggccgagg ccacggcgcg ggcctggcgg acggcccaca ccgagaactt    155700
     cagcaccgcg atggtccgca cgctctgggt ggtgatcgca ctgctggcgg tctccttcgc    155760
     gctggccttc cggctgccgc ccaagccgcg tgaggaagag ggcttctgat gacacgcaca    155820
     ctgctgtcct ggcccggcgg acgccggctc aagtggctgg tgctcgcggc ctggatcggt    155880
     ctgctgatcg tgctccagcc gctggcaggg aagctcggcg acgtcgagtc caacgacgcc    155940
     gccgcctggc tccccggcaa tgcggagtcg accgaagtgc tcgagctgtc cgagaagttc    156000
     cagccggccg acaccagccc gaccgtgatc gtctacgacc gcccgtccgg gatcacggcc    156060
     gccgacgagg cgaaggcgcg ggccgacgcc acgcacttcg cggacggcac cggtgtggtg    156120
     ggcgagccct acggcccggt gcgctcggac gacggcaagg ccctgcgcac cgtcgtcaac    156180
     gtccacctcg gcaaggacgg ctgggagggg ctcaacgcgg ccgcgaagga catgcgggcg    156240
     atcgcccggc cgagcgcccc ggacggtctc ggcgtccacg tcacgggtcc gaccggttac    156300
     gccgccgatt ccgcagagtc cttcagcagc gccgacttca agctcaccct ggtcaccctc    156360
     ctcatcgtcg tgacgatcct cgtcgtcacc tatcgcagtc ccttgctctg gctgctgccg    156420
     atgatctccg cgggcatgtc cctggtcatc tcgcaggcca tcgtctacct gctggccaag    156480
     aacgcgggac tcacggtcaa cgcccagacg gcgatgatcc tcacggtcct ggtgctcggc    156540
     gcggccaccg actacgcgct gttgctcgtc gcccgctacc gcgaggagct gcggcggcac    156600
     gaggaccggc acgaggccat ggccgtggcg ctgcgccggg ccggtcccgc catcgtggcc    156660
     agcgccgcca ccgtcgccgt cagcatgctc gtcctgctgc tggccgctct gaactccacc    156720
     aagggtctcg gcccggtctg cgccgtcggc gtgctggtcg gcctgctgtc gatgatgacg    156780
     ttgctgcccg ccctgctggt gatcttcgga cgctgggtct tctggccggc ccggccgaag    156840
     cacggtacgg agcccgacgt cacccggggt ctgtggtcgc ggatcgcccg gctggtgtcc    156900
     ggccgtccgc gtgccgtctg ggtcaccacc agcctgctgc tgggggcggt ggccacgctg    156960
     gccgtcaccc tgaacgccga cggcctccag cagaaggacg gtttcaagac caagccggag    157020
     tcggtggtgg gcgaggagat cctgacccgg cacttcccgg ccggctccgg tgaacccatg    157080
     gtcgtcatcg ccaagggcgc ctcggcggac caggtgcacg cagctctgga gaccgtgccc    157140
     ggcgtcatcg aggtcgcacc accacaggtg aaggacggcc tcgcctatgt cgaggcgacg    157200
     ctcggcgccg gggcggactc gccggcggcc atgcgttcgg tcaccgcggc ccgcgagaca    157260
     ctcgcccggc tggacggtgc gcaggcacgg gtgggcggca gcagcgccgt cgtgcacgac    157320
     atgcgggagg cgtccagccg cgaccgcggt ctgatcattc cggtgatcct cgccgtggtg    157380
     ttctgcatcc tcgcgctgct gctgcgagca ctggtggcgc cgctgctgct gatcgcgagc    157440
     gtggtgctgt ccttcttcac cgcgctcggc ctcgccgccc tcttcttcaa ccacgtcttc    157500
     gacttcgcgg gagccgattc ggccttcccc ctgtgggtct tcgtcttcct ggtcgccctg    157560
     ggcgtcgact acaacatctt cctcgtcacc cggatcaagg aggagagcga ccggctcggc    157620
     acccggcagg gcgcgctcaa gggcctcacc tcgaccggtg gcgtgatcac cgcggccggg    157680
     ctggtgctgg ccgggacctt cgccgcgctg gccacgctgc cgctggtctt catcgccgag    157740
     ctcggattca cggtcgcggt gggcgtcctg ctcgacacca tgatcgtgcg atcggtcctg    157800
     gtcaccgcgc tcactctcga tgtcggccgg tggatgtggt ggccgcaccc gctcgcccgg    157860
     cgcgaggacc cttccgagga cccagccgta tcaggaatgc cagattctat tgattcggaa    157920
     gcctcgacca ctgcctctcg gtaaaatcca gcaaaaatta atcagtgcag ctcgctgcac    157980
     tgattaattt ttgatcaata ggagatcgct tgtgacggca agcacattga aatctgttga    158040
     gtaggcctgt tattgtcgcc cccaggagac ggagaatctc gacgggggcg cagatgagat    158100
     tcaacttatt gggacgtgtc catgtaatca ccgatgcggg atgtgtaatt ccgcttaaat    158160
     cctcgaaggc gacccagctc ctggtgctgc tgctcctcag gcggcacgag gtggtgggat    158220
     cgggggtgct catcgaggag ttgtgggcgg accacccgcc ccgcagcgcc atgacgacgc    158280
     tgcagacgta cgtgtaccac acccgccggc tgctggggga gcaccgggtg acgagcgacg    158340
     accgggaatt ggtcctgacc cagccgcccg gctacttcgc cctgatcgac gaggacgaac    158400
     tcgacgtcgc ggtcgccgag cgtctgatcc gcaccggcgg ccggctgctc gaggagaacc    158460
     ggctcgagga ggcgctcgcc tcgttggacg cgggactgga tctctggcga ggcccggcgc    158520
     tgtccaccgt accgtgcggc cgggtgctcg aaagcaatat cgcgcacctg gaagagctgc    158580
     ggctttttgg aatgcagctc cgtatcgacg cgaattggcg gctgggcaga atagggccga    158640
     tgattccgga actccggtcc ctggtaattt cgcatccgct gaacgagacc ctgcacgcca    158700
     aactgatggg cgcgctctgt cagatgggca ggcgcgccga ggcgctggaa tcgtatcgga    158760
     atctccggcg gatactgtcc gacgaactgg gggtggatcc gacgccggaa atccagcgta    158820
     tgcacatgga aattctcaac ggtgagaagg tgctcgtgta gcaccggtcc gtgaacgcgg    158880
     tggagcccct cgcagcctgc gaggggctcc accgcgttca cggaccggcc ggcgtcagta    158940
     gttccccagc ccgccgcaga cgttcagcgc ctgcgcggtg accgcggccg caccgggccc    159000
     gatcaggtac gccaccatct ccgccacctc ggacggctgc acgtaccggc cgatcggcac    159060
     gcgcgcggtg atccggtcga aggcctcctc ggtcgacacc tcccagatgt ccgagtagtg    159120
     ctcgcgcacg gacgcggcca tcggcgtctc gacgaatccg gggcagacgg cgttcaccgt    159180
     gatgccggtc ctcgccagtt cgagaccgag cgccttggtg aagccgacca cgccgtgctt    159240
     cgaggcggag tagggcgcgg cgtgcaccac accctgcttt ccgccggtcg aggcgatgtt    159300
     gacgattcgg cccgtgcccc gttcgagcat gccgcccgcc ttgaggacct gtttggtcac    159360
     ccggaacacg ccggtgaggt tggtctccac gacatcgagc cagagttcgt cggcgagttc    159420
     ggccgtggcg ccgccgccgg gccggcccgc gttgttcacc agcacgtcga ccggaccgta    159480
     acgctcgacc accgccgcca cgagagcctc gatctccggg accgagcgga cgtcgcaggt    159540
     ccgcccgtcc gcctccacgc ccgcctcccg caactccttc agcgtcgtcc gcagtccttc    159600
     ttcgccgcgc gcgcagacga acacgcgcaa cccctcctta ccgagcctgc gggcgatctc    159660
     cagcccgatt ccgctggtcg cacccgtcac cagtgcgact tcggagtcct gcgtggccat    159720
     gtgttcccct ccctgcctcg tggtccctca cgcgctcagc tttgggcgcc cggctcgagc    159780
     ggcggtcgaa gggagatggg gtgccgctgg acgcggcgcc ggtggatccg gcatcgaggg    159840
     gtcccgtatc ggccttcgag cctccttcga gccacggggc cgacgatgac gacgaccacc    159900
     ggacgaacgc atcgaaggag ctgttcggat tgaagcgcag agtcgtcatc acgggcgtcg    159960
     gcgtccgcgc ccccggcggg aacggcaccc ggcagttctg ggaactgctc acctcggggc    160020
     ggacggcgac gcgccggatc tcgttcttcg acccctcgcc ctaccgttca caggtcgcgg    160080
     cggaggccga cttcgacccg gtcgccgagg gcttcggccc gcgggagctc gaccggatgg    160140
     accgggcctc gcagttcgcc gtggcctgtg cccgggaggc gttcgccgcc agcgggctcg    160200
     acccggacac cctcgacccc gcccgggtcg gggtcagcct cggcagcgcg gtggcagcgg    160260
     cgaccagcct ggagcgcgag tatctgctgc tgtcggactc cggccgtgac tgggaggtcg    160320
     acgcggcctg gctgtcccgg cacatgttcg actacctggt gcccagcgtc atgccggccg    160380
     aggtcgcctg ggcggtcggc gccgagggcc cggtcacgat ggtctccacc ggctgcacct    160440
     cgggcctgga ctccgtcggc aacgcggtcc gggcgatcga ggagggcagc gccgacgtga    160500
     tgttcgcggg agccgccgac accccgatca ccccgatcgt cgtcgcctgc ttcgacgcga    160560
     tccgcgccac gacggcgcgc aacgacgacc cggagcacgc ctcgcggccg ttcgacggta    160620
     cgcgggacgg cttcgtgctg gccgaaggag ccgcgatgtt cgtcctggag gactacgaca    160680
     gcgcgctggc ccgcggagcc cgcatccacg ccgagatctc ggggtacgcg acgcgctgca    160740
     acgcgtacca catgacgggc ctgaaggccg acggccgcga gatggccgag accatccggg    160800
     tcgccctcga cgagtcccgc acggacgcga cggacatcga ctacatcaac gcgcacggct    160860
     ccggcacccg gcagaacgac cgccacgaga cagcggcgta caagcgcgcc ctcggcgaac    160920
     acgcccggcg cactccggtc agctcgatca agtcgatggt cggccactcg ctgggcgcga    160980
     tcggctcgct ggagatcgcg gcctgcgtac tcgccctcga acacggcgtg gtgcccccga    161040
     ccgccaacct gcgcaccagc gaccccgagt gcgatctcga ctacgttccg ctggaggcca    161100
     gggagcggaa gctgcggtcc gtactcaccg tgggcagcgg cttcggcggc ttccagagcg    161160
     cgatggtgct gcgcgacgcc gagaccgcgg gggcggccgc atgagcgtcc tcatcaccgg    161220
     agtcggcgtc gtcgcaccca acggcctcgg cctggcgccg tactggtcgg cggtgctgga    161280
     cggccgccac ggcctcggcc cggtcacccg cttcgacgtg agccggtacc cggcgaccct    161340
     cgccggccag atcgacgact tccacgcgcc ggaccacatc ccgggccggt tgctgccgca    161400
     gacggacccc tccacacggc tcgcgctgac cgccgcggac tgggccctcc aggacgcgaa    161460
     ggcggacccg gagtcgctga ccgactacga catgggcgtg gtgaccgcca acgcctgcgg    161520
     tgggttcgac ttcacccacc gggagttccg caagctgtgg tccgagggcc ccaagtcggt    161580
     cagcgtgtac gagtccttcg cctggttcta cgcggtgaac accggccaga tctccatccg    161640
     gcacggtatg cgcggtccga gcagtgccct ggtcgccgag caggccgggg gcctggacgc    161700
     cctgggccac gcccgccgta cgatccgccg cggcacgccg ctggtggtct ccggcggggt    161760
     ggactcggca ctcgacccgt ggggctgggt ctcgcagatc gccagtggcc ggatcagcac    161820
     ggccaccgat ccggaccggg cgtatctgcc cttcgacgag cgggcggccg gctacgttcc    161880
     gggcgagggc ggggccatcc tcgtcctgga ggacagcgcc gcggccgagg cccgcggccg    161940
     gcacgacgcg tacggcgaac tcgccggctg cgcctccacc ttcgaccccg cccccggatc    162000
     cggacggccc gcgggcctgg aacgcgcgat ccggctggcg ctgaacgacg ccgggaccgg    162060
     tcccgaggac gtcgacgtcg tgttcgccga cggcgcgggc gtgcccgagc tggacgccgc    162120
     cgaggcccgg gcgatcggcc gggtgttcgg ccgcgaaggg gtgcccgtca ccgtccccaa    162180
     gacgacgacg ggccgcctct actccggcgg cggcccgctc gacgtggtca ccgccctgat    162240
     gtccctgcgc gaaggggtga tcgcgccgac cgcgggcgtg acgtccgtac cccgggagta    162300
     cggcatcgac ctggtgctcg gcgaaccccg cagcacggcc ccgcgcaccg cactggtcct    162360
     ggccaggggc cgctggggct tcaactcggc ggcggtcctg cgccgtttcg caccgacccc    162420
     gtaacgaccc cgagaactgg agaaagccat ggcaaccctg ctgaccaccg acgatctgcg    162480
     ccgcgccctc gtggagtgcg ccggtgagac ggacgggacg gacctgtccg gcgacttcct    162540
     cgacctccgc ttcgaggaca tcgggtacga ctcgctcgcc ctgatggaga ccgcggcgcg    162600
     actcgagagc cggtacggcg tgtccatacc cgacgacgtc gccggccgcg tcgacacgcc    162660
     gcgagagctg ctcgacctga tcaacggcgc actggccgag gcggcatgag ccggccggga    162720
     gaacaccggg tggtccacac cctgaggacc caggccccgg cgcggcggct ctacgagctg    162780
     gtcgcacgcg tcgaagactg gccggccgtc ttcgaaccca ccgtgcacgt acaggtcctg    162840
     gagcgcggcc cgggcaccga acgcttccgg atctgggcgc gcgtgggcgg ccgggtgaag    162900
     acctggacgt cccgccggac gctggatccc gacaccctga gggtgacgtt ccgccaggag    162960
     ctcacccagc cgcccatcgc ctcgatgggc gggagctggg agttccgggg cgacggcgac    163020
     ggcaccgaag tcgtgctgac ccacgacttc gccgcggtcg acgaagccgc cctgccggga    163080
     ctgcgcgagg cgctggacgc gaacagcggg aaggagctgg ccgcgctggt cgcgctggcg    163140
     gagcgccggc agccgcccga ggagctggtc ttcacgttcg aggacacgct ccgggtgccg    163200
     tccggggacg acgcctacgc cttcatcgag cgcagcgacc tgtggcagga acggctgccg    163260
     cacgtgcgga aggtgacact caccgaggag gcggcgggta ccggccccgc cgagacgcgg    163320
     gacatgaccg tccaggacat gaccatggag acggtgacca ccgacggcgg tacccacacc    163380
     acccgttcga tccggctctg cgtccccgcg aggagcatcg tgtacaagca gctcgtcccg    163440
     cccgccctgc tctccgggca ctgcggcgcc tggaccttcg gcgaggacac ggtcaccgcc    163500
     cgccacaccg tggcgatcga cccggcccgc gtggaagagg tcctgggcaa aggcgcgacc    163560
     gtcgcggacg cccgtaccca tctgcgcgag gtgctcggtg ccaacagccg ggccacgctc    163620
     cgccacgcgg cggccgccgc cgggccggcg tcatgacggt cgaggtccgt gaggtcgccg    163680
     agggtgtcta cgcctacgag caggcccccg gcggctggtg cgtcagcaac gcgggcatcg    163740
     tggtgggcgg cgacggcgcg ctcgtcgtcg acacgctgtc gacgatcccg agggcgcggc    163800
     ggctggcgga gtgggtcgac aagctcgccg cgggccccgg ccgtaccgtg gtcaacaccc    163860
     acttccacgg cgaccacgcc ttcggcaacc aggtcttcgc gccggggacg cggatcatcg    163920
     cgcacgagga catgcggtcc gccatggtga cgaccggcct ggccctcacc gggctctggc    163980
     cgcgggtcga ctggggcgag atcgagctga ggccgccgaa cgtgaccttc cgcgaccggt    164040
     tgaccctgca cgtcggcgag cgacaggtcg aactgatctg cgtcggcccc gcgcacaccg    164100
     atcacgacgt ggtggtctgg ctgcccgagg agcgggtgct gttcgcgggg gacgtcgtca    164160
     tgtcgggcgt cactccgttc gccctcttcg gttcggtggc cggcacgctg gccgcgctcg    164220
     accggctggc ggagctggag cccgaggtgg tcgtcggcgg gcacggcccg gtggcgggac    164280
     ccgaggtgat cgacgccaac cgggactatc tgcgctgggt ccagcgcctc gccgccgatg    164340
     cggtcgaccg ccggctgaca ccgttgcagg ccgcgcgccg ggcggacctc ggcgccttcg    164400
     ccgggctgct ggacgcggag cgcctcgtcg cgaacctgca ccgggcccac gaggagctgc    164460
     tgggcgggca cgtgcgtgac gccatggcga tcttcgcgga gctggtcgcc tacaacggtg    164520
     ggcagctgcc cacctgcctc gcctagggag ttcgaagatg gcagccgacc agggaatgct    164580
     ccgggacgcc atggcccggg tgccggccgg ggtggcgctc gtcaccgccc atgaccgcgg    164640
     gggagtcccg cacggtttca ccgccagttc gttcgtgtcc gtctcgatgg agccgccact    164700
     ggcactggtc tgcctggctc gtacggccaa ctccttcccg gtgttcgaca gttgcggcga    164760
     gttcgcggtg agcgtgctgc gcgaggacca cacggacctg gccatgcgct tcgcgcgcaa    164820
     gtccgcggac aagttcgcgg gcggggagtt cgtccgtacc gcgcggggag cgaccgtgct    164880
     cgacggagcg gtcgcggtcg tcgagtgcac ggtccacgag cgctacccgg cgggcgacca    164940
     catcatcctg ctcggcgagg tccagtccgt gcacgtcgag gagaagggcg taccggcggt    165000
     ctacgtggac cgccggttcg ccgccctgtg ctcggcggcg ggtgcctgcc cgtccgccac    165060
     cgggcggggc gtgcccgcgc atgccggctg aggccggccg ggaaggccgt cagcggcccg    165120
     tggcaccgtc gatcagctcg cggaggatgt cggcgtggcc ggcgtggcgg ccggtctcct    165180
     ccaccatgtg ggtgagggcc cagcggacac tgggcgcggg gcggcccggt cgcggccggg    165240
     ggagcggtgc gccgaggtcg gtgcaggcgt cgagcacgcg gttcgcccgt tcgacggcct    165300
     cccggtagcg ggcgacgacg tcggcgacgc cgtcctggga cgcggcccgg aacgtcgccg    165360
     gccagcttcg cacctcctcc ccgaggaaga ccgcgcgctc gacgtgggtc aggtggttga    165420
     gcagcccgag caggttggtg ccggacgcca ccgccgccgt gcggacctgc ggttcggggg    165480
     cgtcctcgac cttgccggcg atcgaggtcc gcaggtagtc gaggaacccg cgcagggtct    165540
     cggcctcacc gccgccggtt cggggcggcg gggtgtcccg gcggtgggtg cggggggtgg    165600
     tgggcatggt gaccggcctc cggaaggtgt ggggcgggcg ggccgcgggc gcggggcccg    165660
     tcagtccgcg cggcggacga gcaggacgtg gtcgacgacc tcggcggtgc gcccgcccgg    165720
     gccggtcgcg gtccggcgtg gcgcctcggc ccgttcgacc cgccacgtcg ccgggtccag    165780
     ggcgaggtcc gccgcgacct cctgcggggc cgggtggcgc gcgtcggggt cctggtccca    165840
     cgaccacggc gccgtcgagc cgtggtcgac gaccagcagc cgcccgcccg ggcgcagcgc    165900
     gtgcgcggcc ccgcgcagga ccgacgcgcg gtccaggtcg aagggcgtgt ggaggtagtg    165960
     cgcgctgacc aggtcgaacc ggccctcggg gaaggagtcg cgcaggtcgt gccgcacggc    166020
     gtcgaccagg tcgccgaggc cgtgggtccg tgcgtgcccc gcgagccgct cggccgcgac    166080
     cccggagatg tccacggccg tgacccgcca gccccgccgg gcaagccaca gcgcgtcgcc    166140
     gccgctgccg caccccaggt ccagggcgtc gccgggcggc aggccggtga ccgtctcgac    166200
     caggcggacg ttcgggcggg gcgcgtcggg cgccgggcgg gcggcgtaca cgccgtccca    166260
     gaacgtgacc gcgtcggtgg tgctcatcgg aactccttca gtcgtttcgg ccggcggcgg    166320
     gcgacgagtc gggcaacgcg ccgcgagccg tcgatgcgac cagtctcgac accctccgcc    166380
     cgaaccggca cgaaaacttg cggttgtggc aaggtggccc gatggacgcc gcaacggacg    166440
     acgtgctcga cgccgtgggc ccacgcctgc gcacgctgcg ccgcgagcgc ggcatcaccc    166500
     tcgcccacct ctcggcggcg accggggtgt cggagagcac cctgtcccgg ctggagagcg    166560
     ggcagcgccg tgcgaccctg gagctgctgc tgccgctcgc ccggatctac gacgtccccc    166620
     tggacgacct cgtcggcgcc ccgcgcacgg gcgacccccg catccacctg aagccggtca    166680
     ggcgcttcgg gatggtcttc gtgccgctgt cccggcggcc gggcggcacc caggccttca    166740
     aaatgatcat cccgagccgt ccggcgccgc tcgaaccgac cccgcagacc cacgaggggt    166800
     ccgagtggct gtacgtgctc agcggccgtc tgcggttgct ggtcggcgag cgcgacctga    166860
     cgctgtcgcc cggtgaggcg gccgagttcg acacgtcgct gccgcactgg ctgggcagcg    166920
     ccgacggcgg cgcggtcgaa ctcctcgtcc tgttcgggct gcagggcgtg cgggcccatg    166980
     tgcacagcgg ctgagagctt cctgcccgac ggcgtcgccg agcgggtcgg ctgggcgcgc    167040
     gaggcggccg aggcgacgcc ggaccggtcg gcggagggcc cgcgcgacag tcctgagggg    167100
     gcgtcgcgtc cgcgtgttgc ccggcagccc gcccggtccg tcgcccggcg tcacatccgt    167160
     gcgtcgcccg gcagcccgcc cggtccgtca tccggcgtca cgcccggtcc gtcgcccggc    167220
     gtcacgcccg gtccgtcatc cggcgtcacg cccggtccgt cacccggcgg caggcctcca    167280
     cgtacccgcg caccagtgcc cgcccctcgt cctcgcggcg ccgggccagg gcgtagcggc    167340
     tgggggacag gccgcggacc gggcgggtga ccaccccgcc cagggtgatc agcggggcgt    167400
     tgcccgtggc caccaggcag atgccgagcc cggcgaccag ggcctcgtac gtctcctccg    167460
     tgccggagat ctcggcgccg acgcgcggcg gacgggcggc ggggccgtcg agtgcgcgcc    167520
     gttcgtccag cgccagccag aagtcgcgca ggacgcccgc ctccgggggc agggcgagga    167580
     acggctcgcc ggccaggtcg gcgaagtcga tctcctcgcg ggcggcgagg gggtggctgt    167640
     cggggagggc gaccaggcgg ggctcctcgg cgaccaccgt ccaggcgtag cggtcggcgt    167700
     cgggcagcgg cagccagacg tacgcgacgt cggccgtgcc gtcggccagg cccgcggtcg    167760
     ggtcctccca gctcatctgc cgcagctgca ggaccgcctc cgggtgggcc gcggtgaagc    167820
     gggagcggat cgccgggagc agcccgccgc ggccggggct ggtgctcatg ccgacgacga    167880
     gggtgtcgcg ccgggccgca cgggccgcct ccaccgccgc cgcgccctcg gtccagtcgg    167940
     ccagcatccg ccgggcgtgc ggcagcaggg ccgtgcccgc ctcggtgagg gtcacgcccc    168000
     gggggccgcg gtggaacagc tcggcgccca actgccgttc cagggcccgg atctgcttgc    168060
     tcagcgcggg ctgtgacacg tacaggagtt cggccgcccg cgtgaagtgc agctcctcgg    168120
     ccaccgtcgc gaagtagcgc agctcccgca catgtacgtc cgtcgtcatg cccatgggtt    168180
     atcaccgcgg gtcttggacc ggcaaccggc ttgtggacga gggtggttgg cgtcggaaca    168240
     aggcgacaga ggaaaccgag ggagtcggga tgaacaaggt gtggctgatc accggggcga    168300
     gcagcggctt cgggcgggcg atcgccgagg cggccctggc cgacggcgac gtcgtggtcg    168360
     gcgcggctcg gcgccccgag gcgctggacg acctcgtggc cgcgcacccg gaccagatgg    168420
     aggcgctgcg cctggacgtc gccgacacgg ccgccgccgg ggacgccgta cgggacgtgg    168480
     tggcgcggca cggcagggtg gacgtattgg tcaacaacgc gggccgcaca cacgtcggtg    168540
     ccctcgagga gaccggcgag gacgaactgc gggcgctgtt cgacgtgcac gtcttcggcc    168600
     cggccgcgct gacgcgcgcg gtactgccgt ccatgcggga gcggcgttcg ggcgcgatcg    168660
     tgcagatgag cagcatgggc gggcagatgt ccttcgcggg cttctccgcg tacagcggca    168720
     cgaagttcgc cctggagggc atgtccgagg ggctcgcgga cgaggtccgg gacttcggca    168780
     tcaaggtgct gatcgtcgag ccgggctcct tccgcaccgg cctgttcgag gccgggaacg    168840
     ccgggatcag cgccgacagc ggcgtgtacg ccaaggtcgg cgagacccgc gggatgatcg    168900
     ccgcgggcga cggcagccag cccggcgacc ccgccagggc ggccgcggtc atccgcgcgg    168960
     ccctcgcggc cgagcacact ccgctgcgcc tgccgctggg cgacgacggc gtcaccgcgg    169020
     tcctcggcca cctcgaccgg gtccgcgagg aggtcgagac ctgggagaag cagacccggg    169080
     ccacggcgtt cgacgactga ggggcagcgg ggtgtcggtt cggcaccttc ggtgcccgca    169140
     cccgaccgca cccgactgtg cccgactgca cccgaccgtg cccgatcgtg cccgtgccca    169200
     tgcccatgcc catgcccatg cccatgccca tgcccatgcc cgtgcccgtg cccgcgtccg    169260
     tgccgaacca ggagtccgcc gtgctctcgt ccctgaaggc cgtcaacctg ctggtgatgt    169320
     tcctgctgga actcgcggtg tacacggcgg tcgtgctctg gggggtcgcc gtcggcggca    169380
     catggccggt cgaggtggcc ctgggggtgg gcgcgccggt cgtgatgatg gcggcgtggg    169440
     cgctgttcgg gtcgccgcgc gcccgccgtc cggcgcgcgg ggccgggcgg ttcgtcctgg    169500
     aggtgctctg gttcggtgcc ggtgcggccg ccctggccgc ctccgggaga ccgtggtggg    169560
     cggccgccct cgccggggtc tgcctggtca acgcggtgct cagacggttg tggaagcagt    169620
     gacgcccggc gcgcccgcga cccgcgcacc gccccccgcg cggaccgcgc ttacgatgcg    169680
     cgaggccgca cccgtcgccg caccaccctc tcgaacagga gcacggtact cgtgtcgata    169740
     ccgccaccgc cggggcccca agggcagtac ccccagggtc cgtacgctcc gcagtggggg    169800
     caccccctcg cgccgtaccc ccggccggct cccgtgagcg ggctcgccgt cgccgcgttc    169860
     gtcctcggcg tcctgtgctt cctgccggcg gtcggactgg tcctcgggct ggtcgcgctg    169920
     gcccggatcc gcaggcgggg cgaacgcggc aaggggttcg cggtggccgg ctgcgtgctg    169980
     tcctccgtgg ggctggccct gtggacgctg acgctgtcga cgggcgccgc gggcgacttc    170040
     tgggacggct tccgggacgc cgcgcgcggc gggggcaccg cctactccct ggagaagggc    170100
     cagtgcttca ccacccccag cggctccctc caaggggtga cgtacgacgt cgacgaggtg    170160
     ccctgcgcgc gggagcacga cggcgaggtc ttcgcctcct tcgacctgcc ggacggttcc    170220
     tacccgggcg acggggagat cacgcgggcc gccgacgacc ggtgctacgc cctccaggac    170280
     gcctacgcga tggaccggtg ggcactgccg accgacgtcg acgtgtacta cctgaccccg    170340
     accgccgcga gctggcggac cggcgaccgc gagatcacct gcctgttcgg caacacggac    170400
     gagcggggca cgctgaccgg ctcgctgcgc aacgacggcg cgcggttcga cgcggaccag    170460
     cacacctacc tgctcgcgga gggctacctg aaccgggcca tggacgaggt gcccgcggcg    170520
     gaggcggtcg aggacgacct cgcgggctac cggacctggg ccgggcaggt ctcggaggcg    170580
     ctcaggggcg aggtcgcgat gctggacggg cacgagtggc ccgccggcgc cgagcgcccg    170640
     gtcgccgcgc tgaccgacga cctgcggtcg gcgcaggagg agtggggcct ggcggctaag    170700
     gccgccgacc tcgacgcgta ctacgagcac tacggcaagg gctacgacct cgtcgtcgcc    170760
     gacagcacgg tcaccgcacg caaggctctg ggcctggcca ccacgccgcc ggactacgag    170820
     ggcggcgagg gcgggggaga cgaccccggc gtggaggtgt gacagcggcc atagcgggga    170880
     gaaagtgcct gcgtaaagcc ctcgggcggc gcaagtcatc acatcgagtg attctttggc    170940
     ctttgcttgc ctgggccaac ctacggttgc cacgctgttg ctgtctgtac aacctgatgg    171000
     gagcggccag tgacattcgg tgagcagccg gcgtatctgc gtgtcgcggg tgatctccgc    171060
     aagaagatcg ccgacggcct gctgccgccc catacccgcc tcccgtccca ggcgcggatc    171120
     cgcgaggagt acggggtctc ggacaccgtc gccctggagg cccgcaaggt gctgatggcc    171180
     gagggcctgg tcgagggccg ctccggttcc ggcacctacg tgcgcgagcg gcccgtcccg    171240
     cggcgcgtcg cccgctccgg ataccggccg gccggcgggg ccacgccctt ccgccaggag    171300
     caggccgacg gggacgcgcg cggcacctgg gagtcgcgca gcgagcaggc cgaggcgagc    171360
     ggtgccgtgg ccgagcggct cgggatcaag cccggtgacc gggtgatgtg cacgcggtac    171420
     gtcttccggg aggccggtga ggccgtcatg ctctccacct cctgggagcc gctggacctg    171480
     accggccgca ccccggtgat gctgcccgag gaagggccgc tcggcgggat gggtgtcgtg    171540
     gagcggatgg ccgccatcga cgtcgtcgtc gacaacgtca ccgaggaggt cggcgcccgt    171600
     cccggcctcg ccgaggagtt gctcgccctg ggcggcgttc cgggacacgt ggtgctggtc    171660
     gtccagcgca cgttctacgc ctcggggcgt gccgtggaga ccgccgacgt ggtcgtcccg    171720
     gccgaccgct accgggtggc gtaccacctg cccgtcaggt agcccgtcgg gcagcccctc    171780
     aagcagggcc gtggccggga gtgttcgggg gctctgccgc gatgcggggc ggcggggtga    171840
     gacggcgggg cgggacggcg gtgtgagatg gcgcacgcca gtcgtgcgcc tcccgtgtcc    171900
     cgttcccccg ctcacgcatc cgccggggcc cgcggcgtcg ttcgcccggc gccggaatcc    171960
     ggtcgttccc ccaggtcgct tccccggtgc ccggcacgcc tgtgaccgga ggcatcggtg    172020
     tgcggagacg gcgcgttccg cgtcgtgcgc cccctgcgtt ctggctggtt gcgtacctct    172080
     ttgtgcaaag ccgtgttcgc tccgtgaagg ttgggcgtag gctcgggcat atgcggattg    172140
     cggtttcctt ggcgggcggg gcgcggcggg tgccgcgggc ggcgggaacg ggaagcggag    172200
     gggcgcgatg aacgacagca cggtcactct tccctggctg gtcttccggc aggacgacaa    172260
     cggcaatcgc tatcgcgtgg gcaggtacgc cacccgggcg gaggcccagg agatcgcgga    172320
     caccctcgac ggtcgcggcc acaagcagct ctactgggtc gagaaactcg ccgcgcccgg    172380
     cgcgggcgcg gcggactgac ccaccgcgga ccggctcatc gcggaccggc tcaccgcgga    172440
     cccgcccggc cgggcaggcc gtaggctccg gcgcatgacg gaacggatcg tggtgggcgc    172500
     cgccctgctc gacggcgggc gcctgctcgc cgcgcgccgc agcgcacccg ccgaactggc    172560
     cggacggtgg gagctgcccg gcggcaaggt cgagccgggc gagacgcccg aggcggcgct    172620
     cgtacgcgaa ctgcgcgagg aactcggggt ggcggccgag gccggtgggc gcgtccccgg    172680
     gcagtggccc ctgcgggccc ccttcgtcct ccaggtgtgg accgcccgcc tgcgccccgg    172740
     ctccgcggcc cccgcgcccc tggaggacca cgacgagctg cgctggctga cccccggcca    172800
     gatctgggac gtgccctggc tcgaccagga cgtaccggcc gtcgagcggg tgctcgcaca    172860
     cctgggactc gaggcgggca ccgggaggaa cggtaccggg cccggataaa gggtatgtgc    172920
     ccattaaccc catgaaaacg ggcatcgatg gggtcgtcgg ccggggaagt gatcggcgtg    172980
     aaggacggcg agggcgactg tgccgagtgg gtctttcccg cggcgccgga cgccgtgcgc    173040
     accgcccgct ccctggtccg ccgcaccctg ggcgagtggc ggctcgacag cgtcggggac    173100
     atcgccgccc tgctggtcag cgagctggtc accaacgccc tgcggcacgc gaccggcccc    173160
     atcggcgtcc gcctggtgcg cagccccgcc ccggccgccc cggccgccgg aggcgccgga    173220
     ggcgacgggg ccgacggtgt cctgctggtg gaggtctccg acccgctgcc ggacccgccc    173280
     cgcgagcgcg tcgcccgtcc cgacgacgag gacggccggg gtctgcagtt ggtggcctcc    173340
     gccgcacggc gctggggcac ccgtcccggg gaggcgggca agaccgtgtg gttcgaactc    173400
     gccctgccgc gctagtgcga cggtcccgtg acgcaccgtc gccggcgcat cggccgacgc    173460
     tcggaatgcc ccggtatcgc ccctggtccg ggtcgccaac cggttcaggc cagtggcagt    173520
     tgtggaactg cgtgattcga tgccgtgtcc gctggttaga agactggaag tgttgtcgcg    173580
     gtccggaccg aaaaccatcg ggaccgtgct gtgatcgtga acaccgtgtc gtgcggcgcc    173640
     gtagtgctgg atactgcggg cagccgcctc cggtgaccgg tgccggatgc ggtgagctgg    173700
     aggggacggt tcgcgtgagc gagataccag cgagggccaa ggagcccacg gagtccacgg    173760
     agtccggggg cccgtcggca gacgcgccac tcggtgacgc ggtgtggcag agcagcccgc    173820
     ccggctccat ctacgactac atcaaggtcg cctccttctc catcggcccc gacgggctcg    173880
     tcgaccagtg gagcctgcgt gcggagcaac tgctcggcat ccgggccgag gacgccgtgg    173940
     gcagcgatcc catcgaggcc ttcatcgacc ccgacctgcg ggagcgcggc cagcgcaaga    174000
     tgaccgagat cctcgacggc cgggaatgga ccggagtggt ccccttccgg gcaccggacg    174060
     aggccgaggg gacggcgcgg cacgcgagcg gccggcccgc cgacggcccg cccaccggcg    174120
     gccggcccgg acagcgcgga ctcgccgagg tgtacgtcat gccgacgcgc acggaggacg    174180
     gggagaaggc cgccgtctgc atcgtcgtcg acgtccgcgt gctgcgcagc atcgagacgg    174240
     atctcgccgc gtcgcaggcc attttcggcc agtctccgtt cgggttcctg ctcatcgacc    174300
     ccgacctgac ggtgcgccgc gccaaccagc ggttcgcctc catcttcggc ggcacccccg    174360
     acgaccaccg cggcaagggc gtccacgact acctgccgcg cgccgaggcc gaccgggtct    174420
     gcgcgaccct gcgccgggtc ctggagaccg gcgactccat cacggacatg cacgtcacgg    174480
     gcttcgtgcc gggctcggag gagcgccgcc actggtccgt caacctctac cgcgtgcaca    174540
     gcggttccgg ccggcccatc ggcgtcgcct ggctcggcac cgacatcacc gcccgccgcc    174600
     aggccgcccg cgaggccgcc aacgcccggc gcaacctcgc cctcctcaac gaggccggcg    174660
     cccgcatcgg caactccctc gacctggaga ccaccgcccg cgaactcctc gacgtcgtcg    174720
     tccccggctt ctgcgacctg gccaccgtcg acctctacca gggcctgctg gtcggcgacg    174780
     agaccccgcc gggactcgcc gacggcagcg cggaactgcg ccgcgtcgcc ttctccagtg    174840
     ccgtctccga cgccccgttc ctgggcaccg gcgagcgggt caagctcggc gccgtccacc    174900
     actacccgtt caactcgccc tgcgccgacg ccctgcgcac cgcccggccg cgcagcgtcc    174960
     ccgccgagga cggcggtctg gtgcagtcca cgctcgccgt gccgatggtc gcccacgaca    175020
     cggtcgtcgg actggtccag ttcgcccgta ccaagggcag cgagccgttc ggcgaccgcg    175080
     accgcgacct cgccgtggaa ctggccgcgc gcgccgccgt ctgcatcgac aacgcccggc    175140
     tctaccggcg cgagcacgaa cgcgcgctga tactgcaacg ctccctgctc ccgcccggcg    175200
     acccggaggc ctccggactc gacatcgcct gccgctacct gcccggcgag gcggccaccg    175260
     gccgggccag cgaggtcggc ggcgactggt tcgacgtgat cgaactcccc gggcaccgca    175320
     ccgcgctggt cgtcggcgac gtcatgggcc gcggtctgcg cgccgccgtc gcgatgggcg    175380
     aactgcgcac cgccgtacgc accctggccc agctcgacat cgaaccggcc gaggtgctct    175440
     cccagctgga cgagatcgcg cgcggcctcg gcgctcccgg gggcgtccag caggccaccc    175500
     gggccgcccg ccgcccccgc gaggccgacc tgtccgaggt ctacctggca acctgcgtgt    175560
     acgccgtcta cgactcggtg accaggcgct gcaccttcgc caacgcgggc cacctgccgc    175620
     ccgtcctggt cgagcccggc gagtccgcgc tgatgctgga cgtgccgccc ggtctgccgc    175680
     tcggcgtcgg cggggagccc ttcgaggagg tggaggtcga actgcccgag ggcgccctgc    175740
     tcgccctcta caccgacggc ctggtcgaga gccgcgacca ccccctcgac gagggcctcc    175800
     aggccttcgt gggcgccctc acggacccca cccagcccct ggaggacgtc tgcgaccagg    175860
     tcctcaacac cctcgacagc caccacggcg aggacgacat cgcgctgctg atggcccgcg    175920
     tccagggcct gcccgccgac agcgtcggcg actggaccct gccgcgcgag ccgcgcagcg    175980
     tcggccgggc ccgcgagtac gcccgcgccc agctgctggc ctgggacatg gagccgctgg    176040
     tcgacaccac cgaactgctc gtcagcgagc tggtcaccaa cgcgctcagg tacggcgagg    176100
     gcgagatcag gctccgcctc ctgctcgacc gcaccctggt gtgcgaggtg tgggactccg    176160
     gcctggtcca gccgcgccgg cgccgcgccc gggacaccga cgagggcggc cgcggtctgc    176220
     aactggtcgg cctgctcagc gcggcctggg gctctcgccg tacgccgcgc ggcaagacgg    176280
     tctggttcga actgcccctg ccgggcgccg acacccagct cacggacccc gcggaggcct    176340
     tgctgagcct gttctgaccc ggcccggcgt cgtacgggtc cgggcccgcc ggatacggcg    176400
     cacccggccg catccggcca gcagcagggc tgccccggcc gtgaccaggg gcggcaccag    176460
     atcgacggag atcaccgccg cgcacccctc accgcaaccg gaacaccggt tcgagtcgtc    176520
     cccgctggca ccacgctcgg agcgtaagcg cggcgaccgg tcaccgcgac cggagacgga    176580
     ccacagggag gggacaccgt ggcggacacg gaaccgggaa acaccgaacc gagaagcacc    176640
     gaaccgggaa acaccgaact gagaagcacc gaaccgggaa gcatcgaacc gggaagcacc    176700
     gaaccggaag ccgccgacgg cgaggacggg ccaccggggc cacccgcatc cgacgacgaa    176760
     agcggcacag gcggtgcggg tgggaaccgg gacgccgaag gcgaagccga ggcgacccga    176820
     cgaacacgcc gccgtacccg catccgccgg acggccgtag ccgtcctcct ggtcctgctc    176880
     gtccccctcc tcaccgccga gacagccctc cgcgtcaact acatgggcga ccccgccgac    176940
     ggcactcaca ccagaaaccg cgacgcgatg tggctcggcc acgcgtgggt cgacggccgt    177000
     aaggacgacg cggacctcgc cgccttcgcc cgccgcgtca aggcgaccgg catccgcgac    177060
     ctgtacgtcc acaccggccc gatggagcac gacggcacgc tgccgaagtc cctctacccc    177120
     agggcccgct ggctggtggg cgccgtgcac cgcgagctgc ccggcgtccg cgtccaggcc    177180
     ttcctcggcg acgtcctcgc caccgagagc cccgacggca tgcgcctgga gaagcccgcc    177240
     acccgcgccg ccgtcgtcgg ctcggcccgc caggtcctgg acgtcggtta cgacggagtc    177300
     cacctggacc tggaaccgct gcactcgggc gacggcgact acctctcgct cctggacgac    177360
     gtccgcgccg tcacccgcgc ccgtgacgcg cagctctccg tcgccgccca ccagatcgac    177420
     ccgctgcccg gcttccactc cttctggggc acggtcgccg gacaccccaa gtggtggtcg    177480
     caggagttct tcggccaggt cgcccgccgc gtcgaccaga tcgccgtcat gtcgtacgac    177540
     acgatgcagc cgctggagag cctgtacggc ggctacgtcg cccagcagac ctcgctggcc    177600
     ctggaggtca ccccgccgac gacccacctc ctgatgggcc tgcccttcta ccacgagaac    177660
     cgcttcggcc actggaacca cgcggagacc gtcgccgccg ccgtccgcgg cgtccgcctc    177720
     ggtttgtccc gcacggacgc cgaccgggag aggttcggcg tcgccgcgta catcgacttc    177780
     gcggcgacgg agcaggactg ggcgtcgtac cgggacggct gggtgcgcta gggggtgtcc    177840
     cgggaccggc ggccgatctt cgcgcccagc cagaccagcg ggtcgtactt gcggtcgacg    177900
     gcccgctcct tcaacgggat cagcgcgttg tccgtgatcc tgatgccctc cgggcacacc    177960
     tccgtgcagc acttggtgat gttgcagaag ccgaggccgt gctcgtcctg ggccgtgcgc    178020
     gagcggtcca ggccggtgtc accggcggcg tccagcgggt gcatgtccaa ctcggcgacg    178080
     cgcatgagga agcgcgggcc cgcgaaggcg ggtttgttct cctcgtggtc ccgcacgaca    178140
     tggcaggtgt cctggcacag gaagcactcg atgcacttgc ggaactcctg cgagcggtcc    178200
     acgtcctcct gcatcatccg gtactcgccc ggcccgaggt cggcgggcgg cacgaaggcc    178260
     gggacctcgc gggccttggt gtagttgaag ccgacgtccg tcaccaggtc ccggatcacc    178320
     gggaaggcgc gcagcggcgt gacggtgatc gtctcctcgc gggtgaagac ggacatgcgg    178380
     gtcatgcaca gcagccgcgg ccgcccgttg atctcggccg agcacgaacc gcacttgccc    178440
     gccttgcagt tccagcgcac cgcgaggtcg ggggcctggg tggcctggag gcggtggatg    178500
     atgtcgagga ccacctcgcc gtcgttcacc tcgaccgtga agtcctcgag gccaccgccc    178560
     gccacgtcac cgcgccacac cttgaagcgg gcctcgtaac cgctcattcg gaccggccct    178620
     ccagttcctc gtcggcgagg tacttcacca gctcctcctt gtcgaagagg gcgagcaggt    178680
     cgggccggat gggctcggtg gtctgccgct ccagggcgat ccggccgcgc tccgggtccg    178740
     tcgccgccgc ctcgcccgct gcctcgcccg ccgggtcggc cagcgagcag agcaggttgg    178800
     ccgggcgcca gcgccggtcc atcgacggat ggtcctcacg ggtgtgcccg ccgcgcgact    178860
     cggtgcgctc cagcgcggcc cgcgccacgc attcgctgac cagcagcatg ttgcgcaggt    178920
     ccagggcgag gtgccagccc gggttgaact gccggtgccc ctcgaccccg gcccggcggg    178980
     cgcgcacccg cagctccgcc agcttctcca gggcctgctt catctccgcc tcgcggcgga    179040
     tgatccccac caggtcgttc atggtctgct ggagttcctg gtggagggtg tacgggttct    179100
     ccggcgggcc cgcgccgggc tcctgcgcct cggcggagaa cggccgcagg gcctccgcgg    179160
     cggccgcgtc gacctgggcg tcgtcgaccc gggcgcgggt gccctcctcc gtccgccccg    179220
     ccgcgtactc ggccgcgtac cggcccgccc gccgcccgaa caccagcagg tcggacagcg    179280
     agttgccgcc cagccggttg gagccgtgca tgccgccggc cacctcaccg gccgcgaaca    179340
     gtcccggcac cccgcgggcg gcggcggtgt cggagtcgac ggcgatgccg cccatcacgt    179400
     agtggcaggt cggcccgacc tccatcgcct ccgccgtgat gtccacgtcc gccagctcct    179460
     tgaactggtg gtacatcgag ggcagccggc gcctgatcac ttcggcgggc atccgggtcg    179520
     acacgtcgag gaagacgccg ccgtgcggtg agccccggcc ctccttcacc tcggcgttga    179580
     tcgcgcgggc gacctcgtcg cgggggagga gttcgggcgg gcgccggttg tggtccgggt    179640
     cgtcgtacca gcggtcgccc tcggcctccg actcggcgta cttctccttg aagacgtccg    179700
     ggacgtagtc gaacatgaac cgcctgccct cggagttcct cagcaccccg ccgtcgccgc    179760
     gcaccgactc ggtgacgagg atgcccttca ccgagggcgg ccagaccatg cccgtcgggt    179820
     ggaactgcac gaactccatg ttgagcagcg gcgccccggc cagcagcgcc agggcgtggc    179880
     cgtcgccggt gtactcccac gagttcgacg tcaccttgaa cgacttgccg atgccgcccg    179940
     tcgcgatcac caccgagggc gcctggagga cgaagaagcg gccgctctcg cgctcgtagc    180000
     cgaagacccc cgagaccttc cggtcctcct ggagcaggcg ggtgaccgtg cactcctgga    180060
     agaccttcag ccgggactcg tggtccccgg tctcgcggaa gtcctcctgc tggagcgaga    180120
     cgatcttctg ctggagggtg cggatcagct ccaggcccgt gcggtcgccg acgtgggcga    180180
     ggcgcgggta ctcgtggccg ccgaagttgc gctgcgagat ccggccgtcc ttcgtccggt    180240
     cgaacagcgc gccccaggtc tccagctccc acacccgctg cggggcctcc tgggcgtgca    180300
     gctcggccat ccgccactgg ttgaggaact tgccgccgcg catggtgtcg cggaagtgga    180360
     cctgccagtt gtccccggag ttgacgttgc ccatggaggc ggcgatgccg ccctcggcca    180420
     tcaccgtgtg cgccttgccg aacagcgact tgcagatcac ggccgtacgg gcgccccgct    180480
     cgcgggcctc gacggcggcg cgcagcccgg caccgcccgc gcccaccacg acgacgtccc    180540
     attcctgccg gtcgaccacg gacatcagaa agcctcactc gtcagaagaa gcgcggatcg    180600
     tcgaagacac cggacgcgac caggtacacg tagaagtcgg cgagcgccac gctcaccagg    180660
     gacgcccagg ccagctgcat gtgccgggcg ttgagccggc cgaccagctg ccacatccgg    180720
     tagcgcacgg gatgccgcga gaagtgcttg agcttgcccc cgacgatgtg ccggcaggag    180780
     tggcaggaca gggtgtacgc ccagatcagc gcgatgttgg cgaggaagac cagggtgccg    180840
     agccccatgt ggccccaggc gtagtgctcg tcgcggaagg cgagcacggt gtcgtagctg    180900
     aggatgcccg cgaccaggag cgccgcgtag aagaagtacc ggtggacgtt ctgcaggatc    180960
     agcgggaagc gggtctcgcc ggtgtacttg cggtgcggct cggccaccgc gcaggccggc    181020
     ggggaggccc agaagccccg gtagtaggcc ttgcggtagt agtagcaggt caggcggaag    181080
     ccgagcggga agatcaggat gatgatcgcg ggggagatgc cccaccaggt gccgaagagc    181140
     tcccagttgg gccccgagcg catcggctcg cagttctccg ccagacacgg ggagtagaag    181200
     ggcgagacgt acggggccgc gtagtagtcg gcgttcgcga aggcccgcca ggtcgagtag    181260
     acgacgaagg ccagcaggcc cgcggcggtg gcggccggtg ccagccacca gcggtcggtg    181320
     cgcaggtgcc gggcgcggat ggcggcacgc gtcggggtgt ggacgccacc gcccggggga    181380
     cggtcttcgg tggctggcgg ttcggtacca gtggccactg ggcggctccg gtcgggtcgg    181440
     gtcgggttga gggcctttct cgagtccccg gagcaggccc tagggggcgc gccggtcgcg    181500
     ggcgccgaga ccctcgtcgt ccgagtccgt ccacagggag ccgtcgtacg gcgtgtcggg    181560
     gatcgggacg aggtccggac gcctgggcgc ctgaggcgcg gcagtcgccg cccgcagcag    181620
     cgcgacgctc tcgcgcaggt ggtcggcgtc ggtgcggacc cggcggactt ccaggtcgcc    181680
     gctgcccagc tgctgttcca gccgggtcac cgtccgggac agttcgtcca ggctgcgctg    181740
     taccgatgac agatcgtcgt gcacggacaa gacgtgacct cgcttccgtc ggacacggca    181800
     gtgggccgcc ggccttgggg ggctacgttc atgcgcctga gagtgtcgcg cgtcacacca    181860
     gtcgctggga agggatgtgc agcgattggc cggggcgcgt cggtgcaccg cgggcggcat    181920
     tgcgccgcac gggtgacctt acgcaccgtt gtcgccgtgt ctccgagcgt ggcggaaccg    181980
     tttccccttc agtggccgca tccccgtccg gatacaaatg atcaacttga ataccgcaca    182040
     tacggcaaat gcggcacaac gcagcgaacg cggccttccg gaggtagcag agatgtccca    182100
     cgtcggcgtc ggaccgcgcg cggtcatgcg tgcggtcgcc ttcctcacca cgggcgtcct    182160
     cgcggtcccc gcgctggccg gctgcacctc cgaggacccg gcgggcaagc cgctggccga    182220
     acaggacgtc gccgccgcgg cccgcgccag gatctccgac ggcggcaccc tgcgctgggc    182280
     cgtggactcc gtaccggaca cgctgaacgc cttccagtcg gacgccgacg ccacgacgac    182340
     ccgcgtcgcg caggccgtgc tgccctcgat gtaccggatg gacgagaccg gcagccccgt    182400
     gcgcaacccc gactacctgg agtcggccga ggtcgtcgac accgagccca agcaggtcgt    182460
     cgtctacaag ctgaaccagc aggccgtctg gagcgacggc cgggagatcg gcgccgcgga    182520
     cttcgccgcc cagtggcgcg ccctgtccgg caaggacagc gcctactgga ccgcccgcaa    182580
     cgcggggtac gaccgcatcg agaaggtcga gcgcggtgcg aacgacctgg aggtcaaggt    182640
     caccttcagc cggccctacg ccgactggaa ggccctgttc acgcccctgt acccgaagga    182700
     cgtcacgggc accccggacg ccttcaacga cggcgcgcgg cgggccctca aggtcagcgc    182760
     cgggcccttc gcggtcaaga aggtcgacac caagggcgac caggtggtcc tcaccggcaa    182820
     tccccgctgg tggggcgagc cggcgaagct ggacgagatc gtgctgcgcg ccgtcccccg    182880
     cgacgagcgg gtctccgaac tggtcgccgg caagctcgac ctcgccgaga tcgacccgga    182940
     gaccgccgac gaggtcaccc tggccgccgg tccccgggac cccgccaccg gcaccccgct    183000
     catgggaccc gggggcaccc cggccgcggg cccgcagggc aggtctgccg ccgaggcgct    183060
     gcgctcctgg gccatcgcca acggctccga cgaggaggcc gccgaggagg aggtcctcgc    183120
     ccgcgaggag cgcggcgagg ccgaggcgaa ggcccggcgc cggcagcagg ccctgagcgg    183180
     cttcgagctc cgcaagtccc tggagcccgc ctacacccag ctcgccctca acggcgccga    183240
     aggccccctc gccgacgaac gcgtccgcag ggccgtggcc cgcgccctgg accgcgagga    183300
     gctggccgag gcggtgctca agccgctcgg tctgcccgcc gagcctgtgg gcagccatct    183360
     cgcgctctcc ggccagcccg cctacgccga cggcagcggc gccctcggcg agcagaacgc    183420
     caaggaggcc cgagccctgc tcgcggacgc cggatgggtt cccggcggcc cggtgaagaa    183480
     gaaggacggc gaggaggcgg ccggtgccga gaaggacgag aacaaggacg aggacaagaa    183540
     ggacgaggag aagtccgagg gcggcgacga cggcacgtac atcgtcggcg aggacgacaa    183600
     gaacaaggac ggcaagaaca aggacggcaa gaacgacgac ggcaagaacg acgacggcgg    183660
     gaacgacgac ggcgggaacg acgacgccgg cgacgccaag gacggcgccg accgggagag    183720
     cggcgagaag cacagcagcg gcaagaacac cgcgcagggc ggcgcacccg gcgcctacgc    183780
     ccccaagggc accgcggccc cggccggcgc ggcggcggcc ccgctcgcca aggacggcaa    183840
     ggaactcacc ctccgcttcg tgctcccctc cggtcccggc tccggcaccc tgcgcaccgt    183900
     ggccgaccgc atcacggaca tgctgaagga gatcggcatc ggcaccagga tcaccaaggt    183960
     gccggacgag agctacttca aggaccacat cgccgccggc gagtacgacc tggcgctcta    184020
     ctcctggccc gcctccgcgt tccccgccac cgacgcccgt cccatctacg ccaagcccgt    184080
     cccggccgcc gacggttccc tgaacgtcgc ccagaactac acccgggtcg gcaccgacca    184140
     ggtcgaccag ctcttcgacc gggccctggc caccctggac cagaaggagt cccgggacct    184200
     gctgcgcaag gccgactcgc ggatctgggc ggcggccggc tccgttcccc tctaccagcg    184260
     cccccagctg acggcggccc gcaagaacct cgccaacgcc ggcgccttcg ggttcgggac    184320
     accggtctac gaggacatgg gcttcctcaa gaagggtgcc cagggctccc ggcccaccgc    184380
     cccggcctcg ccctccccct cgtcctgaac cctcccggca agccgcagcc tccggggccc    184440
     cgtaccattg ggtgaggccg tggcatgtac cgcccggcag gcccgcgtga cacggacgta    184500
     cgcgagggcc gtccacacac cctccgggag tacgcctcat atggccacgc gccacgacat    184560
     ccgcaacgtc gccatcgtcg cccacgtcga ccacggcaag accaccatcg tcgacggaat    184620
     gctgaagcag gccggcgcct tcgccgcgca ccagctcgaa ggcgtcgacg accgcatgat    184680
     ggactcgaac gacctggagc gtgagaaggg catcacgatc ctcgccaaga acacggcggt    184740
     gaagtaccac ccgaaggatg gcggcgacgt catcaccatc aacatcatcg acacccccgg    184800
     ccacgccgac ttcggcggcg aggtcgagcg cggtctgtcg atggtcgacg gtgtcgtgct    184860
     gctcgtggac gcctccgagg gtccgctgcc gcagacccgg ttcgtgctgc gcaaggcgct    184920
     cagccagcgg ctgccgatca tcctgtgcat caacaagacg gaccggccgg acgcccgcat    184980
     cgacgaggtc gtcaacgaga cctacgacct cttcctcgac ctggacgccg acgaggagca    185040
     gatcgagttc ccgatcgtct acgcctgcgg ccgggacggc gtcgcctccc tcaccaagcc    185100
     cgaggacggc acggtcccct ccgactccac cagcctggag ccgttcttct cgacgatcct    185160
     ggaccacatc ccggcgccga cctacgacga ggacgccccg ctccaggccc acgtcaccaa    185220
     cctggacgcc gacaacttcc tcggccgcat cgcgctgctg cgcgtccacc agggcgagct    185280
     gaagaagggc cagaccgtcg cctggatgaa gcgcgacggg tccgtgcaga acgtgcggat    185340
     ctccgagctg atgatgacgg aggcgctcac ccgcaagccc gccgagaagg ccggccccgg    185400
     tgacatctgc gcggtcgccg gcatcccgga catcatgatc ggcgagaccc tggccgacgt    185460
     ggagaacccg gtcccgctgc cgctgatcac ggtggacgag cccgcgatct ccatgaccat    185520
     cggcaccaac acctccccgc tggtcggccg cggcgccacc ggcaagggcg ccgacaacaa    185580
     ggcggtcgtc aaggaccgca aggtcaccgc ccgtcaggtc aaggaccgcc tggaccgcga    185640
     gctgatcggc aacgtctcgc tccgcgtcct ggacaccgag cgccccgacg cctgggaggt    185700
     gcagggccgc ggtgagctgg cgctggccat cctggtcgag cagatgcgcc gggagggctt    185760
     cgagctgacc atcggcaagc cgcaggtcgt caccaaggag gtcgagggca agacgtacga    185820
     gcccgtcgag cggatgacga tcgacgtgcc cgaggagcac atgggcgcgg tcacgcagct    185880
     catgggcgtg cgcaagggcc ggatggacaa catgtccaac cacggctcgg gctgggtccg    185940
     catggagttc gtggtcccct cccgcggcct gatcggattc cggacggagt tcctcaccca    186000
     gacccgcggc accggcatcg cgcactccat ccacgagggc cacgagccct ggttcggcac    186060
     cctcacgaca cgtaacaacg gctcgctggt cgccgaccgc tcgggtgccg tcaccgcgtt    186120
     cgcgatgacc aacctccagg agcgcggtgt gctcttcacg gaccccggca ccgaggtgta    186180
     cgagggcatg atcgtcggcg agaactcccg cgccgacgac atggacgtga acatcaccaa    186240
     ggagaagaag ctcaccaaca tgcggtcgtc ctcggccgac tcgttcgagg cgatcgtccc    186300
     gccgcgcaag ctctccctgg agcagtccct ggagttctgc cgcgacgacg agtgcgtcga    186360
     ggtgaccccc gaggccgtcc ggatccgcaa ggtgaacctg gacgcccgcg agcgcgcccg    186420
     cgccgccagc cgcgccaagc acggctgacc ccaccgcacg gcggacggca ccggacccca    186480
     cggttcacgt ggggtccggt gccgttcggc gtgttggcga cgcgggcggg agtcgggtgt    186540
     agggaaaacc ctcgatttcc cggcggggcg gcacagggcg ggcagggccg cactaacctg    186600
     cgcggaagca ctccgcccgg agcgccggcg ggcagccccg tccgggggcc gggcggccgg    186660
     cgccgacggc cgtgccgggc gcgggacata cctgcgggtc agcttgcacc ccgtgcacgt    186720
     tacgcgcaat caatttctgt cgcgcggacg tccgctatac ggacggtcac caccgttaga    186780
     tgtgtaacaa gtccgtttcg cagcgatctc gtaccaaacc ctttgtccgg attttgaaag    186840
     atctggcccc tatctgtgat cgaaccgaga cctcgaacct gtggttcgtt ccccggagga    186900
     tggcagatag ttaggcgcgt agagctcgga taaacgggtc acgcgctgac ggggcgcagg    186960
     ctcgcgagcg tgagggtgca cggcgatctc atcaccggcc gatggctgga acgtgacgcg    187020
     tgctcctctt tgcggtgaac cagcggattc atgaggagga acccatgcga ggtgccacaa    187080
     gcgccatatg ggtcgcgtcg tccccgatgg caggtgtagg ccccgcgggt gcgttcagtg    187140
     ccgtcacggt tgatgcggca gcggcccggc gtcgcgaact tccttgacgt cgtgtgccgt    187200
     cggccggccg tcgccggccg tgagccaggg ttctcccggg gccgtgctgc ccctccgtct    187260
     ttgttcccct cgcgcgctgc gaaagacgta cgccgtgcga aggccgtcgg ctcccgcact    187320
     cccgacgacc tccaacctgt gaaatggacg aatcatgacg agtccaatcg agattgaggg    187380
     tgctgaagcc tcttccgtct tggacaaaga gagcgcgccg cagggcgacg ccccgaagcc    187440
     caaggagccg gaagggcgca agcccggcca gttgatgtgg gcgcgcttca agcgcgaccg    187500
     ggccggtgtg atctctgcct tcgtcgtcct gttcttcttc gtgatcgcgg cggcggcgcc    187560
     gctgatctcg atggtctacg gcaaggaccc gtacacgctg tacggtcagg acaaccccga    187620
     cctgctggac atgttcacca tgcccgcggc gccgtacggc ggcatcgacg gcgacttctg    187680
     gttcggcatc gaaccgggcc tgggccgcga cgtgttcacc cagctgctgt acggcatgcg    187740
     caactcgatg gccaccgcgc tggcggcgac catcatcatg acggtgctgg gtgtcctgat    187800
     cggcctggcc ggcggctact tcggcggcaa gatcgactac tggctcggcc ggatcaccga    187860
     cttcttcatg gccctgccca gccagctctt cttcgtcgcc gcgatgcccg tcatcaccac    187920
     ggtgttcgtc gctcccgaca aggagacgcc cacctacgtg cgcgccgccg cgatcatcat    187980
     cgtgctgtcc ttcctgggct ggatgagcat ggcccgcatc gtccgcggtg ccacgatgtc    188040
     cctgcgcgac cgggagttca tcgaggccgc ccgcatctcc ggggcctcgc cctggcgcat    188100
     cctccgcaag gaactgctgc ccaacatcgt cactccgacg ctggtacagg cgacgctcac    188160
     gctgccgagc accatcctca gcatcgcgtt cctgtccttc gtgggcgtgg ggtacgtcga    188220
     gcccacgccg gactggggac ggatgttcgc catcggcgcg gacatcgtcg agcaggaccc    188280
     ctactacatg ctcttccccg gagtcgccat ggtgatcttc atcgtggcct tcaacctcct    188340
     cggtgactcg gtccgggacg ccttcgaccc caagggaaac cgctgaggcc aaggggaacc    188400
     ccccacatcc tcgcccggcc ggttcggcgc cgctcagccc ggcctccggc cacgtaccag    188460
     cagtgctcac tactcacagg caggtggatt cgtcctcatg agcattctcc gtaaccgcac    188520
     cgccacggcc gccatagtcg cggtcgcagc cggcgccctg accctcaccg cctgcggtgg    188580
     tggcgacagc gacagctccg ccaaggacaa cagcaagaag aaggaagacg ccaagtcgca    188640
     gtcgaagccg gtccagatcg gcgacgcgca ggcgtccacc ggcccggccc ccgaggtccc    188700
     gggcgccaag ccgggcggca ccatgaccgt ctaccagacg gcggacttct cccacctgga    188760
     cccgggccag atctacgtct cggacggcaa gctgctcggc cgcctcatct tccgcggtct    188820
     gacccagtac gacgaggacg agaacggcaa cctgaccgtc gtgggcgacc tcgccaccga    188880
     cgcgggcaag cagaccgacg gcggcaagac ctggacgtac accctcaagg acaacttgaa    188940
     ggacgccaac ggcaacccga tcaactcggc ggacatccgc cacacgatcg agcggatgta    189000
     ctccagctac atcaccgacg gcccgacgta cctccagcag tggctgtccg gcgacggcac    189060
     cacctaccgc gacgcctacg cgggtccgga caagggcaag cacctgcccg acaacgtcct    189120
     ggagacgccg gacgacaaga cgatcgtctt ccacttcaag acggctcgcc ccgacctccc    189180
     gcagatgctg accatgcccg gttacagcgt cgtcccggag gagacggaca ccaaggagaa    189240
     gtacgactcc gcgcccgtcg ccgccggtcc gtacaagatc gccgagttca agcccggcaa    189300
     gtcgatgaag ctggtcaaga acacccagtg ggacccgaag tccgactcgg tgcgccacca    189360
     gtacgtcgac ggcttcaaca tcgagatgaa ccacgacgac gaggaccaga ccaagaccct    189420
     cctcgccgac cagggtggcg ccaagaacgc catgatgttc accggccagg tcgccacgac    189480
     gcagctccag aaggtcgtcg gcgacaagga cgcgatgaag aaccgcacga tccagggcta    189540
     cgcgccctac gtgtggcagc tcaacttcaa catgaaccgc gtcaaggaca agaagctccg    189600
     cgacgccatc accctggccc tgccctccga ctcggtcttc aaggccgacg gcggtgccta    189660
     cggcggtgag gtcgccaact cgctgatgtc gcccaccacc ccgggctacg acgaggcgtt    189720
     cgacccgttc ggccgcgcca agaagccgaa cggcgacatc gaggccgcca agaagctcat    189780
     caaggaaggc ggcttcgagg gcaagagcct cgtctacgcc tacgccaaca cccctgagcg    189840
     gcagaagcag gccgtcctga tctccaccgc cctggagaag atcggtctcg acatccagaa    189900
     gaaggagatc gactccgcca cctggtacga gcaggtcggc aaggtcgaca acgggctgga    189960
     cctctacatg accggctggg gccaggactg gccgtccgcc tccacggtca tcccgccggt    190020
     ctacgacggc aagcagatcc aggacggtgc gtcgaactac tcgcacatca acgacgacca    190080
     cgtcaactcc gagatccagc gcatccagca gatcacggac acggcggagg ccaccaaggc    190140
     ctgggcggag ctgaacgagt acatctccaa ggaagtgaac ccggccgccc cgatctacta    190200
     caccaaggtc ttccagatct tcggttcgaa cgtcggcggc atccgctaca gctcggactc    190260
     gagctacgtg gacgtgaccc gggtcttcct caagaagtaa cccgtccggt cgggaaacgg    190320
     tggcgggcgc gctgcggagc gcccgccacc gggcccggac cgactccagc cctccccatc    190380
     cccttgccgc agtcctgaga gcagctgtct gccatgcttc aattcctcat tcgccggtcc    190440
     ttcggcgcgg tgctgatcct ggtgttgatc agtgccttca ccttcttcat gttcttcgcg    190500
     atcccgcagg acccggccat gctggcctgt ggcaagaact gcactccgga cgcgctggag    190560
     atcatccaca agaacctggg cctcgaccag ccggtcacgg tccagtactg gcatttcctg    190620
     gcgggcatct tcaccgggcg cgacttcgcg gtcggtcact gcgacgcccc ctgcttcggc    190680
     gtctccttcg cgaacaacca gaacgtctgg gacacgatcc tcgaccgctt cccgctgacc    190740
     gtctcgctga ccgtcggttc cctgatcgtc ttcctcatcg tcggcctcgg cgccggcctg    190800
     ctggccgcca agaaccgcgg cacctggatc gacaaggtgt tcagctccgg ctcgctggtc    190860
     gtcagctccc tgcagatcta cttcctcggc ccgctcgtcc tgctcgcgct cgtctacagc    190920
     accggctggc tgcagaagcc caagtacgtg ccgatctccg aggacgccgc cggctggttc    190980
     gccggcctgc tgatcccctg gatcgtcatg gcgaccatct tcaccgccaa ctacacccgt    191040
     atgagccggt cgtcgatgat cgagcaacta caggaagagc atgtgagggc ggcccgtgcc    191100
     aagggcatgt cgagcaacta caccttcttc cgctacgcct ggcgcggctc gctcgtgccc    191160
     atcgtcacca tcctcggcat cgacctgtcc gcgctgatgg gcggcggcat ggtgaccgag    191220
     atgaccttcg gcctggccgg catcggccgg ctcgcgctgg agtcggtgat caacaaggac    191280
     ctgccgatgc tgatgggcgt catgctggtc agcgccgcgc tcatcatcgt cttcaacctg    191340
     atcgtggacg ccatgtacgc agtcatcgac ccgcgcgtgc gcctgtccta ggagaaccac    191400
     cgtgaccact cagaccaagc ccgaagaggc cccggccgcc gccgcggggg acgcgtttct    191460
     ctcggtgcgc gacctcaagg tccacttctc caccgagggc ggcgtcgtca aggcggtgga    191520
     cggtctctcc ttcgacctgg agcggggcaa gaccctcggc atcgtcggcg agtccggctc    191580
     cggcaagtcg gtgaccaacc tggccgtcct cggcctgcac gaccgccgca ggaccgccat    191640
     cgacggatcg atcacgctgg acggccagga gctgaccgac gccagtgaga agcagctgga    191700
     gaagctgcgc ggcaagaaga tggcgatgat cttccaggac gcgctgaccg cgctgtcgcc    191760
     gtactacacg gtcggccggc agatcgcgga gccgttcatg aagcacaacg gcgcgtccaa    191820
     gaaggacgcc cgggtgcgcg ccatcgacct gctgcagaag gtcggcatcc cgcacccgca    191880
     gaagcgggtc gacgactacc cgcaccagtt ctccggcggt atgcgccagc gcgccatgat    191940
     cgccatggcc ctgtcctgca acccggacct gctgatcgcg gacgagccca ccacggcgct    192000
     cgacgtgacc gtccaggcgc agatcctcga cctgctcaag gacctccagc aggagttcgg    192060
     ctccgcgatc atcatgatca cccacgacct gggcgtggtc ggcaacatgg ccgacgacat    192120
     catggtcatg tacgcgggcc gggccgtgga gcgcggcacg gtgcgcgagg tgctcaagtc    192180
     cccgcagcac ccgtacacct ggggtctgct gagctcgatg ccgaacctca cgtccgacgt    192240
     cgacgagccg ctgatgccga tcccggggtc gccgccctcg ctgatgaacc cgccctccgg    192300
     gtgcgcgttc cacccgcggt gcggcttcac cgacctggtc tccggcgagc gttgctcggg    192360
     ggagcgtccg acgctcccgc acggccgtgc cgccgcctgc cacctgacgg gagaccagcg    192420
     gcagcaggtg ttcatcgaga agattcagcc ccggctgggc tgagcggaaa ccggcgactg    192480
     gggcatcacc atgagcgaca acagcaagac gaccacagcg gtggccgacg acttcccgca    192540
     gcagcgggac ggcgacaccg cgccgcttct caaggtcagc ggcctctcga agcacttccc    192600
     gatcaagggc ggcttcccga tcaagcgcac cgtcggccac gtcaaggccg tcgacggcgt    192660
     tgatttcgag gtcttcccgg gcgagagcct cggcctcgtc ggcgagtccg gctgcggcaa    192720
     gtcgaccacc ggccggctgc tgacccggct gtacgagccg acccagggca gcatcgagta    192780
     ccggggcaag gacatcaccc gggccaaccg gcgggaactg gcgccggtcc ggtccgagat    192840
     ccagatgatc ttccaggacc cgtacgcgtc cctgaacccg cggcagaccg tcggcacgat    192900
     catctcgggc ccgatggaga tcaacgggat caacccgccc ggcggccggg agaagcgcgt    192960
     ccgcgagctc ctggagatcg tcggtctcaa cccggagcac tacaaccgct tcccgcacga    193020
     gttctccggc ggccagcggc agcgcatcgg ggtggcgcgc gccgtcgcgc tgcagccgaa    193080
     gctcatcgtc gccgacgagc cggtctcggc cctcgacgtg tcgatccagg cccaggtggt    193140
     gaacctgctg caggaggtgc agcgggagat gggcatcgcg ttcgtcttca tcgcccacga    193200
     cctggcgatc gtgcggcact tctcgcagcg cgtcgcggtg atgtacctgg gcaagatcgt    193260
     ggagatcgcg gaccgcgact cgctctacaa ccgcccccgt cacccgtaca cgcacgcgct    193320
     gctgtcggcc gtgccggaga cggacctcga cgccgagaag cgggagcgga tccggctcga    193380
     gggcgacgtg ccctcgccga tctcgccgcc ctccggctgc cggttccgca cccggtgctg    193440
     gaaggcgcag gacaagtgcg ccaccgagga gccgccgctg gtgcagctct ccgggaaccg    193500
     ggagggccac ctgacggcct gccacttccc cgaggagggc tcgacggagg ccagggccga    193560
     ggacatcgtc atggacccgg gtctgaaggc gatggaggac ggcgccgacg gcggcgcgac    193620
     cctctccaag ggctgagcac agaaggcagc agggaagggc ggcggcggga gcaggactcc    193680
     cgccgccgcc cttccgtatg ccgccacacc tcccgcaccc gtccggagga caccggcaac    193740
     ccgtatggac cggacgggtg tgcgcccccg agtacgccct tcgaagctgg accggaacgg    193800
     accagcggac gagtcagggc acgaggaggc actccatgcg cggagccacg cacgccagat    193860
     gggccgcttg cgcggcggcg gtagccctcg cggcgacggc ctgcggcggc gggggcgggg    193920
     acggaggcag cggcggcggc agcggcggcg tgctcagctc ctcctggggc gacccccaga    193980
     acccgctgga gccggccaac accaacgagg tgcagggcgg caaggtcctc gacatgatct    194040
     tccgggggct gaagaagtac gaccccggga ccggcgaggc gcagaacatg ctcgccgaga    194100
     agatcgacac ctccgactcg cagaacttca ccgtcaccgt caaggacggc tggaccttca    194160
     gcaacggcga gaaggtcacc gcgcagtcct tcgtggacgc ctggaactac ggcgcgagcc    194220
     tgaagaacaa ccagcgcaac gcgtacttct tcgcctacat cgacggctac gacaaggtgc    194280
     accccgaaag cggctcgcag agcaccgaca cgctctcggg gctgaaggtg accggccccc    194340
     gcaccttcac gatcaagctc agccagaagt tctccacgtt ccccgacacc ctcggctatc    194400
     cggccttcgc gccgctgccc aaggcgttct tcgacgacca cgacgcctgg ctgaagaagc    194460
     ccgtcggcaa cggcccctac caggtcgaca actacacccg cggctcccag atgtccctgc    194520
     gcaagtggga cgactacccc ggcccggaca aggcgcagaa cggcggcgtg gacctcaagg    194580
     tctacaccga caacaacacc gcctacaccg acctgatcgc gggcaacctc gacctcgtcg    194640
     acgacgtccc ggcctcccag ctcaagaacg tcaagaacga cctcggcgac cggtacatca    194700
     acaccccggc gggcatcatc cagaccctcg ccttcccgtt ctacgacaac gactggaaca    194760
     agtccggctc ggagaaggtc cgcaagggcc tgtccatggc gatcgaccgc aagcagatca    194820
     ccgacaccat cttccagaac acccgcaccc cggccaccga ctggacctca ccggtcctcg    194880
     gcaaggacgg cggctacaag ccgggcctgt gcggggacgc ctgcgagtac aacgccgcgg    194940
     aggccaagaa gctggtcaag gagggcggcg gactccccgg cgggcaggtc aagatcacct    195000
     acaacgccga caccggctcc cacaagcagt gggtcgacgc ggtctgcaac tccatcaaca    195060
     acgccctgga caacgaccgc gcctgcgccg ggaacccggt cggcaccttc gccgacttcc    195120
     gcaaccagat caccaaccag aagatgagcg gccccttccg cgcgggctgg cagatggact    195180
     acccgctcat ccagaacttc ctccagccgc tgtactacac caacgcctcc tccaacgacg    195240
     gcaagtggtc cagcaagaag ttcgacgacc tcgtcgacca ggccaacgcc gagaccgaca    195300
     ccgccaaggc cgtcggcctc ttccagcagg ccgaggaggt cctcagggac gacatggggg    195360
     ccatcccgct ctggtaccag aacggcagcg caggctactc cgaccggctc tccaacgtga    195420
     agctcaaccc gttcagcgtc ccggtctaca acgagatcaa ggtcggctga gggggcgcca    195480
     tgggacgcta cgtcgtccgg cggctgctcc agatgatccc ggtcttcatc ggggccacgc    195540
     tgctgatctt cctgatggtc aacgtgatgg gcgaccccat cgcgggcctg tgcggcgacc    195600
     gggagtgcga cccggcgacg gccgcgcagc tgcggcacga gttcggcctc gaccagccgg    195660
     tgtggcagca gtacgccacc tacatgggca acgtcttcac cggcgacttc ggcaccgcct    195720
     tcaacggcca gccggtcacc gagctgatgg ggacggcgtt cccggtcacc atccggctca    195780
     ccatcgtcgc gatcctcttc gagatcgtcg tcggcatcat cctgggcgtc ctcaccggcc    195840
     tgcgccgcgg ccgtcccgtc gacaccgggg tgctgctgct gaccctcgtc gtcatctccg    195900
     tgcccacctt cgtcaccggc ctgctgctcc agctgctgct cggcgtcaag tggggctgga    195960
     tcgacccggc cgtctcctcc gaggcggcct tcggcgagct gatcgtcccc ggcctggtcc    196020
     tcgcctcggt ctcgctggcc tacgtcaccc ggctgacccg cacctccatc gccgagaacc    196080
     ggcgctccga ctacgtccgc accgccatcg ccaagggcct gccccgccac cgggtcatca    196140
     cccggcacct gctgcgcaac tccctcatcc ccgtcgtcac cttcatcggc accgacatcg    196200
     gcgcgctgat gggcggcgcc atcgtcaccg agcggatctt caacatccac ggcgtcggct    196260
     accagctcta ccagggcatc ctgcgccaga acacccagac cgtcgtcggc ttcgtcaccg    196320
     tcctggtcct cgtcttcctc gtcgccaacc tcgtcgtcga cctcctgtac gccgtactcg    196380
     acccgaggat ccgctatgcc tgaacaggag ccctacgagc ccgagcgcgc catcgccggc    196440
     accggcatgg gcggcacgat ggacctcggc gccagcgagg cggtcacgct ggagcagccg    196500
     ccgggcccgg acggggccga cccccgggac aaaccccgca gcctgtggac cgacgcctgg    196560
     cacgacctgc gccgcaaccc cgtcttcatc atctcggcgc tggtgatcat cttcctgatc    196620
     gtcatctcca tctggccgtc gctgatcgcc tccggcagcc ccctcaagtg cgacctggcc    196680
     aaggcccagg aaggctccca gcccggccac cccttcggct tcaacggcca gggctgcgac    196740
     gtctacaccc gcaccgtcta cggcgcccgc acctcggtcg cggtcggcat cctggccact    196800
     ctcggcgtcg ccctcctcgg cagcgtcctc ggcggcctcg ccgggttctt cggcggcggc    196860
     ggggacgcgg tcctgtcccg gatcaccgac atctttttcg cgatcccggt cgtcctgggc    196920
     ggcctcgtcc tgctctccgt catcaccagc aacaccatct ggccggtcat cggcttcatc    196980
     gtgctgctcg gctggccaca gatctcccgc atcgcccgcg gctccgtcat caccgccaaa    197040
     cagaacgact acgtgcaggc ggcgcgggcg ctgggcgcct ccaactcccg gctcctgctg    197100
     cgccacatcg cgcccaacgc cgtcgcgccc gtcatcgtcg tggcgaccat cgcgctcggc    197160
     acctacatct ccctggaggc gaccctgtcc ttcctcggcg tcggcctgaa gccgcccagc    197220
     gtctcctggg gcatcgacat ctcctccgcc gccccctacg tgcgcaacgc cccgcacgcg    197280
     ctgctgtggc cgtccggggc gctcgccatc accgtcctcg cgttcatcat gctcggcgac    197340
     gcggtgcgcg acgccctcga cccgaagctg aggtgagcga ccgcatgctg ctcgaagtgc    197400
     gcgacctgca cgtggagttc cacacccgcg acggtgtcgc caaggccgtc aacggcgtca    197460
     gctacggcgt ggacgcgggc gagaccctcg cggtgctcgg cgagtccgga tccggcaagt    197520
     ccgtcaccgc ccagacgatc atgggcatcc tcgacatccc gccgggcagg gtcaccgcgg    197580
     gggagatcct cttcgagggc cgcgacctgc tgaagctgaa ggaggaggaa cgccggaagg    197640
     tccgcggcgc cgagatggcg atgatcttcc aggacgcgct gtcctcgctg aacccggtcc    197700
     tgaccgtcgg cgcccagctc gccgagatgt tcaccgtgca ccgcggcatg tcccgcaagg    197760
     acgcccacgc caaggccgtc gagttgatgg accgggtccg catcccggcc gcgaaggagc    197820
     gggtgcggca gtacccgcac cagttctccg gcgggatgcg ccagcgcatc atgatcgcga    197880
     tggcgatggc cctggagccc aagctgatca tcgccgacga gccgaccacc gccctcgacg    197940
     tcaccgtcca ggcccaggtc atggacctgc tcgcggaact ccagcgcgaa ctgcacatgg    198000
     gcctgatcct catcacccac gacctcggcg tggtcgccga cgtcgccgac aagatcgccg    198060
     tcatgtacgc cggccggatc gtcgagacgg cacccgtcca cgacatctac aaggccccgg    198120
     cccacccgta cacccgcggc ctgctggagt cgatcccgcg cctggaccag aagggccagg    198180
     agttgtacgc catcaagggc ctgccgccca acctgacccg gatcccgcca ggctgcgcct    198240
     tccacccccg ctgcccgatg gcccaggacg tctgccgcac cgacgtacct cccctctacg    198300
     acgtcaccga gtccgacgcc gagcggggca gcgcctgcca cttctggagg gagtgcctgc    198360
     atggctgaga ccacggagcc gatcctcgaa gtccgcggcc tggtcaagca ctacccgctg    198420
     acttccggca tcctcttcaa gaagcaggtc ggcgcggtca aggccgtcga cggcgtggac    198480
     ttccggctgg cccgcggcga gacgctcggc atcgtcggcg agtccggctg cggcaagtcc    198540
     acggtcgcca agatgctggt caacctggag cggccgacgg cgggggagat ccgctacaag    198600
     ggcgaggaca tcacccgcct gtcgggccgg gccctgaagt ccgtacgccg gaacatccag    198660
     atggtcttcc aggaccccta cacctccctc aacccccgca tgaccgtcgg cgacatcatc    198720
     ggcgaggcct acgacatcca ccccgaggtg gccccgaagg gcgaccggcg gcgacgggtc    198780
     caggacctgc tggacgtggt cggcctgaac ccggagtaca tcaaccgcta cccccaccag    198840
     ttctccggcg gccagcgcca gcgcatcggc atcgcgcggg gcctggcgct gcgcccggag    198900
     atcatcgtcg ccgacgaacc ggtctcggcc ctcgacgtgt cggtccaggc ccaggtgatc    198960
     aacctgatgg cccggctcca ggacgagttc gacctctcgt acatcttcat cgcccacgac    199020
     ctgtcgatcg tccggcacat ctcggaccgg gtcggcgtga tgtacctggg ccgcatcgtc    199080
     gagaccggcc gggacgagga gatctacgac caccccacgc atccctacac ccaggcgctg    199140
     ctgtccgccg taccggtgcc cgacccggag gcccgggaac accgcgagcg gatcatcctg    199200
     tccggcgacg tgccgtcccc gaccaacatc ccctcggggt gccgcttccg cacccgctgc    199260
     tggaaggcgc gggagcggtg cgcgctggag gtaccggccc tggccgttcc cgccgagttc    199320
     cgctcggtct ccgggcccgc ggcgcacgac tccgcctgcc acttcgcgga ggagaagcag    199380
     gtggtgccgc ccgagggcga gggcgagggc gagggcagcg ggccggggtg acatggtccc    199440
     cggcccgctt acggcacccg cacggccgta cgccgatcag cgtcgcgggc ccgtgtgtcg    199500
     ggaccgcttc gccgaagtta cccgcgtgtc aaaggcgttg gcgtacgggt gacgcggcgg    199560
     gcatcacgcc ggggcgggca gcgaccgctt gaggaagtcc acctggagcc gcagcaggtt    199620
     ctcggcgacc gactcctgcg gagtcatgtg ggtgacgccg gacaggggca gcacctcgtg    199680
     cgggcggccg gccgccagca gggccgagga caggcgcagc gagtgggcga ccaccacgtt    199740
     gtcgtccgcg aggccgtgga tgaccatcat gggccggtgc ggctcggcgg cgtcgaccag    199800
     tccggcgtcg tcgatcaccg agttgcggcg gtagacgtcc ggctgctcac cggggtcgcc    199860
     gaggtaccgc tcctggtagt gggtgtcgta gagcctgagg tcggtgaccg gggcgcccac    199920
     gacggcggcg tggaagacgt ccggccggcg cagcgccgcg agggcggcga gatagccgcc    199980
     gaaggaccac ccccggacgg cgacgcggtc caggtccagc gggaagtcgg cggcgagggc    200040
     gtgcagcgcg tcgacctggt cctggagcac cacagcggcc acgtcgtcct tgacggcctt    200100
     ctcccaggcg ggggagcgcc ccggagtgcc ccgcccgtcg gcgacgacca ccgcgaaccc    200160
     ctggtccgcg aaccactgcg aggtgaggtg ggcgttgtgc gcggccacga cgcgctgacc    200220
     gtgcggacca ccgtaggggt ccaggaggac cgggaggggg gtgtcaccgt ggtagtccgt    200280
     tggcataagc acggcgcacg ggacgcgtcg tgcgcccccc tgggtgaggg tcacgcgcgg    200340
     ggacaaaccg gggtcttccg catacgaggc gatggtcgcc gcggccttcc cgtcccgcag    200400
     tacccgtact cgggctcccg gccggtcgag ggtcgcggag acgagcaccg tcacgccccc    200460
     ggcgcgtacc gccgagtgca caccgggctc ctgcgacagg cgttcgacgc ccagttcgtt    200520
     cacccggtag acgtgcacct cgccgatctc cgcctcggcc gcctcctcgc ccgccgaggc    200580
     ggagaccagc acgtcgtcgg cgccgacgtc cagcaccgcc cgcaggtgca actgggcccc    200640
     ggtgagcagt cgttcgccca ccgcgagcac ccgcgcaccg ccctcgtcgg cgatccgcac    200700
     gagttggccc gaggggctcc agtagggcac cccggggaag agttccagcc aaattggatc    200760
     ttcgtcggcg tgcaccatcc gggtcgtccc cgactcggtg tccaccgcca ggaacagctg    200820
     gctgcgctgg tcgcgcgcct gtacgagaag cagcggcgca cccgcggctg accagtgcac    200880
     tcgcgccaga tacggatacc gcgcccggtc ccacaggacc tccgtgcgcc ccccgtcgag    200940
     accgaccacg aacagccgta cgtccgcgtt gggggtgccc gccgccgggt acggcacgtg    201000
     ttgtggatca cgcccgggat gggccgggtc ggagatccac cagcgctgga ccggcgtgtc    201060
     gtccacgcgg gcgaccagca ggcggtccga ctccgggctc caccagaagc cccggctgcg    201120
     cgacatctcc tcggccgcca cgaactcggc gagcccgtac gtgacgccct cgccgtccgc    201180
     ctcggccagg gccctgtccc cgtccccctc ggcgcccacc acgcgcaggg cgccctgggc    201240
     gacgtaggcg acgtgccggc cgtcggggga ggggcgcggg tcgatcaccg gcccgggggt    201300
     gggcagttcg cgcgcggtgc cgacctgcag ctcggccacg aagagccgcc ctgacaaggc    201360
     gaaagaggcc agctcgaccg acgagtcggt ggcgtagccg acgatcccgg cgccgccctc    201420
     gcggctgcgc tcgcgccggg cccgttcctc gggggacagc cgttcctgag cgccgcccag    201480
     aagggcgcgg gggtcggcgg ccatgcgctc cccgcccttc tcggcgtcga gcacccacag    201540
     cgaattggcc cggtccgtac cggtaccgga gcgcaggaag gcgacccgtg aaccatcggg    201600
     tgccacggtg aacgaacgcg gcgcgccgag cgtgaaccgc tgggtgcggg cgtgccgttt    201660
     ggggaaggag tcggactcgg tcgtcatgcc ttgaccatat tggccatgcg cccccttgtg    201720
     cggccgtgcg ccgagagatg cgcgcgcacg gatagttatg atcactagcg catagtgggt    201780
     atcaaccagg tgcccgctgc gtggatttat ctgctccgag ctccgactgc gaccgacccc    201840
     ccatgtccct gggcccattg gaggtgagcc gccgtggcac tctcgatttc ggcggttgtg    201900
     ctgctggcga tcatcgtctt cctgctggtc aagaagtcag gcttgaaggc ggggcatgcg    201960
     gtggtgtgca tgctcctcgg cttctacctg gcctcgtcga cgatcgcccc cacgatcagc    202020
     gagctgacga ccaacatcgc ggggatgatc ggagacatca acttctgacc gtgccggcca    202080
     cgaagcagcc ccaggcctcc ggcgccagcg cgagccgggg gccggtgtcc ggcaggttct    202140
     tcgagtcgcg gacgtggacg gtgccggggg cgagggcgac ctcgacgcag gagtccgttt    202200
     ccccaccgct gctgtagctg ctcttggacc acaccagtcc tgtggacgag gacgtgcgga    202260
     tcatgtctcc cccagcagtt gctcgatgaa ggcggccgac tcacacgggg tgagggcctg    202320
     cgcccggatg atgccatacc gtagttcgag gatacggacc tgcctgaggt cggtcaccgg    202380
     gcggccgttg gcaacacccg gcgagcgacc gaccgccgtg ccgtcctcga acttcaggac    202440
     ctcgatggca ccgtccaccc cggcgtgctc ctcgcggtcc atcggcatca cctggatctc    202500
     gacgttcggc agtcgcccga gcatcagcag gtgttccagt tgccgtcgta ccacgtccgt    202560
     tcccccgagc cgccgtcgga gcgtccactc gtcctgcacg aaaccgagtt caggcgccgg    202620
     gtcgcgctcg aagacggctt tgcgagctgt acgcgcagcc acgccccgct cgatctcgtc    202680
     ctccgcgtaa cgaggtcgtc gcatgcgaaa cagtgctcgg gcgtagtcgg gcgtctgcag    202740
     gagtccgtga acgttcaccg ggtcgtacag ctggagctcc accgcccgcg cctccatctg    202800
     cgcgagatcc cgcaccttct tcgggtaccg gaccttcttc acgtcctcct tcatggccgc    202860
     gacgagccca ccggcggtca gcacctcgtc cgccctgtcc aggtactcgg ggcgcgggat    202920
     ccgcctgccg ccctcgacct tgtacacgag gtcctccccg tacccgatcg ccaccgcgaa    202980
     gtcgggagcc cgcatccccg ccgcctcccg gcgcagccgg agctgccgcc ccaccgtggc    203040
     gatcacggcc agggcccagt cgtcgtccgg atccacctcc caccccggtt cgtcgacctg    203100
     gtccgtcccg gcgtccaccg acatgtcgca cccctccttg gtcccgcctc gcacggccgt    203160
     gccctacccg gaacaacgcc gacgacagtg ccgacggcac tggacaggcc ctggacagtt    203220
     ccgtacgccc cgtgcgggcg tgaggacggg ggccgggcct catagggtgg accccatgac    203280
     ggatctcccc ggccggcgtc tgctgctggt gcacgcgcac ccggacgacg agtcgatcaa    203340
     caacggcgtc accatggccc gctacgcggc cgagggcgcc cacgtgacgc tggtgacctg    203400
     caccctgggc gagcgcggcg aggtcattcc gcccgcgctc gcccacctgt ccggagccgc    203460
     tctgggcggg caccgcaggg gcgagctggc ggacgcgatg cgcgcactcg gcgtcgacga    203520
     cttccggctg ctcggcgggc cggggcggta cgccgactcc gggatgctgg ggctgtccga    203580
     caacgacgac cccggctgcc tgtggcaggc ggacgtcgac gcggccgcgg ccctgctcgt    203640
     cgacgtgatc cgcgaggtgc gcccacaggt gctcgtcacc tacgacccga acggcggcta    203700
     cggccacccc gaccacatcc aggcccaccg catcgccatg cgggcggcgg agctggcggc    203760
     cgaggccggg tgtccggtcg cgaaggtcta ctggaaccgc gtgccgcgct cccgggtgga    203820
     ggacgccttc gcccggctcc gggacgacct gcccggactg ccgttcgaga aggcggccgg    203880
     cgtcgaggac gtgccgggcg tcgtcgacga cgagcggatc accaccgaga tccgcggcga    203940
     gggcaccgcg tacgccgccg ccaaggccgc cgcgatgcgc gcgcacgcca cccagatcac    204000
     ggtcgccgaa ccgtatttcg tcctctccaa cgacctggcc cagccgatcc tcaccaccga    204060
     gtactacgag ctggtgcgcg gcgagcgggg cggcgagggg cgtgagaacg acctgttcgc    204120
     gggcatcgcc ggaaccttcg acaccgggga ggcgacctcg tgaacggccg caacgaaccg    204180
     ccgagctccg cactcgccca gccgctgcgc ccgccctcgc tcggacgggc cgccctgtac    204240
     gccgggctct tcgtgctcgg cgccgtcctc ggagtggcgg gtgcgctgct ccagccggcc    204300
     tggttcccgg gcgggctgct gctcgcgctg gccgccgagg cggggctgtg tgccggggcg    204360
     ggccgtgccg tcgggcgccg gggaggggcc gtcgcgcccg ccctcggctg ggcgctcgcc    204420
     gtggtgctgc tcaccaccag ccgtccggag ggcgacttcc tcttcgccgc cggtgccggc    204480
     tcctatctct tcctgctcgg cgggatcgcc gttgctgtga tctgtgccac cctcgcgccg    204540
     gtgcggcaac cggacggcgg ccccgcccga cttcgcaagt gacgtaccgc ttcgccgtgc    204600
     cgtgggcgtg cgagtcccgt gtgggtttcc acggcggtca cgggatacgc gcgagaagtg    204660
     gccagtatgg tggtgcgcgc cgccgagccg cccgctgaag gcgtgacggg cggcggagcc    204720
     aaccgggaga acctgccttg agtcgtgaaa ctgacagttc gtcctccggg ccccacgggc    204780
     gcggcggagc cgcatacccg tcgggcaccc cgccctacgg gacacccacg gcttccgacg    204840
     ccggtgcgga cgcgggccgt tcggccacgc gaccggagga gcgcaagacc gagacgacgc    204900
     tgacgacccg gatccggatc aacatccccg ggtcgcggcc catcccgccg gtcgtcgtgc    204960
     gcaagcccgt cgcggacggt gaggacaccg ccgacagcac ggagacgacg ggcgagcggc    205020
     ccgcgccggc gcccagcgcc gccgcgcccg gggccgccgc tcccgaggct cccgccgagt    205080
     ccgcgcagtc cgcccagtcc gccgaggaga agccgacgag cgactggttc gcgccacgca    205140
     agtcgggtcc gggcaaaggc actcagggcg gcggttccac caacggtgcc ggtctgcccg    205200
     caggttcggc gcccaccgcc ggaaccccgg gtgcggcggg ggcgcgtggc gcgggtcccg    205260
     cgggtgcttc gggtgccggt gcgcggccgg gcggcgggag tggccgtccc ggtggcgttg    205320
     tcggttccat gaacgcaccc ggcggcgccc ggtccggatc cgcgggcggc ggcgcccgct    205380
     ccggtgcgac cggcggaccc gtggcgcccg gtcacggtgg tggtaccggt tccttcgacg    205440
     tgaccgaggc gctggcggcc ggtccgctgg gcggcaacgg caacggcaac ggcaacggca    205500
     acggcagtgg cccccggccc ggcaccgacg ccggtggcga gccgcgccgt gacgacctgc    205560
     cgtacttcgc gggggagggt cgggccgacc aggcccccgg cgggcagcag aacggcctga    205620
     acgggcagtc cccgtacggc accgggcccc agggccccgc ggggccgacg agcggcccgg    205680
     ccaccggcga cagccggctg acgccgcccc cggccggcga cctcggcggc ctcggaacgg    205740
     ccggcggccc cgcggcgccc ggcacgcagc gcgagcccgc accgaacggc ctgcgcggcc    205800
     cggggagcct tggtggcccc ggtggccccg gtggccccgg caggccggcg ggctccggtc    205860
     cggacgccgc ccgcctcggt cccggcggcg ggctcagcga cgacaccgcg atcctcaccc    205920
     cgcagcggcc ggtcccgccc ggcgcggcca acccggacaa catctccggc aacaccgtca    205980
     ccagcggcat ccccgtcgtg ccgggcgagc gcaccgcgcc cttcccggcc ggttcgggcg    206040
     acggaccgcg cccgcacacg ccgcccaagc tgcccgagcc ggtctccgcc ccgccggcga    206100
     gctccgccaa gcccgccaag aagaaggggc gcaggaagct cccgctgctc gtcgtcggcg    206160
     tggtcgtcgt cgccggtgtc acctacggcg ccggcctgct catgaaccgc tccgacgtac    206220
     ccaagggcac caccgtgctc ggcgtcgaca tcggcggcgg cacccgcgac gacgccgtcg    206280
     agaagctgga caaggcgctc ggcgcccgcg cggccaagcc gctcaagctc accgtgggcg    206340
     gtgacaccgt ctccctgaag cccgaccagg cgggactcca gctcgacacg cagaccacgg    206400
     ccagctccgc ggcgacgagc gactacaacc cgatgtccgt gatcggctcg ctcttcggcc    206460
     agaagcgggt cgtcgaaccg gccatgcccg tcgacgagga gaagctgcac gccgccctgg    206520
     aggacgccgc cggcggggcc gggtcggcga ccgagggctc gatcaggttc gagtccggca    206580
     aggccgtccc cgtgtacggc aaggccggcc agggcataga cgtcgccaag tcgaccgagg    206640
     ccgtgcaggc cgcctaccgc gcccaggtgg agaccggcac cgccaccgcg gtgaacgtgc    206700
     cgacgaccgc caagcagccc acggtcgcca aggccgaggt cgaccggatg ctgaaggagt    206760
     tcgcggaacc ggcgatgtcg gccagggtga ccgtgcagac cgacgccgcc cactccatcc    206820
     agttcagccc cgagaaatcc ctgtggaagt tcctcagggt cacggccgtc gacggcaagc    206880
     tcgtcgacaa gcccgacctg aacgccctca aggagctcta cggccagacc ttcgacggag    206940
     tactcatcgc ccgggccaac ggcgagaaga cggccgtgac cccgcaggac gtctacggcg    207000
     ccatgcgcca ggccctgaag agcaagaccg accgggtggc cgtcatcgac accaacccca    207060
     gctgacgcgg gcacaggagc gaggggcgcc cggcagcagc ggggcgcccc tcgcgtcgca    207120
     ccgggcgccg cgcaccgtat gacatctgtc atccggcacc cgggaccgcc gacactgccg    207180
     ggcgccctct ccccgcggcc acgatggggg catgacgagg acaacggcgg tcggcttcga    207240
     ccgggtgacc aaggggtacg gcgacgtccg ggccgtcgac ggcctgacgc tcgcgctgca    207300
     ccccggcgag accgtggccc tgctgggccc gaacggagcg ggcaagtcga ccacgctcga    207360
     cctgctgctc ggcctgaggc gccccgacgc cggcaccgtt cacgtcttcg gcggcgaacc    207420
     gcgcgaggcc gtcgtcgccg gacgggtggg tgccatgctc cagagcggcg gcctgatgga    207480
     cgaggtcacg gtcgccgaac tcgtccggct gggctgcgcg ctgcacccca gggcctaccc    207540
     ggccgccgac gtgctggccc gggccggact cacgaagatc gccgaccgcc gggtcgacaa    207600
     gctctccggc ggccaggccc agagggttcg cttcgcactc gccaccgccg gcgacagtga    207660
     cctgatcgtc ctggacgagc ccaccaccgg catggacgtc accgcccgcc aggccttctg    207720
     ggccaccatg cgcgaacagg ccgaccaggg ccgcaccgtg ctgttcgcca cgcactacct    207780
     ggaggaggcc gacgccatcg ccgaccgggt gctcgtcctg caccggggca ggctgctggc    207840
     cgacggcacg gccgccgaga tcaaggccag ggccggaacc cgccggatct ccttcgacct    207900
     ggacggcggc ccggacgcaa gcccggacgc aagcccggac ggcagccgga acggcaccgt    207960
     cgacgaggcg acgctgcgcg cgctgccgca cctgaccgcc ctcgacgtgt ccggccggac    208020
     cgtgcgcatc cagtccgccg acgccgacgc caccgtgtac gccctgtacg gcctcggcct    208080
     gtacccccgc aacctcgaag tcgccggcct cggactcgag caggccttcg tcgccctcac    208140
     cgccgccgag gaggccaagc agccgtgaac ggcctgatca agctcgaact gacccgggca    208200
     ctgcgcaacc gaaagttcct gttcttctcg gtgatctacc cctcggccct gttcctgctc    208260
     atcgcgggca gtgccgacgc caccagcgag gtcgacggca ccggactgac cctgcccacc    208320
     ttcttcatgg tctccatggc ctccttcggt gccctgaccg ccgtgctcat gggcaacagc    208380
     gaacgcatcg ccaaggagcg cgagagcggc tgggtccggc agctgcggct caccgccctg    208440
     cccggccgcg gctacgtcct cgccaagacc gcgagcgccg ccgtcgtcag cctgccttcc    208500
     gtcgtggtcg tcttcgtcgt cgccgcggcc gtgaaggacg tacgccttca cgcctggcag    208560
     tggctcgccc tcaccggcgt gatctgggcc ggcagcctgg tcttcgccgc gctcggcgtc    208620
     gccatcgggt acctggccac cggggacgcg gtccgcccga tcacgatgat cgtgtacttc    208680
     gggctctcca tgctcggcgg cctgtggatg cccaccacca ccttcccgca gtggctgcgg    208740
     gacgtcgccg agtggctgcc cacacacgcg tacgctgccc tcgggcagtc gatcgaacag    208800
     agtcacgccc cgcacgcaca ggacctcgcc gtcctcgccg tctacttcgt gctcttcgcg    208860
     ggcggcgcgg cctggctgta ccggaaggac acgctgaagg cgtgagcggc gtcggaatcg    208920
     ggcaacgccc ggagaaccgc aggcagaaga ccgtcaaggt catgtggacc gccatctggc    208980
     tggcctacct gggcgccccc gtcagcgacc tgctgcacgg cggtcacgcc gtcggtgtcc    209040
     aggtcctcgg ctggatcggc ctcgtcgcct tcgtggtctg gtacatgctg ctgctcttcc    209100
     gcaccggccg cggcgagcgg acccggctgg tcctcggctc cctcgccgtc ctcgcggccg    209160
     agtccacgct cctcgccctc accctgggcc gcgagtggct ggtcctcttc gtctacgtgg    209220
     cgatcgcctc cggtgccgcg ctgccgctgc gcctggcccg ctggaccatc ccgggcgcct    209280
     cggcgctgct gacggcgatg gccctcgtgg tgcccggcgg gacctccttc atcgccgggc    209340
     tgctgctccc ggcgctgctg ggcggcttcg ccatgaccgg cgtgcgcgag ctggtccgga    209400
     ccaccatcgc gctgcgcgag gcccgcgcca ccgtcgccca gctcgccgcc aacgaggaac    209460
     gcctgcgcct cgcccgcgac ctgcacgacc tgctcggcca ctcgctctcc ctgatcaccc    209520
     tgaagagcga gctggcgggc cgcatgctcc ccgcccaccc cgacaaggcc gcccagcagg    209580
     tcgccgacat cgaacaggtc agccgccagg ccctcgtcga cgtgcgcgaa gccgtcaccg    209640
     gctaccgccg ggcccgcctg gcccccgaac tcgccggtgc gaaggtcgcg ttgacggcgg    209700
     ccggcgtgga cgccgaactc cccggcgaac cggaccccgc ccatctgccc gaggactccg    209760
     aggcggccct cgcctgggcg ctgcgcgagg cggtcaccaa cgtcgtacgg cacagcggcg    209820
     cccggcgctg cgtggtggag ctgctggagc gccagacgct ggacggagcg gtgctggaac    209880
     tgtcggtgga ggacaacggc tccggcggcc ccgcctccgc gaacgccccg ggcaacggcc    209940
     tcaccggcct cgccgaacgt ctggagaagg cgggcggcac actggaggcg ggcgggtccc    210000
     gccggggatt ccggctggtc gcccgcgtcc cggtgggcgc ggccaccgac gtaggatccg    210060
     gggcatgagc cgcacgatca aggtcctgct ggccgaggac caggcgatgg tccgcgaggc    210120
     actggccgcc ctgctcggcc tggaggagga catcgaggtc gtcgcccagg tggcgcgcgg    210180
     cgacgaggtg ctggacgccg cccgcgccca cggcgtggac gtggccctgc tggacataga    210240
     gatgcccggc gcgaccggca tcgaggcggc cgccctggtc caccgggaac tgccggccgt    210300
     gaagctggtc gtcctcacca ccttcggccg ccccggctac ctgcgcagcg cgatggagtc    210360
     cggcgccgac gccttcctgg tcaaggacgc cccggccgcc cagctcgccg aagcggtccg    210420
     cagggtgctg gcgggggagc gggtcatcga cccgaccctg gcggcagcgg ccctcgccga    210480
     gggcgccaac cccctcaccg accgcgaacg cgagatcctc cgcgccgccg ccgacggctc    210540
     caccaacgcc gaactcgcca gcgccctcca cctctcccag ggcacggtcc gcaactacct    210600
     gtccacggcc atccagaaac tggccgtgag aaaccgcgcg gaggcggtcc gggtggccag    210660
     gaacaagggc tggctgtagc ggaagccgtc cccgccggcg cacccccgcc gccctccaca    210720
     gcgcgcgcag tcgaaggcac cccgttggcg ccgggccgcg caccccccgg tcccgcaccc    210780
     accgacgctc agttcaacat cgcccgagcc gtccgcgcct ccccccgcac ctcctcggcg    210840
     accgcctcgt ccaccgcctc caccacctcc gcgtacgcct ccaactcccc ggcccccgcc    210900
     gcgaactccc cccgctgtac caacaacacc gcccgctcgt accgcaaccg cgccgcatgc    210960
     gccggcagca gcagcgccag ctcgaccgcc cacagcccca ccgccgactg ctccggccgc    211020
     gccgccgccc acgcccggat gttgttcagc acccgtgcca ccacgtccaa cggcgccgcc    211080
     ggctccagca tcgacgcccg cagctccgcc cccgtcgccc cggcgaccag cgcctccgcg    211140
     tccgtaccgc tcagcagccg ccccccgtcg tacggatcga cgagcacccg ctcgcccaac    211200
     ggcgcggacc cggggccgga cgccgctgcc gactcgcccc cgaacccgac cacgaagtgc    211260
     cccggcaacg cgaccccgta caccggcgcc cccgcccgcc gggccacctc cagccacacc    211320
     accgacagca ggatcggcag cccgcgccgc cggcgcacca cctcgtgcag caacgacgac    211380
     tccagccgct ggtagtccgc ggcgaccccg tggaatccgt accgctcgcc gagcaggtcc    211440
     cgcagcgcca ccgcccaggc ccgcggcgta cccggccgga acggcagctc tccggccagc    211500
     cggtccagtt ccacctgcgc ggcgtccagc cccgcctcgt ccagcgtccc gtccgcctcc    211560
     gcgcccacca gcaggcacag cgtggccagg tcggggcgct cggaccgcgc ctcttgcgcg    211620
     aaccgccgcc gcagttcggc cgaccgctgc ggcgacgggg gacggggagg acgaggagga    211680
     cgcatggcag gctcgtgccc tttcggagtg atgtctcggc ggcggtctac cggtcggtcc    211740
     cggcggccgc gggctcccgg tagtggtggt aggagtggtg cgccgcgaag cccatcccgg    211800
     cgtacagcgc ccgggccccg gcgttgtcgg tctccacctg gagccacgcc gccgacgccc    211860
     cctcgtccag cgcccgccgg gccagtgcgg ccatcacggc ggtcgcgagc ccccggcgcc    211920
     gctgcgcggg atcgacctcg acggccgcga aggaggccca ccgcccgtcc acgacacacc    211980
     gtccgatggc cgccacgccg cccccgccgc ccgcgccgtc ggcgccctcc gcgccgggca    212040
     ccgtggcgaa ccacaccgac ggcccggact ccaggactcg cagcgccacc tcgctcaccc    212100
     ccttgcgctg gtaccgggcg agccaggttt cgtccgcctc ccgggacagg accacaccgg    212160
     tgtccccggc caggtcggcg accggcgcca gtggcccggt ccacacctcg gccgtcacct    212220
     cccggaccca gccccgccgc tccagctccg cgcacagcag ctcctgcgta ccggcggcgc    212280
     cggtggcggt ctggacgtac gcgggcagcc cgcgtacgcc gtaccagcgg cgtacggccg    212340
     tcagcgcctc gtcgagcggc agccccggat cgccgagcgg cagcacggag ttggcccgcc    212400
     gggtgaagcc cccggccgcc cgcagctccc aggcgccgag ccgctcgctc tccaccgggc    212460
     gccaggaccg cgcggcgacg cgcgccagct cctcgtagga cgcggcggga ccgcgacggc    212520
     gggcgggggc gggcggcacg accttcccgg cgaccagggc ggactccgcg acacggacgg    212580
     actcgccact ctttcgtgtg atcagcagca caccgtcggt ccatgatgtg agaacgccga    212640
     ccgtgtcggt gaacttctca cctgcggcac cagcttcgct caagcgccgt acggagactc    212700
     gtttgcccac gtcagcagtg gtgatacgga cctcaagacg cccggcggca gagaattcca    212760
     cgggtctgtc cacccctcct gttcggatca tgcccaagaa cggagatact aggggcgggc    212820
     atcgacgacg ccgcgctccc gcgcgccagg cggcggagcc tacggaggcc cgccagcgcc    212880
     ctatcgagga ggaacgacag cgtgacctac gtcatcgcgc agccttgtgt cgacgtgaag    212940
     gacaaggcgt gcatcgagga gtgcccggtc gactgcatct acgagggcca gcggtccttg    213000
     tacatccacc cggacgaatg cgtcgactgt ggtgcctgtg agccggtctg cccggtcgag    213060
     gcgatcttct acgaggacga cactcccgag gagtggaagg actactacaa ggcgaacgtc    213120
     gagttcttcg acgagctcgg ctcgcccggc ggcgccagca agctggggct gatcgagcgc    213180
     gaccacccct tcgtcgccgc gctgccgccg cagaaccagt aagagcggcc cgcacacgcg    213240
     ccgcctcggt cccgtacggc ctgatcaccc cgatcggcgc cgcacgggac cgaggcgttt    213300
     gccgtaccgg cgccgacgag gaaagggagc cacccaccgt gtccgcagtc tccgaccgac    213360
     ttcccacctt cccctgggac aagctggagc cgtacaagaa gacggccgca gcgcaccccg    213420
     gcggcatcgt cgacctctcc gtcggcaccc cggtcgaccc ggtccccgag ctgatccaga    213480
     aggccctggt cgacgcggcg gactccccgg gctacccgac cgtctggggc accccggcgc    213540
     tgcgcgacgc catcaccggc tgggtggagc gccgcctcgg cgcccgcgac gtcacccacc    213600
     gccacgtgct gcccgtcgtc ggctccaagg aactcgtcgc ctggctcccg acccagctgg    213660
     gcctcggccc cggcgaccgg gtggccttcc cgcgcctggc ctacccgacg tacgaggtcg    213720
     gcgcccgcct ggcccgtgcg gagtacgagg cgtacgagga cccgaccgag ctggacccgg    213780
     cgggactgaa gctcctgtgg ctcaactccc cgtcgaaccc gacgggcaag gtcctgtcca    213840
     aggccgacct gacccggatc gtcgcctggg cccgcgagca cggcgtcctc gtcgtctccg    213900
     acgagtgcta cctggagctg ggctgggagg ccgacccggt ctcggtcctg cacccggacg    213960
     tcaacggcgg ctcctacgac ggcctggtcg ccgtccactc cctctccaag cgctccaacc    214020
     tcgcgggcta ccgcgcggcc ttcctggccg gtgacccggc ggtcctgggc ccgctcctgg    214080
     agatccgcaa gcacggcggc atgatgaccc cggcgccgac ccaggccgcc gtggtggcgg    214140
     ccctcggcga cgacgagcac gtccgcgtcc agcgcgagcg ctacgccgcc cgccgcacgg    214200
     tcctgcgcga ggccctgctg ggcgccggct tccgcatcga gcacagcgag gccagcctct    214260
     acctctgggc cacccgcggc gagtcgtgct gggagacggt cgcccacctg gccgaacgcg    214320
     gcatcctggt ggccccgggc gacttctacg gcccggcggg cgcacacttc gtccgcgtag    214380
     ccctgacggc aacggacgac cgcgtccagg cagcggcgga ccgcctgagg tcctgaggcc    214440
     ctgaggggct gagggccttg gccccgctgt gggcaatcgc tccgcagggc gatgggggca    214500
     ccgcccatgc cctcaaggca atgggggagg gtgggcaccg cccacagcgc cgggccccgg    214560
     ctcaggacac gcccactggc ccggcgtggg caagcagaac gccgggcccc gggaacccca    214620
     ggacccggcg ccgtacagcc cggcgcagcc gacgtcagcc cagcggaagc ccctgcaccg    214680
     gcagcccgcc cttgcccagc gcgtccgtcg gcagcccgcc cttcgtggcg gtcgccgccg    214740
     tgtcacccac gatgtccccg gcggagcccg ccgcgtcccc ggccgcgttc tgcgccgccg    214800
     gcgtggcctt cttgacgacc gatccaccgg tcttgccggc cgtcggcacg gccttcttga    214860
     cggccttgcc gccggtgtcg cccgccgtct cggtggcgct ctcggcggcg gaggcggcgg    214920
     tgttgccgac gttcgccccg tccagggcgg tcagtccccc gaggttcggg gtggccggca    214980
     gttcgggagc cgcgctggcg gagccggccg caccgacccc ggcagccgct cccgcagcga    215040
     cgagcagcgc ggcacgggcg atccggcggg tcagggggag ggacatgatg ctccttgggc    215100
     gtaagtcgac agcaacgatg gaaaatccga ccgggcccgg agggcgaccg gagagtggcc    215160
     gaccgggctc ggacgcagtg actaccgctc gagagccacg aaggttgcgg cgacccaacg    215220
     taaagagttg gtaatgcgtc gcattatcag gtgcacagaa aaacgggcaa aagggcgccg    215280
     gtcggaaagt ctgctgaatc cttacggccc ttgattttcc tgggccgcga cgcgttcggg    215340
     ggtgagggtg cgaaaacccg tgctccgcgt cgacttcgcg ccgacgcggg tcactcgcgg    215400
     agatgacgct tcgtacgggc gcgctaccgg gcggacgtga tccgcaccgc ttccgccgcc    215460
     cgctccgcgc ccttggcgcc ctcggtgccc gtcgggtacc acttgctgtc ggtgttgccc    215520
     gcggtccact cccggcccgc gtaggtgacc cgttggatgt gcagcgagga ggcgttggcc    215580
     accgcccagt gcgccaactg ccagccgcgc cgcacgtgct cccgggccgg gccggaaccg    215640
     gtggagccgg tcaccggcag tgtcacggtc cgctcgtcgg aaccggtcgc gggccgccgg    215700
     gacgcggcgt cgccgcccac ctccgcgccg gccggtcgca gcacgtcgtg cccgaagtcc    215760
     cgcaccagcg ccgcgcggac cgcgtccggc cccttctccg gggtcgcgcc ggggcgcccg    215820
     acgcaggtca gcgtggccgc cgaccgtccg gtgagcgcgg cggcgagcaa ctcggcgtcc    215880
     ggttcgtgct tggcataggc gtcggggaag gcgctgcgct gcacccgctg ggcggcgtcg    215940
     gtcagcggca ggtccaggta gccgggcacc tcgaccaggt ggtcgtagaa caggcccgcc    216000
     gagtacgccg ggtccatgat ctcctcgggc ttgccccagc cctgcgaggg ccgctgctgg    216060
     aacaggccga gcgagtcctt gtcaccgtgg tccagattgc gcagcgccga ctcctgcagc    216120
     gcggccgcca gcgcgatcgt cacggcccgg tcgggcagct tgcgggcggt gcccaccgcg    216180
     gtgatcgtgg ccgcgttcac cgcctgctcc ggcgtgaact cgtaggtcgt ccggccgccc    216240
     ttgccgccgg ccaccttgca ccccggagcg aacgcgcctc cggtgacata ctgcaccgcc    216300
     agataaccgg cgaccgcgag caggaccatg gaggcggcgc ccgaacgggc gaggcggcca    216360
     cggcgtttgc gaggtgggga cggctggagc acgcgtacaa ggtactggag ggtagggtcc    216420
     ggtgtccgcc gggtgcgcac cttgcccgaa agggcagggc gctagggtcg ggcccatggc    216480
     cgataccccg cttgacctca cgctggacgc cgcggagctt accgcgcggc tcgtcgactt    216540
     cccgtccgag agcggcaccg agaagcccct ggcggacgcg atcgagagcg ccctgcggac    216600
     cctgccccac ctgtcggtcg agcggtacgg caacaacctc gtcgcgcgca ccggcctggg    216660
     ccgcgcggag cgcgtgatcc tggcgggcca catcgacacc gtgccgatcg ccggcaacgt    216720
     cccgtcccgg ctggacgagg acggcgtcct gtgggggtgc ggcacctgcg acatgaaggc    216780
     gggcgtcgcg gtccagctgc gcatcgcggc caccgtcccc gcccccaacc gcgacctgac    216840
     cttcgtcttc tacgacaacg aggaggtcgc cgccgagctg aacggcctga agcacgtcgc    216900
     cgaggcgcac cccgagtggc tggagggcga cttcgcggtg ctcctcgaac cgtccgacgg    216960
     ccaggtggag ggcggctgcc agggcaccct gcgggtgctg ctgaagaccg cgggggagcg    217020
     ggcgcactcg gcgcgctcct ggatgggctc caacgccatc cacgccgccg ccccgatcct    217080
     cgcgcgcctc gcggcgtacg agccccgcta cccggtcatc gacggcctgg agtaccgcga    217140
     gggcctcaac gcggtcggca tcacgggcgg cgtggccggc aacgtcatcc ccgacgagtg    217200
     cgtggtcacc gtcaacttcc gctacgcccc ggaccgcagt cccgaggagg ccctggccca    217260
     cgtgcgcgag gtcttcgacg gctgcggggt gacggacttc gtggtcgacg accacagcgg    217320
     cgcggccctg cccggcctgt cccacccggc cgcggcggcc ttcatcgagg cggtgggcgg    217380
     caccccgcag ccgaagtacg gctggacgga cgtgtcccgc ttctcggcgc tcggcgtccc    217440
     ggcggtcaac tacggccccg gcaacccgca cttggcgcac aagcgcgacg agcgggtcga    217500
     ggtggcgaag atcctcgcgg gggaggagcg cctgcgctcc tggctgacgg catgatccac    217560
     ggcagccgcg gcgggtttat gtcgctgcgt ggcggacatg ctgaggtccc tcgtacgtaa    217620
     cccgcgtaga tctacgctga ggtggaagaa cctgcaactg gagggagcgc gcatggctac    217680
     cggcaacccc gagggcaaga agcggccacc ggaggagcag cgcctgggcc ccgtcctccg    217740
     gcggcggggc caggtgcagg agagcaccac ggaccagcgc ctgctggacg agcgtgctcc    217800
     gacggactgg gtccacaccg acccctggcg ggtgctgcgc atccagtcgg agttcatcga    217860
     gggcttcggc acgctggccg aactgccacc cgccatcagc gtcttcggct ccgcccgcac    217920
     gccggcggac tcaccggagt acgacgccgg cgtacggctg ggccgcgggc tggtggaggc    217980
     gggcttcgcc gtcatcaccg gcggcgggcc cggcgccatg gaggcggcca acaagggcgc    218040
     cctggaggcg aagggcacgt cggtcggcct gggcatcgag ctgcccttcg aacaggggct    218100
     caacccctac gtcgacatcg gcctgaactt ccgctacttc ttcgtccgca agatgatgtt    218160
     cgtgaagtac gcgcagggct tcgtcgtgct gcccggcggc ctcggcaccc tggacgaact    218220
     cttcgaggcc ctcaccctgg tgcagaccca gaaggtgacc cgcttcccca tcgtcctgtt    218280
     cggctcggag tactggggcg gcctggtgga ctggctccgc ggcaccctgg tggcccaggg    218340
     caaggccgcg gagaaggacc tcatgctctt ccacgtcacc gacgacgtgg acgaggcggt    218400
     cgccctggtc tccaaggagg cgggccggta acggccggtc acgggcgggg gcgaggtccc    218460
     gggccggccg cgggcgcgga cggagccgac cgggcctagg gggtgtcgtt tggatcttgc    218520
     cggggtcgcg ggggctggca cgcgcatctg cggcgttgtc gtcggttgcc agggctccgc    218580
     cctgtcgccc tcctccgccc tgccgctgca cgcaccagac cccgctcggg tcggccacaa    218640
     ggcaccgtcg gccgcggccg gcccgatcca aacgacaccc cctaggccag cccccgccgc    218700
     gccaccgccg gctcccggtg cccggcgatc gtcgccacca tgtccagcac ctgccgggtc    218760
     tccgccacct cgtgcacccg gtacaccctg gcgcccagcc acgccgacac cgccgtggtc    218820
     gccagcgtgc cgatcagccg ttccttcacc ggccggtcca gcgtctcccc gacgaagtcc    218880
     ttgttcgaca gggacaccag caccggccac cccgtctcca ccatctcccc gagccgtcgc    218940
     gtcgcctcca ggctgtgccg ggtgttcttc ccgaagtcgt gcccggggtc gatcagcacc    219000
     gactcccgcg gcacccccag ccccaccgcc cgctcggcca gccccagcgt cacccgcagg    219060
     acgtcggcca cgacgtcgtc gtacgtcacc cggtgcggcc gcgtccgtgg ctcggcgccg    219120
     cccgcgtgcg tgcacaccag ccccaccccg taccgggccg cgacctccgc gagcttcggg    219180
     tcgacgccgc cccacgcgtc gttcagcagg tccgccccgg cctcgcagac ggcctcgccg    219240
     acctcgtgcc gccaggtgtc cacgctgatc acgacgtccg ggtgccgacg tcgcacctcc    219300
     gcgacgaacc ccaccgtccg ccgcgcctcc tccgcggccg acacctcgtc cccgggaccg    219360
     gccttcaccc cgccgacgtc gatgatcgcg gcgccctcgg ccaccgcctg ctccacgcgg    219420
     gcgagggcgg gctcgtcgcc gaaggtcgct ccccggtcgt agaaggagtc cggggtacgg    219480
     ttcacgatgg ccatgatcac cggctcgtgc gccgcgaatt cgcgcctgcc cagcctgagc    219540
     atcccctgtg acatctcctg gtccacaccg ttctctcgtg ccgctctcga ccccgggcgg    219600
     gcggaccttc gaccaccgcg gccccgactg tcagactcgc atggcacgat cggacccgac    219660
     acaaccgact ccggcacaac cgacgccgac ccgaccatgg gggcccagcg atggtcatgt    219720
     tcctgttcct cgtcatcgcg ctggccgtcg tggtggccgc ggtgacgctc gccgtggtgg    219780
     gcggcggcga gagcgggccg ctgcccgacg ccgcacccga gcgggtcagg gacgcgctgc    219840
     ccccggaccg tccggtgggc cgcggcgacg tggagcggct gcgcttcccg ctcgtggtcc    219900
     gcggctaccg catggccgac gtcgacgacg ccctcggccg cctcggcgcc gagctggccg    219960
     agcgcgaggc ccggatcgcc gacctggagt ccgcgctggc gggcgcccgg gccgcggcgg    220020
     cccaccgcca cgtcgtcatg gacaagccgg accgggagga gcagcagtga gcgccgggga    220080
     ggccgtcgcg ggcccggacg gcgcgctgcg ctgcccctgg gcgctgtcca ccgcggacta    220140
     cgtcacgtac cacgacgacg agtggggccg cccggtccac ggggacgacg cgctgtacga    220200
     acggctcagc ctggaggcct tccagtccgg cctctcctgg atcaccatcc tgcgccggcg    220260
     taccggcttc cgcagcgcct tcgccggctt cgagatcgcc aaggtcgcgg ccttcaccga    220320
     caccgaccgc gagcgcctgc tcgccgacac cggcatcatc cgcaaccgcg ccaagatcga    220380
     cgcgaccctc accaacgcgc gcgtgctggc cgagtgggcc cccggcgacc tggacgagct    220440
     gatctggtcg cacgccccgg acccggccgg ccgcccggcc ccgaagaccc tcaccgacgt    220500
     cccggccgtg accccggagt ccacggccct gtccaaggcc ctgaagaagc ggggcctgcg    220560
     cttcgtcggc ccgacgacgg cgtatgcgct gatgcaggcg tgcggactgg tcgacgacca    220620
     cctggcggcg tgcgtggccc gcagaccctg aaccgcgggc cccgtcaccg gcggccgaac    220680
     cgcctgcgac cggctcgcag gccgcccgcg gcccgcattc accgggccgc gggttgccgt    220740
     ccccggccgc ccgcggtctt accggcggtc cgccgtcagc cgtcgggctg cttgccgctc    220800
     ggcgtcgggc gtgcgcagtc tgtcggcggg ctgcttgtcg ccgccctcgg cggcccgcgg    220860
     cctgtcaccg gctgctgccg ggccgcgtgg cgtcgtcatg ggccgcccgc ggtctcaccg    220920
     acggtccgcc gtcagctgtc gggtgccgct tgcagcccgg cgtcggtcgt ccgctgtctg    220980
     tcggcggcgg gggcttgtcg ccgtcctcgg cggcccgcgg cctgtcaccg gctgccgggc    221040
     cgcctggcgt cgtcattggc cgccggcggt ctcaccggcg gtccgccgtc agctgtcggg    221100
     ctgcttgccg cccggcgtcg ggcgtgcgca gtctgtcggc gggggcttgt cgccgtcacc    221160
     ggcggcccgt caccgggccg caatcaccgg gccgcccggc gtcgtcaccg gcggcccgcg    221220
     gcctgtcgcc gggccgcctg tcgccggtcg gtgccgcccg tcgccaggag tctgacggcg    221280
     gcgcgtgcct gccggtgttc gcctaccggc ccagatactt cggcttcccc ttctcgacga    221340
     acgcgcgcac cgcgatcgcg tggtcctcgg aggcgcccgc ccgggactga agctcgtcct    221400
     ccttgtccag cgtctcggac agcgagtgcg tcagcccgta cgccatcgcc tccttcagcg    221460
     ccgcgtacgc caccgtcggc ccctcggcca gcgcccgcgc cgtcttctcg gcctcggcgc    221520
     gcaggtcggc ggcggggacg acacgggtgg cgatgcccag ctcgtacgcc tcctgcgcgc    221580
     ggatgctgcg cgggaagagc agcaggtcgg cggcgcggcc ggggccgacg acgcgcggca    221640
     gcgtccagga gatgccggag tccgcggtga gcgccacgcc cgcgaaggac gtgttgaacg    221700
     ccgccgtgtc cgcgacgatc cggtagtccg cggcgagcgc gaaaccgagc cccgcgccgg    221760
     ccgccacgcc gttcacggcg gcgaccaccg gcttctccgc gccggccagc gcccggacga    221820
     tcgggttgta gtgctcgcgc accgtgctca tcgtctgccc cgagcccgtc tcccggtcgg    221880
     cggccagcag cccgatgtgc tccttgaggt cctggccgac acagaacgcc cggtccccgg    221940
     ccgcggtcag cagcaccgcc cgtacggcgt cgtccgccgc cgcggagcgc accgcgtccc    222000
     ggagcgcgac cttggtctcg atgttcagcg cgttcatcgc ctcggggcgg ttcagcgtga    222060
     tcgtcgcgag cccgtcgctc acttcgtaga gcacggtgtc ggccatggag atcccctccg    222120
     cgtcgtggca tgcagtggca tgtgtccggg agacagcatg acggagatca ccgggaacgg    222180
     atcgctcatg aggtgtgacc tgcgtcaaag aaaaccggtc cgtatccatt cggtggaagt    222240
     gcgtgagggc gcgcagtatc gcagtcacat cgccgaattg agtggttttg ctcgcgcgcg    222300
     ttgcccaagc gatgccgacc gatgttggtc atcgggtcct gggatgcggg ataatggctg    222360
     ggaagcaatg tgttcgatgc cggtgtcgcg cgtccaagcc ggactgcgcg tgccctcacg    222420
     ggccgtcggc ggtgacggtg agctggtatc aggaagggga acgagcatgg cggccatgaa    222480
     gccgcggacg ggcgatggcc cgctcgaggt gaccaaggag gggcggggca tcgtcatgcg    222540
     cgttccgctc gaaggcggcg ggcggctcgt cgtcgagctg acccccgatg aggccgacgc    222600
     gctcggcgac gccctcaaga aggtcgtcgg ctgacgcgcg agcgaccata cccgttcagt    222660
     cgccccggta ccgttcgcgg tgccggggtg attgttcttc cacggtcgtt cccggtgcgc    222720
     gggacttttc tccggcgttc caggtcagcg cttcacggcg cacagcagtc cgtcgcccac    222780
     cggcagcagt gacggcacca gctcctggct ctcccgcacc gcgcgcagga gttcccgaac    222840
     ccgcagcacc tcggtgggct gcggtcccga gtcgatcgtg cggccggcac cgaagacgcc    222900
     ctcgaaggcg acgagacctc ccgggcgcag cagacgcaac gattcggcga ggtagtccag    222960
     gtactccagc cggtcgccgt cgcagaagac caggtcgtat ccggcgtccg cgaggcgggg    223020
     cagcacgtcc agggcgcgcc cgggaatgaa ccgggcccgg ttactggcga agcccgcggc    223080
     ccggaaggca tggcgggcga actgctggtg ctcgggctcc gggtcgacgg tggtcagtac    223140
     cccgtccggc cgcatgccgt gcagcagatg gataccggag acgccgcagc cggtgccgat    223200
     ctccgcgacg gccttggcgt ccacggcggc ggcgagcagc cccagggcgg agcccgtgcc    223260
     cggggtcacc gagcgcaggc cggcctcgcg ggcccggtcg cgtgcccaga gcagcgcgtc    223320
     gtcctcggcg acataggcgt cggcgaacgc ccagctcgtc tgccggttgc cggtaatgac    223380
     cctctcctgt ccccgtcgtt gcctcggcgt gactgtatcc gttggcgtcg ggaacccgca    223440
     gatgggacca gtcgtttaaa gggggaagca aagaggcggc gccgagaggc ggtcgagacg    223500
     ggccgggacg agccgtaccg gcccagatca aattctcgta aaaccgctta tccggagcta    223560
     acgggcgagg tggctatggt aggggctcca ctggacacca ccagagccga caggggaggt    223620
     gcggccgcac ccgcggatcg gggtggagtg ctgaggcgct tcctcggatc ggcaggcagg    223680
     ccgaaatccg tgaacgacac cgctgctgac cacagccacg ccgacggtcc caccacggga    223740
     cacgcccata ccgcgacctt ctccagcgac gcggacgggc aggcgtggac tccgcccacc    223800
     tgggaggaga tcgtcagcac ccacagcggc cgggtctacc gcctcgccta ccgcctcacg    223860
     ggcaaccagc acgacgccga ggacctcacc caagaggtct tcgtccgtgt cttccgctcc    223920
     ctgtcgacct acacgccggg caccttcgag ggctggctgc accgcatcac gaccaatctc    223980
     ttcctcgaca tggtgcgccg caagcagcgc atccggttcg acgcgctggg cgacgacgcg    224040
     gccgagcggc tgcccagcag ggagcccacc ccgcagcagc tcttccacga cgcccacttc    224100
     gacgcggacg tccagcaggc gctggacacc ctcgcgcccg agttccgcgc cgccgtcgtc    224160
     ctgtgcgaca tcgaggggct gtcgtacgag gagatcgccg cgaccctggg cgtcaagctg    224220
     ggcacggtgc gctcccgcat ccaccgcggc cgttcccagc tgcgcaaggc gctcgcgcac    224280
     cggtccccga aggcgcgtgc cgaccgtcgc tcgctggcgg ccggtgtgcc cgcactggga    224340
     ggagggggca cgagcgcgtg agtgggtcac ggcctgagcc cgagggacac ctcgcagagc    224400
     agcacctggg agaccgactc tccgccctgg tggacggaga gctcggtcat gacgcgcgcg    224460
     agcgcgtgct ggcgcacgtg gcgacctgcc cgaagtgcaa ggcggaggtc gacgcgcagc    224520
     gccggttgaa gaacgtcttc gcggaagcgg ccccgccggc cccgtccgag agcttcctgg    224580
     cccgcctcca ggggcttccc ggcggcggtg actccgacgg cggcggctcg ccgttcagcg    224640
     ggctgcccgg aggcttcggc gcgtccgcgg catccggtgt cttcggcccg aggcgggacg    224700
     agcggttcga gttcgactac gtccccgccg ggtcgcacac cccggtgctg ccgtccgcca    224760
     cgtcggggcg cggcttccgc atccacgagg tgggcaggca tgagtccgac cgttcggcct    224820
     cccgcggtct gcggttcgcc ttcgccgccg ccggagcggt gtcgctggcc gcgatcgcgc    224880
     tgggcggcgt caccctcggc acaccggaca ccaccaccga ggcacgcggc tcgggcagcg    224940
     gcagcaatgt gacgccgctg cgcaccccgg gctcggccgc ggccaccggt tccgagagcc    225000
     agcgccgccg cacggccggg ccactgctcg ggcaggggca gcgcgcgctc ggtgacctcc    225060
     ccgtcgcgtc caccacggcc tcggcgccac tgctgcccgg gatgccggcc cccgccgggg    225120
     gcgacgcacg gcagcaggcc gtccgggcgc tgaccacccc ggtgacggcc ggtgccgccg    225180
     ccatgtcccc gctgatacgt ccgctggaag ccgttccgcc gctctccctg agctcctggt    225240
     cggcggcgcc agaggtcagg ccgcccggcc tgctcgccgc ccccgacccc gctccgtccc    225300
     cctacccggc ggcttccccg gccgcctcct cctctccgct tcgctgacgg gatctgcgcg    225360
     ccggtccgtg aacctgattg aatccggggt ggcgccggag ttctcggagc cgacgatctg    225420
     cggccagctg cgggggagag catgaacgag gggaagccca cgaaggcgaa gtggtggagt    225480
     cgtccccgct cgtccgagga cgcacccgac ggcgacttcg aactggaacg ccctcgcccg    225540
     gcccccagca cgggcacgga gacggccacc ggcgaccggg cgaccgacgg gggcgacttc    225600
     gagctggccc gcccggcgtc ggcgacctcc cgctcgaccg gagcgggcga ctacgagctg    225660
     gacctgcccc tgcccgagcg ggacgaaccg gcgcccgcgc ccccgcgtcc acgcccggcc    225720
     cgcgaagccg gcgccgcacc ggcggccggt ccggggcagg gagatgccga cgccgccggg    225780
     ctgccggatg ccggtctgcc ccgtcagggg gactgggacc ggcaagccgc cccggcggtg    225840
     gaggcggggt cgcggcccca cgcggggacc ggctccgttc cggccgccga cggcacgtcc    225900
     gacgccgggc ggcccaagcc gctgcacgaa cccgacccgt acagcacccc gccgtacggt    225960
     gagcccggcc cctgggcccc cgcaccgccg gtccagcacc ccgcggccac cccggcgcac    226020
     ggcacggtga cggccgcggg aggggcgctg cacgccccgg tcacgcccgt gacggagggc    226080
     tcgcacgccc acgtgccgca cccgggcgcg tcgtcggtgt ctccgcccgt gggtgcggtg    226140
     cccgaccccg ccttcgcgga cgccgcgccc ccggtgccgc cgacggcgca ggagcagcct    226200
     ccggcgccgg ccgccacccc ggcgtacgac acggcgcccc acgacgcggc cccacccccg    226260
     gccgcgcccg ccgacccgtg ggggcgctac gacccctggg ccgcctccgc gcagcaccac    226320
     gacgctgccg agcgcgcgcc gaagcggcga cgcgggccgc gcgcgaaggc gctcgtcggc    226380
     ggggcgctgc tcatcgccct ggtctccggc ggcatcggcg gcggcgtggg cgcgtacctg    226440
     gaacggaacg gcggcgtggg cactgtggag ctgccccagg ccggacccga ggcggccgag    226500
     cgggacccgg acagcgtcgc gggcatcgcc gcgcgtgccc tacccagcgt ggtgaccctg    226560
     cacgtgagcg gcagcgaggc ggccggcacc ggcaccgggt tcgtgctcga cggccgcggc    226620
     cacatcctga ccaacaacca cgtcgtggag cccgccggct ccggcggcga gatcaccgtg    226680
     accttcaaca gcggcgacac cgccgaggcc gaggtcgtcg gccgggacag cgggtacgac    226740
     ctcgccgtgg tgaaggtcaa gggcgtcacc ggcctcaccc ccatgcccct cggcaactcc    226800
     gacaacgtgc gcgtcggcga ccccgtcgtc gccatcggcg cccccttcga cctggccggc    226860
     accgtcacct ccggcatcat cagcgccaag gaacggccca tcaccgcggg cggcgaggag    226920
     ggcgacggca gcgacatctc gtacgtcgac gccctgcaga ccgacgcgcc catcaacccc    226980
     ggcaactccg gcggccccct cctggacgcg cggggccggg ccatcggcat caactccgcc    227040
     atccgctccg ccgacagcgg cagcaccgag tcggacgacg ggcaggccgg ttccataggc    227100
     ctcggcttcg cgatccccat caaccagggc aagcgcgtcg ccgaggaact gatcaacacc    227160
     ggcaaggccg cccaccccgt catcggcatc accctcgaca tgaactacac gggtgacggc    227220
     gcccgcgtga gtgccaaggg cggcgacggc ggacccgcgg tcaccaccgg cggccccggc    227280
     gcgaaggccg gcatcaagcc cggggacgtg atcaccgcgg tcgacggaca acgcgtgcac    227340
     tccggcgagg aactcatcgt caagacccgc gcccaccgac ccggcgaccg cctggaactg    227400
     accctgcaac gcgacggcaa ggagacgaag gtctcactgg tgctcggctc ctccggcgac    227460
     gactgaccgc cggaaggtcc tgacaaggcg ccaggaaggc aaacaattcg gaaagcgctc    227520
     acgtacaccc actcggggct cacgggacgg taccggtcgg acgggatcgg cgggtaccgt    227580
     ggtggcggcc cggacatccc aaggagcttc aggtgttcaa tgacataggc gcactagagc    227640
     tggtgacgct cgtcgtcctc gccgtgctcg tcttcggtcc ggacaagctc cccaaggtca    227700
     tccaggacgt gacgcgcacc atccggaaga tccgggagtt ctcggacagc gccaagcagg    227760
     acatccgcca ggagctgggc cccgagttca aggacttcga gttcgaggac ctcaacccca    227820
     agaccttcat ccgcaagcag ctggacaacg aagagctggg gctcaaggag atccgcaacg    227880
     gcttcgacct gaagaaggag atggccgagg tcaccgacgc ggtccacggc cgcgacgcgg    227940
     agtcctcgtc ctcggggtcg tcctccggat cgtcgtccgc cgcgtccggc aacggccgcg    228000
     tcgacatgtc gaagaagccc gagaagcccg agaagcccgg gaagaccgac aagcccgccg    228060
     ccgacgaccg cccgcccttc gacatggacg ccacctgacc ccgctcctcc cacgcccggc    228120
     ccgcgggccg ggaacgtgac gtgtctcata ctccggacgg ggcgcacagg ccctgaaggc    228180
     gacgcccgcg cggctcacgc gccgggcgat ttcccggctg ccgccagcgg ggtggctatg    228240
     ctgcccgagt tgttgtgcgg accggacgag tgcgcccgaa ggggggcggg ccgttccggt    228300
     ccgacgagag cgaggaggcg tccgggcaca tggagacgac gagtcgggca gtcgcgcagg    228360
     cgccggccgc ggagggcgga ccacagtccc cctccggccg gcgtacggtc gacggctacc    228420
     tgcgtgcgcc cttcccgtgg tacggcctcg acgaggcctt cacggggcgg cgctggctga    228480
     tgcagatcgg tacggcggcc gacggggccg tggagcacgg ctcgatcggg cacggcgacg    228540
     aaccgtcggt gcgcaacgag cacgtggcgg gcgacgagca ggacgccaag gagaagttcg    228600
     cggtcgtggt gaccgtcgcg gccaaccccg accggcgcag cgccgacggc accggcctgc    228660
     tggaggccac ctcggtgtcc tcggcggcct ggctggccgg cgtggggctg ctgtcgttca    228720
     cctggcccgg ccagatggac cactcgctgc gcgacgactg gctggagcag cagacggaga    228780
     ccgcctgggt cctcgcggac gacctcgacg gcgaggactg gacgacgctg tccctgccgg    228840
     tggacggcgt gccgacgccc ttccactacc gggagtccga gttcggctgg gtgctggccg    228900
     gttcgaccga gcagggcgtg cacctcggcg cgtacgggcg gggcatgagc gcgtacgggc    228960
     tggccttcgc cgtcgtcaag gacgtcgccg cgtacgccta gccggcggtc gcgggtacga    229020
     ggaggggcgc cgtcccccgt ggacagcgcc cccactcccg tacggaaacg gaacgtcaga    229080
     acttgttctt cggcgtgatc cccagcgaca gcccggaaag gccacgctga cggccgccga    229140
     gcttgcccgc gatcgagcgc agggccgcgc ccgccgggga gtccgggtcg gacaggacga    229200
     cgggcttgcc ctcgtcaccg ccctcgcgca gccggacgtc gatcgggatg gcgccgagca    229260
     ccggcaccga cgcaccggtc gtgcgggtca ggccgtcggc gaccgtctga ccgccgccgg    229320
     tgccgaagac gtcgaccatc tcgccgcagt gcgggcaggg cagccccgac atgttctcga    229380
     ccacgccgac gatcttctgg tgggtctgca cggcgatggc gcccgcccgc tccgccactt    229440
     cggcggcggc ctgctgaggg gtcgtcacga ccaggatctc cgcgttcggc accagctgcg    229500
     ccaccgagat cgcgatgtcg ccggtgccgg gcggcaggtc gagcagcagg acgtccagat    229560
     cgccccagta cacgtccgcc aggaactgct ggagcgcgcg gtgcagcatc gggccgcgcc    229620
     acaccaccgg cgcgttgccc ggggtgaaca tgccgatcga gatgaccttc acgccgtggg    229680
     ccgaaggcgg catgatcatg ttctcgacct gggtgggacg cccgtcggcg cccagcatgc    229740
     gcggcaccga gtggccgtag atgtcggcgt cgacgacacc gaccttcaga ccgtcggccg    229800
     ccatcgaggc cgccaggttc accgtcaccg aggacttgcc gacgccgccc ttgccggacg    229860
     ccaccgcgta cacccgggtc aggctgcccg gcttggcgaa gggcacctcg cgctcggtct    229920
     gaccgccgcg cagggcggtg gccagctcct tgcgctgctc gtcgctcatc acgtccagct    229980
     cgacgtcgac gcgcgtgaca ccctccaccc gcgacaccgc gtcgctcacg cgctgcgtga    230040
     tggtgtcccg catggggcag ccggagaccg tcaggtacac ggcgaccgcg accgctccgt    230100
     ccgcgccgat ctccaccgac ttgaccatcc ccagctcggt gatgggccgg ttgatctcgg    230160
     ggtcgttcac cgtcgccagt gcttcgcgca ccgcgtcttc cgtagccata gggtcgatgg    230220
     tacggcgccg cccacggggc gcggaaagcc ccgtcagcgg tcgtgtacgt cacgccccgc    230280
     ggaccggtcc gccgggaata ccccgcgatc ggggtgatgg ccgttctgcc gctcctccag    230340
     gtccctgacg aggtcctgga gctcggagcg gatccagtcc cgcgtcgcga cctcgccgag    230400
     cccgatgcgc agggcggcga tctcccgggt caggtactcg gtgtcggcga tcgaccgctc    230460
     gttctgcttg cggtcctgct ccaggttgac cctgtcccgg tcgtcctgcc ggttctgcgc    230520
     gagcaggatc agcggggccg cgtaggaagc ctggagcgac agcatcagcg tcaggaagat    230580
     gaaggggtac tcgtcgaagc gcagcccgct cggcgcggac acgttccaca ccacccacag    230640
     gatgatgacg accgtcatcc agacgatgaa ccgcccggtg cccaggaagc gcgcgacgcg    230700
     ctccgacagc cggccgaagg actccgggtc ccactcgggc agcagcctgc ggcgcggcgg    230760
     acgcggctgg tcgaggcggg cccgggcccg ggaggacgcg gtggcccccg aggtggcgcg    230820
     ctcccgtgtc gtcgtctcgc gctcaggcac catcggcgcc cacctccccc gtcgtccccg    230880
     tcgtctcgtc gaggtggtac tcggtctccc gccagtcgtc gggcagcatg tggtccagca    230940
     cgtcgtccac ggtgaccgcg ccgagcagcg cccccgagtc gtccacgacg ggcgccgcga    231000
     ccatgtcgta cgcggcgaag aacccggcga ccaccggcag cgccgcgtcc ggctccaggg    231060
     gttgcaggtc gtcgtcgagg atcgagccga ccagcgtgta cggggggtcg cgcagcaggc    231120
     gctggaagtg gacggtgccc aggtacttgc cggtcggggt ctcctcgggc gggcggcaga    231180
     cgtagacctg ggcggcgtgc gccggggaca ggtcggggtt gcggatgcgg gccagggcgt    231240
     cggcgacggt cgcgtcgggg cgcagcacga tcggctcggt cgtcatcaga ccgccggccg    231300
     tgtgctcctc gtacgccatc aggcgccgca tgtcggccgc gtcctcgggc tgcatcagac    231360
     tcagcagccg ctccttgtcc gcctcgggca gctccccgag caggtcggcc gcgtcgtcgg    231420
     ggtccatcgc ctccaggacg tccgcggcgc gctcctcctt gagcttgccg aggatctcga    231480
     tctggtcgtc ctccggcagc tcctccagca cgtcggccag ccggtcgtcg tcgagggcgg    231540
     cggcgacctc ggcgcggcgc ttggcggaca ggtggtgcag gacgttggcg aggtcggcgg    231600
     ggcgcagctg ctcgaaggtg gccagcaggt tctcggcgcc ctgcccctgc tcctcgacgg    231660
     agaagccgga gacgccggac cactccacgg tcagggtctc gcccttgttg cggcggaagg    231720
     cgccgccctt cctgcccttg cggacgaaga ccttgtcgat ctcccagtcc cgtcgggcgg    231780
     gcaactgctg caccgacagg tcgagcacgg tgacctcctc gcccgtctcg gtgagcgtga    231840
     cccgccggtc gagcagctcg ccgaagacga ggcgctcggt gggccgctgc tcgaaacgcc    231900
     gcacgttgag cacgccggtg gtgatcacct ggccggactc gatgccggtg acccgggtca    231960
     tgggcaggaa gatccggcgg cgggtggtga gttcgacgac cagtccgagg acgcgcgggg    232020
     gtttgcggcc gacgcggagc atgacgacca gatcgcggac gcgccccacc tggtcaccgg    232080
     ccgggtcgaa gacggcgatg ccggagaggt gggagacgaa gatccggggg gcgcccgctg    232140
     ccatggccgc ggctcctttc ctcacgctcg cgcttcgcgg agccgagcgc gcgtgcctga    232200
     gagtcgagtg ggggtgtgtg aaagctgatt cgtacggtgt cccttttccg aattgcccgc    232260
     tcggacgcgc ttcaggctag cccgtcccga tcggcctcgc cctggcggcc ggtccggacg    232320
     gactggctcc gttcggtccg tacggccccg gtacgctgcg gcctggcccg gtcggcacga    232380
     tgccgatgcc cgtcggcccc gtgtcagccc tgtcagaaag gcagtccccc ctgtgtctgt    232440
     gactccccgg cgccgaatcc gcagggccgc cttgctgggc gcggtgtgcg ccctggccgt    232500
     gacgggagcc gggctgacgg gatgcagcag cgaggacccc gacgcgggca ccaacggtct    232560
     cggaaagctt tcggccgaca agatccaggc gaaggccggg acggccgccc aggccgcccg    232620
     gacggtgcgc ctgcacggct ccgtggaggc cgccggcagc acgtacaccc tcgacatgcg    232680
     gctgaaggcc gacggaggga ccggctcggt cgcggccgag gggaccacgt tcgggctgct    232740
     gcgcgtcggc gagcagctct tcctcaaggc cgacgccggg ttctggagcc acgacggcgg    232800
     cgacgccaag gcggccgaca agctcgccgg caagtacgtg aaggtgccgc agagcgaccc    232860
     cgtgtacaag aagttcagcg gcttcacgga caaggacgtc ctcctcggcg gtctgctgac    232920
     cctgcacggc acggtgaaga cggacggccg ccacgagcag gccggggtgc gcaccatccg    232980
     gatcaccggc gacgacggcg cgggcggctc gctggacgtc tccctggagg gcaccccgta    233040
     cccgctgcgc ctggtgcggg cgggcagcgc gggcacgatc ggcttctcgg actggaacaa    233100
     ggacttcgcg ctggagcagc cggcgaagga cgacaccctg gactacggca agcagctgcc    233160
     gtcctcctga ggcgtcccgg gccgtcagcg ccgtttgcgg cgcttcagca gcaggcgcgg    233220
     cagtccggcc ggcaccggct gccgggtcgt cgccgggctc ggcagcggtg cctcggccag    233280
     cgaggcgtcg ggcagcggcg ccgtggtccc cgtcggctcc aggcgcagca cccggcactc    233340
     gcgggcccag cggccggtca tggcctcgcc gtccggggcg ttgagccgtt tgcccttcag    233400
     gtcgcccacc gccgcctgcc acgcctcgga gccggacggc agctccacga cccgggcggc    233460
     ccaggagacc agccggccgc ccttgtcctt gctgcgcacc gtcacctcgg ccgcggcccc    233520
     gtcggcaaga cccggcagcg gctgctcgcc cggtccgtcg ccgacgacgc aggccgcgcc    233580
     gtcgtgccag acgtgccaca gcgcccgggc gggcaccccg gggcccttga cccagacgag    233640
     gccggacttc ttggtggcct cctcgacgag ggcctggtcg agcagctcgc ttgtcatgcg    233700
     gtcagcctat ccaggggccc gggggcgggt tcagagccag ccgttgcgct tgagggtgcg    233760
     gtggatgccc agacagatgc agaccgtgac cgacaggacc agcgggtagc cgaacttcca    233820
     gtgcgtctcc ggcatgtagt cgaagttcat gccgtagacc ccgcacacca tcgtgggtac    233880
     ggcgatgatc gcggcccacg aggtgatctt gcgcatgtcc tcgttctgcg ccacggacgc    233940
     ctgggcgagg ttggcctgga gaatggagtt cagcagttcg tcgaacccga tgacctgctc    234000
     ctgcactcgg gccacgtggt cggccacgtc ccggaagtac ttctggatct ccgggtcgac    234060
     cagccgcatc ggccgctcgc tgagcagctg catgggacgc agcagcggcg ccaccgcccg    234120
     cttgaactcc agcacctcgc gcttgagctg gtagatccgc ccggcgtccg tgccgcgcgg    234180
     ggagcccttg cgccccggcg agaacacctc cgtctcgacc tcgtcgatgt cgtcctgcac    234240
     cgcgtcggcg accgcgatgt agccgtcgac gacgtggtcg gcgatggcgt gcagcaccgc    234300
     ggaggggccc ttgagcagca gctccgggtc ctcctggagg cggcggcgca gcgcacgcag    234360
     cgagccctgc ccgccgtgcc ggacggtgat gaagaagtcc cggccggtga agcacatgac    234420
     ctcgccggtc tcgacgacct cgctgttggc ggtgagctgg tcgtggtcga cgtagtggac    234480
     ggtcttgaag accgtgaaca gggagtcgtc gtagcgctcc agcttgggcc gctggtgggc    234540
     ctggacggcg tcctccacgg ccagcgggtg cagcccgaac tcccgggcga taccggcgaa    234600
     ctcgtcctcg gtgggctcgt gcaggccgat ccacacgaac ccgccgtcgc gacgcacctg    234660
     gcgcatcgcc gtgtgcgggg tcagcggcac gtccgtctcg acgcgggtgc cgtcgtggta    234720
     gacggcgcag tcgacgacgg cggaggccgt cgccgggtca cgggtggtgt cgtaggcacc    234780
     gccgtccttg cgcagcgaga cgcgggacgg gcggaccgcg gcgcgcaggt cacggatcat    234840
     cgacatggca ggctccttcg cggcgggcag cgaacgaggg ccggtgacgg atggaaccac    234900
     ccggaatgag gacgtcctga ccacgcgtgc tcggcgcgtc cacaaagcgg ggggcaccgc    234960
     accgtcgcgg tggccggctt cgctgctgat tcagcggctg atccggaccg gcggcggacc    235020
     gacggccggg tcaggcaaaa cgagacgaag tgctcttcct tgcgagggcg cgcgtgcggt    235080
     cagcggcgac gggaagaaag ccggtgcggc tgcgtcagcg gcgggaagag cgggtggtac    235140
     tgcacggtcg acttcggtcc atgccagccc cacctcctcc ggccggtccc tcgtgaggga    235200
     cgatccattc cccttgtttg gaggggttcc ccgtagggga gtgttcacag tgtcggggac    235260
     ttgatcgcga cgctctgcgt gctgccccga accgctgggc cagagtacca gtcacccgac    235320
     gtgtcaaggc gccgctttgc ctcttcccga cgagttctat gctcgccgca tggctgatgt    235380
     tcttcctctg gtcgaggccc ggttgcgcag tgcgctgggc gagccggacg cgcgcgcggc    235440
     ggtcaccttc ctcggcaccg accgcatcga ggtgctgcgc ttccccgccg ccggccagga    235500
     gggcgacgtc gtccgctacg ccaccctcgg catgtcggcc cagcccatgg cggaccccac    235560
     ggccgtgctc gccgacccgg tcaagggccc ccgcgccgag ctggtgctct ccgtgcgctc    235620
     cggggccgcc gacaccgaca aggtgctgcg cccgctcgcc gtactggccg cgtccccgca    235680
     ggtcgagggc gtgatcgtgg cgcccggcgc ctcgctggac gtcggtgagc cgctgtggcc    235740
     cggggccccg ttcacctcgg tgctggtcgc cgagccgggg ggtctggtcg aggacctgga    235800
     gctggacgcc ccgctggacc cggtgcggtt cctgccgctg ctgccgatga cgccgaacga    235860
     ggccgcctgg aagcgcgtgc acggcgcgcc cgccctccag gagcgctggc tgaaccacgg    235920
     gacggacctg cgcgatccgt cccgcaggtc cgtccccctg gactgacgca gccgagtgac    235980
     gcagccgagt gacgcaactc accggctttg tccgtcagtt ggcgaagacc gtgaccgagt    236040
     cctcgctcgc gtgcttcggc tccagctcct cggcgtcgtg ggtcagcgcc cggcgccgta    236100
     cgaccaccac gaccgcgccg agcagcgcgg tcaccgccgc caccacgaac gggacgtgga    236160
     cgtcggtcca ctcctcgatc ttcggcgcga agtagggcgc ggccgccgcg gcgaaccagc    236220
     gcacgaagtt gtagcccgcg ctcgccaccg gacgcggcgc gtccgagacc ccgagggcca    236280
     gctcggtgta gacggtgttg ttcaccccga tgaacgcgcc ggacaggatc gtgcagacga    236340
     tcgccgcggt gtggttcccg tacccgagga ccaggacgtc ggccgcgagc aggaccaggg    236400
     aaccgccgag caccttgagc gagccgaagc gccgctgcat gcgcggtgcc accagcacgg    236460
     agaagacggc gagcagcacg ccccacgcga agaacacggc gccggacttg tacggcgtca    236520
     tgttcagcac gaagggcgtg aaggccagca ccgtgaagaa cgtgtagttg tagaagaacg    236580
     ccgagaccgc ggcggaggcg aggccaccgt ggcccagcgc cctgatcggg tcgagcagcg    236640
     aggtcttgcg ggccggccgc ggctgctcct tgaggaacac cgtgatgcac aggaagccga    236700
     tcgccatcag gaaggccgtg ccgaagaacg ggtagcgcca gctggcgtcg ccgagcagtg    236760
     cgcccagcag cggaccgcag gccatgccga gaccgagggc ggactcgtag agcaggatcg    236820
     cggcggcgct gccgccggcc gccgcgccga cgatcaccgc gagggccgtc gagacgaaca    236880
     gcgcgttgcc caggccccag ccggcccggt agccgacgag ctggccgacg gtgtcggagg    236940
     tgccggcgag gcccgcgaag accacgacga aggccaggcc gagcagcagg gtcttgcggc    237000
     cgccgatgcg gctggagacg aagccggtga ccagcatggc cagggcggtg atgaggaagt    237060
     acgaggtgaa caggagcgag acctgcccgg cgctcgcgtc caggcccttg gcgatggacg    237120
     ggaggatcgg gtcgaccagc ccgatgccca tgaacgccac gacggacgcg cccgcggtcg    237180
     cccacacggc cttgggctgc cgcaggatgc cgcccgcacc cacgtcgaag ggatccatgc    237240
     ttgctctcca atggggacga ggtggacgtg atgcacgcca aatggttggc gtatacacat    237300
     agtaagttag ctctgctaat taatgcaatg tacatctagt cactcggaag ccggcccggc    237360
     cggtgccctc ccctccggat gggtgatcgt ccttgacgtg ggggagcgag ggtaggaccg    237420
     tggggctcta tgaggggcga acccagttgc ccgaagtgtg gtggccgggt cagggctccc    237480
     ggcctcttcg ccgattcctg gcagtgcgac ctgcacggca ccgtgcaccc ggtccagccc    237540
     gtacttccgc ccagcgtcga ggcgctcggc gtcgtggtgc accgcacaca ggtgccgttg    237600
     tggatgccct ggccgctgcc ggtcggctgg ctgttcaccg gcgtggcctg tgcgggcgac    237660
     gaccgcagcg ggggccgggc gaccgccgtc gcctgttccg gacccggtcc gctcggcggc    237720
     atcggtgagc tgatcctggt cgccgaggaa ctcggcgtcg gcctcggcgc gcggtacgcg    237780
     ggcctcgacg gcccggaccc cgggccgtat ctggacgtcg agaagccgcc ccaggtcaag    237840
     gtcctggccg cgggccgccc cacccccctc tggcacgtct ccggcgggcc cgtcgaccgt    237900
     gccgtcttcg ccggggaggc cctcggcatg tggctgtggg ccgtggtgtg gcccgagcgg    237960
     tccgggctgc tgatgtacga ggagctggtg ctgaccgacc tgcgggacgc cggtgccgag    238020
     gtggacctgg tgccgtgcgg ggcgctgtcg ccgcggctga tcgagccgac ggcgccgtag    238080
     cgccgccggg gtggacgggg cgggcggggt gcgccgtggc cgtggggact cagggcgctc    238140
     aggtgcttgg gttgctcggg gcgctcaggg tcccaggggc aggtggagcg agtagggcct    238200
     gtgcctgcgt agggggcgca ggggtgctgc gggtgtgacg gcggggggcc gagttccggt    238260
     tatccttgag cgtccccttc cgtcccgtca ccgcttggag tcagcgtcgt gcgcatcgat    238320
     ctgcacaccc actccaccgc gtccgacggc acggacaccc cggcccagct ggtgcgcaag    238380
     gccgccgcga ccggactcga cgtcgtcgcg ctgaccgacc acgacaccac ccgcggccac    238440
     gccgaggccg tcgccgccct gcccgagggg ctcaccctcg tcaccggtgc cgagctctcc    238500
     tgccgcctcg acggcgtcag catgcacatg ctggcctacc tcttcgaccc cgaggagccg    238560
     gccctgctcg ccgagcgcga gctggtccgg gacgaccggg tgccgcgggc ccgggccatg    238620
     gtcgccaagc tcaacgagct gggcgtgccc gtcacctggg agcaggtcgc caggatcgcc    238680
     ggtggcggct cggtcggccg gccgcacgtg gcctccgccc tcgtggaact gggcgtcgtc    238740
     ccgaccgtga acgacgcctt cacccgggac tggctggccg acggcggccg ggcgcatgtg    238800
     gggaagcacg agaccgaccc cttcgaggcg ctccggctga tcaagggcgc gggcggggtc    238860
     gccgtgttcg cgcacccggc cgccgccaag cgcggccgca cggtgtccga ggccgcgatc    238920
     gccgacctgg cggccgccgg gctcgacggc atcgaggtcg accacatgga ccacgacacg    238980
     cagacgcggg cacggctgcg cggggcggcg aaggagctgg ggctcctggt gaccggctcg    239040
     agcgactacc acggcagccg gaagacctgc gtgctcggcg agtacacgac cgaccccgag    239100
     gtgtacgggg agatcacgcg acgggcgttc ggggcgttcc ccgtgcccgg ggccggcggg    239160
     gcctgagccg caccctccgt ccactcttcc ccctcctccg caaggccagt agctcaccca    239220
     tgttcgacgt cgccgtcttc ggctccctct tcctgaccct ttttgtcatc atggatcccc    239280
     ccgggatcac cccgatcttc ctcgcgctca cctccggccg ccccggcaag gtgcagaagc    239340
     ggatggccct ccaggccgtc tgcgtcgccg gtggtgtgat cacggtgttc ggtctgctcg    239400
     ggcaccagat cctggactac ctgcacgtgt ccgtgcccgc cctgatgatc gcgggcgggc    239460
     tgctgctcct gctgatcgcc ctcgacctgc tcaccggcaa gacggacgag ccgaagcaga    239520
     ccaaggacgt caacgtcgcc ctcgtaccgc tgggcatgcc gctgctcgcc gggcccggag    239580
     cgatcgtgtc ggtcatcctg gccgtgcaga aggcggacag cgtgaccacg caggtctcgg    239640
     tgtgggcggc gatcctcgcc atccacgtgg tgctgtggct ggtgatgcgg tactcgctgc    239700
     tgatcatccg ggtcatcaag gacggcggcg tggtcctggt gacccgcctc gccggcatga    239760
     tgctctccgc gatcgccgtg cagcagatca tcaacggcgt cacgcaggtg atccagggcg    239820
     cgtgagcgca gcgacagggc ccccgcacgg tgttccgtgc gggggccctg agcatgtgca    239880
     aacggtccgc gttacaaggc cgaggtgtcg gcggggcgga tccacaggcg ctgcccgatg    239940
     gcggcggcct gctgaacgat gcggttcacg gaggcggcgt ccacgacagt cgtgtccacg    240000
     ggggtcccgt cgacgtcgtc gagtcgcatg acttcaaagc gcatggcctc tcccttgatc    240060
     tggtcatcct cctgcggaga actactggtg tggctcctgg gtcgtcggtg cccgggcttc    240120
     cgtagtggtc aacgggatgc cctctgcaaa cattccctac gctaaggaaa tttttcgcac    240180
     gactaattac tgacaagtaa gacgcttgtt accgcgcgac aggtgtcccg tacaagactg    240240
     accgggaccg gttgtattcg tagcgtgacc gccgggacaa tggaggcgat gaacgacgac    240300
     ctcgcgcccc tgaacgctcg tatcgatcgc acgaacgagc tgctccagcg catgctcgcc    240360
     gaggtggcga agaccccctc gacccacgcg atcttcgtcg acgccggtta cctctacgcg    240420
     gcggcggggc ggctggtggc cgggaccgag gaccgccggg ccttcgacct ggacgccgag    240480
     gggctcatcg aggccctcat cgacagggcc cggaacatct tcgcggacag ccgcctgctg    240540
     cgcgtctact ggtacgacgg cgcccgccgc cgcatccaca ccgccgagca gcagtccatc    240600
     gccgagctgc cggacgtcaa ggtgcgcctg ggcaacctca acgccaacaa ccagcagaag    240660
     ggcgtcgact ccctcatccg caccgacctg gagtccctcg cccggcaccg cgccatcagc    240720
     gacgcggccc tgctcggcgg cgacgaggac ctcgtgtcgg cggtcgaggc cgcccagggg    240780
     ttcggcgccc gcgtccacct gtggggcatc gaggcccccg agggtcgcaa ccaggccgag    240840
     ccgctgctct gggaggtcga cagccagcgc accctcgacc tcgacttctt caagccgtac    240900
     gtctcccggc gcacggcccc cgccgccgag gcgacgggcc tcacccgccc ggcccgggag    240960
     gacgtccgct tcgtgggcgc ccagatcgcg gcgaaatggc tggcgtcccg ggggcgcgag    241020
     tccctcgtcg agctgctccc cggccacccc tacctccccg gttccgtgga ccaggacctg    241080
     ctggtggagg ccgagggact gctgcagtac tcgctgcgcg gccaggccga cctgcgccgg    241140
     gccctgcggg acggcttctg ggagcacctg cgggcgcagt actagggcct gtccgcggag    241200
     gatcgggtcc cgttccggcg gggagcgggg cgcggggagc agcggggcgc agggtgcagg    241260
     gtgcagcggg gcgcgggagt gccaccgcgg cctcagcgca cgtacggtcg gggcggcacg    241320
     ggatggtcgt cccagaagtc ggcgagggcg cgggcggtcg gcaggggctg gtcggtgttg    241380
     ggggagtgct cggcgcccgc gacgaccgtc cggcgcgcgt ccagccgcag ggccatctcg    241440
     tccaggaggg gcacgggcca ggtgtcgtca taggtgcccg acagcacgtg gaacggcagc    241500
     ggcacggcgg ccagctcggc gacacggtcc ggctcggtgc acaactggcc tcccgtggcg    241560
     agcagttgcg ccggtctggt gcccagccag cggtcccgca gccgtacccg gtcctccggc    241620
     ccgtgggcgg gggccggggc accggcctcc tccggcggtc ccatggcctg catcacctcc    241680
     cagacctccg ccatcgtcat cgtgtccagc gcgtcccgca gcagcttcac ccgctgccgc    241740
     tgcgactcgg agatccgcgc cgggcccgag gacatcagcg tgagggacag gaacggggcg    241800
     gggtcgagca ggacggcggc ccgtgcgatc tggccgccca gggagtgccc gacgaggtgc    241860
     acgcgcgtcc cgagggcggc ggcctgcgcg agcacgtccc gggccagctc gggccgcgcg    241920
     tacgcggact cgtcgtgctc tggcccgtcc gactcgtact gcccccgtcc gtccacggcg    241980
     accgtgcggt acccgcgtgc cccgagcggc cggtgcagca gggtgaagtc ctccttgctc    242040
     cccgtaaagc cgggcagcat catcaccacg cccctcggcg cgaccccggc ggccgcgggc    242100
     gagtcgacga cggcgaactc accgcgtgcg gtacgcagcc ggtacgcgcg ggcgctcgga    242160
     ggcgggctga aggcggcgtt cctgctcacg ggcagaggct atctggcgat gcgcacggga    242220
     gtgacgacgc ccaacgccgt cggccccgtc ccgcctgagt ggcgggacgg ggccgacggt    242280
     ctcggacgag cggcgcggat cagctctcgc ctgcctccgc gggctgcgcg gcggcggccg    242340
     tcttgcgggt gcggcgggcc ttcggcttcg cctccgccgt gtcggctccc gccgcgggcg    242400
     cctcgacggc aaccgcggcc ttacgggtcc ggcgccgcgg cgcggcctcc ggctcctgcg    242460
     aggcctgcgc cggaatctcg gcggtggcct cgacggccgc ggccgtcttc cgggcgcggc    242520
     gggccttggg cttcgcctct gccgcctcgg ctgtgtcggc ggcggcttcg gccttggcgg    242580
     cggcttcggc cttggcggcg gccgtcttgg tggccgtcgt cttgcgggtg cggcgcggct    242640
     tggcctcggt ctccgcctcg ccctccggag cggcctgcac cgccggttcg gcggccttgc    242700
     gggtgcggcg ggccttgggc ttcgcctctg ctgcctcggc ggtgtcggcg gcggcttcgg    242760
     ccttggcggc ggccgtcttg gtggccgtcg tcttgcgggt gcggcgcggc ttggcctcgg    242820
     cctccgcctc gccctccgga gcggcctgca ccgccggttc ggcggccttg cgggtgcggc    242880
     gggccttggg cttcgcctct gccgcctcgg cggtgtcggc ggcggcttcg gccttggcgg    242940
     cggccgtctt ggtggccgtc gtcttgcggg tgcggcgcgg cttggcctcg gcctccgcct    243000
     cggcgtccgg agcctgcgcg gcgggctcgg cagccttgcg ggtacggcgg cgcggcttgg    243060
     tctcggccgg ctcgggcgcg ggctcggccg ctccctcggc cgtctcgacc gtcgcctcgg    243120
     cggccgtggc cttgcgggtg cgccggcgag gcttctcggc gggagcctcc accgtcgggg    243180
     tctcgacgac cgccggagcc acgatcgact cctcggtggc cgtcggcgcc gccgtcggag    243240
     cggtctccag cggggcggcc ggggtctcgg ccgccttgcg ggtgcgggtg cgtcggcgcg    243300
     gcttcgccgg ggcctccacg gcctccgggg ccgccaccgg ttcggccgcc accgtttcca    243360
     cgaccggagc ctcggaaggc gcgagcgcgg cgtcctcggc ggcctgcgcc gccgggccgt    243420
     cggtgccgag cgtcgcggcg gtctcctggc ggcgcgaggg ctcgccgctc cgcgtacggc    243480
     gccggcggcg cagcgtgcgg ggggccttgt cggtgtcggt gcccgcgtcg gtggcgccgg    243540
     ccgcaccatc ggtcacggtc acggtctcgg ccgcgggggc cacggaggcc tccgcgtcca    243600
     ccggcgcacc gccgcgcatc cgacggcggc ggcgcggcgt cgtacgggac gaacggtcgc    243660
     gctcgcgatc gccggaacgt gagtcgtcgc gcccaccccg gccgccccgg tcgccccggt    243720
     cgccgcgccc gcggccaccg cggccgcccg gctcgcccag gtcctcgagc tcctccgcgt    243780
     cgagcccggc gcgggtgcgc tccgagcgcg gcaggacgcc cttggtgccc tcggcgatgc    243840
     ccaggtcggt gtacaggtgc ggggaggtgg agtacgtctc cggcgggtcg ttgaagccca    243900
     ggtccagcgc cttgttgatc agctgccagc gcgggatgtc gtcccagtcg accagcgtga    243960
     tcgccgtacc cttcgcgccc gcgcggccgg tgcggccgat gcggtgcagg tacgtcttct    244020
     cctcttccgg cgactggtag ttgatgacgt gcgtcacgcc ctcgacgtcg atgccgcggg    244080
     cggcgacgtc ggtgcagacg agcacgtcca ccttgccgtt gcggaaggcg cgcagggcct    244140
     gctcgcgggc gccctggccg aggtcgccgt ggaccgcgcc ggaggcgaag ccgcgctgct    244200
     tgagctggtc ggccaggtcg gccgcggtgc gcttggtgcg gcagaagacc atggccagtc    244260
     cacggccgtc ggcctgcagt atgcgcgcca ccatctcggg cttgtccatg ttgtgcgcgc    244320
     ggtagatgaa ctgcttcgtg ttcgcgaccg tcgcgccctc gtcgtccggc gaggtggcgg    244380
     agatgtgcgt gggctgcgac atgtaacggc gggccagtcc gatgaccgcg cccggcatcg    244440
     tcgccgagaa cagcatggtc tggcgcctgg ccggcagcat gttgatgatc ttctcgacgt    244500
     cgggcaggaa gcccaggtcg agcatctcgt cggcctcgtc gaggaccagg ctcttgatgt    244560
     gcttcaggct cagcttgttc tggcccgcca ggtccagcag gcggcccggg gtgccgacga    244620
     tcacgtcgac gccctgcttc agcgcctcca cctgcggctc gtaggcgcgg ccgccgtaga    244680
     tcgcgaggac gcgtacgttg cggaccttgc cggcggtcag gaggtcgttg gtgacctgct    244740
     ggcacagctc gcgcgtcggg acgacgacga gggcctgcgg ggcgtcggtc agggactcgg    244800
     gcgccgcgcg gcccgcctcg acgtcggcgg ggacggtgac gcgctcgagg agcgggaggc    244860
     cgaagcccag cgtcttgccg gtgccggtct tggcctggcc gatgacgtcc ttgcccgaca    244920
     gggctacggg gagcgtcatc tcctggatcg ggaagggagt gatgatgccg acggcttcga    244980
     gggcttcggc ggtctcgggg aggatcccga gggatcggaa cgtcgtagtc agggtgctgc    245040
     ctcttctgtg tgcgtggtgc gaggcgagcg cgcgggtcgt gccggaccgt gtcggggacg    245100
     tcggctgcct tacgggtgag ccgtaggaca cgggacctct gtcgacgctc cagcgctcgt    245160
     accactgagg gtccccctcc ggattccgta cgcagcgtgg cgtacggcag ggagggctgt    245220
     cgggtcggag ccgatcgggc caccgaccgg gcatcctcat gcgtgcggcc cgacgacgat    245280
     gtcacgtacc cgtacgtcac atactcggca ggcgcattac caccataccc cggattcgcg    245340
     cacatgcgat ggccgatttg ctcacgtagt cgtcgtcaca ctgactgacc agggccttac    245400
     caccgccgaa gagcgggcta ttgtgcgctg catgacgagc tctgacaagc ctggcaccgc    245460
     cgcagacgcc cccgccgaga ccgctggaac cgccggtacc gccggtaccg gcggagccac    245520
     cccggtcgcc gcccgcgact gggcggcggc cgcggccgac ccgcagtacc gcgccgcggt    245580
     cgtggacctg ctcggcgcgc tcgcgtacgg cgagctggcg gcgttcgagc ggctcgcgga    245640
     ggacgccaag ctggcgccga cgctggcgga caaggcggag ctggcgaaga tggcgtcggc    245700
     ggagttccac cacttcgagc ggctgcgcga ccggctggcc gagatcggcg aggagccgac    245760
     gggggccatg gagccgttcg tggccgccta cgacggcttc cacaagcaga cggacccctc    245820
     ggactggctg gagggtctcg tcaaggccta cgtcggcgac tccatcgcca gcgacttcta    245880
     ccgcgaggtc gccgcccgcc tcgacacgga cacccgcgag ctggtcctcg ccgtgctcga    245940
     cgacaccggg cacgccggtt tcgccgtgga gaaggtgcgc gcggcgatcg acgccgaccc    246000
     gcgcgtgggc gggcggctcg cgctgtgggc gcggcggctg atgggggagg cgctctcgca    246060
     gtcccagcgg gtggtggccg accgggacgc gctgtcgacc atgctcgtgg gcggggtcgc    246120
     ggacggcttc gacctggccg aggtgggcaa gatgttctcc cggatcaccg aggcgcacac    246180
     caagcggatg gcggcgctgg gtctggcggc ctgacgccgt catccaggtc tgaccccacc    246240
     gctcgggcct gacctcaccg ctcgggcctg acgccaccgc tcgggccggg cgccgtggcc    246300
     gggcccgacg cgctacggcg gcctgccggt caggcggtcg ccgaactgcg gcggagcctt    246360
     cccgcggggc gcagcagcag cgacagcgag gccgcggaga ccgtcgccga acccagcagc    246420
     accggcacga gccccccggc acccagcgcg gtgtgcgtga cgaacgcccc gaagagggcc    246480
     ccggcgacac cggtcggcag gacgaggagc ggggcgggca ggcggtgggg cagacggtgc    246540
     gcggccgccc atgccagggc gaggccgaga agtgcggcgc tgagcgcttc caagaacatg    246600
     tcggggtccc tcccacatgg ccggcctgcc ccaaacggtc acagccgact tacccctgac    246660
     ctgcggaatg caatccaccc cctgtgggtg aactgtgctc cgcccgtgaa cgggagcagg    246720
     ggtgtgggag cgagaacacg tagcacgggt ggcacgggca gcacgggtag cacgggtggg    246780
     gcccggcggt atgtcaccgc cgggccccac ccgtgctacg tccgtcgtcc cgcgtccggt    246840
     cgctacagcg tgccgaagcc caccttgcgc ggggccgact cgccgatctc gacgtaagcg    246900
     agccggtcgg ccggcaccag gaccttgcgg ccgtgttcgt ccacgaggct cagcagctgc    246960
     gacttgccgg ccagtgcctc gcccaccacg cgctcgacct cgtcggcgct ctgaccgctc    247020
     tccagaacga tctcgcgggg cgcgtgctgc acgccgatct tgacctccac ggctatgtcc    247080
     ctccgacggt cagtaagtgc gcgatcttcc gcgccgtacc agcacacatt agcccggtga    247140
     ggggacgtac acgcagcgtc gaagaacgcc aggagcgaac agccgacggg aacagaaccg    247200
     gagccgcggc cctcagtgct gctcgatgcc gtgcagcggg aagccggcga tgccccgcca    247260
     ggccagcgag gtcagcagct gcaccgcctg gtcgcggggc acgctgcggt cgctgtgcag    247320
     ccaagagcgc gccaccacct gcgcgagacc gcccagtccc gaggccagca gcatcgactc    247380
     cgcgcgcgag aggccggtgt cctcggcgat gacgtcgcag atcgcctccg cgcactcgtt    247440
     cgtcaccttg tccacgcgct cgcgcacggc gggctcgttg gtcaggtccg actcgaagac    247500
     caggcggaag gcaccgccgt cgtcctcgac gtaggcgaag tacgcgtcca tcgtcgcccg    247560
     gacgcgctgc ttgttgtcgg aggtcgacgc cagcgcgctg cgcacggact ggatcagtgc    247620
     ctcgcagtgc tggtccagca gggcgaggta gaggtcgagc ttgccgggga agtgctggta    247680
     gagcaccggc ttgctgacgc cggctcgctc ggcgatgtcg tccatcgcgg ccgcgtggta    247740
     gccctgggcc acgaacactt cctgtgcggc gcccagcagc tggttgcgtc gggctcggcg    247800
     gggaaggcgt gtgccccgcg ggcgtaccgc ctctgtctgc tcgatggctg tcacgccgcc    247860
     tcccatagtc gtcctcgtgc ggtgtgcgcc gcgtcgacat cgtacttttc ggtaaccgtg    247920
     gtgtgtgtgc tgcgagcgca gaatttcacg gaccggacgg cggcgaaagc cgcacaacag    247980
     gtttcaaaag gagccagacc gggcaaagat cggcctccct tccggtgttc agcggtagtc    248040
     gtcctcgtcg tgcgggacga cccgggcctg ctcggccagg tcggcctcgt cggcgcggtc    248100
     cggctctacg ccggtcagcg gcgcgtcgcg ctcctgcccg acgtccgccc gctgctcggc    248160
     ggcgtcggcg tcgggcgcct cgacgtcgcg gtcctccgga tccggtgcct gcgcctcgtc    248220
     gtcgaaggtc tcggggtcgg tcgggtcgac ggtcatgatg ggctcccttc ctacggacgt    248280
     ccccggggtg caggggtcac acgcgggtgc ccacttcccg agcctaggag acacccgatc    248340
     cggacgccat gcgtcgccgg tcccggtctt gcgcgcccgc ttcccgcgcc gacggcatcc    248400
     gtacccggcc gacgcgccgc cgcagcaccg cttgtgacgg cgaacacatg aaccactgtg    248460
     tgatcatctc gtaatattgc cgcatgcctt cgaccgagcc gccgtccgtg ccgcccgcca    248520
     acgcgctgcc gaaggtcacg gccgtcaagg tcgcggacgg ggagcggctc aggtcggtcc    248580
     acctccccgg catcaccctg acggtgcggt cgagacggcc cgcccgcgag ggactgccgc    248640
     ccgccctcta cgtccacggc ctcggcggct cctcgcagaa ctggtcggcg ctcatgccgc    248700
     tgctggacgg cgtcgtccac agcgaggccc tcgacctgcc cggcttcggc gactccccgc    248760
     cgccggacga cggcgactac tcgatcacga gccacgcgcg cgcggtcgtc cgccacctcg    248820
     acgcgtccgg gcgcggcccc gtgcacctgt tcgggaactc gctcggcggc gccgtcgtca    248880
     cccgcgtcgc agccgtgcgt cccgacctgg tgcggacgct gaccctcgtg tcgcccgcgc    248940
     tgccggagat ccgcgtgcag cgcaccgccg taccgacggg gctgctggcg ctgccggggg    249000
     tggtttcgct gttcaaccgg cttacccggg agtggaccgc ggagcagcgg gtccgcggcg    249060
     tgacggcgct ctgccacggg gacccggcgc gggtgacgcc ggaaggcttc cgcaacgcgg    249120
     tggaggagat ggagcggcga ctgcggctgc cgtacttctg ggacgcgatg gcgcgttcca    249180
     cccggggact cgtcaacgcg tacaccgtgg gcggccagca cggactgtgg cgacaggccg    249240
     agcgggttct cgcacccacg ctcctggtct acggtggacg ggaccaactc gtcggttacc    249300
     gcatggccct acgggccgcc cgcgccttcc gcgactcccg gctgctgacc ctgccggacg    249360
     cgggacacgt ggcgatgatg gagtatccgg aggccgtcgc cacggcgttc cgcgaactcc    249420
     tcgcggacac cgcggacagc acggccgcct cggacacggg gggcaccgcg gacacggtgg    249480
     gcaccgggaa gccggcgggt ggcgagagga ccgacggggc cgtcgacgac gagcccgcca    249540
     accagacatc aggaggctga ggcgcgacgt gggacgccac agccgccgcg ggcccgctcc    249600
     caaggcagac gccgcggaca ccgccgcagc acgtgagaac cgggccggcc ggcccgaccc    249660
     gcgtcggacg aacgggccgt cgcaggagcc acaggggccg taccagccgc agggacctca    249720
     tcagtcacag cggccccacc agccacaggg ggtcgagggg gcggcaccac ccggggcggc    249780
     tccgggcgac gtcccgggtg cccgccaggg gtacgcgggc cccagcccgg ggcggggtcc    249840
     gggggcgcga ctccccgacg gcgagacgtc ggcccacggt ttcccgcgga cggcggacgg    249900
     cacgcccgcg gggggcgtcc ccggataccc cgacggcact ccggcgcacg gcgtccccag    249960
     gtatcccgac ggcactccgg cgcacggtgt gcccaggttc tccgacggca ccccggcgca    250020
     cggtgtgccg cgggtccggg gcggtcaccc cgagcagcgg gaacccggcg gaggctgggg    250080
     cgagccggcc gggcggcccg gtgccgggta cggatcggtg tcgggaccgc gcaacggggc    250140
     ccccgagtcc ttcgcgccgc cctcgccctc cggaccggcc tcggccttcc cgaggcagcg    250200
     gcaggcgccg gcggaggggc cgcggcagga ctacctggac gccttccgcg cggacgacga    250260
     cgtcttcgcg gtccgccccc gcggccgtat ccccggtgcg gcccggcccg ccgacccgta    250320
     cgcctccgtc accgactgga gcgccgaaga cgggggcgcc tccggaggcg gcggcatccc    250380
     cggcggtgcc gaggcggacg ccgacgacga gccgcccacg ggcgaacccg caccggccaa    250440
     gggagccaag ggccggacct tcaccggtat cgcggcggcc gccgtcacca ccgtgctggc    250500
     cgtcgtcgtg gccggtcagg tcgctgacgg gtcggacggg agcgacatgc gcgcgcagtc    250560
     cgccaccgac caggcccgcg gtgcccacga cccggcgtca cgggacgacg aacggccgac    250620
     gcccgccgcg tccgcctccg cgaaaccgct gacgtacgag cagaagatgg gcaggaccta    250680
     cccgctgggt gccaccctca aggcctcggg gaagttcgac gcggtcccgg gcatcgccaa    250740
     ggggaccggg aaggggcaga agtacaccta ccgcatcgac gtggagcagg ggctcggcct    250800
     cgacggcgga ctcttcgcgg aggccgtgca gaagaccctc aacgacgacc ggagctgggc    250860
     ccacaacggc gcccgcacct tcgagcgcgt cgaatcgggt cagccggact tcgtcatcac    250920
     gctggccagc cccggtacca ccgccgagtg gtgcgccaag tcgggcctgg acaccaccga    250980
     ggacaacgtc tcctgcgact cggccgccac ccagcgcgtg atgatcaatg cctatcgctg    251040
     ggcccagggc gccgcgccgt acggcgacgc gatccacgcg taccggcaga tgctgatcaa    251100
     ccacgaggtc ggtcaccgca tcggctacaa ccacgtgacc tgcgacaagg acggcgaact    251160
     cgccccggtc atgcaacagc agacgaaatt cgtcgaccac gacggaatcg actgccgccc    251220
     caacgcctgg gcctatccga acggctgacg gccagttcgg gcccgtgcgt cacgtgtggt    251280
     gaccgattaa tctcttagcg cgaccgaacg cgcctcgcac gtgaaagtta cgaccgttca    251340
     ccccttttgg tggcgcgatg gacaaccgtc catcgcgcca cctccttgtc cgcatacgtt    251400
     cgtcccgctg cgagccgccg ggccaacggc ggctccccaa acgggagatc gggggtgcgc    251460
     gcgtgcgcat cggactgctt acggagggtg gctatccgta tgtgagcggt gaggccgggc    251520
     tctggtgcga ccggctcgtg cgcggcctgg agcaccatga gttcgacgtc tacgcgctca    251580
     gccgcagcga gcgcgaggag gacgggggct gggtgccgct gccgccgcag gtcggccggg    251640
     tgcgcaccgc cccgctgtgg gaaaccgtgg acgacggaat cgtccacgga cggcgcgcgc    251700
     gccggcgctt cgccgagtgc tacggcgagt tggccacggc cctgtgcgcg gccgcccccg    251760
     gggatccggc caggagttcg gaggccagga gttcggaggc ccggagctcg gagggggagc    251820
     cggaagggca gtcggccctt gaggcggacc gtttcgccag tgcgctgtac ggcctcgccg    251880
     aactcgcccg ggacgagggc ggactgccca ccgcgctccg ctcggagacc gccgtacgcg    251940
     ccctggagcg cgcctgtcgc gcgcccggcg cccaccgctc cgcgcgcgag gcgcgcgttc    252000
     ccgatctact ggccgtcgcc gcgcgcctcg aacgcgccct gcgccccctg tccctcgact    252060
     ggtacgagga cgacgacctc ggttcggtgg acctgtgcca cgcggcctcc ggaggcacgg    252120
     gcgccctccc gggcctgctc gcccggcact tctgcgacgt gccgctgctc gtgaccgagt    252180
     acggcgtgcg gctgcggacg cactacctca cggaacccga ttcctcgccc gcgatacggt    252240
     cgctgctcgc cgccttccac ggtcggctgg ccgccgagac ctaccggcgc gcggccgtga    252300
     tcaccccggg caacacccac acccgtcgct ggcaggagcg ctgcggcgcc gaccgagcca    252360
     aactgcgcac ggtccacccg ggcatggacg cggctccctt cgcggaggcg ggggagtccc    252420
     cggagtgcgc cgacccgcag accctcgtct gggtcgggcg cgtcgaaccg gccaaggacc    252480
     tggtctcgct gctgcacgcc ttcgcggagg tccgcagggc ggagcccggc tcgcggctca    252540
     ggatcgtcgg tgcccccttc ggccccgagg gcgtcgccta cctggcccac tgcaagggac    252600
     tggcggcgca gctcttcccg gacgaggccg acggtccgca cgccgtgggc cgcaacccgg    252660
     tctccttcga ggagaccggc ggccccgaac tgccctcccg cgccgacgcc tacgcctcgg    252720
     gggccctggt ggtgctctcc agcgtcgtcg aagggttccc gaccgggctc gtcgaggcca    252780
     tgttctgcgg ccgggcgacg gtgtccacgg acgtcggcgc ggtggtggag gccatcggcg    252840
     gcaccggact cgtcgtgccc ccgcgcaatc cgcgggcgct cgccgaggcg tgcgtcgcgc    252900
     tgttgcgcga ccccgagcgc cgcgaacgcc tgggcgccgc cgcacgcgcc cgcgcactgg    252960
     aactgttcac cgtcgagcag aacatcacgg catttcacgg catttacctg gagatcctct    253020
     ctcgtgcacc ggtacgccgc gtcgtcctcg acggcgccgg cgaacccctg cccttcggtg    253080
     tccccgccga ggcccacgtc cccggtcgct ggagcgacgc cacggcccgg gccgctgccc    253140
     ggggcggtcc cggcgcggtc cggaccggtc ccgggtgggc gacgggcggc ggcccggtcc    253200
     gggccacgac agcggtttcg gcggccgagg gagcgtcccg atgagcggcc tcggcgaact    253260
     ggaccggccc gggaccccgc gcgacccggg ccctcgcgag ggcgccggtg gtgaagacgc    253320
     cggccgggcg ggccgcgacg gcagacagtc gccgcccgcg tccgccgtcc gccgctccgc    253380
     cgcggacccc gtgaaggggc tgttgcaccg gcaccgcgaa ctgtgcgaac gcgccgtgga    253440
     cccgctggag atcgtggcgg gcctggaggc gcacggagtc accgaccgga ccgccgcacg    253500
     cttccgtcac cgggacgtct tctccctcgc ggaggagatg tacgcccggg tcccgcgcga    253560
     cggcgacgcc cccgcacccc ccgaggacgg gccgacgccc cggccgggcg gaccccgcgc    253620
     cgccgggtcc gtcctcctcg ccctgctgcc cggcgtgctg tgcgcggccg ccgtggccgg    253680
     actgcgcctg accgacggcc ggccgcgcct gatcgcggcc gccgtcggag tcctcgcggt    253740
     gagcctggcc ctgggcgcgg cgctgcgccg cgggccgctg accgccgcga cgcgcaccac    253800
     cagcacctgg acctgctggc tcctcggcta cgccctcctc ggcgacgggc tcctgcggac    253860
     cgcggtcagc ggcggccccg acggcctccc ggacggctcc cccgacgggg cgtggcccgt    253920
     caccctcgcc cccgtcctgg cgctcacgct gtcctacgcg cccgcggccg gctgcgccca    253980
     cctcttcgcc gcgggcgccc gccgcaagct gtcgtccagc cggggtctca ccgacttctc    254040
     cgcctccgtg cgcccattgc tgctcggcgc gttcgccctg tacctgggag ccctggcggc    254100
     tctgctcacg ctgaccggcg ccgtgctggg cgaacccgcc gactggtccc agggcctcag    254160
     tctgggcgcc ctgttgctgc tcgcccggct gctcggcgtg cacggccaca cccacgccgg    254220
     cccgttcgtc ctcaccgcca cggccgccgc ggaggcggcc gccctggcca cggtcttcgc    254280
     cggccgcctc ccgggctgcg gcctcctgtc cgcccccgtg gaggcactgg tcgccgcctg    254340
     cggcccggcc ggtgtcccga cggccgcctg cggcatcggc gccctcgccc tcctcgtcca    254400
     cgcgtgccgt cgcctgaccc gggcatcggc ccacgcttcg acggagcgaa cgcggtgagc    254460
     gcgcgcacgg acatcccccc aaccgtccgc aacaccctcg catcacccct tgaaggagcc    254520
     cccagatgac cacctcccga cccgacgcct cggcaccggg agccgcccga tgagagtcct    254580
     gctgatcgga gccaacggct acatcggccg cttcgtcgcc gaccgtctgc tcgccgaccc    254640
     cgccgtccag ctcaccgccc tcggccgcgg tgacgacgcc gacgtccgct tcgacctcgc    254700
     caccgggagc ccgggcgccc tcacccgctt cctggacgcg gtccatcccg gagtggtggt    254760
     caactgcgcg ggcgcgaccc ggggcggcgc ccgcgaactc acccggcaca acaccgtcgc    254820
     cgtcgcgacc gtctgcgagg ccctgcgccg cagcggctgc ggcgcccgcc tggtgcaggt    254880
     cggctgcagc gcggagtacg gacccagcca gcccggttcc tcgaccgcgg aggacgccgt    254940
     cccccgcccc ggcggtccct acggcgtcag caagctcgcc gcgaccgaac tcgtcctcgg    255000
     ctccggtctg gacgccgtcg tcctgcgggt cttctcgccc gcggggcccg gtacgcccgc    255060
     cggctccccg ctgggccggc tcgccgaggc catgcgccgc gccatgcagt ccggcgacgg    255120
     cgaactccgg ctcggcggcc tgggcgccca gcgggacttc gtcgacgtcc gggacgtcgc    255180
     gcgagcggtg cacgccgcct cgctctccgc cgcgcagggc gtcatcaaca tcggctccgg    255240
     ccgcgccgtc cggctgcgcg acgccgccgc caccctcgcc agggtcgccg gctacggcgg    255300
     ggccctgcac gaactcgacg ggccccccgg cgcgctgcgg cccacgatcg gccacccccg    255360
     taccgagtcc ctcggccatc gtgtcgacgc cctcggtcac caccggagcg acgccctcgg    255420
     ccatcaccgt ccggaccccc tccaaagccg cggcgagcgc accgaccccg agcacacgac    255480
     cccggccccg taccccgacg gctgcggcag ctggcagcag gccgatgtgc gcaccgcacg    255540
     cgaccggctc ggctggcggc cccggatcgc cctcgaagag tccctcgccg acatctggat    255600
     ggaggcggca tgtcgtatct gaccagcacc aaagcaggcg tcgcgagcac cggcgtccac    255660
     accggcctcg gtgtcccggg gctggcccac cccctcctcg cccccgacga gtgggccggc    255720
     ctcacctgcc ccggcacccc gctgcactgg gtcgtcctca acatcgccga cggacccggt    255780
     gcgcatcccg acccgcgatg cctggaggcc gccggccgcc tgcgcaacgc gggcatccgc    255840
     gtcctcggcc acctcgacac cgcgtacgga gcccgcagcc tcggcgagca gatctccgac    255900
     gcccgccgat acctcgactg gtaccaggtc gacgggttcc tcctggccca ctgcccctcc    255960
     gaccgggccg ccctcccgga ggtccggcgc acggtcacca ccctgcgggc gatccgtgac    256020
     gatgcccaca tcgtcctcgg tcacggcacc cacccctgcc cgggctacgc cgagaacgcc    256080
     gaccagctcg tcaccttctc gggcacctgg gccgactacc gctggtccca ggcggccgag    256140
     tggagcgcgg actatccgcc cgagcgcttc tgccacttcg tacacggact gccgcgcggg    256200
     cacctggagg aagcgctgcg catcgcccgt tggcaggggg ccgcgacgat ctgcttcacc    256260
     gaccgcacgg accacggcgg ccgggccgac ccctgggaga cgatgcccgg ttactgggac    256320
     gaaatcgtct cgcgggtcgg gacgggtgtc tcggaatgaa aaaggccatg gcagtgttac    256380
     gtggagaaca accgtaatta ctgaccgacc aacggagtcc ccgtgtcgct gccacccctg    256440
     gtcgagccgg ccgccgagct caccgtagac gaggtccgca ggtactcccg ccacctgatc    256500
     atccccgatg tggggatgga cgggcagaag cggctgaaga acgccaaggt gctcgccgtg    256560
     ggcgcgggcg gcctcggctc gccgaccctg atgtacctgg cggcagccgg tgtcggcacg    256620
     ctcggcatca tcgagttcga cgaggtcgac gagtcgaacc tgcagcggca ggtcatccac    256680
     agccaggccg acatcggccg gccgaaggcc gagtccgccc gtgacaccat ccagggcatc    256740
     aacccgctgg tggacgtgat ccttcaccag gagcggctcg aggccgacaa cgtgatggac    256800
     atcttcagcc agtacgacct gatcgtcgac ggcaccgaca acttcgcgac ccgctacctg    256860
     gtcaacgacg cctgcgtgct gctgaacaag ccctacgtct ggggttcgat ctaccgcttc    256920
     gacggccagg cctccgtctt ctggtccgag cacgggccct gctaccgctg cctctacccg    256980
     gagcccccgc cccccggcat ggtcccgtcc tgcgccgagg gcggcgtcct gggcgtgctg    257040
     tgcgcgtcca tcggctccat ccagaccaac gaggccatca agctcctcca gggcatcggg    257100
     gagccgctgg tcggccgcct gatgatctac gacgcgctgg agatgaccta ccgccaggtc    257160
     aaggtccgca aggaccccaa ctgcgcggtc tgcggcgaga acccgaccgt caccgagctc    257220
     atcgactacg aggccttctg cggcgtcgtg tccgaggagg cccaggcggc cgccgccgac    257280
     tccacgatca ctcccaagca gctcaaggag tggatcgacg acggcgagaa catcgagctc    257340
     atcgacgtcc gcgagccgaa cgagttcgag atcgtctcca tcccgggggc ccggctgatc    257400
     ccgaagaacg agttcctcat gggttcggcc ctcgagaacc tcccgcagga caagaagatc    257460
     gtcttgaatt gcaagacggg tgtccgcagt gcggaagtcc tcgcggtcct caagtccgcc    257520
     ggcttctcgg acgccgtcca cgtcggcggc ggcgtgatcg gctgggtcaa ccagatcgag    257580
     ccggagaagc ccgtctactg accggctccc caacccgctt tcccgacggc gggggtttcg    257640
     cgcaccgcag gtgcccgaag cccccgccgc cgtcatgagc agaccttgcc gtccttcggc    257700
     accgtcccct tcaacaggta ggcgtccacc gcggagtcga cacagtcgct cccgttcccg    257760
     taggcaccgt gtccctcgcc ctgccaggtc agcaccacgc cgacgtcctt gcccagctcg    257820
     tccgccatcc tgcgggcgcc ctcgtagggc gtggccgggt cgcccgtgtt gccgaccacc    257880
     aggaccgggt ccgcgccggg cgcgctcacc tccgcggtct cgtgctgacc ggccaccggc    257940
     cagtcgtggc accacccggc cgtgtcccag ccgaggaagg cgccgaagac gggagagacc    258000
     ttctcgaacc tcggcagcag cttcttcgtc tcctccacgg tcggccgctg cttgtcgtcc    258060
     aggcacgata tgaccctttg cgagtgggtc gtcgtgccgt agcgccccga aggatcacgc    258120
     tcgttgtagc cgtcggcgag ggccagcaac tccgagccgt cgccctcctc ggccgccttc    258180
     agcgcactgg tcagggccgg ccagccgctc tcgctgtaca gcggcagcac gatgccggtg    258240
     aacgcgaggg tctgcgtcag ctcccgcccc ggcgaggacg tgggcagcgg ctcggcgtcc    258300
     agccgctcca gcaggccggc gatcttccgc gacccctgtt cgggttcctg gccggtcgac    258360
     tccaggtagt cgtccagcgc gcgctggaaa cccctggcct ggttctcggc gtggcccatc    258420
     gtgtcggcgc ccgggtccac caccgcgtcg aggatcacgc ggcccacgtg ctcggggaac    258480
     agatgggcgt agacgccgcc gagttcggtg ccgtaggaga tgccgaagta gtgcatcctc    258540
     tcgtcgccca ggacgtgccg catcaggtcc atgtcgcggg ccgtgtccgt ggtcgagacg    258600
     tgttccatga gcttgccggc ggccttctcg cagcccctgc cgaagtcggc ggcgtccttc    258660
     aggtaggcct gctcctcggc cggggagtcc ggcgtggagt ccaccgactc ggcggcctcg    258720
     atcgcctcgt cggtgcggca gcggacgccc tcgctggcgg ccaccccgcg cgggtcccag    258780
     ctcaccaggt cgtaccgctc gtgcagggag gagacggtgt cggcgtagga cggcatcgtg    258840
     gagacgccgg aggcgcccgg gccgccgaag ttgaacagca gggagccgat gcggtcgtcc    258900
     ccgctcgccc gggaccggat cagcgcgaga tcgatcgtct cgccgtcggg gtcggaccag    258960
     tccagcggtg ccttcagcgt ggcgcaccgc cagtcgccgt ccggtgccgg ggcatcgtcg    259020
     gtgccctcgc atcgggccca gtccagcgtc tgggacgcca gtgcctccgg caccccggag    259080
     ggtgccgccg ccgaaggtcc cgcgctgctc ctgcccccgt cgtccttgtc ctcgtcggac    259140
     gagccgccgc tgcagcccgc cgtcagcagt gcggcggcgg ccgtcagagc cgtccaccgg    259200
     acgagacgcg ccatgtcctc tcccccctgg caagccgtcc gcgccgtgcg gcggatggcg    259260
     ttcctgccat ggtaggtggc gggggcagca cccgccgacg cctgtggata acgctctgac    259320
     ctgctacttc tgtcgatctg ctgcttctgc cgacctgtgg tggcgtccgc ggtcaggagc    259380
     acacggtctt ggccgccggt acctttccgt cgagcaggta gccgtgcacc gcgtcctgca    259440
     cgcacctgtt cttactgtcg taggcaccgt gcccctggcc cttgtagatg agttcgacgc    259500
     cgacgccctt gccgagcgcg tccaccatcc tcccggcgcc ctcgtagggc gtcgcggggt    259560
     cgccggtgtt gccgatcacc aggatcggcg ccgcccccgg cgcgtggacg tccgggtggt    259620
     cggcggctcc ggcgaccggc cagtccgtgc agctgagcat ggaccaggcg aggtagtcgc    259680
     cgaacagcgg ggaggcgtcc cggaactcgg ggagcttgtc ctccacgtaa gccgggtcgt    259740
     accgcggttt gtcgtcggca cagttgatgg cgacgttggc ggcggtgatg ttgctgtact    259800
     cgccgtcctc gttgcgcccg ttcaacgcgt ccgacagcac catgaggacc cgtccgtccc    259860
     cgtcgtacgc ctgctccagg ccctcggtga ggtactccca gaagtccttc gagtacagcg    259920
     cctgcgcgat gccgccggtc gcggcggtct cggtgagttg gcgggggaag atccccggga    259980
     tcggcttgcg gtcgaggtcc ttcaacaggc gggcgatgcg cgcctcgacg tcctcggccg    260040
     tgtccccgac ggggcagtcc tcgaccttcg acacacagtc ctcggcgaag ttgtcgagcg    260100
     ccagctggaa acccttggcc tggcccagcg agccctgttc cgcggtctgc gtcgggtcga    260160
     cgaccgcgtc gaagacggca cggcccacgt gccgggggaa gaggtgggcg tagacgccgc    260220
     cgagttcggt gccgtaggag atgccgaagt agtgcagctt ctcgtcgccg agtacctggc    260280
     gcatcaggtc catgtcccgg gcggcgtcgg tcgtgcggac gtgcggaagg atcttcttcg    260340
     agtgcttctc gcaggccgcg ttgaactcct ccgtgttgtc cacgaactcg gtgcgctcgg    260400
     cccggtcgtc gggcgtggcg tcctgctgga aataggtgtc gagctgtttg tcgtccaggc    260460
     actcgacggg gtcgctgcgg ccgacaccgc gcggatcgaa gctgaccagg tcgtagcggg    260520
     tgcgcagctt cgcgtagtcc tggccgaagg cgggcagcgt ggtgacgccc gatccgcccg    260580
     gcccgccgaa gttgaagacg agcgatccga tccgccggtc cgccgcgccg tcggcctcgg    260640
     cccggatcag cgcgaggccg atcgtgtcgc ccttgggatc gtcccagtcg aggggcgcct    260700
     tcatggtggc gcactgccac tcgtcgccgt ccggcagcgg agagggggcg gcgccgccgc    260760
     cctcggcctc ggacggtgcc gggcagttct tccagtgcag cttctggccc gacagatcct    260820
     cgtcgtcctc ctgcgacccg ccgccgcagc ccgccagcag ggcggacagc gcggcggcgg    260880
     tggcggtcag ggcggcggcg cgcagccggg agggattcgg catgcgtcca tcgtgcggtc    260940
     gcgcgcgagc acccgcgcgg gcccagggcc gtacgaggta cggagcgccc ttctcgtacc    261000
     gggctacaga gcctctttgc gcgtgaggtg gttgaagacc agccaccccg gcagtaccgg    261060
     aagccacagg gtgagcagcc ggtagagcag caccgcgggc gcggcgacct ccttggggag    261120
     gccgacggcg atcagtccca ccgtcagcgt cgcctccacc gcgcccacac cgccgggcgt    261180
     cggcgcggcg gacccgaggg cgttgcccgc gaggaagacg accgcgacgc tggccaggct    261240
     gatggacgac gactcgtcgc cgaaggcgcg gatcgaggcg tccaggcaca tcacgaaaca    261300
     ggcggtgagc agcagcatgc cgccgatgcc ggtgatcagc ttctgcggcc gctgcagcac    261360
     gtccagcatg cgcggcacga ccccggcgaa gagcgaccgc acgcgcgtga cgacgaattt    261420
     gcgcaggaac ggcaccgacg tcaccacgag caccagcacc gccaccgtca gcagacccgc    261480
     gatgacggtc cgggacggcg acagcgacgg tgtcttctcg gtgccggtca gatagccgaa    261540
     ggacagcagc atcaggatgt ggcagccgag cccgaacagc tgggacgcgc cgacactcgc    261600
     caccgcaagc ccggggcgca cgcccgcgcg ttgcaggaag cgggtgttca gggcgacgcc    261660
     gccgaccgct gccggggcga cgatcttcac gaacgatccg gcgacctgcg cggccacggt    261720
     ccgcaggaac ggcacccgct cgggcacgaa acccagcagg gacatcgccg ccgcgacgta    261780
     gctcgccgcc gagaacagca cggccgcggc cacccacccc cactgggcgt tcgagatcag    261840
     cgggccgaac tcgatgtggg tgagctgggt gagcaggaag taggcgccga tcgcgccggc    261900
     gatgaagctg atcagcgtgc gcggccgtac ccgctccagc cgggccggct cgacgggggc    261960
     ctgcggcctg atgcgcagca ccgcgtggcg gatctgggtg agcaggtcct cctcgcgggc    262020
     ctcctcgatg gcctcgtcca cggcccgctt ctcggcccgc tgctcggcac gtagggcctt    262080
     cttgtccgct ttgtcggtct gggtggcctt gtcggtctgc tccgccgggt ggctcgcggc    262140
     gtcgtgaccg gccgcctccg cgcgcgccag cttggcctgc cgggacgact ccagcaccgc    262200
     ctcgcgctcg cgctgggccc gctcccgcgc cagcctgcgc agggtcgcgc gggtggagcg    262260
     gctgagcgcg atgggctgga gcatgggcag gcagtccgcc accgtgtcgg ggccgaggac    262320
     cgccaccgcc gacgcgaccg cgcgttcggc accgacccgc aggccgagcg tcaccaggag    262380
     ctgggagatg tccatgcgca gcagcaggtc gccggcggcg atctcaccga tgcgcagatc    262440
     ggtgaggatc accgtgccgg aacgatccac caggatcgcg tcgcccacca gcctgcggtg    262500
     cgcgatgcgc cgggactgca gggcccgtac ctgctcccag gtcccgtgca gcaggtcgtc    262560
     ggtgatctcc tcgtccgcca gcgagtccag ggagcgcccg ccggtgtgct cgtagacgag    262620
     catcacggcg tcgggaccca gctccgacgt cgcgatcagc ttgggcgcgt tggcgccggc    262680
     cgcgatggcc gcgtaggcga gcagcgcctc ctgctccagc gcctgccgca gcgaagggag    262740
     gctgctgcgg gtggcgaagc cgcgcagcgt cagattgcgc cacgcgcggt agaagaagcc    262800
     ctgcgcctgc tgctcgcggt ccaccaccgt cacgtcgagc ggccggccgt cctccagcgt    262860
     gacgaaatag cggcgtccgc ggtcacccgt ctcgacgttg tcggacggcg cctcctgccg    262920
     ggcggcggtc accggccgga agcccacgtg ccgcaggccc gccatcagcg ttcggccggt    262980
     ggggcggacg ttgggggagc cgacggcgta gagggtgccg taggcgacgg tccagccgat    263040
     gaggacggtc aggatgatcg agaacggcgt cgtgtagccc gtgacgagca tcgagaaggc    263100
     gtcgaggagc agcacgatcc acagcaccgc gcgccagcgg ggtctgcggg acatgccgac    263160
     ggccgtcatg tacgcgatga ccggggcgag gtaaccgtgc accgggtcgg tcagtgcgtg    263220
     gatgtcaccc ggggacggct gggtgagcgc ctcctggatg gagccgggag cggccttggc    263280
     gacccacagg tcggtggcga gggtcactcc gtgcgcgagg accgccgcca gtacgccgtc    263340
     ggcgatccgc agaccgtccc gcttgatcag ccgctcgatc gcgaacgcga cgggcaccag    263400
     gaggatcgcg atgctggagg ccagcccggc gatcttgatg agcaggtcgg gggcctgccc    263460
     ggtgcccttg ttgatgtcct gttcgagacc ggacgtggtg ccgtgcgcga aggccgcgat    263520
     ggcgaggagt acggcgacgg cgagtacgcc caccaggagg cgcaccaggt cggagggccg    263580
     gtgcacgcgc gcggggagca gtggttcgtc gccctcgacc tcgtcgatgt gcgccacgtc    263640
     gtcggggtcg gcggccgtcg ccgacgggcc ctcggccgcg tgctcgccgg ccgccccgtc    263700
     gcccgcgtcc ggggtgtccg ggcgcgacga agcgtcagag gtgccctcgg cgtcctcggg    263760
     gtgcacaccc tgctgcttca tcgcctcttc ttgctctcgt atcactggtc accgcccgca    263820
     cgatggtggc atgccgcgtc cgcctcggca ggcatcaggg tgcccgtgcg ggccgcacag    263880
     tctgcccgaa gcaccgcctg cgggcgaggg acgcgggctc tcgggagtgc gccgcgctgt    263940
     cggccgggtg cggcaggatg gggcggatga gcgagcagag ccttccggac ggcgtccgtc    264000
     cgcagaacgc ggatgcgctg cccgagtacg ccgagcgggt cctcgacatg accgaactga    264060
     tcccgccggg ccgcgtcatg acctacggag acgtggccga gtacttggag gagggaggac    264120
     cccgccaggt cggccgggtg atgtccctct acgggggagg cgtcccctgg tggcgtgtcg    264180
     tccgcgcgga cggggtcctg ctcgcggggc acgagctgga ggcgctcgac cgctaccggg    264240
     aggagggcac gcccctgaag gaggcgagca gggccgcaga ggggcacctg ccgcggctcg    264300
     acctgaagcg ggcgcggtgg gacggcgagg gacgcccaca ggggcacggc ggacgcgcac    264360
     agggtcacac ctgacagctt ccgccatgtg accggccgat gtgcgacgtg tgatccgtat    264420
     gaggtaaacc acgcacttcg ggcatgtccg tggcatgacg tacgttcgag gggcaggggg    264480
     cgctcgtgcc gcgagtgacc cgagggaaga agaggaagca ccgcttccgc ctcgtccccc    264540
     ggcgtagcgt cggccgcacg cgtgcccctc atcccgtggc caccgccccg cccacggcgc    264600
     ggacggccca ccagcacacc caccaggacc ggcgaaccac gtgagctcct cttcctccag    264660
     cggacacccg tcgcaccccc aggtgcgacg ggggagccgt ggcgcttacc gactggtgcg    264720
     taccccgccg gctcgcacgg acccccctcg tctggacgcc gcacagcgcg ccgtggttga    264780
     ccaccgctcc ggaccgctgc tcgtcctggc ggggccgggc accgggaaga ccaccaccct    264840
     ggtcgagtcg gtggcggacc ggatcgccag gggcggcgac cccgagcgca tcctggtgct    264900
     caccttcagc cgcaaggcgg ccgtcgagct gcgcgaccgg atggcgctgc gcatcggtgc    264960
     cgcgcgggcg ccccgggcga cgacctttca ctcgttcggc tacgccctgg tccgcgccca    265020
     ccaggacagc gacctgttcg tggagccgct gcgcctgctg tccggcccgg agcaggacgt    265080
     gacggtgcgc gagctgctcg ccgggcaggt ggacctggag cggctcgggc tcgcccatgt    265140
     gcgctggccc gacgagctgc gggcctgcct gaccacccgc ggcttcgccg acgaggtccg    265200
     cgcggtgctc gcccgcagcc gcgaactggg actcggcccg gacgcgctcg cggccttcgc    265260
     ccgccgcatc ggccgccccg actggcgcgc cgccgccgtc ttcctcgccg agtacctcga    265320
     cgtgctggac ctccagggcg tgctcgacta cgccgaactg gtccaccgcg cggtgctcct    265380
     cgcccgccgc cccgaggtcg ccgcgcacct gaccgcccag tacgacgcgg tgtacgtcga    265440
     cgagtaccag gacaccgacc ccgcccaggt acggctgctg cacgcgctgg cggacggtgg    265500
     gcgcaccctc gtcgccttcg gcgaccccga ccagtcgatc tacgccttcc ggggcgcgga    265560
     cgtgaacggc atcctggact tcccgaccgc cttcccgcgc gcggacggcc gtccggcgcc    265620
     ggtcggggta ctgcggaccg cccgccggtc cgggtccggc ctgctggccg ccaccaggct    265680
     gctgacccag cgcatgccac tgacccgcct ccccgccgac aaggtgcgtg cccaccgtga    265740
     gctgacaccg gtgcggggcg gcgggcgggt cgaggcgtac acgtatccga ccgccggtac    265800
     cgaactggac aacatcgccg acatcctgcg ccgggcgcac ctggaggacg gcgttccgtg    265860
     gcgcgacatg gccgtcctgg tacgcgccgg ctcgcgcacc atccccacgc tccgccgtgc    265920
     cctcacctcg gccggcgtcc ccctggacat cgacggcgac gacctccccc tgcgccacga    265980
     gcccgcggtg gcgcccctgc tgacggcgct gcgcgccgtg gcggaggcgg aggccgacac    266040
     gggggcccgg acgggggagc ggttcggggc gctcgggtcc gaggccgacg ccgatccgcg    266100
     cgccgacgcc gacgccgacg ccgacgccga cgccgacgcg tacgtggacg ccgacgccga    266160
     cgcgtacgtg gacgagggcg gagacgcggc gacgaagctc tcgcgcggtg aacacgcgta    266220
     ccgcgcggac gagccgtgct ggctgtccac cgagacggct ctcaccctgc tcacctcacc    266280
     cctcgccggg atggacgccg ccgacctgcg ccgcctcggc cgtgccctgc gcgacgagcg    266340
     gcgcgccgcg ggcaacccgc tgccgccgcc ctcggacgaa ctgctcgcac aggcactggc    266400
     cgagccggag cggctcgccg tgcacgaccc cgcgtacgcg cgcggcgccc agcggctcgg    266460
     cgcgctcctc cgcaaggccc gtgagcgcct ggcgggaggc ggcagcgccg aggaggcgct    266520
     gtgggacctg tgggacggga ccccctggcc cacccgcctg gagcgctccg cccggcgcgg    266580
     cggcgccgcc gggcgcaacg ccgaccgcga cctggacgcc gtgtgcgccc tgttcgcgac    266640
     cgccgcccgc gcggaggagc gcaccggtgg ccggggcgcc ctgaacttcc tggaggagat    266700
     cgacgccgag gacatcgcgg ccgacacgct cgcgcggcgc gcggtacgcc ccgacgccgt    266760
     ccgcctgatg acggcgcacc gctccaaggg gctggagtgg cggctcgtcg tcgtggccgg    266820
     cgtccaggag ggcctgtggc cggacctgcg ccgccgcggc tccctcctgg aggccgaccg    266880
     gatcggccgc gacggactcg ccgaacccct cagccccgga gcactgctcg ccgaggagcg    266940
     ccgactgttc tacgtggccg ccacgcgcgc gcgtgaacgg ctcgtcgtga ccgcggtgaa    267000
     ggcaccggcc gacgacgggg accagccgtc ccgcttcctg accgaactcg gcgtcgaacc    267060
     cgccgatgtc acgggccgtc cgcgccgccc cctcgccgtc gcggcgctcg tcgcggaact    267120
     gcgcgccacc accgtcgacc cccgcgtctc cgagccgctg agagaggcag ccgcgcgccg    267180
     tctggcccgc ctcgccgccc tgaccgacga ggacggccgt cccctggtgc cgtccgccca    267240
     cccctaccgc tggtggggca tgtgggaccc gaccgagagc aaggtgccgc tgcgcgaccg    267300
     cgaccagccc gtcacgctct ccggcagtgc cctggaccag ctggccaaca cctgcgccct    267360
     gcagtggttc ctgggccgtg aggtgaaggc cgacgcgccc gcgacgaccg cccaggggtt    267420
     cggcaacgtg gtgcacgtgc tcgccgacga ggtggcctcc ggacacaccc cggccgacct    267480
     cgccgtcctc atggagcgcc tggactccgt gtggaacgcg ctcgccttcg acgcgccgtg    267540
     gaagtcggcc caggagaagg ccaacgcgcg cgtggcgctg gaacgcttcc tgaagtggca    267600
     cgtcatggac cgcgccggac gcaccccggt ggcgagcgag cacgacttcg acgtgaccct    267660
     ggaggcgggc gagtacgagg tgcgcatccg gggccagatg gaccgcgtgg aaaccgacgc    267720
     cgacggccgc gcctacgtcg tggacttcaa gaccggcaaa caggcgccca cctcatcgga    267780
     ggtggcccgc cacccccagc tcgccgtgta ccagctcgcc gtccgcgagg gcgccgtcga    267840
     cgaggccttc gacggcgtgc gcccgcaacc gggcggcgcc gagctcgtcc acctgcgcca    267900
     gggcgcgccc aagcgggacg gcggcgagac cctgcccaag gtgcaggcac aggagtcgca    267960
     ggagggaccg gagggcgagt gggtcggcga cctgctggcc acggccgccg gcaaggtcct    268020
     ggacgaacgg ttcaccccga ccgcgggcca gcactgcacc cactgctcgt tccgcgcgtc    268080
     gtgcagcgct cgccccgagg ggcggcacgt cgtggagtga gcgacggctg ccgggacgcc    268140
     gggcgtgtgg ccggaccgga gccgccccgg cccaccggag ccgccgcgcc gagcggccgg    268200
     tgtgacacgt cgcaccacgc gggctgacct gcacttccct ccgacccgag aggacatccg    268260
     gcaccagctg tcagtggccg ccgctagcct ctctgacgtg cccgcccaca tcaccgatcc    268320
     cgagcagctc aaggagctcc tcggcatccc cttcaccccc gagcagacgg cctgcatcgt    268380
     cgcgccgccc gcgccgcagg tgatcgtggc cggagccggg tccggcaaga cgacggtgat    268440
     ggcggcacgc gtggtgtggc tggtcggcac cggccaggtc gccccggagc aggtcctcgg    268500
     gctcaccttc accaacaagg cggccggcga gctcgccgaa cgcgtccgta cggccctgat    268560
     cagagcgggc gtgaccgacc cggacgtgat cgacccggac cacccgccgg gcgagcccgc    268620
     gatctcgacg taccacgcct tcgcgggccg cctcctgacc gaccacggcc tgcgtctcgg    268680
     ccttgagccg acctcccgcc tgctcgccga cgccacccgc taccagctcg ccgcgagggt    268740
     cctgcgcgag gcccccggcc cctacccggc gctcacccgg tccttcgccg acctggtcag    268800
     cgacctcctt gccctcgacg gcgaactggc cgagcacctc gtgcgccccg aagacctgcg    268860
     cgcctgggac gccggtctcc tggacaccct ggacggcgtc cggctcagca acgccgacct    268920
     gcgcaaggtc cccgaggccg ccgccgcccg ccgcgaactg gccgacctgg tgatccgcta    268980
     ccgggccgcc aaacgccggc aggacctgct cgacttcggc gaccagatcg ccctgtccgc    269040
     gcagctcgcc ggactccccg aggtgggccg cgtcctgcgc gacgactacc gggtcgtgct    269100
     gctggacgag taccaggaca cctccgtggc ccagcgcatc ctcctcgcgg gcctgttcgg    269160
     cggcggcacc ggccatcccg tgaccgccgt gggcgacccc tgccaggcga tctacggctg    269220
     gcgcggcgcc tccgtcgcca acctggacga cttccccgaa cacttcgccc acgccgacgg    269280
     acggcccgcg gcccgccagg cgctcagcga gaaccgccgc agcggcggcc gcctcctcga    269340
     cctcgccaac ggcctcgccg agcccctgcg ggccatgcac gcgggcgtgg aggcactgcg    269400
     gcccgccccg ggcgccgaac gcgacggcat ggtccgctgc gccctgctga gcacccacgc    269460
     cgaggagatc gactggatcg ccgactccgt cgcccacctc gtgcgcaccg gcaaggcgcc    269520
     cggtgagatc gccgtcctgt gccgcacggc gaccgacttc gcggagatcc agggcgcgct    269580
     ggtggcccgt gacgtccccg tggaggtcgt cggcctgtcc gggctgctgc acctgcccga    269640
     ggtggccgac ctggtcgccg tctgcgaagt cctccaggac ccgggtgcca acgcctctct    269700
     ggtccggctg ctctccggcc cgcgctggcg cgtcggcccg cgcgacctcg ccctcctggg    269760
     acgccgcgcc cggctgctgg tgagccacgc gcgcgtggag ggcgacgacg accccgaccg    269820
     gaggctcgcc gaggcggtcg agggggtcga cccgtccgag gtgatatcgc tcgcggacgc    269880
     cctggacacc ttcctggaga cgccgctgga cggcaccggc gacgacgacg ggctgccctt    269940
     ctcggcggac gcgcgcgtgc ggttcgcccg gctcgccacc gaactgcgcg agctgcgccg    270000
     agccctgtcc gacccgctca tggacgtcct gcaccgcgtc ctcgccgtca ccggcctgga    270060
     ggtcgagctg tcggcgtccc cgcacgccct ggcggcccgt cgccgcgaga ccctgtcgaa    270120
     cttcctcgac gtcgccgcgt ccttcgccgc gggcgacggc gaggccaccc tgctcgcctt    270180
     cctgggcttc ttgcgcaccg ccgcgcagta cgagaagggc ctggacaacg cgctgcccgg    270240
     cggggagaac accgtcaagg tactgaccgc gcacaagtcc aagggcctcg agtgggacgt    270300
     cgtcgccgtg cccggtctcg tcaccggcac cttccccagc ggtcagggcc gggagaagtg    270360
     gaccgcccag ggcaaggtgc tgccgcacgg cctgcgcggc gacgccgaga ccctgcccga    270420
     cgtcgcctcc tgggacgccc gcggtctgaa ggcgttccac gaggccatga aggaccacca    270480
     gcacaccgag gagctccgcc tcggctacgt caccttcacg cgcccccgct ccctgctcct    270540
     cggctccggc cactggtggg ggcccagcca gaagaagccc cgcggtccgt ccgacttcct    270600
     gacggccctg tacgagcact gcgcggccgg acacggcgag atcgaggtct gggcggacga    270660
     accggcggag gacgaggaga accccgccct gcaccgggcg accgccgacg aggtctggcc    270720
     gctgcccctg gacgacgcgg cactcgcgcg gcgccgttcg gccgccgaga cggtcctcgc    270780
     ccacctggac ggactcgccg cccgggaaga cggtcccccc tccgcccccg ccacctacga    270840
     ggacccggac tggccgccgc ccccggagga cgacgaggga ctcccggagg aagcggagcc    270900
     cgaccgggcc ggggaccccg cccactggga cagctggacc acggagcgcc ccgccgccgc    270960
     gcgggaggcc gccaccgcgc cggagagccc tgccgccccg caggccggcc ccaccgtccc    271020
     gcaccaggcg ccgccccccg aacagccccc gggcaccgcg cccgtccccg ctcccgctcg    271080
     cctcacaccg gaggaggccc gcaccgtcgc ctcctgggac cgcgacctcg acgcgctcac    271140
     cggagagctc ctgcgcgccc gcgagagcgt caccgaagtg ccccttccgg cgtcgctgac    271200
     cgcctcccag ctgctgagcc tggccgccga cccggacggg ttcgcccagg agctggcccg    271260
     gcccatgccc cgcccgcccc agcccgccgc ccgccgcggc acccgattcc acgcctgggt    271320
     ggaggcccgg ttcgaaccgc tgaccctgcc gttgctcgaa ccggaagagt tgcccggcgg    271380
     cgacgccgag atcgccgacg accacgacct ggagttcctg aaggacgcct tcgagcgcac    271440
     cgagtacgcc cgccgcaccc cgttccgtgt cgaggcgccg ttccagctct cgctcgccgg    271500
     gcgggtcgta cgcggccgca tcgacgccgt ctacaaggag ggcgacggcg acaccgcgac    271560
     gtacgagatc gtcgactgga agaccaaccg cgccgccacc gccgacccgc tccagctcgc    271620
     gctctaccgc atcgcctggg ccgaacagca gcacgtaccg cccgcctcgg tgacggccgc    271680
     cttcctgtac gtacgcaccg gcgaggtcgt acggcccgag gggctgccgg accgcgcggc    271740
     gctcgagaag ctgctgctgg ccgagccggt cggtgacgaa ccgcacgacc ggggtgtccg    271800
     cgcgggccga taggctcgta agtatgagcc accccgttga caatgctgtc agcgctgtcc    271860
     gcacgtacat cgagcagcac cgcgccgcct tcctcgacga cctcgtcgaa tggctgcgca    271920
     tcccgtccgt gtcggcccag cccgaccacg cgaccgatgt gcgccgcagc gccgactggc    271980
     tcgccgccaa gctgaaggag accggcttcc cgaccgcgga ggtctggccg acccggggcg    272040
     cccccgcggt gttcgccgag tggccctccg gggacccgca ggcaccgacg gtcctcgtct    272100
     acggccacca cgacgtacag cccgccgccc gcgaggacgg ctggaccagc gagcccttcg    272160
     accccgtcgt ccgcgagaac cgcctctacg cgcgcggggc ggccgacgac aaggggcagg    272220
     tgttcttcca cacactcggc gtccgcgccc acctcgccgc caccggccgt aaggctccgg    272280
     cggtgaacct caaactgctg atcgagggcg aagaggaatc cggttccccg cacttccgtg    272340
     ccctcgtcga ggagcgcgcc gagcggctca ccgccgacgc ggtcgtcgtc tccgacacgg    272400
     gtatgtggtc cgaggacacc cccaccgtct gcaccggcat gcggggcctc gccgagtgcg    272460
     agatccggct gcacggaccc gatcaggaca tccactcggg ctccttcggc ggcgccgtcc    272520
     ccaacccggc caccgccgtc gcgcgcctcg tcgccgccct gcacgacgag cacgcgcgcg    272580
     tggcgatacc cggcttctac gacggagtgg ccgacctcac cgaccgcgag cgcgagctct    272640
     tcgccgagct gcccttcgac gagcggcagt ggctgcgcac ggccaagtcg tacgccgccc    272700
     acggcgaagc cggacacacc accctggagc gcatctgggc ccgccccacc gccgaggtca    272760
     acggcatcgg cggcggctac cagggccccg gaagcaagac gatcatcccg tcgtccgcca    272820
     tggtgaagct ctccttccgc ctcgttgcgg gccaggaccc cgatcacgtg gagaaggccg    272880
     tccgcacctg ggccgacgag caggtacccg cgggcatccg ctgcgaggtc gtcttcggct    272940
     ccgccacccg cccgtgcctg acgccgctgg accacccggc gctgcggtcg gtcgtccgcg    273000
     cgatgggacg ggccttcgac aaaccggtcc gcttcacccg cgagggcggc tccggcccgg    273060
     ccgccgacct ccaggaggtt ctcggcgccc cggtgctctt cctgggcatc tcggtcccgt    273120
     ccgacggctg gcacgccccc gacgagaagg tggaactgga cctgctcctc aagggcgtcg    273180
     aaaccgccgc ccacctctgg ggcgacctgg gggagcactg gcgtcacgcg ccctgagcgc    273240
     cgtgcacggt ccgggacccg accggcatcg cgcgcggcac actggaaacg ccgccccgca    273300
     cccgccgagc ccgcccggac ccggtcacca cccgccgtac gaaccgccga aaccgcctgc    273360
     cgaaccgaac cgctcaccgg gggagttgga agcacccgtg accacctgga ccgaccacac    273420
     cgccgaccgt cccatctcgc tcaccgcccc cagcggcgtc gaccgcgccg cccaccaccg    273480
     cctcgacgag gcctggctcg cggcggcgtg gagtcacccc tcgacgcgct gcttcgtggt    273540
     ctccggcggc caggtcctca tcgacgagac gcccgacggg gccaccgaac tcgtcatgac    273600
     cccctccttc gaggccccgc tcaccgaggc acaccgctac ttcctgggca ccgacgagga    273660
     cggcaccagc tacttcgccc tccagaagga ctccctgccc ggccgcatgg accagtccgc    273720
     gcgccccgcc ggcctgcgcg aggccggcct gctcctgtcc ccccgcgacg ccgggctgat    273780
     ggcccacgcg gtagccctgg agaactggca gcgcctgcac cggttctgct cccgctgcgg    273840
     agaacgcacc gtcatcgccg cggccggcca catccgccgt tgccccgcct gcggtgccga    273900
     gcactacccg cgcaccgacc ccgcggtgat catggcggtc acggacggtg aggaccgcat    273960
     cctgctcggc cgccaggtgc actgggcccg agggccgctt ctcgaccctc gccggtttcg    274020
     tggagcccgg cgagtccatc gagcagtcgg tgcgccgcga ggtccaggag gaggtcggcg    274080
     tcaccgtcgg cccggtcgag tacgtcgcga gccagccgtg gccttcccgt ccagcctgat    274140
     gctcggcttc atggcccacg ccacgtcgac cgagatcgac gtggacggcg acgagatcca    274200
     cgaggcccgc tggttctccc gcgaggagct gggcgccgcc ttcgagtccg gcgaggtcct    274260
     gccgccctac ggcatctcga tcgcggcccg cctcatcgag ctctggtacg gcaggccact    274320
     gccgacgcgc agcgccttct gagcccgggc gccgcagacg ccacgagagg ggcggccgtc    274380
     cccgtcgggg gagggccgcc cctctcgtcg tgctgtccgg ccggccggtt acgcgccgat    274440
     cttctgcttg acctgcgcca gcgacgggtt cgtcagagtg gagccgtcgg ggaagagcac    274500
     ggtgggcacc gtctggtttc cgccattcgc cttctccacg aacgcggcgg actccgggtc    274560
     ctgctcgatg ttgacctcgg tgtacgcgat gccctcgcgg tccatctggc tcttcagccg    274620
     acggcagtag ccgcaccagg tggtgctgta catcgtcaca gtgcccgaca tgtctctcgt    274680
     gctccttagg cgactcggaa agcggcggct cggggatgag gtcgcacgga gtgaacgtcc    274740
     gtggcggcac gaccattccc gtcgcgcact cgcaccgcgt gatgcctgtc gcattgatac    274800
     gactgtcagt gcgtgcctgt ggacaaccga ctcacccgtc ccgcgagacc tggcagcatg    274860
     gcggtgtgac agcagcaacg cactccaccc tcttcccgca ggtaccggac tcggccgacg    274920
     cggtgctcga agggctcgac ctcgagcagc gcgaggtggc gaccgccctg cgcggcccgg    274980
     tgtgcgtgct ggcgggagcc ggcacgggca agacccgcgc gatcacccat cgcatcgcct    275040
     acggggtgcg cgccgggatc ctccagcctt ccagcgtgct cgccgtcacc ttcaccaacc    275100
     gtgcggccgg cgagatgcgc ggtcggctgc gccagctcgg cgcctccggt gtgcaggccc    275160
     gcaccttcca ctcggcggcg ctgcgacagc tccagtactt ctggccgaaa gcgatcggcg    275220
     gttccctgcc ccggctcgtc gaccgcaaga tccagctcgt cgccgacgcg gccgccgcct    275280
     gccgcatccg cctcgaccgc ggcgagctgc gtgacgtcac cgcggagatc gagtggtcca    275340
     aggtgaccca gacggtgccc gccgactacg ccccggcggc tgccaaggcc ggccgtgagg    275400
     cgccccgcga cccggcggag atcgcgcagc tgtacgccgc ctacgaggac ctcaagcgtg    275460
     cgcgctccgt catcgacttc gaggacgtgc tgctgctgac ggtggccgtc ctccaggacc    275520
     ggcacgatgt cgccgagcag gtccgcgccc agtaccagca cttcgtggtc gacgagtacc    275580
     aggacgtcag ccccttgcag cagcgtctgc tggagctgtg gctcggggac cgcgacgacc    275640
     tgtgcgtggt cggcgacgcc agccagacga tctattcgtt cacgggagca acccccgacc    275700
     atctgctcga cttccgcggc cgccaccccg gcgccaccgt cgtcaagctg gtccgcgact    275760
     accgttccac cccccaggtc gtccacctcg ccaacggcct gctcgcccag gcccggggcc    275820
     gggccgccga tcaccgcctg gagctggtct cccagcggcc cgcgggcccc gagcccggct    275880
     acgccgagta ctccgacgag ccggccgagg ccgagggcgc cgcccgccgc atccgcgaac    275940
     tcatcgactc gggcgttccg gccgccgaga tcgcggtcct gttccggacc aactcccagt    276000
     cggagaccta tgagcaggca ctcgccgacg ccggggtccc gtaccagttg cggggcgcgg    276060
     agcgcttctt cgaccggccc gaggtgcgca aggccggcag tgccctgcgg gccgccgccc    276120
     gcttcggcgg caacgactcc ctcctcgacg acgccgtcga cctgccctcg caagtgcgcg    276180
     cggtgctgtc cggggagggc tggacgaccc agcccccggc cgggtcgggc gccgtccggg    276240
     agcggtggga gtcgctggcc gccctggtgg gactggccca ggacttcgcc gccgccagag    276300
     cgggagccac gctgagcgac ctcgtcgtgg aactcgacga gcgcgcgggc gcccagcacg    276360
     ccccgacggt gcagggcgtc accctcgcct ccctgcactc ggccaagggc ctggagtggg    276420
     acgtcgtgtt cctggtcggc gtcgccgagg gcatgatgcc gatcacctac gcaaagaccg    276480
     acgagcagat cgaggaggaa cgtcgccttc tctacgtcgg tgtcacccgc gcgcgtgaac    276540
     gcctgcacct gtcctgggca ctggcccggt cgcccggggg ccggccgaac cgcaggccca    276600
     gccgctttct gaaggggctg cggcccggtt cgggcacggc gggcggacag gcggccgccg    276660
     cgggtgccgg gggcgtggag cgcgggatcc gagggggcgg cggtggtggc gcggccgccg    276720
     cgccgagacg gacccagcgg acgcccgccc gctgccgggt ctgcggacgc acgctcaccg    276780
     acgccggtga gatgaagctg atgcgctgcg aggggtgccc gtcagacatg gacgagggcg    276840
     tctacgagcg gttgcgggag tggcgggcgg tgcaggcggg gcgcagcgga cagcccgcgt    276900
     tctgcgtctt caccgacaag acgctgatgg cgatcgccga gtccgtcccg gaggacgagc    276960
     gggagctggc caggatcccg ggggtcggga tgcgcaagct caatcgctac gggaccgacg    277020
     tcctggccat ctgcgcaggc caggaaggcg tggggcttga cgaggacgac tgatacaaac    277080
     tcgtcgagaa aatagtttgc gcatgcccgg ggaatcccca taggttcttg gtcacgggaa    277140
     cagcggcctt cccggaggcc ctgaatccgt gttgtacttg catatccgcg gactggttcg    277200
     tcccagtccc ccgagacgcc gagaggaggc gagcccagtg atcagcatca agagcagctt    277260
     catcgtcagc tccaccgcca aaatgaccga tcgctcggcc gtctccctgt gcatgctcgg    277320
     cgcttctcac tcgggcaccg gtctgtccgg cattcgtgcc gtgcgtccgg ctgccgccgc    277380
     tgctgctccc gcgggccttc ccgtccggga gcgcaatgag cgaccgacca aggcactgga    277440
     agcagcagta gcggcacagg cgcaggccta tgcctttacc gcgaccggtg ccggattccg    277500
     gaagcagacg acgcagcacc acctgatgtg ggccttccgt gggccagaac cctggagtga    277560
     tccagcctga tcgtcgatca ggccggcgcc ttcagggccg cggaacccca cccgggatcc    277620
     gcggcccttc tgtttgtccc cgaacggggg cgacagcacg aaggagcctc gggacaagaa    277680
     aagaacccgg taccaagccg ccacccggtc aaccggccgg aacgaacaga cgaggaagac    277740
     caccccgtgc aactcgaagc gcacgccccg tccgtaccgc cttccgacac gatccccaag    277800
     ccctgttcca cggaggactc caccttgacc ccgctcaccg cgctcaccgc gctcgacgac    277860
     gccatcgaga acctcggcgt acccgtcccc tgccgctcct acgacccgga ggtcttcttc    277920
     gccgagtccc cggcggacgt ggagtacgcc aagtccctct gccgcacctg cccgctgatc    277980
     gaggcctgcc tcgccggtgc caaggagcgg cgtgagccct ggggtgtctg gggtggcgag    278040
     ctgttcgtcc agggtgtcgt cgtcgcccgg aagcggcccc gcggtcgccc gcgcaagaac    278100
     ccggtttcgg catgaacacc gcaggaacga tcgaccgccc cctgacgtac gacccccaga    278160
     agcaggcccc gatgaagccg tccacccacg acctcgcagg caccgcgcct gaagacttca    278220
     ccaccagtga cgcgaaggac tcgcgtcaga acaggacccg tgaaatgcaa ctcatcccag    278280
     aagccctggc acgtgcgcat atgcacgacc gcctgcatga ggcggagcag gaacgccggg    278340
     cgctgcgcct ggcgaccgct cgccggatgc agcgccgggc ggagcgcgcc tcgatgcgtg    278400
     ctcggcgtgc gctggccatg gcggtcatgc agtaaccgac acacctgaaa cacccgaagc    278460
     agtggtctcc ctacgggaga cgaagctccg ctcgcgtggg ggccggtccg tccgaacgga    278520
     ccggccccca ccgcgcgttc ggctccggtg gatcagtcga tcggtggatc aggcctccgc    278580
     ggccgttccc tccgtctcgt acacgtcctc gtccgcttcc tcgccttcct ccacctcggc    278640
     ctcgccctcg gcgacgaacc cgaccagcca ctcctccaac tcgtcgcgca gccggaccgt    278700
     ggcacccagc tggcagagca caccgatggt gctcaaggtc acgcggtgga tcaggagata    278760
     cgccggcggc aggttgagct gcttggccag ctggtacgcg ggggagcggg ggtcaccgat    278820
     gcgggcggcc tggctccgca tccagccgcg ggtgaaggtg aacgcgtcga ccctggccgg    278880
     ctcgatgatc ggaagcaggt actcgagaac ggcgtcgggg gccagctcta tcgactcctt    278940
     gacgaagcct tccgcgcaga gcatctcgta gacggcctct gcctcgccgt ccagcgtcat    279000
     gcgcagggcc tcgccgatgg gttccggcag accgcccgga aggcggtcga ccgtgccgaa    279060
     gtccaggacg cccaggcgcc agtcgtcctc gccccgaggc ccgccgggca gcagccggaa    279120
     gttgccgggg tgcgggtcgg cgtgcaggag cccggtgcgc gcgggaccgg agaacaggaa    279180
     gtgggcgagc aactgacccg cccggtcgcg ctgctcctgc gtgccgttcg agatgatctc    279240
     cgacatcggg atgccgtcga tccactcggt gatcagcacc tgctcgcact ggtggatgac    279300
     gtccggtacc acgatgtccg ggtcgtcgtc gaagacctcg gcatgcgtcc gctgggcctg    279360
     cgcctccagg tcgtagtcca gctcctccga gacccggtcc ttcagctccg tgatcagcgg    279420
     cttgatgtcc atgccgggga ccagcgggcc gagcaggcgg gcgaagcggc tgagctggtt    279480
     caggtcggac agcagtgcct cgccggcgcc cgggtactgc accttgaccg ccacctcgcg    279540
     gccgtcctgc cacacccccc ggtgcacctg gccgatcgag gcggccgcgg cgggcttgtc    279600
     ctcgaactcc aggaacagct cctgccagtc ctcaccgagc cgctccgcca gcacggagtg    279660
     cacggtgcgc gtcggcatcg gcggtgccgc ctcctgcagc ttggtcagcg ccgcacgata    279720
     ggggccggcg acctcctcgg gcagtgccga ctcgaagacg gacagggcct gcccgaactt    279780
     catcgccccg cccttgagct cgcccagcac cttgaacaac tgctccgcgg tgcgctgctg    279840
     cagctgctgg ccgacgatct ccgcggactc gccgacgatt cgcttgccca gcccccaggt    279900
     ggcccgcccg gcgaagccga gcgggagcgc ggcgagcttg gcggtccggg tgaccgcctt    279960
     gcgcggaaga tcagacatgc gccctccaag tcccagccgg ccgcgcccgt tccgcctcgt    280020
     ggcgtacttc cgctgacggc ccttgcccag ccattgtcgc gcgccacccc ccgtcctcgg    280080
     ggatgtgttc ctgcttacct ttccgggccg ccccgcaggg gcacgaaggg tgtggccgga    280140
     ccggccgcac ctgccatcgc aggccgggca gcgagacctc ccagcgcgct ccggtgccgg    280200
     agggcgtcct gccgtccagg aaggcgagcg cctgagccgc cgcgaacccg gcgacggtcg    280260
     tcgcgagagc gaggtcgcag ggcggtaccc ggtgccgccg gccggagcgc cactgcgcca    280320
     ccagccgagg aaaggcgggg tcccggcccg tacgctccgc gtgcagacat ccggcgcacc    280380
     ccgtctcgcc gggcaggacc agagggccga cgacaccggt tccctccacg acaccggcgt    280440
     agaggtgggg tgtgccggag gccatcaggg attccgcggc ggtggggtcg ggcgtgtaca    280500
     ccgcgacgtc gtcgcgcggg gcgacgatca ccagggagag gcccggggcg ctctcctcgg    280560
     gcggtgtcgt cgggcctcgg cggggaggcc ggccgggagc ggcccggcgc acgaggcggc    280620
     gggccgtctc gtcccggcgg tcgccgaccg cctcggcggg caggccgccc ggagcgacgt    280680
     cccacggctc gacgcgtccg ccgtcgcgca cgtcgatctc gccgacgccc gcgcccgaca    280740
     gcaggccggc cagcaccgca cccactcgtc cggcgccccg cacacccacc cgcagggcgc    280800
     gtcgggcggc caggtgtctg atcgcgtcgc ccggttccga ggtcgtcagg gacagcgagg    280860
     ccagatcggg gcggagtcgg tcgaggacct ccttcttcgc gcgcagcgcg tcggcggccg    280920
     gcccgccgcc ccgggagtcg tcgagcagac cggccagcgc caggcgctcc acgacccggt    280980
     cgacatgccc gtccggcagg tccatgcggt gccccgcctc gcgcagcagc gccgggccgc    281040
     gggtgccgtt gagcagttcg aggaagctgc ccgtcgccgt gtccaccggt gccagggtca    281100
     gcgcgtgcgc cggagtcatg ccgaactgca cggtgttcag atcgcgccag ccgcgcctga    281160
     gcgcgggctt caccatcgga tgcatgccag gtcccccgta tgtctcgcgg tgtccgtgtg    281220
     cgggcccgcc gtcggccgcg aatccgccgg cgagtgccag catgcccggc tgcgcggaga    281280
     ggcgtcgaaa gttgtccaca ggcggtgggt attcgtcata cgaatcagcc gcccgtctcc    281340
     caggacgagt ggtggatcgg caccgatgcg tcccggagcc gggacttccc cgtgtgcagc    281400
     gggtaacgtc gtggcgtgtc cgccgaccca ctgcaccgcg ccggggcacc cccgcgcaca    281460
     ccgacgaatc cagcgccgag cggcccgggg acgagcccga tcgaggtgcg cagaagcgcc    281520
     cggcgacgcc ggacggtctc cgcgtaccgg gagggtgatc gcaccgtcgt gctgatcccc    281580
     gcccggatgt ccgaggccga ggagcaacgc tgggtgagcg tcatgctgga caagctggcc    281640
     gcccaggaga gcaagcgcgt cctgggcgac gccgagctgg ccgagcgcgc cgagcgcctg    281700
     tcgggccagt acttcgaggg ccgggcccgg cccgcctcgg tccgctgggt caccaaccag    281760
     aacacccgct ggggctcgtg caccccgtcc gagggaagca tccggctgtc gcaccgcctc    281820
     cagggcatgc ccgagtacgt cgtcgactac gtcctcctgc acgagctggc gcacctgctg    281880
     gtccccgggc acgggccccg gttctggcgg ctcctggagg cgtatccgcg gaccgagcga    281940
     gccaggggct acctggaggg tgtggtcgcc gcggaccggc tgccgcacgt tcccggagcc    282000
     cgcagcgagt aagcccgtgc ggccccgaag ggggtccgac acggtcgcgc acgggtttcg    282060
     taccgggtct gtaccgactt cctccggtgt ccgtgtttgc cgttagcctg tcgcgacgca    282120
     ctcacattcg gatgggggac ggtcgtaacg catggccagg gaatttcaac gcggccacaa    282180
     ggccaggatc agtgacctca cctcgggcac ggatctgtac gtaggtgtgc agatctccgg    282240
     ccccgggctg aacttcgaca tcagctgctt cggtctcgac gccgacgagc ggttgtcgga    282300
     cgaccggtac ttcgtgttct tcaaccaacc gaagaccccc gaggagtcca tccagctcct    282360
     gggtgcgcag gcgggtgaca ccgagtcctt ccgggtcacc ctcgacagga tcccgcagca    282420
     gatccagaag ctctccttca ccgcgacgat cgacggcgcg ggacagatgt cgcaggtggg    282480
     gcccggatac atccggatcg tcgcgggcgg cgaggaggtg gcccggtacc cgttcagcgg    282540
     ttcggagttc tccaccgagc gcgccgtgat gctgggcgac ttctacctga aggacgtgtg    282600
     gcgcttcgcc gccgtcgggc agggcttcga cggcggtctc gacgcgctgc tgaagaactt    282660
     cggcggcgag gtggccgagg acgaggcccc cgcaccgcag caggccccgc agccgcaggc    282720
     cggtgccgcc ccgggcttcg ccccgcccgc ccaggccgcg gcgccgccgg ccttcggcgc    282780
     gcccgccgcc ccggctcccg cggcccccgc cccggctccc gtgccgcagc ccgcaccgca    282840
     gggcttcgcc ccgccgccgg ccgccccgcc gccaccggct cccgtcccgg cgcccgggcc    282900
     ggacgtgcac gccgcgcaga ccatcgtcgc gcccatgaac acgccgcccg gcggtgcccc    282960
     ggtgccgccc cccgccccgg cgcccgcgcc gtacggccag ccgggccagc ccggccagca    283020
     gccgccctac ggccaggttc tcggccagac cgcaccgccg ccccccggct acggccagcc    283080
     gcaagccccc caggccccgg ccccgccgcc cggctacggc cagccgaccg cacctcccgg    283140
     ttacggacag cagcccggcc cgcccgcggc ctacggccag caggcgcccc cgcccggata    283200
     cgggcagcag cctccccagg ccatgccccg gggtgcgccg cagggcgccg gtgtgaccgc    283260
     tgcgctccag cagttccggg agaccccgac cggccagcgc tggacccagc agaacaagaa    283320
     actggtccgc gtcgacctcg gcgcggaagg ccagcccgtc ctcgcccgcc agggcagcat    283380
     ggtgctctac cagggcaagg tcgacttcag ctacaagggc gccggattcg ccggccgggt    283440
     cgtgggcaac gccaccggcc aggagatgca gctgatgcgc tgcaccggga agggacaggt    283500
     gttcctcgcg gagaactccg cgatgctgca ccccatcgag ctccagggcg acgccgtctg    283560
     cgtctccgcg gagaacgtcc tggccttcga cgagagcctc cagtacgagg tccgccgcat    283620
     cgagggccac ggcatcccgg gcggcgcgct gttcacgatg cagttccagg gcaccggcac    283680
     ggtcgtcgtc aagacgcgcg gtgtgcccgt ggtgctgccg gtgacgccca cgaccttcgc    283740
     cgactgcaac gccgtggtcg cctggtccgc cgccgcccag gtggtcgtct ccagccaggt    283800
     gcggatgcgc cgcaactcct acgcgggcga cacgggcgaa agcgtcaacc tgcagttccg    283860
     ggccgcgccc ggcagcttcg tcgtcgtcca gccgtacgag atctgaggga gagcccgaca    283920
     tgaaccagcc gctcgcgggc tacgcccccg ctcctgccgg cgcccgcatg gagaaccacg    283980
     gcaaccacat gctgaaggtc gccatgcaga ccggaaacga cctcctcgcg cgcgtgggct    284040
     cgatgaccgc ctacgagggc ttcgtccagt acgagccgaa cccgccggcc gtccgccaga    284100
     tcgccaagga ctggatgacc ggtgagggcg cgcccctgat gaagtgctcc ggcgacgggc    284160
     tgctctacct cgccgactac ggtgccaacg tcgtcgtgat caacctcaac ggcgacggga    284220
     tctccgtcaa cgccaccaac ctgctcgcct tcgacgccca cctgacgtgg ggcgtggagc    284280
     gcgtcaaggg cctggcgaaa ttcgccgggc agggcctgtg gaacacgaag atctccgggc    284340
     agggctgggt cgcgctcacc tcccggggca agccgatcgt ggtcgactgc ggcggcggcg    284400
     aggacgagac ctacgtcgac ccggacgcgc tcgtggcctg gtccccgaac ctcaaggtga    284460
     agggcaagcg cagcttcaag gcgcagtcgc tgatcggccg cggcagcggc gaggccttcc    284520
     agatggcctt ctccggtcag ggcatcgtcg tcgtccagcc cagcgaggac agcaccgacc    284580
     gcctccgggt ccggggctga gggggagcca gaacatcatg cagagcccga ttttcgccta    284640
     caacgaccag cagacccagg aagcctggag cctgcagaac aagcacatgc tccgtgtcgc    284700
     cctgacgggc cacgacgacg tgctcgcccg caagggcacg atggtcgcct accaggggct    284760
     cgtcgagttc gacgccgagt accagagcaa cagccagtcg cgctcgcgtg cgcacaccgg    284820
     cgagggcctg gacctgatgc gctgccacgg gcagggcacg gtctacttct ccaacctcgc    284880
     ccagtgcgtc cacgtcgtgg acgtcgacca ggacggcctc accgtcgaca gcagctacgt    284940
     gctcgcgatg gactcgaacc tgcaccacga ggtcatcgcg gtggacagcc tctacggcat    285000
     ctccggctcg gggaagtacc agctcaacat cacgggccgc ggaaaggtcg ccctgatgac    285060
     ctcgggctcg ccgctgttca tgcaggtgac acccgacaag tacgtcaact gcgacgccga    285120
     cgcgatcgtg gcctggtcca ccggtctgcg cgtgcagatg caggcccaga cgcactcctc    285180
     cggggtgtgg cggcgccgcg ggaacaccgg tgagggctgg gagctgagct tcatgggcag    285240
     cggcttcgcg ctcgtccagc ccagcgagct gctgccgccg cagaacgccc aggtcgggca    285300
     gggcctcgcc gcgcagtacg gcatggggca gcacggggcc cgcggtcaga gccagggcaa    285360
     cgtctggagc tgagccgccc ggccgccacg gtccggtaag gggtgatcgc catggcggcc    285420
     accccttacc ggtcacaggc gggcgcgggt cgcctccagc aggcgtacga ccgagtcgtc    285480
     ggccacgtcc gcgacctccg cgtaggggaa ccagcgcagg tcgagcgact cgtcactgat    285540
     cgcctccacc gcgcccgggg gagccacggc cgcgtactgc acgtccaggt gccaggcgca    285600
     gggcgtgtgg tgccggtcca accgcacggg gccgccggcc agcagggcca gtccggcgat    285660
     gcccgactcc tccgtgccct cgcgcagggc cgcccgggcc agcgtctcgt ccaccggctc    285720
     gcagtgaccg cccatctgca gccacatgcg caacttcttg tgcagggtga gcaggacccg    285780
     ctcgcgcgac ggatcgatca ccaaggcgct cgccgtgacg tgtccgtccg cgcacgcctt    285840
     ccacatcccg tccgggtgcg tcgcgagatg gtccaggtag acctgccgca gctcgtcctg    285900
     gccctcgtac gccttcagga ccaggaccgc gtcgtcgtgg aggctcactc gccgtcgtcg    285960
     cccttgggct cgtcccggtc ggcggaccgg ttctcgcccc ggtcgccctc gtccttcttc    286020
     ttcagatcgg gcttgcccgc cgcctcgccg agcatcttgt ccagctcgga gaagtcgagc    286080
     tgctcacggt gcacgaagcc gtccgggtcg tccaggtcgg tcgcggtcgg cagcatgtcc    286140
     gggtgggccc acagcccgtc ccggccgtcg acaccgtgcg cgtccgtcag ggacgcccac    286200
     aggcgggagg cgtcgcgcag ccggcgcggg cgcagctcga gaccgatcag cgtcgcgaac    286260
     gtctgctcgg cgggaccgcc cgaggcgcga cggcggcgca gcgtctcgcg cagcgcgtcg    286320
     gcggaggaca ggcgcggctt cgcggcggtg tgcaccaccg cgtccaccca gccctcgacg    286380
     agcgcgagag cggtctccag ccgggccagg gccgccttct gctccggcgt gtcctccggc    286440
     tggaacatgc cctgctggag agcctcctgc agctgctcgg ggttctgcgg gtcgaactgg    286500
     ccgaccacgt cctccagctt ggccgtgtcg accttgatcc cacgggcgta gccgtcgacg    286560
     gcaccgaaca ggtgcgagcg cagccacggc acgtgcgcga agaggcgctg gtgggcggcc    286620
     tcgcgcagcg ccaggtacag ccgcacctcc tcctggggca cgccgaggtc cttgccgaac    286680
     gactcgatgt tcgccggcag cagcgcggcc ttgcccgccg ggccgagcgg cagacccacg    286740
     tcggtcgagc cgacgacctc gccggcgagc acgccgacgg cctgcccgat ctgcgtgccg    286800
     aacatggcgc cgcccatgga ccgcatcatg ccgatcagcg ggccggccat ggcctgcatc    286860
     tcctccggca gcacgtcgcc catggcgttg ccgacgcgct cggcgaccgg gtcgaccagc    286920
     tcgcgccacg cgggcagggt cgcctcgacc cactccgcgc ggctccaggc cacggcggta    286980
     cccgcgcccg acggcagggc cgtcgcgtcg tccagccaca gatcggccag acgcaccgcc    287040
     tcctggacgg cattgcgctc ggcgggaccg acgctggcgt ccttgcggcc gtccggcgtg    287100
     ccctgggaga ccgtctgccg ggcgatctgc ttggccatgt cccagttcac cgggccgccc    287160
     tcgtaggaga gcatctggcc cagctgctgg aacgcggcgc ccaggtcgtt ggggttcatg    287220
     gaaccgaaca tggcagcgaa cgggttgtcc gcgccggggc cgcccaggcc tccggctccg    287280
     gacatcccga aaccgaacgg gttggccggt ccctgaccac cgccgctctg ctggtccttc    287340
     ttcttgccct cgtcgccgtc gtccggctcc tccggcggaa ggccgaatcc gaatggggtg    287400
     tcactcacgg ggttcctcgg ctggtagggc cgccggttct ttccggcggc acggctgccc    287460
     gacttcacca cccagcgtag acacccgaag ccgatcgggc ctcggtgctt cgccgactga    287520
     cggcctgcgg caggatggat gccacctggt acgcacgcgt cgctcgcgct cgtactgaag    287580
     acaacctctg gagacgcccg gtgagttccc cagatccgca ggttcgcgca gcgcgaaacc    287640
     agtcaaccag ctccgcacgc cccggcgcgc gcggacccgt cgtcgcggtc accggcgccg    287700
     cgtccggggt gggggcactg ctcaccgcgc ggctcgccgc gtccgacgag gtcagacagg    287760
     tcgtggccat cgacgagcgg cgcggcgggt gcgaggcggc gcagtggcag atcctggacg    287820
     tgcgggaccc ggccatcgcc gagaaactgc gtggtgcgga cgtcgtggtg cacctggcgc    287880
     tcgacctcga cctggagacc gacgcggccg cccggacggc ttacaacgtc cgggggacgc    287940
     agaccgtcct gaccgccgcc gcggcggccg gcgtgcaccg ggtggtgctg tgcacctccg    288000
     cgatggtcta cggcgcactc ccggacaacg agctgccgct gtccgaggac gccgagctgc    288060
     gcgccacggc cgaggccacg ggcgtcggag acctgctgga gatcgagcgg ctcgcgcggc    288120
     gcgcaccccg ggcccacccc ggcctgaacg tcaccgtggt gcggcccgcc gtactggtcg    288180
     gaggcatgga caccgcgctg accaggtact tcgagtcacc ccgactgctg gtcgtggccg    288240
     gatcgcggcc cgcctggcag ttctgccacg tcgacgacct gtgcagtgcc ctggagtacg    288300
     ccgtcctgga gaaggccgac ggagagctgg ccgtcgggtg cgacggctgg ctggagcagg    288360
     aggaggtcga ggagctcagc ggcatccggc ggatggagct gccctccgcg gtcgcgctcg    288420
     gcgcggcggc ccggctgcac cggatcggcc tgacgccctc cccggccggg gacctggcgt    288480
     acacgatgta cccctgggtc gtcagcggca gccgcctgca cgatgccgga tggcgtccga    288540
     agcacacgaa cgaggaggtc ctggcggagc tgctcgagga ggtctcgggc cggcacacgg    288600
     tcgccggccg gcgtctcggg cgcaaggacg cgacggcggc gggcgccgcg ggcgcgacgg    288660
     tggcgctgct gggcgcggcc gcggtggtgc gtcgcgcgcg caaggcacgg cgccgcatct    288720
     gaggacaatc caggggggcg gctgcctctg taggaggctc caacgcggca cgcgcgcgtg    288780
     ccgggcgatc acgctattcc gcgtcgtcgg cgccgtgggg cacgatgggc gcatggcaac    288840
     cacgaacgac caccccggcg agcgggccgc agcggacccc gtgaagctga tcggcatccg    288900
     tgagacgccc ctgtccgtgg acgaggtctt cggcgcggtc ggggacgacg cgtcgggcgg    288960
     caccgcgctg ttcgtgggga ccgtgcgcaa ccacgacggc ggcaccgacg tcgaccggct    289020
     cgggtactcg tgccacccga gcgccgaggc ggagatgcgc cggatcgcgg agaaggtcgt    289080
     cgcggagtac cccgtacggg cgctcgcggc actgcaccgt gtgggtgacc tggaggtcgg    289140
     ggacctcgcg gtggtcgtcg ccgtgtcctg tccgcaccgg ggcgaggcct tcgacgcctg    289200
     ccgcaagctg atcgacgacc tcaagcacga ggtgcccatc tggaagcacc agacgttctc    289260
     cgacggaacc gaggaatggg tgggcgcgta gcgccttcgc cgggacacac ctccggttgc    289320
     gtaacccgcc ccccggcgtg agcgttgtca ctgcgaatgg ttaatctgct gatcagtcag    289380
     tcgcggacac tcatggggtt gggaggtcgg catgggagcg cttgcctggt tgctgattcc    289440
     actggtggcc gctgtcggtg cgggcctgtg gggaagctgg gcaaaccgga cccgcagggc    289500
     gcggagcgac ggccccgagc tggacgggta cgcccggttc cgtgaggcca tggagaagcc    289560
     ccgcacgggt gcctgaccgc cgcccgacgg ccgtccggcg acggccgccc tgacggtgtt    289620
     ccgacagccg cgtcccgtac tgtcgtgcca tgccacgccg caccgcgacg atgctcgcct    289680
     ccaccctgat gctgatcgcg ctcctgtgcg cgggtgtttt catccccgtg ccgtactcgg    289740
     agatgtcgcc cgggccgacg gtgaacaccc tcggggacca cgacggcgag ccggtgctcc    289800
     agatctccgg tcacaagacc tacgaggcga gcggtcatct gaacatgacc accgtccggg    289860
     tcaccagcgc cgagtaccgg atgaacctcg tggaggccgt ctacggctgg ctggcacacg    289920
     acaacagcgt ggtgccgcac gagaccctct acccggacgg caagaccgag gaagaggcca    289980
     cccaggagaa cgccgaggag ttcagccagt cccaggagag cgcgaaggtc gccgctctga    290040
     aggcgctcga catcccggtg aagtcctggg tggtcgtctc cgccgtcgtc aaggactccc    290100
     cgtcgcaggg ccggctgcac gccggcgacg tgatcaaggc cgtggacggc acgaccgtca    290160
     agaagcccgc ggacgtcgcc gagctggtga ccaagcacga gccgggacag gacaccgtct    290220
     tcacgatcgt gcccgccaag gagcaggccg ccgcggagaa ggagggccgg acggcgacga    290280
     agacccagaa gatcaccatc aggaccgaga cctcccagga cgcgggcgcg cagcgcgccg    290340
     tcgtagggat ctccgccgga acggaccaca cgttcccgtt cgagatcgac atcaagctgg    290400
     ccgacgtcgg cggcccgagc gccggtctga tgttcgccct cggcatctac gacaagctca    290460
     cccccggcga cctcaccggc ggcaagttcg tcgccggcac cgggacgatc gacgacaacg    290520
     gcaaggtcgg cccgatcggc ggcatcggca tgaagaccat cggcgcgcac gacaagggcg    290580
     cccagtactt cctgacgccc gcggacaact gcgcggcggc cgccgaggac acccccgacg    290640
     ggctcaccct cgtgaaggtg gacaccatcg acgacgccct cggcgcgctc aaggacatcc    290700
     gttccggaaa gaccgccgac ctgccgaagt gcacgcaggg gtagcccccg cacagccgtc    290760
     ccgcgtccgg cggactactc ctcgaaggtc gccgtcagcg ccgcggccag acccggcacc    290820
     aggtcggaac cggtcaggac ctccgtggcc gtgtccttct cccgcagccg cagggccgag    290880
     tcgcggctgc cgtcgcgcag gaccgcgacc gtcatgcgga cctcctgacg gtccgggtgc    290940
     tccgccaccc actgcgcgag tttcttctcg ttcaggcccg aaggcacctg ggcctcggcc    291000
     gagggcggca gcatcaggcg ctccacggcg agcgcgcagc cgaccacgga gtcgggccag    291060
     gcgatggtgc ccaggaactc gtcgagcgcc tggtccgttg gaatttcgtc ctgctcgatc    291120
     ggggtgaggc cggaggactc cggctcctcc cgcagaccga gccggtccgc gagcgagggc    291180
     tggtcggccc gcagccgtgc ggtgtcgaca agtgcaaaga ggcgtgcggg ctggtcccag    291240
     ccgaggccgg agacgtactc gtcgatctcg agtacggccc gggtgagggg gctcgctgcc    291300
     atgggggtgt tggacatggt cacaatcctg cctcgttcat ggccggaatc gggaaccgag    291360
     taaacgatga gtaagttgca taagtgtggg cccgcgatca cgggggcgca cggggggccc    291420
     gcgaacccga gggcctgacg gatcaacagc gaacttcgag gtgcgcacct tggctttcca    291480
     gatgccggac cgcggcggag gccccccgac ggggccgcgg atcagagtgg gccgcccgtc    291540
     ccggcgtgtc cgaaccctgc tgctgacact tggtgtcctc gccgtgctcg ccatggcgtt    291600
     caccatgttc gcgggattct ggacggactg gctctggtac aggtcggtcc actactcgtc    291660
     ggtgttcacg acgaccctgt ggaccaagat cggtctcttc ttcgtcttcg gcctgctgat    291720
     ggcgctcgcc gtcgggttca acatctggtt ggcccaccgc ctgcgcccgc cgctgagcgc    291780
     catgtcgatg gagcagcaga acctcgaccg gtaccggatg ggcatcgccc cgtacaagaa    291840
     gtggctgctg ctcggcatca ccgccctggt cggcctgatc gccggcgcct cggcgtccgg    291900
     ccagtggcgg acctggctga tgtgggtcaa cggcgtgccc ttcgggcaga aggaccccca    291960
     gttcaagctg gacgtctcct tctacgcctt cgacctgccc tggtaccggt tcctgctcgg    292020
     cttcggcttc gcagccgtga tcatctccgt gatcgccgcc gcgctgaccc actacctgta    292080
     cggcgggctc cgggtcacca gcccgggcgc gcgcgccacg gcggcggcca ccggtcacct    292140
     ctcggtgctc ctcggagtct tcgtcgccct caaggcggtc gcctactggc tcgaccggta    292200
     cggcctcgcc gtgaagtcca gcgacttcaa ggccaccgac aactggacgg gcctcaggta    292260
     cgtcgacgcc aacgcctacc tgccggccaa gacgatcctg ttctgcatcg cggtcatctg    292320
     cgccctgctg ttcttcgcca ccctgtggcg gcgcacctgg cagctgcccg tgatcggctt    292380
     cggcctgatg gtgctctccg cgatcctcat cggcggcctg tacccggcac tggtccagaa    292440
     gttccaggtc cagccgaacg agcaggccaa ggaagcgccg tacgtcgaga agaacctcgc    292500
     ggccacgcgc gacgcgtacg gcatcgaggg cacccaggtc gccgagtacc cgggcaagag    292560
     cgagaccaag gacaagacca agctccgtga cgacgcggac gccgcggcct ccgtccggat    292620
     catggacccg aacatcatct cgccgacgtt ccagcagctc cagcagatgc gtaactacta    292680
     cgcgttcccg accaacctgg acgtcgaccg ctacgcgaag gacggcaagg accaggacac    292740
     ggtcatcggt ctgcgcgagc tgaacctggc gggcatcccg aagaagaact ggatcaacaa    292800
     ccacttccgc tacacccacg gctacggcgt ggtcgcggcg aagggcaccc aggtcgactc    292860
     cgagggacgc ccggtcttca ccgagtccaa cctgccgtcc gagggcgacc tcggaaagta    292920
     cgagcagcgg atctactacg gcgagaagac caccacctac tcgatcgtcg gcggtcccca    292980
     gaaggagatc gactactcgg acgacaccgg ggagaagacc ttcagctaca agggcgacgg    293040
     cggcgtcgac ctgtccaacc cgatcaaccg ggcggcgtac gcggccgcgt tcagcgagcc    293100
     gcagatcctc tactccggcg cgatcggcga cggttcgcgg atcctctaca accgcacgcc    293160
     caaggagcgc gtcgaggcgg tcgccccctg gctgaccatc gacggcgacg cgtatccggc    293220
     ggtggtggac ggccgcatcc agtggatcgt cgacgcgtac acgacgacga acggctatcc    293280
     gtacgcctcc cgtacgacgc tcggcgacac cacggccgac tcgctgaccg ccaacaacaa    293340
     ctcgcgcgcg gtggtggccc agcagaacca ggtcaactac atccgcaact ccgtgaaggc    293400
     gaccgtcgac gcgtacagcg gtgacgtgaa gctctacgag tgggacaccc aggacccggt    293460
     cctgaagacc tggaagaagg cgttcccggg cacggtgcag gacaagggcg agatctccaa    293520
     ggagctgatg gcccacctgc gctatccgca ggacctgttc aaggtccagc gcgagctgct    293580
     cacgcgctac cacgtgaagg acgccaacac gttcctcagc ggcagcgagg tgtggcaggt    293640
     gccggacgac ccgaccaaca agtcgggcga cgcggtgccg ccgtactacc tgagcatgaa    293700
     gatgccggac cagaaggcgc aggcgttctc gctgacgacg acgttcacac ccaacgggcg    293760
     tgacaacctc agcgcgttca tggcggtcga cgccgaggcg ggcaccagcg actacggcaa    293820
     gatcagaatc ctgaaactgc cgacgagcac gaccgtcgac gggcccaaac aggtacagag    293880
     ccagttcaac tccgaacagg acatcgccga gtccatcagg ctgctgagag gcggcgactc    293940
     ggaggtggag tacggcaacc tgctgacggt gccgctggac ggcggactgc tgtacgtcga    294000
     gcccgtctac gtgcgcggtg gcgacctcaa gtacccgctg ctgcgcaagg tcctggtgag    294060
     ctacgggggc aacaccgcct tcgagaacac gctcgacgcg gccctcaaca aggtcttcgg    294120
     agcgcaggcc gccgagaccg agcagccacc ggacgagggc gacgacacga ccgagccgcc    294180
     accgacgtcc accaacccca cggtccggga agcgctgagc gacgcgcaga aggccttcga    294240
     cgccgggcag aaggccctgg agcagaagga cttggccgcg tacgccgagg cgcagaagga    294300
     cctcgaggag gcactccagc gggccgagga cgcacaggcc aaggccgacc agggcgccgg    294360
     cggcaagaac ggcgacgaca agaacgccgg tgacaagaac agcggtgaca aggccgggag    294420
     cgacaaggcc ggtccggacg cgacaccgac cggtgacgcc ggtggcggag cggacaccgg    294480
     ctgaccgtcc ggtcgcatcg gaccgttgtt ccagctggtc aaagcccatc ccgcgccgtg    294540
     ctagggttgt gaacacaacg gcgcggggtg gagcagctcg gtagctcgct gggctcataa    294600
     cccagaggtc gcaggttcaa atcctgtccc cgctactgaa gtcgtgagct gtgtgcgagc    294660
     gaccacgaag gcccggattc ccacaaggaa tccgggcctt cgtgatgtgc gaacgcatgt    294720
     accggagaac gcgacggccg cgccgccaag gggagttggg cagatctgtg tttgacttgt    294780
     ctccctgtgg gcatgtcgac aaaacgctga agtgacctca ctgactgcgg tataccggat    294840
     gtaccgaggt tgcgggtggt gcgacgatga acgttatggg ggacatggca aatctgttcg    294900
     ggacagggcg ttttgcgcag ccttccggtc agctttccgg tcaggaggag gccacggacg    294960
     aggctcagga agccgccgac gaggccgccg aggaagtgcg cctgcggctc gccgtcgact    295020
     gtggtgacgt cgaggcgatg agcgtgctcg gcgcgatgct gctgcgccgt ggcgacttcg    295080
     acgcagccga gtcgcacctg cgtgccgcca ccgcggccgg cgaccgggcc gccgccaaca    295140
     acctgggcgt cctgctgcac cagcggggat acgccgacga ggccgccggc tggtggcgca    295200
     tcgccgccgt cgccggatcc gccgccgccg cgcacgcgct cggccggcac ttccgggaac    295260
     gcggggacga gcccgccgcc gagtactggc tgtgccagtc cgcggaacag gggcacgtgc    295320
     tgggcgccta cgcgctcgcc gacctgctgg agcaccgcgg cgacgacacc gggtccgagc    295380
     ggtggatgcg ggccgcggcc gaacgcgggc accgggaagc ggcgtaccgg ctggcgcgga    295440
     cgctggaccg gcgggccggg cgggacggcg acgacaaggc cgccgcacgc gcggccgacg    295500
     aggccgagca gtggtaccgg caggccgccg cgcgcggtca ccggcgcggc gcgctgcacc    295560
     tggggacgat cctggagaag cgcggcgagc tcaaggaggc gggccgctgg tacctcacgt    295620
     ccgccaagga cggcgaggcc cgcgccgcct gcgcgctcgg cttcctgctg cgggacgccg    295680
     gggacaccga gagcgccgcc gtgtggtggc tgcgcgccgc ccaggacggc gacggcaacg    295740
     ccgccaacgc cctgggcgcg ctgcacgccg agcgcggcga gacccagacc gcggagcgct    295800
     ggtaccgggc cgcgatggac gcgggcgacg acaacggggc gtacaacctc gggctgctct    295860
     gcgccgagca gggccgcacc acgcaggccg agcagtggta ccggagggcc gcctacgccg    295920
     ggcaccggga ggcctccaac gcgctggcca tcctgctgct gcgcgccggg gacgagagcg    295980
     gcgccgagcc gtggttctcc aaggccgccg aggcgggcag cgtcgacgcc gccttcaacc    296040
     tcgggatcct gcacgccggg cggagcgagg agcgggcggc gctgcgctgg tacgagcggg    296100
     ccgccgccgc cgggcacacc gaggcggcgc tccaggtcgg gatggcgcgg ctgcgcggcg    296160
     gggacgagca agaggcggag cggttcctgc gctgtgcggc cgggggcggc agcgcggagg    296220
     ccgcgtaccg gctggcgacg gtgctggacg cgcgccggcc gccggagccc gcgcacgagc    296280
     tgggtgagcc cgcgcaggac aagtccgagt gcgaggagtg gtacgagcgg gccgcctccc    296340
     aggggcaccg gcgcgcgcag gtgcgggtcg ggatgctcgc cgcggcgcgg ggcgacgtgg    296400
     tggaggccgc gcggtggtac cgcgaggcgg ccgaggccgg gtcccgcaac ggtgcgttca    296460
     acctggggct gctgctggcc cgcgaaggga gcgagcccga ggccgtcgtg tggtggcgca    296520
     gggcggccga cgccgggcac gggcgggcgg cgctgcggct ggcgctggtc tgtgcgcggc    296580
     ggggggagct ggcggagggg cagcggtggg cggacctcgc ggtgtcactg gggccgcggg    296640
     aggtggggga gcgggcggct cggctgcggg acgcgttgcg gcaggagctg tcggcgtgac    296700
     gcgtcccgct tcgggccggc accggcacga tggcccgcag ctgcggcggg gtgccaccga    296760
     acgcggtcag aatgcacctg gggccgggat ccttgcggat cccggcccca ggccttcagt    296820
     agcggggaca ggatttgaac ctgcgacctc tgggttatga gcccagcgag ctaccgagct    296880
     gctccacccc gcgtcgatga atggaacact acgtcacgat gaagacgtga ggcaaatccc    296940
     tgctcacgcc gccgcgcagt tcgggcaggt gccgcggtac gtcacctcga cgtccgacac    297000
     cgtgaagccg aagcgctccg agtcgggcag gtcggccagc gggttgccgg tcgggtgcac    297060
     gtcgcggatc gcgccgcagc gcgcgcagac caggtggtgg tgcggccggt gcgcgttcgg    297120
     gtcgtagcgc ttggcgcgct tgtccgtcgc gacctccagc acctcgccga gcgagaccag    297180
     ctcgcccagg gtgttgtaga ccgtcgcccg ggagatctcg gggagcttgt ccacggcccg    297240
     ggagtgcacc tcgtcggccg tcaggtggac gtgttcgccg tcgaggacct cggccacgac    297300
     ccgccgctgc gcggtcatgc gccagccgcg cccgcgcagc cgttccaaaa ggtcactcat    297360
     acacatcagc ctaacagcaa gggggaccag gtcccgaatg ggtgtgattt tggagtcctg    297420
     ctcgaattag acactgtcca ttgtaggaac cggggcggca ttggccaaga ggcgcggttc    297480
     gtgcgggccg gcgaccggtg ccggcccgca cctcgcccgg gccggccagt gcccgtcaga    297540
     gcccagtcag gcggtcaccg ccggggcgtt gtgcggggag cgcgccggtg cccagcggcg    297600
     gatgatgtcg cgcaccgaga cgatcccgac gggctcgccg ccgtccagga cgatgaggtg    297660
     gcggaagccg ccgtgcgcca tcgcgcccgc cgcctcctcc acggtccagg tcggggcggc    297720
     gaagacgacg tcggtggtgg tgtggccgtg ggtgcgctcg gtgtccgggt cctggccccg    297780
     gccgacggag accaggacgt cgcgttcggt gaggatgccg atgccgccgg cgtcggggtc    297840
     gtacaccacg gccgcgccga cgcggcgtgc ggacatcagg gcggcggcct ggcggagtgt    297900
     gtgggcggga ccgatggtga ggacgaccgt gctcatgact tcgcggacga gcatgggtgg    297960
     agccacctcc tgccggtgat ccatgagcta gttcatggat tcacaagttc acaagtgagg    298020
     gaactctcag agtggcaggt aaagcggggg tcaacaaggg ggcgcggagg gcgagtcggc    298080
     gggcgctcag tagcgctggt tgagataccc gagcagttcg tcgtggagcc ggccgttcga    298140
     cgccgccgcg ttgccgctgt gcgggccggg gcggccgtcg aggccggtga aggtgccgcc    298200
     ggcctccgtg acgatgatcg cgttcgcggc catgtcccag agggagagct ccggttcggc    298260
     gcagaggtcc accgagccct cggcgaccat catgtacggc cagaagtcgc cgtacgcgcg    298320
     cgtgcgccac acctcgcggg tcaggtccag gaagccgtcg aggcggccct gctcctccca    298380
     gccgctcagc gaggagtacg cgaaggaggc gtcggagagc gtggagacct gggagacgtg    298440
     gagccgatgg gcggaggtca ggctgcggcc ggtgaacgcg ccgtggtcct ccaccgccca    298500
     ccagcggcgg ccgagggcgg gcgccgagac gaggccgacg accggctggt agccgccctc    298560
     cttcgcctcc atcagggcga tgagggtggc ccagacgggg acaccgcgca cgtagttctt    298620
     ggtgccgtcg atcgggtcga tgacccagcg ccgcgggccg gtgcccgcca cgccgaactc    298680
     ctcgccgtgg accgagtcgc gggggcgggc gcgggagagg tgaccgcgga tgagttcctc    298740
     ggcggccttg tccgcctcgc tcaccggggt catgtccggc ttcgtctcga ccttcagatc    298800
     gagggccttg aagcggtcca tcgtcgcggc gtcggcggcg tcggcgagca cgtgggcgag    298860
     gcggaggtcg tcgaggtaat cgggcatgcc gtcacgctat ctgtcgcggg cggggcgggg    298920
     ctaccagggc tttggcgggc gtggcggggc gggagagccg ctgcgggggc tccgccccac    298980
     gggtgcgagg acccttgaca gtgctcccat acccgtcaaa tctggcagca agtcgctcgg    299040
     cacgtccggc agcgttcgct cggcccgagg gaggcgaggg tgcccgcagc ccgggagtcc    299100
     ctgctcgacg ccgcgtacac ggcgctggcg cgccggccgt ggtccgccgt gcggatggtg    299160
     gacgtggcgg cttccgccgg ggtgtcccgg cagaccctct acaacgagtt cggcagcaag    299220
     gagggactcg cccgggccct ggtgaggcgg gaggccgacg gctacctcgc cggagtggag    299280
     cgcgcgctct ccgggcccag cgacccgcgt gaacgactca ccgccaccgc cgagtggatg    299340
     atgtcggcgg cccgcgacaa cgcgctggtc cgggccatgc tcacggggtg ctggaacgag    299400
     cggctgcccg caccggccct gacggcggtg ccctcctcct gcgcggtgcc ggcccagcga    299460
     cgggccgacg gtccactgcc ctcgcccggc gacttcgtgg gcctggtccg cgaccgtgcc    299520
     gtggccgtcc tgggcggggc cgggccgctc ccgccgccgg acgccgccga actggcccgc    299580
     tcctgcgaac tgaccgtgcg cctcgccctc tcctgcgtcg ccgcgccgcc cgccgagggc    299640
     ggggtggccg acctcgtacg caccgccctg ccacgccgcc tgacggcata gcggccgcct    299700
     gcgcctgcgc aggggaggat ccctagtgcg ccgagcccga cagctgcaga ccgatcacgc    299760
     cgatgatgac gaagctgatc gagacgatct tcagggtcga gaccaggtcg ccgaggaaga    299820
     tcatgccgta gatggcggta cccgccgcgc cgatgccggt ccacaccgcg tacgcggggc    299880
     cgacgtcgag cttcttcagg gacatcgtca gcaggccgaa gctgcccagc gcgaaggcgc    299940
     agaaggcgat ggtgggccag agccgggtga agccgtgcga cagcttcaga cagacggcga    300000
     agccggtttc gagcactccg gccactatga ccagcagcca cgccatgtct tgtcctcccg    300060
     tggtccctac cgcgaccgct gtgccgatgc cgatcggtgg cctcgtccga ccacgacttc    300120
     gttggacgac gatttcgtgc gacgacgact tgtgcgacaa cgacttcgtc cggctttgct    300180
     caggcttggt tccggcttgg tgcgattatg cacttaccgg ctgcacggca cgccaaacaa    300240
     cgcgatggtc agtcgccttc cttgcgttcc cgcgtcgaca gcagccggcg cagcgagtac    300300
     agccgggccg ggtcggcgtg cccctcggcg acccaggcgt ccagcgcgca gtcgggctcg    300360
     tcgtggctgc acgcccgcgg acagccctcg gtgccgggca ccaggtcggg gaaggcgttg    300420
     atcacccggg acggatcgat gtgcgccagc ccgaacgacc gtacgcccgg ggtgtcgacg    300480
     acccagccgc ccgccgcgga ggacagcggc agggcgaggg ccgaggtcgt ggtgtgccgg    300540
     ccgcgccccg tcaccgcgtt gacgtgcccc gtcacccggc ggcggtcctc gggcaccagg    300600
     gtgttgacca gggtcgtctt gccgacgccg gagtggccga cgaaggccgt gatcttcccg    300660
     tccaggtgct cgcgcaccag gtcggcggcg gcgccgttct ccagctcctc ccggctggtg    300720
     acgacgtacg ggatgtccaa cgcgccgtac agctcgagga gttcgtccgg cggtgccagg    300780
     tccgacttgg tcatcaccag cagcggggtg aggccgccgt cgaacgccgc gaccaggcag    300840
     cggtcgatga ggcgggggcg cggctcgggg tcggcgaggg cggtgacgat ggcgagctgg    300900
     tcggcgttgg cgacgacgac ccgctcgtag gggtcgtcgt cgtcggccgt gcggcgcagg    300960
     accgaggtgc gctcctcgat gcggacgatg cgtgcgagcg tgtccttctt gccggtgagg    301020
     tcgccgacca gggccacccg gtcacccacg atcgccgcct tgcggcccag ctcgcgcgcc    301080
     ttcatcgcca tgacgacccg gtcgtcgacg aggcaggtca gccggccgcg gtccacggtg    301140
     aggaccaggc cctcggcggc gtcctcgtgc ttgggccgga tgtgggtgcg cggtcggttg    301200
     cccttgcggt tggggcggga gcggatgtcg tcctcgtcgg tgtgcttgcc gtagcggcgc    301260
     atggcgatcc gtccctacgc cccgagcatc ccggtccaca ggtcggggaa gtcgggcagg    301320
     gtcttggcgg tcgtcgccac gttctcgatc tgcacgccct ccaccgcgag accgagaacg    301380
     gcgccggcgg tggccatgcg gtggtcgtcg taggtgtgga agacgccgcc gtgcagacgg    301440
     cgcgggcgga tgtgcagacc gtcggcggtc tcggtgacgt caccgccgag ttcgttgatc    301500
     tccttggtga gcgcggccag ccggtccgtc tcgtgcagcc gcagatgggc cacgccgcgc    301560
     agggtcgagg gggagtccgc gagggcggcg acggccgcga tccccggggt cagctcgccg    301620
     acctcgctca ggtcgacgtc gatgccgtgg atcgcacccg atccggtgaa cacgagtccg    301680
     aagtccgtca gttcgcagga accgcccatg tcggtgaaga tctcgcgcag ccggtcgccg    301740
     ggctgggtgg tgcgggacgg ccagtcgggg atcaccacct tgccgccggt caccagcgcc    301800
     gccgccagga acggctgcgc gttcgacagg tccggctcga cggtcaggtc ccggccgagc    301860
     agcgcacccg gcgtgacccg ccacacgttc ggctcgccgc cggactcggg ggtgtcgacc    301920
     tgggcgccga ccgcgcgcag catgtcgacc gtcatgcgga tgtgcggcat ggagggcagc    301980
     gcggaaccgg tgtggcgcac ctcgacgccc tggttgaagc gcggcccgga cagcagcagg    302040
     gcgctgacga actgggagga ggaggacgcg tcgatctcga ccgggccgcc ctccagggcc    302100
     ccgccgccgt gcacggtcag cggcagcgcg ccgcgcccgt cgtcgtcgat gcgggcgccc    302160
     aggacgcgca gcgcgtcgat cacgccgtgc agcggacgct cgtacgaccg cgggtcgccg    302220
     tcgaaacgga cggcgccgtc ggccagcgtg gcgaccggcg gcaggaagcg catgaccgtg    302280
     ccggcgttgc cgacgtcgac cgtggccggg ccgcgcagcc ccgccgggat gacccgccag    302340
     aactcgccgg tgccctcggg gccgacgccc tcctcgatct cgacgcccag cgtgcgcagc    302400
     gcctcggcca tcagcagggt gtcgcgggag cgcagcgggc ggcgcagcca gccgggctcg    302460
     gaggcgaggg cggccagcac cagggcgcgg ttggtgaccg acttggaccc gggcacgtgg    302520
     acggtcgcgt cgacggctcc gctcgcgtgc ggggcgggcc agagggcggt gtgcgtgggg    302580
     ttcacggtca tggggcccac tttaatggct gaggacgatc ggagatcttg atcaaaagcg    302640
     ccgaaacctg accgaaagcg caacagtgca cttgccgtgc atatatgcgg agcgggtgga    302700
     gggcgcccgg cgtctcacag ctccagtagc cagcgcgccc cgccgatcag cgagcacagc    302760
     gacaccgcgt ggaagaggaa gaaccacact cccgccggcg cgtgggtcag ccgcgccaac    302820
     tggtcggcgt ccgagtcgcc ggcgccgccc cgcgaccgct tggcctgcag ctcgaaggcc    302880
     gggcgcactc cgccgaggag aaggaaccag accaccgcgt acgcgaacgc cgcctgcacc    302940
     tgcggcccgg ccagccacga caccaggacg aacgtgccgc cggtgaccac gaccgtcagc    303000
     accccgtacg cgttgcggac catcaccagc agggccacca gcagcgccgt cgccagccac    303060
     agcagcagcg tgatgcgccc ggccgccagc agtgcggcgc cgccgaggcc gagcagcggc    303120
     ggagcggtgt aaccggcgac cgcggtgagg atcatgccga cgccgtgcgg cttgccccgg    303180
     ctcaccgtca gaccgctggt gtccgagtgc agggtgatcc cggtgagggt acggccggtc    303240
     agcagggcca ccaggccgtg accgccctcg tgcgcgatgg tgatcgcgtt gcgcgctatc    303300
     cgccacgatc cgcgcgtcgc gacgacggcg agcgccgcca ccagggtcgc gaccaccacc    303360
     cacaggtcgg gatcgggctg gatgccggag acctcgtccc acagggaggt gagcgaggcc    303420
     gttgcgaggt ggtccatgtt cggggagggc tcctcgtact agcgcggggt ctggcagtgt    303480
     ggcacgtatg tgcggacggt atgcggcgag tcgtcgaccc gaggatctcg cgggaatctt    303540
     cgagatcgag aagtgggagc ccaaggagag cttggaaccc gactacaacg tggcccccac    303600
     caaggaggtc tacgccgtcc tggaccgtcc cctgaaagac gtcgaggacc cggagccggt    303660
     tcgccagctg cggaagctga agtggggcct cgtcccctcc tggtccaaga cgcccgaggg    303720
     cggcgcccgg atgatcaacg cccgcgcgga gaccgtccac gagaagccct cctaccgccg    303780
     cgccttcagc acccggcgct gcatcctgcc cgccgacggc tactacgagt gggtcaccgg    303840
     caagcaggag cgagacctgg aggtcgaagg gcgcaagaag cggccgcgca agcagccgta    303900
     cttcgtgacc cccgccgacg gctccgtgtt cgccatggcc gggctctacg agttctggcg    303960
     ggacaggacg ctgcccgacg accatccgca ggcatggtgg gtgacgtgct cggtgatcac    304020
     gaccgaggcc gagaccacac cactcgccgt cgccccggcc gacggtccgc acgccctggc    304080
     cgacatccac ccccggatgc cgctgatgct gacgccggac cgctgggacg actggctcga    304140
     tccggcgcgc accgaccccg acgagctgac ctccctgctg gcacccccgc ccaccggcct    304200
     gatgcgggcc ttccccgtct cgacggccgt gagcaacgtc cgcaacaacg gaccggagct    304260
     gctcgaggag ctggaagcac cggaagaggg cacactcttc tgacgtgacg gatgcgacag    304320
     aggttgtgac agaggcggtc gagacggatg cgggccccgc ccgcatcacc tggcaccggg    304380
     cgaagcagcc ccggctggtg ctcgccgtga gccacggggc cggcggcggc atcgaggcgc    304440
     gcgacctgaa ggcgctggcg gccgcactgc ccgcccacgg ggtgagcgtg gccctcgtcg    304500
     agcagccctg gcgggtggcg ggcaggaagc tggcgcccgc gccgaagacc ctcgacaccg    304560
     ggtggcgggg cgtctggccc gcgctcgccg cccccggcct gccggtgatc tcgggcggcc    304620
     gcagcgccgg cgcccgtgtc gcctgccgca ccgccggcga actgggcgcc cgcgccgtcc    304680
     tcgccctcag cttccccctg cacccgccgg gcaggccgga gaagtcccgc gccgacgagc    304740
     tgctcggggc cggcgtgccc accctcgtgg tccagggcgg caacgacccc ttcggcaggc    304800
     cgcacgagtt ccccgaggcg cccggaggga cctacgacct gatcgaggtg ccgtacggcg    304860
     accacggctt cgccgtgccc aaacgggcgg agatcagcca ggaaagggcg ctggagctga    304920
     tcaccgacgg cgtggcccag tgggccggct cactcggctg aacgcctggg aatgaccggc    304980
     ggacggccac tgttgtgccg ttcgtacgtt gctgagaatc agcaccgacg ccgtaggaga    305040
     ggaagtccgc cgcatgggtt cagccttctg cccgagtcgc agcagccgcg ccgacctgga    305100
     ctggaccgtg ctgcacgctg ccaagaccgc ccctattcgg gcggcgggcg gaccggatcg    305160
     tcgtctatcc tccgattcga gtgagaccgg tctcggtttc acgacgacat cggaggaggt    305220
     gggtccggtc actgggaccg acgcagggac cgaacacggc caggcggagc agcccgaggg    305280
     ccggggtacg ggcgcggagt cgaccgcgga gcgcagcgcg cgcttcgagc gggacgcgct    305340
     ggagttcctc gaccagatgt actcggccgc gctgcgcatg acgcgtaatc cggccgacgc    305400
     cgaggacctg gtgcaggaga cctacgccaa ggcgtacgcg tccttccacc agttccgcga    305460
     gggcaccaac ctcaaggcgt ggctgtaccg catcctcacc aacaccttca tcaactcgta    305520
     ccgcaagaag cagcgcgaac cccagcgcag cgcggccgag gagatcgagg actggcagct    305580
     cgcccgtgcc gagtcgcaca tgtcgacggg tctgcgctcc gcggagtcgc aggcgctcga    305640
     ccacctgccc gactcggacg tgaagcaggc gctccaggcg atccccgagg aattccgtat    305700
     cgccgtgtat ctggcggacg tcgagggctt tgcctacaag gagatcgcgg acatcatggg    305760
     gacacccatc ggtacggtga tgtcccggct gcaccgtgga cgccgtcagc tgcgcggcat    305820
     gctggaggac tacgcccgcg accgcggtct ggtccccgcc ggcgccggag agtcgaacga    305880
     agcgaaaggc tcggggtcat gagctgcgga gagccgcacg agacggattg cagcgaaatc    305940
     ctcgatcatc tctacgagtt tctcgacaaa gagatgccgg actcggactg cgtgaagttc    306000
     gagcaccact tcgaggagtg ctcgccctgc ctggagaagt acgggctgga gcaggccgtg    306060
     aagaagctgg tcaagcggtg ctgcgggcag gacgacgtgc ccggtgacct gcgggccaag    306120
     gtgatgggac ggctggacct gatccggtcc gggcagtccg tgccggaaca cgacgtcgcg    306180
     gccgcaccgt cgtcgtcggc cccgcaggag tcctgagtcg ccctgagcgt cgcgactcgg    306240
     ccagaagtca ctcgtacgtg ctaatccgcg ggttatctgc ccgcggcctc cccgccgccg    306300
     tcctaggctc ctgagcctga caggcgtggc caggggaggg gctgatggac gcggtaccgg    306360
     cgcgggcacg tgtgtacgtg gccgtcgtcg ccctcaccgc cctgctctgc ctgcgaccgc    306420
     tgcccgcggt gcgcgcgccc tggtgggcgg tgctgctgct ggcggggctg tacgcggggt    306480
     ccgagctggt cgcgcggtcc cgcttcgtcg ggacctgcta ccccgtcctg ctcgccggcg    306540
     ccttcctgct gccgccgccc gccgccgcgc tcgtggcact gccgggagcc ctgctggccc    306600
     cggtgccgcg ccgtcccctc ggcctgcggc gcgtgtggcg ggccgcgcag ctgactctcg    306660
     ccgtgtgggc cgcggcctgt gtccactggc ggctcggggg ccgggacgcg gtcgtcgagc    306720
     ccgccttccc gtacgccctc gtgccggccg gggcggccgt actcgccttc tgcctggtcc    306780
     tcaccgtgct ggacggcggc atcctcaccc tcgccgacca cgtgccgccg agccgggcgt    306840
     ggcggggact gctctcccgg tcgctcgcgc cgatcgccgt gcacgggctc gccgggctca    306900
     tgatggccgt cctgtggcgc agcccgtacg gtccggtggc cgcgctgctc gtgctgctgc    306960
     cgatgtgcgt ggcctggtgg gccttcgccc agtaccaccg tgagcgggcc gcgcaccagg    307020
     cgaccatccg cgccctcgtg caggccgtcg acatcaagga cggctacacg cgcggccaca    307080
     gcgaacgcgt cggccaggcc tccatgatga tcgcccgcga gctgggcatg gacgacgaac    307140
     gcgtcgagac cctgcgcttc gccgggatcc tgcacgacgt gggcaagctc ggcgtgccca    307200
     cccggctgct gcgcaaggac ggcccgctga cgcccgagga gcgccgggtg atcgaactgc    307260
     accccgagta cgggcacgag atggtgcgcg gcatccgctt cctgggagag gcccgcgccg    307320
     ccgtcctgca ccaccacgaa cggctggacg gcagcggcta tccctacggg ctggccggcg    307380
     accggatccc cgagtcggcc cgggtggtgg ccgtcgccga cgccttcgac gcgatgacgt    307440
     ccacgcgctc ctacagcagg gcccggcccg tcgcgacggc gctggcggag ctccagcggt    307500
     gtgccggcgg acagttcgac ccgcggatgg tgcgggcact ggtccgggcc ctcggccggc    307560
     acggctggcg cccgtccgtc acggcggact ccccgctcac ccgcaccgcc ggaccggcac    307620
     cggaccgggg cgaggacgcg cgggacagcg tcggcagggg agcgccatga cgtccttgca    307680
     gccgccggcc cggtcctcgc cgccggcggc cgtcctcctc gtacccggct gtgccgggct    307740
     cctcgcgctc ggatgtctcg cctccgtgct gggggcgggg cccgcccagc ggcccgtcgc    307800
     gctggccttc ggagggctgg tcgtcctcgg tgagctgacc cggcggaccg gcgccgaggc    307860
     ccgggaggcg gctccgctcg gtgccgcggg cgcactggcg tacgcgctgc tcggagacgt    307920
     cgccgggcag cccgcgcacc acggtgtggc cgagaccgtc accgtcgtgc tcgccgcctc    307980
     gctgctcggc agcgtgccct acgtcgcgcg cggcagcggg cccgtcctcg accacctggc    308040
     gcggcgcgtg ctcaccgtcg gtttcgccgc cgtgtgcttc cggccgctgt ccaaccaggg    308100
     cgtcttcgac gactggagcg gccccgccta cgcgctgctg ctgctcgggc tgctcgccct    308160
     gaccacgctg tgcgacgcgg tgctcgccgc ggcacccgcg cacgcgcgca ccggctggcc    308220
     cttcgggccc ctgctgcgcg aagagctgcg cggcatggtc gggatcacgt cggcggtgtg    308280
     cgcgaccggc gcggtgatgg cgctcgcggt gagcgtcgcg ggactgtggg cgctccccgt    308340
     cttctccgtg cccctgctgc tcgcccagct ctcctaccgg cggtacgcgg ccgtccgggc    308400
     cacttaccgg cagaccatcg cctccctggc ccgcgccacc gagatcgccg gatacacccc    308460
     ggccgggcac gcgcgccgcg tcgccgggct cggggtggcc gtcggccggg acctggggct    308520
     gtcgggggcc gagctgaccg tgctggagta cgcggccctc atgcacgaca tcggccagct    308580
     gagcctggtc gacccggtcc cggcgggtgc cacggccggc ctgccggtca ccgaacagcg    308640
     gcggatcgcg ctgctcggcg gggccgtcgt ccgccagacc ggcgtcgacg cggcggtcgc    308700
     ggtggtggtg gagcggcagg ccgacccctg ccgggagcag ccggtcgccg cgcggatcgt    308760
     acgcgtcgtg aacgcctacg acgagaaggc gcgggacgcg ggtcccggcg gcgtcctgac    308820
     cgcgctggag gagctgcgcc tggccaccgc gggcgactac gctccggaag tggtggaagc    308880
     gctggcccgg gtcctttccc gaggcagcct taccgagccc gcggctgggt aacccatggg    308940
     taatgagcgc ctccgcagcc gtacgtggtt tgatgcccgg gagagggtgt ccgggggcgc    309000
     gaaaaggcac agccagccca cagaacggaa ctggcaggcg ggaatcgtga ggatcttcgg    309060
     caaggcacgg caccggccct ccgcctcttg gcggcaggcc accgaccgcg cgttcacgct    309120
     gatcggcgac ggtcgctacg aggacgcggg cgcgctgctg acgcgggcgg ccgacctgga    309180
     gccctggctg tcggagtcct ggttcaacct ggcgctgctg cacaagttcc ggcacgactg    309240
     ggaacaggcg agggcggccg gtctgcgggc cgtcgcgctg ctcgaccggg acatcggcgc    309300
     ccccgactgg tggaacgtcg gcatcgccgc gaccgccctt caggactggc cgctggcccg    309360
     tcgcgcctgg caggcctacg ggctgcgcac ccccgggggc gccacggacg cgggtgagcc    309420
     gctcggcatg gacctcggca gcgccgccgt acggctgtcc ccggagggcg aggccgaggt    309480
     ggtgtggggg cggcggctgg accccgcccg cgtcgaggtg ctgtccatcc cgctgccgtc    309540
     ctccggccgg cgctggggcg aggtcgtttt gcacgacggc gtaccgcacg gggagcgcac    309600
     gacctcggcc gggcactcct accccgtctt cgacgagatc gagctgtggg cgccctcgcc    309660
     ggtgcccacc tgggtggtcc tcctggaggc cgccaccgag tccgaccgcg acgccctgga    309720
     gcagctggcc gccgacgccg ggttcgccgc cgaggactgg tcgtcctccg tccggctgct    309780
     gtgccggatg tgctcggagt cccggatgcc gtccgacgag ggcgacggcg agcacctcga    309840
     tccgcacgac cacagcgaac ccggacaccc cgggcccctg gggcaccgca ccgacgggca    309900
     gctgtgggtg ccggagcggg agtgcggggt ggccgcgccg gccgggctgg tgaaggggtt    309960
     gctggacggg tgggtcgcgg acagtccgga ctcccgggac tggcgggacc tggaagaggt    310020
     ctgctgagca gccccgtagt ctttgtcagg acacttcagc agcgtcagca tcacctttgg    310080
     ttgtacgagg aaggcatacg tcggtcatgg cccagcagga caccgatcag cagcacccgg    310140
     gcgtgctccc cgtggacgac gagggattcg tcgtcgacag ccaggactgc gaggagcgtg    310200
     aggccgactg gcgcgggcgc ggcacctccc gtccgatcac ggtggtcggc aacccggtgc    310260
     tgcacaagga gtgcgaggac gtcaccgact tcggcgagga gttccagcag ctggtggccg    310320
     acatgttcgc cagccagcgc accgccgagg gagtgggcct ggccgccaac cagatcggcg    310380
     tctccaagaa ggtcttcgtc tacgactgcc ccgacgacga gggcgtccgc cacgtcggcg    310440
     tggtctgcaa cccgcggctc gtcgagctgc cggccgaccg ccgccgcctg gacgacagca    310500
     acgagggctg cctgtccgtg cccaccgcct acgcgccgct cgcccgcccc gactacgccg    310560
     aggtgaccgg gcaggacgag aagggcaacc cggtcaaggt gcgcggcacg gggtacttcg    310620
     cccggtgttt gcagcacgag acggaccacc tgtacgggta cctgtacatc gaccggctct    310680
     ccaagcgcga acgcaaggac gcgcttcggc agatggccga gaacgagccg cgctaccccg    310740
     tggtcgcgaa cgactgacac cgcctcaccc gccccacatc tcccttgcgc acggcgcctg    310800
     ttcgggtctt ccccgagcgg gcgccgttcg tctgtgcacg cgcatggaaa gccgccacac    310860
     aacaggagaa ttccggcacc aggggtagtg aatgaagcaa atccgttccc agaacggtca    310920
     gttgtggtgc tgaatgggaa gtgcggggat acgcaacggc gcacgccccg ctcagcgaga    310980
     ggggtgcgcc accggcggct                                                311000
//

If you have problems or comments...

PBIL Back to PBIL home page