(data stored in SCRATCH zone)

EMBL: AM039949

ID   AM039949; SV 1; circular; genomic DNA; STD; PRO; 19146 BP.
XX
AC   AM039949;
XX
PR   Project:PRJNA13649;
XX
DT   20-OCT-2005 (Rel. 85, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Xanthomonas campestris pv. vesicatoria plasmid pXCV19, complete genome
XX
KW   complete genome.
XX
OS   Xanthomonas euvesicatoria
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Xanthomonas.
OG   Plasmid pXCV19
XX
RN   [1]
RP   1-19146
RA   Thieme F.;
RT   ;
RL   Submitted (16-JUN-2005) to the INSDC.
RL   Thieme F., Institut fuer genetik, Martin-Luther-Universitaet, Weinbergweg
RL   10, 06120 Halle/Saale, GERMANY.
XX
RN   [2]
RX   DOI; 10.1128/JB.187.21.7254-7266.2005.
RX   PUBMED; 16237009.
RA   Thieme F., Koebnik R., Bekel T., Berger C., Boch J., Buettner D.,
RA   Caldana C., Gaigalat L., Goesmann A., Kay S., Kirchner O., Lanz C.,
RA   Linke B., McHardy A.C., Meyer F., Mittenhuber G., Nies D.H.,
RA   Niesbach-Kloesgen U., Patschkowski T., Rueckert C., Rupp O., Schneicker S.,
RA   Schuster S.C., Vorhoelter F.J., Weber E., Puehler A., Bonas U., Bartels D.,
RA   Kaiser O.;
RT   "Insights into genome plasticity and pathogenicity of the plant pathogenic
RT   bacterium Xanthomonas campestris pv. vesicatoria revealed by the complete
RT   genome sequence";
RL   J. Bacteriol. 187(21):7254-7266(2005).
XX
DR   MD5; 4ace0d65ed8cc88b53bfbf722720569b.
DR   BioSample; SAMEA3138194.
DR   EnsemblGenomes-Gn; EBG00001206924.
DR   EnsemblGenomes-Gn; XCVb_tRNA01.
DR   EnsemblGenomes-Tr; EBT00001776576.
DR   EnsemblGenomes-Tr; XCVb_tRNA01-1.
DR   EuropePMC; PMC1272972; 16237009.
DR   EuropePMC; PMC2246292; 17927820.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..19146
FT                   /organism="Xanthomonas euvesicatoria"
FT                   /plasmid="pXCV19"
FT                   /strain="85-10"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:456327"
FT   CDS_pept        complement(96..443)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19748"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19748.1"
FT                   /translation="MPETIKLDTARELAVAGSIRDTVLLGQRGGFLIIFRMGMSERVLA
FT                   TKYGVPRLFSGLDAAAKVLREISITRFQVDASDLVKDDSTRRRRPDRAAALKQTYRDAA
FT                   LVLSRHINDAQ"
FT   CDS_pept        676..2916
FT                   /transl_table=11
FT                   /locus_tag="XCVb0002"
FT                   /product="DotA/TraY family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19749"
FT                   /db_xref="GOA:Q3C0G2"
FT                   /db_xref="InterPro:IPR027628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19749.1"
FT                   /translation="MLKSYGSTFPWAFGRAAAPEKWNPPADDSSLGILREVFGNIVDFV
FT                   IGNGVSAANLSENNTVIASGFEVFNTAILFLAMIFVAYSSIMGVINTAHDGEFLGRKMS
FT                   SIWVPLRTVGGSALLLPLAGGFSLIQIIILWLTLQGVGIGDKAWTAMLGRIDQSGMINH
FT                   PAIPNARPLVANILRSEVCMAAMNKQYAESDRTDRINLVEIKSSRTQMVPTDDLLGGTG
FT                   GNGLGLFGINYKSLTVPVTSWSWAASNGSYIRNDVCGGISWDESSESQAGNARYLDVAK
FT                   ISTAHTAAVRDVILAIRPVAASIVAGQKPNSDVILSTAYAYENKLRQAAKAAVDSGNKA
FT                   SRSAFVDYAKTGGWVFAGSYYNHIISLNDSVQLAVNSLPTSTSIDIQDKESQEALYGFR
FT                   DAMTVTEEFLKHRSQSAAAAYANETRLDTDACKSPTPTGWDEIRTCLSKPALAGIELMA
FT                   ANMTGSNTSHVAQVKAVGDTIMNVAWTQAGVFAIAGGVADAKLVDYSVGSFFSLKGALG
FT                   SVSVLVNTLVLSMLTAGIVLAFYVPMIPFITWTVGVIKWLVSVAEAMVAAPIFAAAHIH
FT                   PDGDEAVGRAGPGYTIILSTVLRPILMLFGLILSIAVAQPIAHFVNAGFMLAVKGSMHD
FT                   SANGLGAFVAYCVIYVIIMTTVLHSVFALIHWIPDNTMRWMGSAVGMGGVGDREEGESH
FT                   QVFAGAARQGRNLTTGPKAPPGGGRMGTEDGPEPPSGGTSESDHAQRPRGGG"
FT   CDS_pept        complement(3106..3699)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19750"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19750.1"
FT                   /translation="MAPSANTRWPQGTALRTEYFPPVVVKGQRVDLSHLDPLTITFESL
FT                   KVGKALRVAVTFTNHCFSASYGEIPHPPGDAVIWDGRKMRTFCPTRYRLSKVLPDLIRS
FT                   MPEKKVILAAHETTWVHTLTIEDPSGPYHLFLTVKRSSREKRTWQDVDVIVESAYHETR
FT                   NAPTTTGSWRPFVVVCGEAYLANPHKPNKRRHRR"
FT   CDS_pept        complement(3762..4280)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19751"
FT                   /db_xref="GOA:Q3C0G0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR033390"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19751.1"
FT                   /translation="MRFFLDTEWADPVGSELVSIGLVSEDSHHRFYAERDPLPAMPTDF
FT                   VRHVVYPILQGKPASMSEMAMTTGLRVFLGADQAPLVLADYAHDLVLLRYVLAGFDMPD
FT                   DQAQECGPIPQVQGLLIDGDQIDRKVEWLFENRPMLRARRHHALNDAEALRMAWKLCRA
FT                   EQALDKTGD"
FT   tRNA            complement(4309..4401)
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="XCVb_tRNA01"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:34..36,aa:Ile)"
FT   CDS_pept        complement(4605..4997)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19752"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19752.1"
FT                   /translation="MSSWSKNAHPPGCASSGDAGLQPGVACPKPSKKETKMSTEKRNTR
FT                   LTDFTQNDADDDLVLQVCDALEAIVVRLQLRAGAALAAVRSGTLGIEPRRAYDYLLGVF
FT                   HALVFRGEINEDSWWEIDAELDRLAV"
FT   CDS_pept        complement(4990..5190)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0006"
FT                   /product="putative ribbon-helix-helix protein, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19753"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19753.1"
FT                   /translation="MTKEGGQVPANGEPARTRAMRGKRNVITHTLPPELLEKIDRRAGE
FT                   LGIPRAAFINMALSKALESGV"
FT   CDS_pept        complement(5202..5570)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19754"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19754.1"
FT                   /translation="MPMSQADYQRGLDDQRFYFQQRLNRLIELRDRWIVHARGETARAD
FT                   RLSHELAKAQKHSQASTQQIASLQTKLAAAERTLADLQATSAQRITSLERELEQATENY
FT                   GWIVSVVEDHGVQLRSQP"
FT   CDS_pept        complement(5616..7217)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0008"
FT                   /product="MobA/MobL family plasmid mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19755"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19755.1"
FT                   /translation="MCGPTGKSEEQKVSVAIFHLCAKVIGRSAGRSATAAAAYRSGTEV
FT                   VDMRTGEVHDYSRRGGVRETFILAPVGSGEWVSDRSALWNAVEAAEKRKDAQLCREVEV
FT                   SLPHELSHDERRRLLVEFCEAEFVALGMVADVAMHSPGHEGDKRNEHAHIMLTMRRVEG
FT                   QGFGQKAREWNSKDLVEQWRSGWAERVNVRLAEHAIQATVDHRSYVRQALAAGHDVESA
FT                   AAPTVHLGPKASAMERRGEQTELGNQNRKVIAFNAQRKVLRRELGQVSAQIIDLEKARS
FT                   DRAARSVVPPRSGVQVRAPRRLGESREAREMREAAERVTEVLMTLLGLGEPPTSHQVRA
FT                   EISRRRPAPMNIRPSGAVLETQALLQVIESKLAKVENRNRALNEDVAKYRDFVALDERV
FT                   AAWREAHPYRARMHDLGVARTDEAEFCGHDLQAAKGRIAELQKELRDEYASLGKAKEEQ
FT                   TVYLAQLQGQAAAQALTSGAPATVELIEQLEQHAAVLEAYERSIAEAAAQVAETAADDK
FT                   NLDDQPDIEHPRPSIN"
FT   CDS_pept        7300..7572
FT                   /transl_table=11
FT                   /locus_tag="XCVb0009"
FT                   /product="putative plasmid mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19756"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19756.1"
FT                   /translation="MATERLESLKAKKAQLAAQISKLEARESDKARKERTKALILFGTA
FT                   LEKQIKKGDQDGRLRSLILGNLTEKDGQKALSYIESIEHSNVADS"
FT   CDS_pept        complement(7606..7947)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19757"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19757.1"
FT                   /translation="MATKAMRAMSNRGLSVLAAWKIYLKLLESRNSSYAQTLISHRKLV
FT                   EAMSLPTRDVTAGIDHLVNHSLVHVRQHDVLGSVGHPVNQYNLLGEFRSKPITVSIGGF
FT                   PISTRVAEM"
FT   misc_feature    complement(8068..9291)
FT                   /locus_tag="IS_Xac3_pXCV19_1"
FT                   /note="IS element Xac3"
FT   CDS_pept        complement(8073..8933)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0011"
FT                   /product="ISxac3 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19758"
FT                   /db_xref="GOA:Q3BYS8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19758.1"
FT                   /translation="MIERCRDEFPIRLMCRCLKVSASGYYEWSKRPASARQLDNERLVV
FT                   RMRELHEDSRGTLGAGRMREDLAEEGETASLNRVARLMAADGLQGWPRRKRRGQRGSPA
FT                   VTPPGVVNLLERDFLALEPETKWVTDITEIKTQQGKLYLCIVLDLYDQRIVGWSMHARQ
FT                   DRQMVIRAVQMAVWQRQGSDEVIVHSDRGSQFRSGDYQRYLTANGLICSMSAVGHCGDN
FT                   AACEGFFGLLKRERIYRTSYATLDGARADVFDYIERRHNPRMRRRAAKQDQKVAALLQP
FT                   SVISG"
FT   CDS_pept        complement(8942..9229)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0012"
FT                   /product="putative ISxac3 transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19759"
FT                   /db_xref="GOA:Q3BYS7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19759.1"
FT                   /translation="MSKRRKFTAEFKRGAVEQASQPGVSCAQVARELGIRDTLLTRWKR
FT                   EAQTPGTAAFGGSGTPRDEELARLKRELARVKKERDFLREAATFFAKGSP"
FT   CDS_pept        complement(9414..10097)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0013"
FT                   /product="putative metal-binding protein, SEC-C motif"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19760"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19760.1"
FT                   /translation="MGAGHDAQLDRLGDFLEGVGAPAMNLEMLDGFFAALICGPETVLP
FT                   SEYLPQVFGEDHCFDSNDQAAEILGLVMRHWNTIASELFRTLEKDDVYLPVLLEDADGA
FT                   VHGNDWARGFMRGIQLRPNSWQELIGSEEFGGPMLPIMILTHEHDPDPAMRPPEIAPDK
FT                   RDELLQSLIAGLTHIYRYFASHRQLATQGPLRRQGPKIGRNDQCPCGSGRKYKHCCATS
FT                   APTFH"
FT   misc_feature    10084..11309
FT                   /locus_tag="IS_1477_pXCV19_1"
FT                   /note="IS element 1477"
FT   CDS_pept        10228..11280
FT                   /transl_table=11
FT                   /locus_tag="XCVb0014"
FT                   /product="IS1477 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19761"
FT                   /db_xref="GOA:Q3C0F0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19761.1"
FT                   /translation="MPSAWFQPGQLLSVAGQVRGDGGRRGQAAERTGGPEHSIEEVAGR
FT                   GAPGHRSAEGWLRGKTLAPQRKREAIRRMLEHTPLSERRACRLAGLSRDAFRHAPVPTP
FT                   ATQALSARLVELAQTHRRFGYRRLHDLLRPEFPSVNHKKIYRLYEEAELKVRKRRKAKR
FT                   PVGERQKLLASSMPNDTWSMDFVFDALANARRIKCLTVVDDFTRESVDIAVDHGISGAY
FT                   VVRLLDQAACFRGYPRAVRTDNGPEFTSRAFIAWTQQHGIEHILIEPGAPTQNAYIESF
FT                   NGKFRDECLNEHWFTSLAQARDVIADWRRHYNQIRPHSSCGRIPPAQFAANYRTQQANN
FT                   AVPFNPGLYQ"
FT   CDS_pept        complement(11350..14325)
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="XCVb0015"
FT                   /product="Tn5045 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19762"
FT                   /db_xref="GOA:Q3C0C6"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19762.1"
FT                   /translation="MPVSFLSTTQRERYGRYPDTLSSEELARYFHLDDDDREWIATKRR
FT                   DSSRLGYALQLTTARFLGTFLEDPTAVPSPVLHTLSSQLGIADPSDCVIDYRTTRQRWQ
FT                   HTSEIRTRYGYREFTGTGVQFRLGRWLCALCWTGTDRPSALFDYANGWLVGHKVLLPGV
FT                   TLLERFIAEIRSRMESRLWRLLVHGVTPEQRQRLDDLLKLVEGSRQSWLDRLRKGPVRV
FT                   SAPALVAALLRIETVRGLGIKLPGTHVPPSRIAALARFASTAKVSAVARLPEVRRIATL
FT                   VAFVHCLEASAQDDAIDVLDLLLRELFTKAEKEDRKVRQRSLKDLDRAASTLAEACRML
FT                   LDPALPDGELRERVYAAIGHDELAQALNEVRGLVRPPNDVFYTELEARKATVSRFLPAL
FT                   LRVIRFDANPAAQPLAQALQWLHEKPDHDPPTAIVGKAWQRHVVQDDGRINATAYSFCA
FT                   LDKLRSAIRRRDVFISPSWRYADPRAGLLAGAEWEASRPIVCRSLSLSAQPEATLSELT
FT                   RELDETYRRVAARLPQNDAVRFENVGDKTELVLSPLEALEEPPSLIALRNEIKARMPRV
FT                   DLPEILLEVAGRTGCMEAFTHLTERTARAADLTTSLCAVLMAEACNTGPEPLVRPDTPA
FT                   LKRDRLMWVDQNYVRDDTLTACNAVLVAAQSRIALARTWGGGDVASADGMRFVVPVRTI
FT                   HAGPNPKYFNRGRGVTWYNLLSDQRTGLNAITVPGTLRDSLILLAVVLEQQTELQPTQI
FT                   MTDTGAYSDLVFGLFRLSNYRFCPRLADVGGTRFWRVDPDADYGDLNALARQRVNLDRI
FT                   TPHWDDVLRLVGSLKLGLVPAMGIMRTLQVDERPTSLAQAIAEIGRIDKTIHTLNFIDD
FT                   EARRRATLLQLNLGEGRHSLAREVFHGKRGELFQRYREGQEDQLSALGLVVNMIVLWNT
FT                   LYMDAVLTQLRSEGYPVKPEDEARLSPFGHEHINMLGRYSFSVPEAVARGELRPLTKPN
FT                   DP"
FT   CDS_pept        complement(14330..14749)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19763"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19763.1"
FT                   /translation="MRVVLDTNVLLAALISSHSPPDIIYRGWLAARFELVTGTAQLDEL
FT                   RRVSRYPKIKAILPAHRVGTMINNMQRAVVLHVLPPLPDRIEVNDPNDAFLLAMALASE
FT                   ADYLVTGDRRAGLLQRGSIGRTRIVTPVTFCAEAL"
FT   CDS_pept        complement(14749..14988)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19764"
FT                   /db_xref="GOA:Q3C0C4"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR031914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19764.1"
FT                   /translation="MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYL
FT                   FERAVEQAKAATVGMGETELNDLIDEAVQWAREH"
FT   CDS_pept        15203..16126
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="XCVb0018"
FT                   /product="Tn5045 resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19765"
FT                   /db_xref="GOA:Q3C0C3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19765.1"
FT                   /translation="MKIGYARVSTREQNPALQVDSLKAAGCERIYQDVASGAKTARPAL
FT                   DELLGQLRGGDVLVIWKLDRMGRSLKHLVELVGSLMERKVGLLSLNDPIDTTSAQGRFV
FT                   FNLFATLAEFERELIRERTQAGLTAARARGRVGGRPKGLSPQAEATALAAETLYRERKL
FT                   SVAAIAQKLHLSKSTLYSYLRHRGVEIGPYKQSAQSPINVSVVESGNADQPKVATILLT
FT                   LRIENNSKFVRGKKRSIEHVEFFDLAQYDATRRPNGEYELKVPYDTDEELDEAVNDLLT
FT                   DIACGADDRHCFSESHARMEGTDRHW"
FT   CDS_pept        17396..17899
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="XCVb0019"
FT                   /product="Replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19766"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19766.1"
FT                   /translation="MSLPVPSSKKRIEYVQLYRSSMKALRQLALEAPTAHAVLYVLMER
FT                   INERNALVASYATLAKLTGKSRATITRALAELRTRNYIEMVKAGNVSVIVVNKRVAWAT
FT                   ETALRGKLAVFDARVIVSSEEQDEPERLGKEPDLVRLPPVLVPPEMATMLEDGEDDGQG
FT                   DLQL"
FT   CDS_pept        17896..18054
FT                   /transl_table=11
FT                   /locus_tag="XCVb0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19767"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19767.1"
FT                   /translation="MNQIMDACNSNAIRITLEWRALGDAANAPRYLASDLDALSWEDVR
FT                   ELGLQPA"
FT   CDS_pept        18152..18802
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="XCVb0021"
FT                   /product="Plasmid partitioning-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19768"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19768.1"
FT                   /translation="MKILVLASQKGGAGKTTLAAHLAVAAETAGAGPVVLLDTDPQGSL
FT                   SAWWNSREAQSPALASATLKELPEKLDALAAAGFKLAVIDTPPAIADAIRDVVRLADLV
FT                   LIPTRPSPHDLRAVGSTVDIAQEAGRPFAFAVTQAKPTARITVQAVAALSAHGPVAPAI
FT                   VHDRVDYATSMVDGRTVGEVDARSRSAEEIRTLSAFVNERMHEKKKAKIKETV"
FT   CDS_pept        18805..19059
FT                   /transl_table=11
FT                   /locus_tag="XCVb0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19769"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19769.1"
FT                   /translation="MATKKTADLSGLVATKGAAAPVAGMPVRAPAPRSDDTEVANNEPL
FT                   NFRVSGDFRRRFRMFAAAHDMKLNELLRLVFEEYEKKHG"
XX
SQ   Sequence 19146 BP; 3912 A; 5839 C; 5603 G; 3792 T; 0 other;
     tttggagcgc tgggccaacg caggtgacac cgctgcaagc tgcaatcccg taaaagattc        60
     aagcacgaaa gaacgtaagc acgaaaagcc gctttctact gggcgtcatt gatgtggcgt       120
     gatagcacta gcgctgcatc ccgataggtc tgcttaaggg ctgcggcacg gtcaggcctg       180
     cgccggcggg tactgtcgtc tttgaccagg tcgctggcgt cgacctggaa gcgagtgatg       240
     gagatctcgc gcaggacctt ggcagcggca tcgaggccgc tgaagagtct cgggactccg       300
     tatttggtcg ccaggacccg ttcggacatc cccatccgga agatgatcaa gaagccgccc       360
     cgttgcccga gcagcacggt atcgcggatg ctgccggcga cggcaagctc ccgggcagtg       420
     tccaacttga tcgtctcagg catgttgggt gaccaaccaa caattaagag ggcgacacta       480
     taccgtcgcg cagcttacga ctgaccattt cggggtgggg caggccgtac ataccgtcta       540
     tttatgcgaa gtactcatgg tcgcggtagc ccccggatcc ccatctttaa caaattcgtg       600
     acatcagttc ccaaataact gttaaaggtc ggctatcata tttcaacggc gaaagctata       660
     cgcaataata cgaccatgct gaaaagctac ggctctacct ttccttgggc cttcggaagg       720
     gcagcagccc cggagaaatg gaatccccca gctgacgact cttcactcgg cattcttcgc       780
     gaagtgttcg gcaatatcgt cgatttcgtg attggcaatg gcgttagcgc cgccaatttg       840
     agcgagaaca acacggtcat tgcctcaggc tttgaggtgt tcaacaccgc gatcttgttc       900
     ctggccatga tcttcgtggc ctacagctcg atcatgggtg tgatcaacac cgcccacgac       960
     ggcgaattcc tcggccgcaa gatgtcctcg atctgggtgc cactacgcac tgttggcggc      1020
     agtgccttac tgcttcctct ggccggcggc ttctcactga tccagatcat cattctctgg      1080
     ctgaccctgc agggcgtagg catcggcgac aaagcgtgga ccgccatgct cggccggatc      1140
     gaccagagcg gaatgatcaa tcacccagcg atcccgaacg ctcgtccgct ggtggccaac      1200
     atcttgcgat ccgaggtgtg catggcggcg atgaacaagc aatatgccga atccgaccgc      1260
     acggaccgca tcaacctggt ggagataaaa agctcccgca cgcaaatggt tcccaccgat      1320
     gaccttctcg gtggcaccgg cgggaacgga ctcggcctct tcggtatcaa ctacaagtcg      1380
     ctcaccgtac cggtcacgag ctggagctgg gcggcaagca atggctccta tatccgcaat      1440
     gacgtgtgtg ggggcatcag ctgggatgag agtagcgagt cgcaagctgg caatgcccgc      1500
     tatctcgatg ttgccaagat cagcactgcc cacaccgccg ccgtccgcga tgtcattctg      1560
     gccattcgcc ctgttgcggc cagtattgtc gctggtcaga agccgaacag cgatgtgatc      1620
     ctcagcaccg cctatgccta cgaaaacaag ttgaggcaag cggccaaggc ggcggttgat      1680
     tccgggaata aagccagccg cagtgcattc gttgactacg ccaagaccgg gggctgggtc      1740
     ttcgccggca gctactacaa ccacatcatc tcgctcaacg acagcgtcca attggcggtc      1800
     aattcgcttc cgacctccac ctcaatcgat atccaggaca aggaatccca agaagccctc      1860
     tatggcttcc gggatgcaat gactgtcaca gaggaatttt tgaagcatcg ctcgcagtct      1920
     gcggcggcgg cctacgccaa cgaaactcgt ttggacaccg atgcgtgtaa gagcccgact      1980
     ccgacgggct gggatgagat ccgcacgtgc ctttcaaaac ccgcgctggc tggcatcgag      2040
     ctgatggcag ccaacatgac tggcagtaac acgtcccacg tcgctcaggt taaagctgtc      2100
     ggtgacacga tcatgaatgt cgcctggacg caggctggcg tctttgcgat cgccgggggc      2160
     gtggccgatg ccaagctggt cgactattcg gttggctctt ttttcagctt gaaaggagca      2220
     ctgggaagcg tctcggtcct agtcaacacg ctggtcctgt ccatgttgac tgccggcatc      2280
     gtcttggcgt tctacgtgcc catgattccg ttcattacct ggacggtcgg cgtgattaag      2340
     tggctggtct cggtcgccga agcgatggtg gccgcgccta tcttcgctgc cgcacacatc      2400
     caccctgatg gcgatgaagc ggtggggcga gctggacccg gctacaccat catcctgtcg      2460
     accgtcctgc gacctatcct gatgctgttc ggcctaatcc tctcgatcgc agtggcgcag      2520
     ccaattgctc acttcgtcaa tgccggcttc atgctcgcgg tgaagggctc gatgcacgac      2580
     agcgcgaatg gacttggtgc gtttgtagcc tactgcgtga tctacgtgat catcatgacc      2640
     acggtcctgc attcagtttt tgcgctaatt cattggatcc ccgacaacac catgcgctgg      2700
     atgggcagcg cggtcggcat gggcggcgtt ggcgacagag aggagggcga aagccaccag      2760
     gtcttcgcgg gcgcagctcg ccagggccgc aacctgacaa cggggccgaa agctcctccg      2820
     ggcgggggac gcatgggcac tgaggacggc ccagagccac ccagcggcgg taccagcgag      2880
     agcgatcacg cccagcgccc acggggcggc ggttaggctt cgcttggcat gacttgcatg      2940
     taacgcatgc gtaacgctat aattgcatcg caagtcgaag cgactgaccc ggtgaaattg      3000
     agcgcttccc agcggcttcg gccgtaggca tccacgatgc ctcgcaagtg gtctccgggg      3060
     tctgaacacg gaaaagggcg cttcggcgcc cttttctttt gtccttcacc gcctgtggcg      3120
     ccgcttgttg ggcttgtgag gattggccag ataggcctca ccgcatacga ccacaaaagg      3180
     ccgccaactg cctgtggtgg tcggcgcgtt gcgcgtctcg tggtacgcgc tttccacgat      3240
     aacatcgacg tcctgccagg tgcgcttctc cctggaactg cgcttgaccg tcagaaacag      3300
     gtggtagggc ccgctgggat cctcgatcgt cagggtgtgg acccacgttg tttcatgcgc      3360
     cgcgagaatc acttttttct ccggcattga gcggatcaga tccggcaaca ccttagagag      3420
     ccgatagcgc gtcgggcaga aggtccgcat cttcctccca tcccaaatta ccgcatcacc      3480
     tggcgggtgc gggatctctc catacgaggc gctgaaacag tggttggtaa aggtaacagc      3540
     caccctcaag gccttgccca ccttcaggct ttcgaaggtg attgtcagcg ggtctagatg      3600
     cgacaggtcg acccgttgac ctttgaccac taccggcggg aaatactccg ttctcaatgc      3660
     cgttccttgt ggccatcgag tattggccga tggcgccatt atcgcttcgc ggtcagctct      3720
     tccaatgggc caacccgccc cgcaaacggc ttggttggct atcagtcgcc tgtcttgtcc      3780
     agagcctgct ctgccctgca cagcttccac gccatgcgca gtgcctcagc atcattcaac      3840
     gcatgatgcc ggcgcgcccg gagcatcgga cggttctcga acagccactc gaccttccgg      3900
     tcgatctggt caccgtcgat cagcaggccc tgcacctggg ggattggacc gcactcctgc      3960
     gcctgatcgt ccggcatatc gaagccggcc agcacgtagc gcagcagcac caggtcatgg      4020
     gcatagtctg ccagtaccag tggggcctgg tcagcgccca ggaagacgcg caggccggtg      4080
     gtcatggcca tctccgacat cgaggccggt ttaccctgca agatcgggta gaccacatgc      4140
     cgtacaaagt cggttggcat cgccggcagt ggatctcgct cggcatagaa acggtgatgg      4200
     ctatcctcgc tcacgagccc aatgctcacc agctcggatc ccactggatc agcccattcc      4260
     gtatcgagaa agaagcgcat cgcgcctcca gggtacttct gagggtggtg gtgcccctgg      4320
     ccgggctcga accggcactt gccgcttatc tggcgctgac gggatataaa tccgctgctc      4380
     tacccattga gctacagggg cgtgatcgat caggcgatca cgccggtatt cgggcaaaaa      4440
     ggtggtggca gcgtaggtga cacatagtca taccgtagca tgccgccggc ccgcaaaggc      4500
     ccccaaattt gggggcgaaa gcagatttgg tagctcttcc atgcctaaag ccctggagat      4560
     ttctcaagtc tgggcgtgat gcccccatag ataggggcct taactcagac ggccaatcga      4620
     tcgagctcag cgtcgatttc ccaccagctg tcttcattga tttccccgcg gaacaccagg      4680
     gcatggaaga cgcctagcag gtagtcgtag gcgcggcgtg gctcgatgcc tagagtgcct      4740
     gaccgcacgg ccgccaacgc agcccccgca cgcagctgca gcctgacgac aatcgcttcc      4800
     agggcatcgc acacttgcaa aaccaggtca tcatcagcgt cgttctgagt aaagtcagtc      4860
     aggcgagtgt tacgcttttc agtgctcatc ttcgtctcct tcttagacgg ctttgggcag      4920
     gcgacgccgg gctgcaaccc ggcgtcgcca ctagaagcgc acccaggtgg atgcgcgttt      4980
     ttggaccagc tagacaccgc tctccagcgc ctttgagagc gccatgttga taaaggccgc      5040
     gcgaggaatt ccaagctctc ccgctctacg gtcaatcttc tccagtagct ccggcggcaa      5100
     tgtgtgcgtg atcacgttgc gctttcccct catggccctg gttcgagccg gctcgccatt      5160
     ggcaggcacc tggccacctt ctttggtcat cgtatttcct gttatggctg cgacctcagc      5220
     tggacaccat ggtcctcaac cacgctgacg atccacccgt agttctcggt cgcctgctct      5280
     agctcgcgct ccagactcgt gatgcgctga gcagaggtgg cttgcagatc ggcgagcgtg      5340
     cgctcggccg ccgccagctt cgtttgaagc gaggcaatct gttgagtgga agcctggctg      5400
     tgcttctgcg ctttggccag ctcatggctc aggcgatcag cccgcgccgt ttcgcctcgg      5460
     gcatggacga tccaacggtc gcgaagctcg atgagtcgat tgaggcgctg ctgaaagtag      5520
     aacctctggt cgtcgaggcc tcgttgatag tcagcttgcg acatgggcac atcctcagca      5580
     cgttaaagac aatatattta attgcttttt acttgtcaat tgattgatgg gcgtgggtgc      5640
     tcaatatcgg gctggtcatc cagattcttg tcatcggcag ccgtctctgc cacttgtgct      5700
     gcagcctcag caatagatcg ttcgtaggcc tccaacaccg ccgcgtgctg ctccaactgc      5760
     tcgatcagct ccacagtcgc aggggcgccg ctggtcagcg cctgggctgc agcctgcccc      5820
     tgtagttgtg ccagataaac cgtctgctct tccttggcct tgcccagcga agcgtactca      5880
     tctctgagct ccttctgcag ctcggcaatc cgccccttcg ccgcttgcag atcatggcca      5940
     cagaattcgg cctcgtcggt acgagccacg cccaggtcgt gcatcctcgc cctatagggg      6000
     tgggcttcgc gccatgcagc tacgcgttca tccagagcaa caaaatcccg gtacttcgcg      6060
     acatcctcat tgagggcgcg atttcgattc tcgaccttgg ccagcttcga ttcgatcacc      6120
     tggagcagcg cctgcgtctc tagtaccgca ccagacgggc gaatattcat cggagccgga      6180
     cgacgacggg aaatctctgc gcgcacctgg tgcgacgtcg gcggctcacc cagacccaac      6240
     agggtcatga gcacttccgt tacacgctcc gcggcctccc gcatctctcg ggcctcacgg      6300
     ctttcgccaa gacggcgcgg tgcacggacc tgcacgcctg agcgaggagg gacaaccgat      6360
     ctggccgctc gatcagagcg cgccttttcc aggtcgataa tctgagccga tacctggcca      6420
     agctcgcgtc ggaggacttt ccgctgagcg ttgaaggcaa tcaccttccg gttctgatta      6480
     cccaattcag tctgctcacc tcgccgttcc atggccgatg ctttcggccc aaggtgaacg      6540
     gttggagccg cagccgattc aacatcatga ccagcggcga gcgcctggcg aacatagctc      6600
     cggtgatcca ctgtcgcttg aattgcgtgc tcagcaagtc gcacgttcac tctctcagcc      6660
     cacccggaac gccactgttc gacaagatcc ttggagttcc attcccgcgc cttttggccg      6720
     aagccctgcc cctcaacccg gcgcatggtc agcatgatat gagcatgctc attccgcttg      6780
     tcgccttcgt gaccaggtga gtgcatggcc acatcagcga ccatccccaa tgccacaaat      6840
     tccgcctcac aaaactcgac caacagacgg cggcgctcat catggctgag ttcatgcgga      6900
     aggctgacct ccacctctcg gcatagctga gcatccttgc gcttctcagc ggcctctacg      6960
     gcattccaaa gcgccgacct gtcagaaacc cattcgcccg aacccacggg tgccaaaata      7020
     aaagtctcac gaacaccacc acggcgagag tagtcgtgaa cctcaccagt gcgcatatcg      7080
     accacttcag tccccgagcg ataagccgcg gccgcagtag cggaacgacc cgccgaccga      7140
     ccgataacct tcgcacagag atgaaatatg gccacagata ccttctgctc ttcgcttttg      7200
     cccgtagggc cgcacacatc gcgtagcgat gtataagtgc gcccttgcgc agggggcgat      7260
     caaagcctac cattcgttca ccacaagagg aagtagctta tggcaacgga aagactagag      7320
     agcctgaagg ccaaaaaagc ccagctcgcc gcccaaattt cgaagcttga ggcgcgtgaa      7380
     agcgacaagg ctagaaaaga gagaaccaag gcactgatcc ttttcggaac cgcacttgag      7440
     aagcaaatca agaaaggcga tcaggatggt cgattgcgat cattgatctt gggaaatctg      7500
     acagagaagg atggccaaaa ggcactttcc tacatcgagt caatagagca cagcaacgta      7560
     gcagacagct aagtggatct ggcgtcaccc tgatccagat cagtcctaca tctctgcgac      7620
     tctagtgctg atcgggaaac cgccaatgct gacagtgatc ggcttggaac ggaattctcc      7680
     cagcaggttg tactgattga ccggatgccc cactgatccg agcacgtcat gctgccggac      7740
     atgaaccaag ctatggttga ccaagtggtc aatcccggcg gttacatcgc gcgtcggtag      7800
     cgacatggct tcgaccagct tccggtgcga aataagggtt tgtgcgtagc tagagttgcg      7860
     actctccagc agctttagat agatcttcca ggctgctaac acgctcaaac cgcgattgct      7920
     cattgcacgc atcgctttcg tggccacgtc agtcgggatc ttggaccacc gctctgtgcc      7980
     atcggtgacc tgtcggaacc tatttcggta cttagtggaa tcgacctgga ggatgccctg      8040
     cccttcgagg gcgtcgatcc cagggcgggg ttctaccccg atatcacgga cggttgtaaa      8100
     agagctgcaa ccttctgatc ctgcttggcc gcccttcgcc gcatccttgg gttgtggcgt      8160
     cgctcgatgt agtcaaacac atccgctctt gctccatcca gtgtggcgta gctcgttcga      8220
     tagatccgct cacgcttgag tagtccaaaa aagccttcgc aggccgcgtt gtcgccgcaa      8280
     tgccccacag cgctcattga acagatcagc ccgttagccg tcagatacct ctggtagtca      8340
     ccgctgcgga actgactgcc acgatccgaa tgcacaatca cctcatcgct tccttgccgc      8400
     tgccagaccg ccatctgcac agcccggatc accatctgac ggtcctgccg agcgtgcatt      8460
     gaccagccaa caatgcgctg gtcgtacaga tccaatacga tgcacagata cagcttgccc      8520
     tgctgggtct tgatctcggt gatatcggtc acccacttgg tttccggctc cagcgcgaga      8580
     aaatcacgtt caagcaggtt gaccacgccc ggcggcgtca cggccggact gccacgctgc      8640
     ccgcgacgct tgcgccgggg ccagccctgc aggccgtcgg ccgccatcag gcgtgctacc      8700
     cggttcaggc tggcggtctc gccctcctca gccaggtctt cgcgcatgcg gccagccccc      8760
     aacgtaccgc ggctgtcttc gtgtagttcg cgcatccgta cgaccaggcg ctcattgtcg      8820
     agctgccggg cgctcgcagg acgcttactc cactcgtagt agccgctggc cgataccttc      8880
     aggcaccggc acatcagccg aatcggaaac tcatcgcggc aacgttcgat cacctgatac      8940
     ctcagggtga tccctttgcg aagaacgtcg ccgcttctcg caaaaaatcc cgttccttct      9000
     tcacccgcgc caactcgcgc ttgagtcgag ccagctcctc gtcccgaggc gtgccactgc      9060
     cgccgaatgc ggccgtcccc ggggtctgcg cctcgcgctt ccagcgggtc agcagggtgt      9120
     cgcgaatccc cagctcccgg gccacctggg cacagctgac gccgggctgg ctggcctgct      9180
     caaccgcgcc acgcttgaac tcggcagtga acttcctgcg ctttgacatg aacactcctc      9240
     atggccttga tcggccttct tgtaagtgtc cgtgaaaacg ggggtgaacc cgcgaagcat      9300
     cggccgcgag aggcctgtca ggtgcatcag gcgatcattc gtgatgtcac tctctctcgt      9360
     atagaagtcg gggttcgggg agcaatggaa cagggaagtc agttaagccg gtatcaatga      9420
     aatgtcggag cgctggtagc acagcaatgc ttgtacttcc gcccactgcc acatgggcac      9480
     tgatcatttc tcccaatctt aggaccttgt ctgcgtaaag gcccttgggt tgccaattgg      9540
     cgatgtgagg caaagtagcg atagatgtgc gtcagtccgg caatcaggga ctgaagcaac      9600
     tcatcgcgtt tgtccggcgc aatctctggc gggcgcatgg cgggatcagg atcatgttca      9660
     tgggtcaaga tcatgattgg cagcatgggc ccgccaaatt cttcgctgcc gatcaactct      9720
     tgccaactat tgggccgtaa ttgaatgccg cgcatgaaac cacgtgccca gtcgttaccg      9780
     tgtacggccc catccgcatc ttcgagtagc acgggaaggt agacatcgtc tttctccaga      9840
     gtgcggaaca attctgatgc aatcgtgttc cagtgccgca tgaccaagcc aagaatttcg      9900
     gcggcttggt cattgctgtc gaagcaatgg tcttccccga atacttgtgg caagtattcg      9960
     ctgggcaaaa ccgtttctgg accacaaatg agtgcggcaa agaacccatc gagcatttcg     10020
     agattcattg caggtgcgcc gactccttcg agaaagtcgc ccagccgatc aagctgggca     10080
     tcgtgacctg cccccactga gccgtaccag ctgaagctat aaagtccgtg aacccaagag     10140
     gacggacatg aagaagagca gattcagcac cgagcagatc atcgggttta tcaaacaggc     10200
     cgacgcgggc atggccgtgg cagagttgtg ccgtcggcat ggtttcagcc cggccagctt     10260
     ttatcagtgg cgggccaagt acggggggat ggaggccgac gaggccaagc ggctgaaaga     10320
     actggaggtc cagaacactc gattgaagaa gttgctggcc gaggcgcacc tggacatcga     10380
     agcgctgaag gttggcttcg gggtaaaacg ctagccccgc aacgcaagcg cgaggcaatc     10440
     cgacgaatgc tcgaacacac cccgttgagc gagcgccggg cttgccgcct tgcggggctg     10500
     tcccgcgatg ctttccgcca cgcacccgtg ccgacgccag ccacgcaggc gctgtcggcg     10560
     cggctggtcg agctggccca gacccaccgc cgcttcggct atcgccgact gcatgatttg     10620
     ttgcgcccgg agtttccatc cgtgaatcac aaaaagattt atcgcctgta cgaggaagcc     10680
     gagctgaagg tgcgcaaacg gcgcaaggcc aagcgtccgg tgggtgagcg gcagaaactg     10740
     ctggcgtcct ccatgccgaa cgacacctgg agcatggact tcgtgttcga tgcgctggcc     10800
     aacgcacgcc gcatcaagtg cctgaccgtg gtcgacgact tcactcgcga gagcgtggac     10860
     attgccgtgg atcacggcat cagcggggct tacgtagtgc gcctgctcga tcaggcggcg     10920
     tgtttccgtg gctatccacg cgcggtccgc accgacaatg gccccgagtt caccagtcgc     10980
     gccttcattg cctggacgca gcaacatggc atcgagcaca tcctgatcga gccgggtgcc     11040
     cccacgcaga acgcctacat cgaaagcttc aacggcaagt tccgcgacga gtgcctcaac     11100
     gagcactggt tcacctcgtt ggcacaagcc cgggacgtga tcgcagactg gcgacgccac     11160
     tacaaccaga tcaggccgca cagcagttgt ggtcgcatcc cgccggcaca gttcgccgcc     11220
     aactaccgta cacaacaagc caacaacgca gtacccttca accccgggct ttatcagtaa     11280
     tcactggtac ggacgatggg ggcaggtcag ttgttgcgtc atttgttgca tggtgaattt     11340
     ccaaggtttt taaggatcat tcggtttggt caacggtctc agctcgccgc gcgcgacagc     11400
     ttccggcacc gagaacgaat agcgtccgag catgttgatg tgctcgtggc cgaacggcga     11460
     cagccgtgcc tcgtcttctg gcttcacggg gtagccttcg ctgcgcaact gcgtcagcac     11520
     cgcatccatg tacagcgtgt tccaaagcac gatcatgttc acgaccaggc cgagcgcgct     11580
     caactggtct tcctgccctt cgcggtagcg ctggaacagc tcgccgcgct tgccgtggaa     11640
     aacctcgcgc gccaggctgt ggcggccttc accgagattc agttgcagca gcgtggcgcg     11700
     acggcgggct tcgtcgtcga tgaaattcaa cgtgtggatg gtcttgtcga tacggccgat     11760
     ttcggcgatg gcttgcgcca ggctggtggg ccgttcatcg acctgtaagg tgcgcatgat     11820
     gcccatcgcc ggaaccagac cgagcttgag cgagccgacc agacgcagca catcatccca     11880
     atgcggggtg atacggtcga gattcacacg ctgccgggcc agcgcattga ggtcgccata     11940
     gtcggcgtcg ggatcgacgc gccagaaacg ggtaccgcca acatcggcca ggcgcgggca     12000
     gaatcgatag ttggagaggc ggaacaaacc gaacaccaaa tcgctgtacg cgccggtgtc     12060
     ggtcatgatc tgggtcggct gcaactccgt ttgctgctcc agcacaaccg ctagcaaaat     12120
     caaactgtcg cgcagcgtgc caggcacagt gatcgcgttc agtccggtgc gctgatcgga     12180
     aagcaagttg taccaagtga cgccgcgccc gcgattgaaa tactttgggt tcggtccagc     12240
     gtggatcgtg cgcaccggca ccacgaatcg catgccgtcg gccgaagcca catcgccacc     12300
     tccccaggtt cgcgccagtg cgatacgact ttgcgcggcc accagcacgg cattgcaggc     12360
     tgtcagcgtg tcgtcacgca catagttctg atcgacccac atcagccggt cgcgcttgag     12420
     cgccggagtg tctggccgca ccagtggttc cgggccggtg ttgcaggctt cggccatcag     12480
     caccgcgcac aggctggtgg tcaggtcggc cgcgcgcgcg gtgcgttcag tcaggtgcgt     12540
     gaacgcttcc atgcagccag tacgaccggc gacttccagc aggatttccg gaagatcgac     12600
     gcgcggcatg cgcgccttga tttcgttgcg cagcgcgatc aatgaaggcg gctcctccaa     12660
     tgcttcaagc ggactgagca ccagttccgt cttgtcgcca acgttctcga agcgcactgc     12720
     gtcgttctgg ggcaggcgcg cggcgacgcg gcggtaggtt tcgtccagct cgcgcgtcag     12780
     ctcggacaac gtggcctcgg gctgcgccga caggctcagc gagcggcaga cgataggccg     12840
     cgaggcctcc cattcagctc cggccagcag cccggcgcgt ggatcggcgt agcgccaact     12900
     cgggctgatg aacacgtcgc ggcggcgaat cgcactgcgc agcttgtcga gcgcgcagaa     12960
     cgaataggct gtggcattga tgcggccatc atcctgaacg acatggcgtt gccacgcctt     13020
     gccgacgatg gccgtgggcg gatcatggtc gggcttctca tgcagccatt gcaacgcctg     13080
     cgccaaaggt tgcgcggccg gattggcgtc aaagcggatg acgcgcagca acgccggcag     13140
     gaagcgcgag acggtggcct tgcgggcttc cagttcggtg tagaacacat cgttgggcgg     13200
     gcgcaccaga ccgcgcactt cattgagcgc ctgggccagt tcatcgtggc cgatggcggc     13260
     atagacgcgc tcgcgcagtt cgccgtccgg cagggccgga tcgagcagca tccggcatgc     13320
     ctcggccagc gtcgaggcgg cccgatccag atccttgagg gagcgctgcc tgaccttacg     13380
     atcttctttc tcagccttgg tgaacagctc gcgcagcagc aggtcgagca catcgatggc     13440
     atcgtcttgc gcgctggctt ccaggcagtg gacgaaggcc actagcgtgg cgatgcgtcg     13500
     cacctccggc aatcgagcca cggcggatac cttggcagta ctggcgaagc gggccagcgc     13560
     tgcgatgcgg ctcggcggca catgggtgcc tggcagctta atgcccaagc cacgcacggt     13620
     ttcgattcgc agcaaggccg caacgagcgc cggagcgctg acgcgtaccg gccccttgcg     13680
     caatcgatcc agccaagact gccggctgcc ttcgacaagc ttgagcaagt catcgaggcg     13740
     ttgtcgctgc tcgggtgtca cgccgtgcac cagtagtcgc cacagacgcg actccatgcg     13800
     tgagcgtatc tcggcgataa agcgctccag caaggtgacg ccgggtagca gcaccttgtg     13860
     gccgaccagc cagccgttgg cgtagtcgaa cagcgcactc gggcggtcag tgcccgtcca     13920
     gcacaacgcg cacaaccagc ggccaaggcg gaactggacg ccggtacccg tgaactcgcg     13980
     gtagccatag cgggtgcgaa tctcgctcgt gtgctgccag cgctgccgag ttgtccggta     14040
     gtcaatgacg caatcggaag ggtcggcgat gccaagttgc gacgacagcg tatgcagcac     14100
     cgggcttggc acggcggtag ggtcttccag aaaggtgccg agaaaccgcg ccgtggtcag     14160
     ttgcagcgca taaccgaggc gactgctgtc gcgtcgcttg gtggcgatcc actcgcggtc     14220
     atcgtcgtcc aggtggaaat agcgcgccag ctcttcgctg gaaagcgtgt ctggatagcg     14280
     gccgtagcgt tcccgttgtg tggtggacag gaagctgacc ggcatggcgt caaagcgcct     14340
     cggcgcagaa ggtgactggc gtgacgatgc gcgtgcggcc aatgctaccg cgttgcagca     14400
     gcccagcgcg gcggtcgcca gtcacaaggt aatcggcctc gctggccagt gccatcgcca     14460
     gcaggaacgc atcgttcgga tcattgacct cgatgcgatc aggcagaggc ggcaatacat     14520
     gcagcacaac ggcgcgctgc atgttgttga tcatcgtgcc gacgcgatgc gcgggcagga     14580
     ttgccttgat cttcgggtaa cggctcacgc ggcgcagttc atcaagctgc gccgtccctg     14640
     tcaccagttc aaagcgtgct gcaagccaac cgcgatagat gatgtcgggt gggctgtgcg     14700
     acgagatcag cgcggccagc aatacgttgg tgtcgaggac gacccgcatt aatgctcacg     14760
     cgcccattgc accgcctcat caatgaggtc gttcagttct gtctcaccca tacccaccgt     14820
     agcggctttg gcttgttcca cagcccgctc gaagaggtag gcgcgcaccg catcctcgat     14880
     gaagcgtgac aggtcgccct tgcgaccgcc gccttgcgcg gcgatgaaca tgcggacgga     14940
     ctgatccacg tccggcgata cggcgatgtt ccagcgcacg gtattcatga agctctctcc     15000
     aatcagagtt tatgcacatc ggtgtttata cactctttaa gcggtttttt tttgcaacgg     15060
     ttcaataaaa cgatcgtttt tatgaactct gatggggcga tcggcgcgag gtgtccgtaa     15120
     gccaacaagc agtctgtaat agtggtttgt acaatcaaag tttgatatta ttaaaactta     15180
     acgagtaaag caaaatatta cgatgaaaat cggctatgcg cgcgtatcca cgcgcgaaca     15240
     gaacccagcc ttgcaggtgg actccctcaa ggcggccggc tgcgagcgca tttatcagga     15300
     cgttgcgagc ggcgcgaaga ccgcgcgccc agcgctcgat gaactgctgg gccagttgcg     15360
     tggcggcgac gtgctggtga tctggaaact cgaccgcatg ggacgctcac tcaagcacct     15420
     ggttgagttg gtgggtagcc tgatggaacg caaggtcggg ctgctcagcc tgaatgaccc     15480
     catcgacacc accagcgccc aagggcggtt cgtgttcaac ctgttcgcca cgctggccga     15540
     gttcgagcgc gagctaattc gcgagcgcac ccaggccggg ctgacggccg cgcgggcgcg     15600
     tggcagggtc ggtgggcgac ccaagggcct gtcgccgcag gccgaagcga cagcgctggc     15660
     ggccgagacc ctataccgcg agcgcaagct gtcggtcgct gccattgcgc agaaactgca     15720
     cttgtccaag agcacgctgt acagctacct gcggcatcgc ggcgtagaga tcggcccgta     15780
     caaacaatcg gcgcagtcgc cgataaacgt ctccgtggtc gagagcggaa acgctgacca     15840
     gccgaaggtc gccaccatcc tgctgacctt gcgcatcgag aacaatagca agttcgtgcg     15900
     cggaaagaag cgctcgatcg agcatgtcga gttttttgat cttgcccaat acgatgccac     15960
     gcggcggccg aacggggaat atgaactgaa ggtgccctat gacacggatg aagagctgga     16020
     tgaagccgtg aacgatttgc taaccgacat cgcctgcggt gcggatgacc gccactgttt     16080
     ctcagagagc cacgcccgca tggaaggtac agaccggcac tggtgaaggc ttaactgact     16140
     tccctgttcc attgctcccc gaaccccaag tccacctcta gcgccacggc catgaacacc     16200
     ttcatggccg caatgtgagc gcccgtcatc ccatcagagc ctcggagcgg ccctaaaccc     16260
     tttgcaccga ctgaccaagc tggaaatgtt ccccaggcgc tcattcatcg tctccttttt     16320
     tacgcaaagc agtacccgct acgttcaagg ccttccagat cacgacgaag gaggccagtg     16380
     ccaatacaaa gatggcgcag gccatcgggt tagcgatcca gaatttgtcg attacacgca     16440
     gtagtagttc cacgagatgt tccacagagg agaggtgttt taaattgaaa cgaaggacac     16500
     gtggaacatc tagatagagc gatcatctta gaaacgcatt tttttccccg caaagcccgt     16560
     cccataaggc tttcagccag aaatgctctc cacgaaaaca gtaaatgaag aagcttgagt     16620
     tgcctctcct gtttactaga cagggcaaat tgggggcttt gtagcgcaac aaaggcgtca     16680
     tggcagactt gaggttcgat gcgctgaggg ggtggcgggg gtatccccgc cggctactgg     16740
     gccgccctgg cggcccgctg ttgccgttcc ttgatctccc ccttcgtagg gttgcccagg     16800
     cgcggtcgtg gcccttacag gcccgtctac gtcctcgcgc ccgccaaacc gctttttatg     16860
     gaaggtgtac attcgtacac ctcacgcgtg cacgcgcact agacgggtca ggccgtggat     16920
     gttgccgccg ttggcggcac cacgggcaca gcccgtggac aggtatggac gggcgaagcc     16980
     cgcccacatc ctgcccaccg gctgcacccg ttacacccac cgccagcccg tgagatttgg     17040
     ctggtggtcg aggttagaaa gccccatgcg ccattagtaa gaaaattccg aagccagggc     17100
     agcagcccgc ccccaggacg ggggcggaaa ggccggcacc gcaggtgacg gggcgaagcc     17160
     atggacggcg aagggcaggc gccgttgccg tcgccttaga tcataagaaa ggggatgctg     17220
     taagtaattg atttcaatag ggctcagttt catgagctgt gagcctcata aggctcagag     17280
     ctggtgagcc tcatacggct cacaaaacat actaggttgt ttcttaaatg agttgagttg     17340
     tttcatatcc catgatacaa cccatgtcat ttatgagcct gaccaggatc actacatgag     17400
     cctccccgtg cccagttcca agaagcggat cgagtacgtc cagctctatc gatcatcgat     17460
     gaaagccctc agacagctgg ccctagaagc gcctacggcg cacgccgtgc tgtacgtact     17520
     gatggagcga atcaatgaga gaaacgccct ggtagccagc tacgccacac tggcaaagtt     17580
     gaccggcaag tcccgggcaa cgatcactcg agctctagca gagctgcgca ctcgcaacta     17640
     catcgagatg gtgaaggcgg gcaacgtgtc tgtgatcgtg gtgaacaagc gcgtggcttg     17700
     ggccacagag acggccttgc gcgggaagct ggcagtattt gatgctcgcg tcatcgtgtc     17760
     ctccgaagag caggacgagc ccgaaaggct tggcaaagaa ccagacctag ttaggcttcc     17820
     ccctgtgctt gttccacctg agatggccac catgcttgaa gatggtgaag acgatggcca     17880
     aggtgatttg cagctatgaa ccaaatcatg gacgcctgta acagcaatgc gatacgaatc     17940
     acgcttgagt ggcgtgcgtt aggcgatgcc gccaatgccc cccgctactt ggcctcagat     18000
     cttgatgccc tcagctggga agacgtcaga gagcttggac tgcaacctgc ctaaaacagg     18060
     gcaggagcac acaaaaaagc acgcatgcgt gctttttttc aatcgtgctt tatgccaata     18120
     ttcctctact tcctgtgggt gagagggttc aatgaaaata ctggtgctgg ccagtcagaa     18180
     gggtggagct ggaaaaacca cgttggccgc gcacttggcg gtggcggccg aaaccgccgg     18240
     cgctggcccg gtggtcttat tggatactga cccgcagggt tctctgtcgg cctggtggaa     18300
     ctctcgcgag gcgcaaagcc cagccctcgc ctcagctacc ctcaaggaac tgccggagaa     18360
     gttagacgca ctggcagctg ccggtttcaa actggccgtc atcgacacac cgccggcgat     18420
     cgccgatgcc atccgcgacg tggtgcgcct ggctgatttg gtactgatcc ctacccggcc     18480
     aagcccgcat gatctgcgtg ccgtcggcag caccgtggac attgcccagg aggccggccg     18540
     gccgttcgct ttcgccgtga cccaggccaa gccaaccgcg cgcatcaccg tgcaagcagt     18600
     ggcggctcta tcagcgcacg gcccggtggc gccagcgatc gtgcatgacc gcgtggacta     18660
     cgcgacttcg atggttgatg gccgcaccgt gggtgaagtt gacgcccgca gccgcagtgc     18720
     cgaagaaatc cgcactttga gtgcattcgt taatgaacga atgcacgaaa agaagaaagc     18780
     caaaataaag gaaactgtat aacgatggcc accaagaaaa ctgccgacct gtcgggcctt     18840
     gtggccacaa agggcgccgc cgcccccgtt gctgggatgc cggtacgggc gccggcgccg     18900
     cgctccgacg acaccgaggt ggccaacaat gagccactga acttccgggt ttctggcgac     18960
     ttccgccggc gctttcgcat gtttgccgcc gctcatgaca tgaagctcaa cgagttgtta     19020
     cgcctggtct ttgaggaata cgagaagaag cacggctaaa tactgggcgc tttgatcgca     19080
     taccgtggtt ggcccatctc tgcggccgcc ggcactacat cgctagccgg gaacaggggt     19140
     gcgctt                                                                19146
//

If you have problems or comments...

PBIL Back to PBIL home page