(data stored in ACNUC9435 zone)

EMBL: AM039950

ID   AM039950; SV 1; circular; genomic DNA; STD; PRO; 38116 BP.
XX
AC   AM039950;
XX
PR   Project:PRJNA13649;
XX
DT   20-OCT-2005 (Rel. 85, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Xanthomonas campestris pv. vesicatoria plasmid pXCV38, complete genome
XX
KW   complete genome.
XX
OS   Xanthomonas euvesicatoria
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Xanthomonas.
OG   Plasmid pXCV38
XX
RN   [1]
RP   1-38116
RA   Thieme F.;
RT   ;
RL   Submitted (16-JUN-2005) to the INSDC.
RL   Thieme F., Institut fuer genetik, Martin-Luther-Universitaet, Weinbergweg
RL   10, 06120 Halle/Saale, GERMANY.
XX
RN   [2]
RX   DOI; 10.1128/JB.187.21.7254-7266.2005.
RX   PUBMED; 16237009.
RA   Thieme F., Koebnik R., Bekel T., Berger C., Boch J., Buettner D.,
RA   Caldana C., Gaigalat L., Goesmann A., Kay S., Kirchner O., Lanz C.,
RA   Linke B., McHardy A.C., Meyer F., Mittenhuber G., Nies D.H.,
RA   Niesbach-Kloesgen U., Patschkowski T., Rueckert C., Rupp O., Schneicker S.,
RA   Schuster S.C., Vorhoelter F.J., Weber E., Puehler A., Bonas U., Bartels D.,
RA   Kaiser O.;
RT   "Insights into genome plasticity and pathogenicity of the plant pathogenic
RT   bacterium Xanthomonas campestris pv. vesicatoria revealed by the complete
RT   genome sequence";
RL   J. Bacteriol. 187(21):7254-7266(2005).
XX
DR   MD5; a7acbded629fcd2b21fe54aae448867a.
DR   BioSample; SAMEA3138194.
DR   EuropePMC; PMC1272972; 16237009.
DR   EuropePMC; PMC2246292; 17927820.
DR   EuropePMC; PMC2704820; 19411426.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..38116
FT                   /organism="Xanthomonas euvesicatoria"
FT                   /plasmid="pXCV38"
FT                   /strain="85-10"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:456327"
FT   CDS_pept        1242..2060
FT                   /transl_table=11
FT                   /locus_tag="XCVc0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19770.1"
FT                   /translation="MPAVDTGPHAQGPEPTAPSGRPHKRVHWRQPKPLAGKKRRPGVLD
FT                   ATRHGLVRALEERKGAWKRIRHNVIVAGYALDKALTRVRGLRKDGADSLLAMAVALLYL
FT                   ADVRTGFVGKPRQGGGPWQRYTLPDLAQLAYGGQSDAEQRRARRSLDMMVSLGWAFPTK
FT                   QVRRHTKDADGGDLWCSEAGVRRLNFQRLCDMVGTSRLLKRDRKHADQARGTGVASFTQ
FT                   AQARRQPTQESRTTSRRRDTRPAAHRATGAPPGDAQSAVRHISDILALFN"
FT   CDS_pept        complement(2729..3049)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0002"
FT                   /product="putative PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19771"
FT                   /db_xref="GOA:Q3C0B3"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19771.1"
FT                   /translation="MQRGDLVTVSLQGDYGKPRPALVVQSDLLTDLESVVLCPVTSDLR
FT                   NAAFRVTVEPNPANGLRALSQVMVDKLSTLPRTKISEPFGRLDDERMKAIDRALLLVVG
FT                   VI"
FT   CDS_pept        complement(3049..3264)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19772"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19772.1"
FT                   /translation="MSSIHESKVARHRERMRAAGLRPVQFWVPDTRSPEFAAQVRKQCQ
FT                   NLKGDPAETEVLRFTEEAATHVEGWE"
FT   CDS_pept        complement(3510..3836)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19773"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19773.1"
FT                   /translation="MSMKGKPNTAQFKPPKDPTAFLEGGEADKAEKPLVAPAAVATPPA
FT                   ATPPAAEEAQRYGRARVQKIFNFPEELADRLRREALKRSEEKGVRVTEKDIVIEALEAF
FT                   LNGI"
FT   CDS_pept        complement(3833..4459)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0005"
FT                   /product="putative partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19774"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19774.1"
FT                   /translation="MVFACVNTKGGVGKTTTAVHLAVMLARQGKTLLIDGDPQASAASW
FT                   AAWRRETQYDPSPTTTCLAGKAILSEGKQLATGFEHVVVDAGGRDSVGLRSALLLAQRA
FT                   VIPVGASNLDAAAMTDLLEVVELARDYNPELDVRVLLTRIDPRTKDAAEMLEFLAEQKL
FT                   TVLPTKVCERVAFRRAIGEGATVQELGRDQAAIAEMEAFFKEVMQ"
FT   CDS_pept        complement(4663..4956)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19775"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19775.1"
FT                   /translation="MRLGTGPCATPTGLFGNNNTTILITKQLIAARFRLAVGAVRRNPV
FT                   GGGGRRRAGTVRSRQKTAPTAWRHILLNGHYTFQRSGKIIDLDALVAGLELG"
FT   CDS_pept        4935..5621
FT                   /transl_table=11
FT                   /gene="kfrA"
FT                   /locus_tag="XCVc0007"
FT                   /product="KfrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19776"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19776.1"
FT                   /translation="MDPSQDARDRILTAADSLYDQAGREVFPTVDAVRKAAKVNMNDAS
FT                   TVMKEWRRMQTRPAVVVQVPEAVQQVASTAVLALWQAAQDAANDALRAAQAGWEAERQE
FT                   ADALSQQMADAYEAQALELEAAQARIAELEAAMQQAVTAAAAHQAAIDQVRTELVDLQQ
FT                   RASTAEARASELRTELDRAHLVAAEQRSAAGQAREDAATLRGRLAAFEGMATSPAPVKA
FT                   APGKGM"
FT   CDS_pept        5780..6742
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="XCVc0008"
FT                   /product="Resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19777"
FT                   /db_xref="GOA:Q3C0A7"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19777.1"
FT                   /translation="MTTFVRAYLRASTDEQDAQRARSGLDQFARDRGVRICNYYAENAS
FT                   GARLDRAELFRLLADSRPHDVLLVEDVDRLSRLGRAEWEKLKTLIRERSVRVVAVNVPT
FT                   TWQHLAPLQNEFDARMFGAINDMLLDMLAAIARRDYEQRRQRQAQGIAKAKVAGKYRGR
FT                   QIDRARYGAINRLLASGSSWSVVQKTVGCSRSTISQAVKHAKLSASAPSTELMAAASVA
FT                   VILWFHVENGSKFTRGKKRVREDIDYLIATSHKSTKLSDTEYRLVIRYADDADLKQQIN
FT                   DLLHEILHLADLRNCVVDDMSVKNEATGSFWDECDGGWK"
FT   misc_feature    7081..8409
FT                   /locus_tag="IS_Xax1_pXCV38_1"
FT   CDS_pept        7147..8373
FT                   /transl_table=11
FT                   /locus_tag="XCVc0009"
FT                   /product="ISXax1 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19778"
FT                   /db_xref="GOA:Q3C0A6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19778.1"
FT                   /translation="MSPRTHEVPDELLSSLLVNYTKPEDLIGENGLLKQLTKRLVERAL
FT                   DAEMTEHLGHDKHEPVANAAGNTRNGRSRKTLKGEFGELPIEIPRDRHGSFAPQLIPKH
FT                   QTRWAGFDDKILSLYARGMTVREIQSHLEEMYGTEVSPSLISSVTDAVVEEVKAWQARP
FT                   LDPVYPIVYLDCIHVKVREGAVRVKAVYLAIGITMGGEKEVLGLWLAQAEGAKFWLQVV
FT                   TELRNRGVQDIFIACVDGLKGFPEAIEAVFPQTTVQLCIVHMVRHSLNYVSWKRRAEVA
FT                   ADLKRIYACATVEEAEQALTEFEAKWDAQYPPISQSWRRNWSRLIPFFDYPPEIRKVIY
FT                   TTNAIESVNMSLRKLTKNRGAFPSDEALMKLFYLALRNITKKWTLPIRDWKAALNRFTI
FT                   QFEGRLPQR"
FT   CDS_pept        complement(8780..9172)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0010"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19779"
FT                   /db_xref="GOA:Q3C0A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19779.1"
FT                   /translation="MGSHVSTAREALMAELLQDADAIVRRFEQADQALAGKIEKATTDA
FT                   AGKAFLAAKLNFESVIDKNAEKLTEAGRHAAAQIGNQLNSGAAQLVAANAALESKARRF
FT                   VLLLAGFAFVAGVVGGFVGARLAGMG"
FT   misc_feature    9249..10443
FT                   /locus_tag="IS_Xac2_pXCV38_1"
FT                   /note="IS element Xac2"
FT   CDS_pept        9318..9584
FT                   /transl_table=11
FT                   /locus_tag="XCVc0011"
FT                   /product="ISxac2 transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19780"
FT                   /db_xref="GOA:Q3BZ53"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19780.1"
FT                   /translation="MKKSRFTDSQIIAVLKQAQAGAPVPELCREHGISSATFYKWRSKF
FT                   GGMDVSMVARMKELEEENRRLKKMYAEAQLSTDLLKEALAKKW"
FT   CDS_pept        9578..10405
FT                   /transl_table=11
FT                   /locus_tag="XCVc0012"
FT                   /product="ISxac2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19781"
FT                   /db_xref="GOA:Q3BZ54"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19781.1"
FT                   /translation="MVRPSQRREMAQSAVTSGRTNIRHACQTFAVSQTCFRYQAKASEQ
FT                   NARIADWLIRLTTAHRDWGFGLCYLYLRNVKGFGWNHKRIYRIYRELELNLRIKPKKRL
FT                   VRERPQPLAVPETINQVWSMDFMQDQLADGRSFRLFNVLDDFNREGLGIEVDLSLPSAR
FT                   VIRSLEQIIEWRGKPAVIRCDNGPEYISGALLSWAQRHGIRVEHIQPGKPQQNAYVERY
FT                   NRTIRYAWLAQTLFDTIDQVQDKATRWLWTYNHERPNMALGGITPAMKLAMAA"
FT   CDS_pept        complement(10402..11088)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0013"
FT                   /product="putative plasmid stable inheritance protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19782"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19782.1"
FT                   /translation="MKVAVISFSGNPGKTTLVDHLLAPRMNAPKFEIETINAGSSADTD
FT                   AQRFKGKDYGGLQEDLMTLDSAIVDVGASNVEEFIKQMGQFEGSHEEFDYYVVPTVSEK
FT                   KQQADTLSTIRTLTSLGVPAKKIRVVFNKVELEDANDVPRLFRMIFGLHEETKSFTLRP
FT                   EAVVFKNEIFDRLRTLKKTVSEIVADETDYRAMLREAKDEDAKAHAINMISAGNPPTFS
FT                   GRQKWS"
FT   CDS_pept        complement(11085..11540)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0014"
FT                   /product="putative TraD protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19783.1"
FT                   /translation="MTKPDAKQAVRQTEPTTKAAQLREVMPEIEKKLAAGVQLRTIHKA
FT                   LTDAGFDLTFQTLKTYLYRYRKKHQAKTVRQQTESVGSRSAGTPTPASSQSDESVSDET
FT                   YSSEPPTPRGPISMQELDRLMKPDPAKQAQDIARYERLAKQKERSRK"
FT   CDS_pept        11929..12324
FT                   /transl_table=11
FT                   /locus_tag="XCVc0015"
FT                   /product="putative TraA protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19784"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19784.1"
FT                   /translation="MSTAKSVSVWYTEDERIRVEQAAALAGYKHLSKYIRDKSLDRGSH
FT                   RESSRDSMEAWADRQELVGRLAEIERSQKGAHALLAMLLFLVRKKATTGEVNELVLACE
FT                   KSGVPADVLAASLPELAALLTRFTEDS"
FT   CDS_pept        12398..12691
FT                   /transl_table=11
FT                   /locus_tag="XCVc0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19785.1"
FT                   /translation="MSTKAVFTMKLEPELRDTFMAEAAADDRPAAQVVRELMRDYITRR
FT                   REAREYDEFVRRKVQVARKQRDAGLHFSNEEVEADAAARRVDLLRRAGEAGL"
FT   CDS_pept        12688..12981
FT                   /transl_table=11
FT                   /locus_tag="XCVc0017"
FT                   /product="putative plasmid stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19786"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19786.1"
FT                   /translation="MKVRWIAAARQDRADIIDYIAVETPRAALKMDDLFSEAAKRLGEF
FT                   PKLGCTGKIPGTRELIPHESYRLVYEVDEAADTVWVMTLIHTARQWPPARDD"
FT   CDS_pept        13094..13714
FT                   /transl_table=11
FT                   /locus_tag="XCVc0018"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19787.1"
FT                   /translation="MKLFSAAVIAMSALFVTQAHAQQQPVNTGLGECVDFVIFASSTLT
FT                   GQVNGTTYPFVYGPATYLDKPGSTVYIQNYSCASNDIPGLYSRVSMVSHEMGHLYLDQG
FT                   WVLGTREDYIAKACTNEGRAVLNNSTARNEILDTSQGGADISLIAANAPALLSTIAAGG
FT                   ADLAQRVGDAFCEANVTSTTGENYKVYYGNEYDKLNPPSQEEQ"
FT   sig_peptide     13094..13156
FT                   /locus_tag="XCVc0018"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        13718..14254
FT                   /transl_table=11
FT                   /locus_tag="XCVc0019"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19788"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19788.1"
FT                   /translation="MKTLAAALGALVLATAPLVLAAAVPRASAAAEKQLWAFSEKIALA
FT                   LPGNGKDVLTLVSPRPDSVAMTNGQKTRKPSKQIAPSLFASNAVVVMGADNRADSASFE
FT                   VTGSCVSMASLRKQYPSLIVMDYARGVNEHAVYTLGAQIGDAIVAYSFPASKLDCMSRV
FT                   FITPAKITKNKLGIE"
FT   sig_peptide     13718..13780
FT                   /locus_tag="XCVc0019"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        14326..14523
FT                   /transl_table=11
FT                   /locus_tag="XCVc0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19789"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19789.1"
FT                   /translation="MTSGAQTTGQVEAGINAVIAAPTTSRWLKAALADALHRDCVDAAH
FT                   DAELLADLWGRRCDSILGRV"
FT   CDS_pept        14527..16101
FT                   /transl_table=11
FT                   /locus_tag="XCVc0021"
FT                   /product="putative TraB protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19790"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19790.1"
FT                   /translation="MQKHEAEDATLFFGVSLPIAGWLAGTYAANVPLSPFPQALTAALH
FT                   ATPNNPFMVGGVVAGLGLAATTGYLFHEYGDDGFRGAPYRRWMRGSQMANWHSVKSKVN
FT                   AANRRENRRRRAEQRGAKDLPPIMIGPMPMPLHLENRNTLICASIGAGKSVALESMISS
FT                   AVKRRDKMAVIDPNGTFYSKFSFPGDTILNPFDRRSSGWTLFNEIKGVHDFDRMAKSVI
FT                   PPQIDPSDEQWCAYARDVLADTMRKLVETNNPDQDTLVNLLVREDGEVIRAFLANTDSQ
FT                   GYFRENAEKAIASIQFMMNKYVRPLRFMTKGDFSLHKWVHDPNAGNLFITWREDMRAAQ
FT                   RPLVATWIDTICATILSISDDAQHLSRRLWLFLDELESLGKLESFVPAATKGRKHGLRM
FT                   AASIQDWAQLDETYGKDAAKTLLGCFRNYLIFGASNALNADKASEILGKQHVERIQMTT
FT                   NAGGSGGGGRSRHVVASPPEPVVLDSEISNLKDLEGYVMFAEDFPIAKIKLPYVKYPHR
FT                   AAAIDIK"
FT   CDS_pept        16115..19090
FT                   /transl_table=11
FT                   /locus_tag="XCVc0022"
FT                   /product="putative TraI protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19791"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19791.1"
FT                   /translation="MLNVTPIRGNNQYAAAHYFSAADDYYAKEHPGEWQGQGAQALGLT
FT                   GPVEQAQLSRLLDGQLPNGERIQTTFDPTDNKKRMGLDLTFSAPKSVSMQALVAGDKDV
FT                   TAAHDRAVTRALEQVERLAEARKKVKGKSYRERTANMVIGKFRHEMSRAKDPQLHTHAV
FT                   VLNMTQRADGAWRALSNEDIFRVQHEVDALYKAELARGLQALGYAIRLVDDQGNFELDH
FT                   ISRDQIEAFSARSRVIEEALANEGKTRATATTLEKQIISLATRPRKDESDRELVKQYWV
FT                   EKSRELGIDYGLRSQLDGRTYEAGDSFGTRGRERGDAGDRIAATSLPASLTPAQAVVQY
FT                   AINHLTEREAVVRETALTATALRRAVGLAGPDEVRAEIKRLAGQGALIEAVPAYRMADR
FT                   KDGPALSSAGWKSYLQELKGWSDKQAQQYVGNAIKQGSLVPAEKRYTTQKALAREKAIL
FT                   AIERTGRGAIEPIMTAAAVKTALEGTALSAGQRSAVETIVSTKNRFVGIQGDAGTGKTY
FT                   TVNQAVALIKQASAVSEGYRTVALAPYGNQVKALKNEGLEAHTLASFLRTKDKPIDGKT
FT                   IIVLDESGVVGARQMEQVMRVVEKAGARMVLLGDTKQTEAIEAGKPFAQLQQDGMQTAR
FT                   ISEIQRQKDHELKTAVEHAAEGRVTPSLAHIKHVEELKEPIERHRAIVNDYIQLTEPER
FT                   RETLIVAGTNEARREINRMVRQSLDLTGKGREFETLTRVDMTQAQRRFAPSYQPGMVIQ
FT                   PEKDDQKAGLTRGETYRVKDALPGNALVLQRQDGTTTTINPRKATQLSVYRLERAELSV
FT                   GDTVRINRNDPGRDLTNGDRMRVAGVIGGVVKLESVEQRDGRPARALELPTNRPLHLEH
FT                   AYASTVHSAQGLTNDRALIALDTNSRTTSMNLYYVAISRACHEARVYTNSVKELPAAIA
FT                   RRFDKTTALAIQRERQLQRRDAGMQPKGAADGKQALQRQQFQQQRKQPASGKKPSEYGR
FT                   FG"
FT   CDS_pept        complement(19160..19486)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0023"
FT                   /product="putative PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19792"
FT                   /db_xref="GOA:Q3C0E0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19792.1"
FT                   /translation="MMRGDFVTIAMQGDFGKPRPALVIQANQFDEHTTVTVLPVTSTLV
FT                   AAPLLRITVHPSTDNGLLKPSQVMVDKAMTVKRDKIGRAFGRVDADALVEIERCLAVFL
FT                   GIAK"
FT   CDS_pept        complement(19483..19809)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19793"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19793.1"
FT                   /translation="MSAASWGTKPEPQKVPLLLHVTKMRRKLVACNGEANMAHVNSRVQ
FT                   KHRDALRMAGLRPVQIWVPDTRRPDFAEECRRQCRLAAQADMEDTDMQRFMDEALADMD
FT                   GWTE"
FT   CDS_pept        complement(19838..20434)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19794"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19794.1"
FT                   /translation="MPTSNGRYCRASDGRGQESRAGHGDHLPMGRSSRTPEHLAAIVKA
FT                   LWLRHGPRNLDDVGVMQQSIQQGGLMKVTTILLDTAGEIAHRMAISMNALMLTVAAEAR
FT                   QDMAREHGADWAAGAVTFFGTEILKAFQSNKPDRDREMERSMMSLAMAVWVCDSVYGGL
FT                   AAETFVASDLRFTITHDGIVRYDRLPKPDDRADHQ"
FT   CDS_pept        complement(20732..21337)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0026"
FT                   /product="putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19795"
FT                   /db_xref="GOA:Q3C0D7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19795.1"
FT                   /translation="MRRSIVCAALLALASLAGLNSFTAGLLDKVRNTMAAEPASAPDSQ
FT                   TVEVAFSPDGRAEALVLKVIGAAKTSIRLAGYTFTSPAVVRALTDAKKRGVDVAVVVDY
FT                   KNNLVESRSNTSRQALNLLVHAGIPTRTVSVYPIHHDKYIVADGLHVETGSFNYTMAAA
FT                   RRNSENVLVVWNNAAVAGQYIAHWQSRWEQGQQYQSSY"
FT   sig_peptide     complement(21269..21337)
FT                   /locus_tag="XCVc0026"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(21350..21937)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0027"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19796"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19796.1"
FT                   /translation="MKKLIVALFIGAAAVSAHASEYGCKVLLCLANPASNGGPKGVSEC
FT                   VPPIDQLYHDLSKGRPFPTCDLADGNDGSSYARQVYDPYDPCPAPLQPAARGSYVVQGQ
FT                   KKTGTNKPGWWGGDGSYTLSGQPQVSQSQSDYGHSSGARACVGKSVGSYTVGSYDSSDT
FT                   VDVFDKVIWQPAQNPRAIDVFIDNTWQQRVRW"
FT   sig_peptide     complement(21881..21937)
FT                   /locus_tag="XCVc0027"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(21983..22894)
FT                   /transl_table=11
FT                   /gene="virB1"
FT                   /locus_tag="XCVc0028"
FT                   /product="type IV secretion system protein VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19797"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19797.1"
FT                   /translation="MQVRDVITMAAGLLAVVPLFAGAQTPAQPLPFEKLAAECAPDVHP
FT                   STLKGVVSTESSWNPYAIGVVGGRLDHQPRGLAEAVATARELDRQGFNFSMGLGQVNRY
FT                   NLAKYGESYETVFEPCRNLKAGSAILKDCFQRAKAQMGDDQHALRAAFSCYYSGNFTRG
FT                   FRADKAGQPSYVQKVVANATGAAQPIPVVPAVKPESSDGAVAVRPAGRAAGPAKQAATS
FT                   SQWVIFAEGSPQGGQSVVPTDAASAKEPAVKVQLVTPGAAPAVAAAPAERVQTQRQAQA
FT                   VPVQRATANSTQQDAPFVQFVH"
FT   sig_peptide     complement(22826..22894)
FT                   /gene="virB1"
FT                   /locus_tag="XCVc0028"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(22881..23903)
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="XCVc0029"
FT                   /product="type IV secretion system protein VirB11"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19798"
FT                   /db_xref="GOA:Q3C0D4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19798.1"
FT                   /translation="MSQIASFRTKLSLLADHLDDKQVTEIQVNKPGELWLRKKDAYYAE
FT                   QIEVPGLTYQLLSSLAEVTASFKSLDVDRESPILSAEIPVNLDDGVPDFERGTYRTEMI
FT                   LPPVVPEGTIAMTIRKQSLVRMSLPKYKEQGAFRFVNSDVTDEPYSDARLLELYRAKEW
FT                   DQFLRGAVLAHKNIVISAGTYCGKTTCLNALVQEIPAHERIVTIEDSREIEPAQPNCVR
FT                   LSYARHQASGQAAVTPTTLLRSCMRLTPDRVIMGEIRGPEAVEFLNMLNTGHKGSLTTI
FT                   HTDSPAEMYDRFGELMDGHTSMTREQVIARVKRRIDVVVQWKYTERNGRYISEIIYAGA
FT                   "
FT   CDS_pept        complement(23914..25134)
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="XCVc0030"
FT                   /product="type IV secretion system protein VirB10"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19799"
FT                   /db_xref="GOA:Q3C0D3"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19799.1"
FT                   /translation="MSDQTNKPQDDREAAVQAWEKQANASLVADDRKKKMSGIAIAAIA
FT                   AAALGAVWYMKHDGSEPAKPAGNSELSIPERKPVPKLKDQEPASVPAVTSAPAATPASA
FT                   AQADDPMKAQREQMEMQRREQERRILEARMKSAIIPPNSNNQAAASAQPVGDSGDQGPS
FT                   NAGALGGGSGERGAQDPNSRFARAVSGNGVAVSKANQIDNLPYKVLQGKLIEAVLEPRA
FT                   ISDLPGMVCATVQRDVYGEQDRNKLIPWGSRVCGVYSAEVRKGQDRLFVIWNTVRRPDG
FT                   VQVALDSAGADQLGTAGMGGIVDTHFAEIFGMSALLSIIGAGASNAGVSSGDQYNSTAA
FT                   YRQSVQQAAAQTSQSVLQPYINIPPTITVPAGSRVRIYVNKDLDFTPIYKDDIDAAKHG
FT                   DGVTFIP"
FT   CDS_pept        complement(25136..25918)
FT                   /transl_table=11
FT                   /gene="virB9"
FT                   /locus_tag="XCVc0031"
FT                   /product="type IV secretion system protein VirB9"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19800"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19800.1"
FT                   /translation="MKFNPIALAVALIAGTSISLASVPAHAAKSPHALVTDDRVKQVPY
FT                   DPNQVYEIVGTYGYQTSIEFANDETVKVVTLGDSIAWQTVPYQNRLFLKPVEPNAATNL
FT                   TVITDKRTYYFKLTSSKSQAAMTFLVRFVYPNSNVKTYAGAGSAQRMSNGFDPAKLNLG
FT                   YGTSGNKTAIPLKRAFDDGQFTYFMFDQNAEIPSVYTVGPDGTETIVNTRREGQYLVVE
FT                   RTASLFTLRNGNAHLCVQNNANPYKRAVSGLVSTGGGN"
FT   sig_peptide     complement(25838..25918)
FT                   /gene="virB9"
FT                   /locus_tag="XCVc0031"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(25943..26617)
FT                   /transl_table=11
FT                   /gene="virB8"
FT                   /locus_tag="XCVc0032"
FT                   /product="type IV secretion system protein VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19801"
FT                   /db_xref="GOA:Q3C0D1"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19801.1"
FT                   /translation="MNFGKGTFKGDNETQAAQLGGSNKLKQERNRAYLLIGLLLFVVGG
FT                   MASAVTVLANVHTVIPVVSVIDANGHVVKQQVVNKETITGQESFVQSQVYDFIMYCNTF
FT                   DPDWRQRFADLCRLHSTQAVAGQYDAETSPDNPNNPYYQLGQGGRRYPKITGITSLGKD
FT                   AYQVSFQSITEKAGSPPKTDYYTALVRYTFTFKPLALGDRWENALGYATTAYRKDQELS
FT                   RQ"
FT   CDS_pept        complement(26614..27480)
FT                   /transl_table=11
FT                   /gene="virB6"
FT                   /locus_tag="XCVc0033"
FT                   /product="type IV secretion system protein VirB6"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19802"
FT                   /db_xref="GOA:Q3C0D0"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19802.1"
FT                   /translation="MATLTIEGMIGSADGVTTSFLTQIYPALANAISTPIYLVAVLYWA
FT                   IYGYKIYAGYEPMKWNAVLSKAFMTTAVFSALNWGGLGQSIYGFFTSFMEGAASTIMAG
FT                   QSTPSMLDALYNNVGQVSALMQNVSWYQFGMILQGFGLFLINCILFILALVYMTIAKFG
FT                   LAITMVLLPIFVGFFFFEQTRQWAMNWLSKMLNFCFIYILVIAIVRFGFLAFGDAIDEA
FT                   GKAASVTDAARINVQQVAYLYIVEGVLIIFMLQVKGWAAALAGGASVQGVSLLMMVGRM
FT                   FTKGAIK"
FT   CDS_pept        complement(27468..27875)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0034"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19803"
FT                   /db_xref="GOA:Q3C0C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19803.1"
FT                   /translation="MPKALWTWILMGTAVVLIGGYGLLKIMSREPIIPMPVPQQGMPTP
FT                   SPSVETQNGGNPLLTADKVAVARWFPGHCFAELYNKDPSFGGRLIPSCVVKVIQQVKAD
FT                   TGVTLTEADIKSPDVLAHFKHVYGDDNQWRH"
FT   CDS_pept        complement(28134..28706)
FT                   /transl_table=11
FT                   /gene="virB5"
FT                   /locus_tag="XCVc0035"
FT                   /product="putative type IV secretion system protein VirB5"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19804"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19804.1"
FT                   /translation="MATVLQLQQQFQQLQEQYKTLKDQYAAVTGSYGRGQMGLSDSISS
FT                   ASVVPGSWQEVVAQQQSGAFGSKQAAYEKLINTMPQDLFANPQAQNATTYKMSTDAVRA
FT                   ALAGGDSLYAEVQTHLNNLARMSQQVDTTVNIKDAQDLQNRIAGENGMMQSAMAKLNAM
FT                   NMNLQANMVNQQNQATAANQNFYQWKK"
FT   CDS_pept        complement(28767..29465)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19805"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19805.1"
FT                   /translation="MQQMTQQPLNDAQLDRLGDFLEGVGAPAMNLEMLDGFFAALICGP
FT                   ETVLPSEYLPQVFGEDHCFDSNDQAAEILGLVMRHWNTIASELFRTLEKDDVYLPVLLE
FT                   DADGAVHGNDWARGFMRGIQLRPNSWQELIGSEEFGGPMLPIMILTHEHDPDPAMRPPE
FT                   IAPDKRDELLQSLIAGLTHIYRYFASHRQLATQGPLRRQGPKIGRNDQCPCGSGRKYKH
FT                   CCATSAPTFH"
FT   CDS_pept        complement(29484..32459)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0037"
FT                   /product="Tn5045 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19806"
FT                   /db_xref="GOA:Q3C0C6"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19806.1"
FT                   /translation="MPVSFLSTTQRERYGRYPDTLSSEELARYFHLDDDDREWIATKRR
FT                   DSSRLGYALQLTTARFLGTFLEDPTAVPSPVLHTLSSQLGIADPSDCVIDYRTTRQRWQ
FT                   HTSEIRTRYGYREFTGTGVQFRLGRWLCALCWTGTDRPSALFDYANGWLVGHKVLLPGV
FT                   TLLERFIAEIRSRMESRLWRLLVHGVTPEQRQRLDDLLKLVEGSRQSWLDRLRKGPVRV
FT                   SAPALVAALLRIETVRGLGIKLPGTHVPPSRIAALARFASTAKVSAVARLPEVRRIATL
FT                   VAFVHCLEASAQDDAIDVLDLLLRELFTKAEKEDRKVRQRSLKDLDRAASTLAEACRML
FT                   LDPALPDGELRERVYAAIGHDELAQALNEVRGLVRPPNDVFYTELEARKATVSRFLPAL
FT                   LRVIRFDANPAAQPLAQALQWLHEKPDHDPPTAIVGKAWQRHVVQDDGRINATAYSFCA
FT                   LDKLRSAIRRRDVFISPSWRYADPRAGLLAGAEWEASRPIVCRSLSLSAQPEATLSELT
FT                   RELDETYRRVAARLPQNDAVRFENVGDKTELVLSPLEALEEPPSLIALRNEIKARMPRV
FT                   DLPEILLEVAGRTGCMEAFTHLTERTARAADLTTSLCAVLMAEACNTGPEPLVRPDTPA
FT                   LKRDRLMWVDQNYVRDDTLTACNAVLVAAQSRIALARTWGGGDVASADGMRFVVPVRTI
FT                   HAGPNPKYFNRGRGVTWYNLLSDQRTGLNAITVPGTLRDSLILLAVVLEQQTELQPTQI
FT                   MTDTGAYSDLVFGLFRLSNYRFCPRLADVGGTRFWRVDPDADYGDLNALARQRVNLDRI
FT                   TPHWDDVLRLVGSLKLGLVPAMGIMRTLQVDERPTSLAQAIAEIGRIDKTIHTLNFIDD
FT                   EARRRATLLQLNLGEGRHSLAREVFHGKRGELFQRYREGQEDQLSALGLVVNMIVLWNT
FT                   LYMDAVLTQLRSEGYPVKPEDEARLSPFGHEHINMLGRYSFSVPEAVARGELRPLTKPN
FT                   DP"
FT   CDS_pept        complement(32464..32883)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19807"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19807.1"
FT                   /translation="MRVVLDTNVLLAALISSHSPPDIIYRGWLAARFELVTGTAQLDEL
FT                   RRVSRYPKIKAILPAHRVGTMINNMQRAVVLHVLPPLPDRIEVNDPNDAFLLAMALASE
FT                   ADYLVTGDRRAGLLQRGSIGRTRIVTPVTFCAEAL"
FT   CDS_pept        complement(32883..33122)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19808"
FT                   /db_xref="GOA:Q3C0C4"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR031914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19808.1"
FT                   /translation="MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYL
FT                   FERAVEQAKAATVGMGETELNDLIDEAVQWAREH"
FT   CDS_pept        33337..34260
FT                   /transl_table=11
FT                   /locus_tag="XCVc0040"
FT                   /product="Site-specific recombinase / resolvase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19809"
FT                   /db_xref="GOA:Q3C0C3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19809.1"
FT                   /translation="MKIGYARVSTREQNPALQVDSLKAAGCERIYQDVASGAKTARPAL
FT                   DELLGQLRGGDVLVIWKLDRMGRSLKHLVELVGSLMERKVGLLSLNDPIDTTSAQGRFV
FT                   FNLFATLAEFERELIRERTQAGLTAARARGRVGGRPKGLSPQAEATALAAETLYRERKL
FT                   SVAAIAQKLHLSKSTLYSYLRHRGVEIGPYKQSAQSPINVSVVESGNADQPKVATILLT
FT                   LRIENNSKFVRGKKRSIEHVEFFDLAQYDATRRPNGEYELKVPYDTDEELDEAVNDLLT
FT                   DIACGADDRHCFSESHARMEGTDRHW"
FT   CDS_pept        complement(34380..37013)
FT                   /transl_table=11
FT                   /gene="virB4"
FT                   /locus_tag="XCVc0041"
FT                   /product="type IV secretion system protein VirB4"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19810"
FT                   /db_xref="GOA:Q3C0C2"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19810.1"
FT                   /translation="MSLSMPVPEGAAADAKEMALSDMIPYTVHYDDESVITKDDGLVQV
FT                   IKLDGLYFESLTAEQIKQFERRRNTVLRSIANSDRGVYVHLIRRKVNLYPAGEGGTWFA
FT                   RRFNQAWRERYNKRSFYVNEIYISIVRNRFRQGAPGILDRAFSLLSGSKVTKEDLESFE
FT                   EQAKDVNEAANLVVQTLSGYGARKLRIQRRPEFVLDRVSRADAQLAVERFKMSWQEFQR
FT                   SHGHHDVYRRDEVLDYLGEDFTEIGGFLHYLVNLEDERVPVTEMQLDRTLAVSSLDFKM
FT                   LSNMMAVQNLSGTRAGAMLSMAEWPARTPSRMLDEFLKQPVEYIITQSFFFTDRISAEH
FT                   DMRQERRRIAVNDREGVAEEDKDEITKGLQDLTRGRSVNGLHHLTMLVHVPATTQFADP
FT                   IENKRQTIADLDGAVGLLKKAFVNLGVKPVREWFAVETFFWAQLPGQAQHFMGRRGKIK
FT                   SGNFAGFASLHNFAVGKIDGNLWGPAIMPFETESGTAYYFNFHREMEGMVAGHLALTAD
FT                   TGGGKTTLLAAFIAMADKARPRVFWFDNREGAKVFMRAMGGQHTTLTVQGNTGWNPMKL
FT                   PDTPENRAYLVELLTLMRTCYGGKLVPDDIDRFKKAVHENYALAYPDRRLRNVAWCFGQ
FT                   GELAKDMRVWHGANGIEGANWGVFDNAHDNIDLTKCRHYCYEMRQLIKDGSARPELPVV
FT                   LSYPFHRIEQSMNGEPFILVLEEGQNLVKHAYWREKIDSYIMQIRRKNGLLVFVTPDAK
FT                   YLYCETDSIQKQTATKIYLPNGEANRTDLVDVLGLTPGEYEFVRDTPPENRTFLIRRGN
FT                   ESIKAKFDLSDMPAFIPVLSSNDKGVALMDEIIRELETDDPEQWVPVFMERALAKNTHN
FT                   LKQKGA"
FT   CDS_pept        complement(37332..37709)
FT                   /transl_table=11
FT                   /gene="virB2"
FT                   /locus_tag="XCVc0042"
FT                   /product="type IV secretion system protein VirB2"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19811"
FT                   /db_xref="GOA:Q3C0C1"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19811.1"
FT                   /translation="MEKNEAIEKDTAVGPRKGDKVDKALGLTANALVMALVFLPQLAYA
FT                   QDAGGTFGGITAFLKSITQLLIYEWGYYIGIITLAIQGYRWKSGRIDLMTLGGWGLGIG
FT                   LVFFAPNIVSDLKARSSGSIQ"
FT   CDS_pept        complement(37738..37995)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19812.1"
FT                   /translation="MLTLTKKELAVLDEAQPDYAVYLVEAEHESSRWWRMTVKLPTHNK
FT                   AYEVVTALGKTKLWKRLDIAVDFIKESCPHTKTVFVVFAP"
XX
SQ   Sequence 38116 BP; 7620 A; 11710 C; 11439 G; 7347 T; 0 other;
     ggtgcgcatc gcgttccttt cgttggtcgt gggtcaggaa cccggcgacg gtgttggctc        60
     tgccagaaaa ctgctccagc agttgcatca cgtttcgccg aggtttcttt tgacgctatc       120
     agcctcgatc cagatcagaa cccgctcatc gagactcgtg tcggcagcag ccatgcgcct       180
     cgccaaggac cgacctatgc cgcgagttcc gttgcaaatc gcggcgacag tcgagtacgg       240
     gatacccaaa gcaacggctg tttttgccgc ccccccgtgg cgctctacgt actcgttcca       300
     gtaagtgcga ggattcacgc cgaaactact ctttaagtat agcgcaaaac tatacaaaaa       360
     gattagcagc tatgcaatca atttctctag tctctagttt caacctatga gcactctatc       420
     cgacaacctc accgcccgca gggaactgct tgggctgaac atcccccaag tacatgctgc       480
     gcttacgctg cgcggtgtgt gcgtggccga atctaccgtc tacagctggt tcaatggcag       540
     tagaggggta gggaagataa gccacttgaa agccctgtgc gaagtgctcc aaacggactt       600
     aaatagcctt actgacggca cactcggcaa ggcagcaggc tctgtcgccg ctgatatcgt       660
     gcgcgagctt gctggactga gcgaagttca gcaacaagca atattgagca ccatcaaggc       720
     gatgaaggcg gcgtaaagcg ctagctggta gcactcagca acgcaccaca cgaggcaaga       780
     gttgacggaa aaacaatgaa ctcagcataa attgctacac aatacgaaga gtaattatac       840
     aaattgtgtt gcgcgggatg tgcccataaa gtatagtaac ttcacaaaaa agcttgaacc       900
     ggcgcgcgac aagcccccgc cgtttagggc gggtaggata gccaggccag gccaggccag       960
     gccaggccaa cgccttgccc tacagcctac cggggggcga tactgctgcg aattttaaca      1020
     aacgcggtgg ctgctcgcat agcgagcagg gcgccgaaaa cgaaaaaacc gcccttgcag      1080
     gggcggcttt ttcatcactg ggctggcggg aaaaaccagt accaatgggc tagtcacata      1140
     gctccatcct aatcccgccg gcgaagccgt gcaagaggga aaaggatgca aaggccaaaa      1200
     cgccgaccac cttgccccgc tgccgttcat cggcgcggga catgccagca gtagacacag      1260
     gcccccacgc tcaaggccca gaaccgaccg ctcccagcgg caggccgcac aagcgtgtgc      1320
     actggcgtca gcccaagccg ctggccggca agaagcgccg gccgggcgta ctggacgcta      1380
     ctcgccatgg actggtgcgc gccctggaag aacggaaagg cgcgtggaag cggattcgcc      1440
     acaacgtcat cgtggccggt tatgccctgg acaaggcgct gacgcgggtg cgcggactgc      1500
     gcaaggatgg ggccgactcg ttgttggcca tggccgtagc gctgctctac ctggccgacg      1560
     tgcgcaccgg ctttgtgggc aagccacgcc agggcggcgg cccctggcag cgctacacgc      1620
     tgcccgacct tgctcagctc gcctatggcg gacagagcga cgccgagcag cggcgcgcac      1680
     ggcgctcgct cgacatgatg gtgagccttg gctgggcatt ccccaccaaa caggtgcggc      1740
     ggcacaccaa agacgccgat ggcggcgacc tgtggtgcag tgaggcgggc gtgcgccggc      1800
     tcaacttcca gcggctgtgc gacatggtgg ggacgagcag attgctcaag cgcgatcgca      1860
     agcacgccga ccaagcacgc ggcacaggcg ttgcgtcctt tacgcaggcg caagcacgcc      1920
     gtcagccgac ccaggagtcg cgcaccacgt cgcgcaggcg cgatacccgc cctgcggcgc      1980
     accgcgccac gggcgccccg ccaggcgacg cacagagcgc cgtgaggcac atttccgaca      2040
     tcctcgccct gttcaactag ccatcgccgg caggctcgcc gctgcccgat gccgcaaaaa      2100
     cagacatgta cgccggcaaa tctgccgcga aaaggcgagc cgcaccgctt acggcgacct      2160
     cgatcaccga gccgtacccc tcaacgccat gccccgcgcc aagttatcca ccgtggtggg      2220
     ggataagcct gtggagaaat agcgttattt gtcctgttta tttggcaggc catccagtca      2280
     acctttggtt gaaagcacag tcagcagaaa atcaacagca gatcggcgtc gccgccgcta      2340
     cgcgacgccg acaacgttag aagctcgata gaggggctgc gcccctccca ccgccactgc      2400
     ggatgctcca gctcgggaaa ccaaaccaaa tgagcgcaca gtagcggcgg ttccctcctg      2460
     caaagagcaa caacgggtca gcagggaatg attaaccgga cttcgagaca gggcatgacc      2520
     ctggaaccgc tgccgacttc gggtggtcta cgcttaagag cggtcgccgt gcgctacgcg      2580
     cacaaaagag cagataacgg ggttcgggga gcaatggaac agccaactca cttaaaccaa      2640
     gccggaaccg ccgaaaattc cgggacggca cccggtaagc cggaatccca gatttttccg      2700
     accacatggc aggcggtcgc gcacctggtc agataacgcc aacgaccagc aggagcgccc      2760
     tgtctatcgc tttcatacgc tcatcatcga ggcggccaaa cggttcgctg atcttggtgc      2820
     gaggcagcgt tgagagcttg tccaccatga cctgcgagag cgcgcgcagc ccgttggccg      2880
     ggttcggttc cacggtgacg cggaacgcgg cattgcgcag gtcgcttgtc accgggcaca      2940
     gcacgacgct ttccaggtcg gtgagcaagt cggattgaac gaccaaggcg ggccgtggtt      3000
     tgccatagtc gccctgcaat gaaaccgtca caaggtcgcc ccgctgcatc actcccagcc      3060
     ctcaacgtgc gttgcggcct cttcggtgaa gcgcaaaacc tcggtttctg ccgggtcgcc      3120
     cttcaggttt tggcactgct tgcgcacttg cgccgcgaac tcgggagagc gtgtgtcggg      3180
     cacccaaaac tggacaggcc gtagccccgc agcgcgcatc cgctcgcggt gccgggctac      3240
     ctttgattcg tgaattgatg acatggtgct ctccattggt tgcatgcgta gttacatgat      3300
     gccgcgcatg caaccaaaac gcgagtacgg ataactcgac tgaaaagggg ccagccgaca      3360
     tgcgtgtaaa aatgactcgc aaaatccaat ttttctcgta aaaacatgac gttgccagat      3420
     aaaaggcttc caccggttcc acggtaatcc ccgttccggg ttacatattg aacttcgtta      3480
     tccatgtgca catataggta tgtatatacc tatatcccgt tgaggaaggc ttccagcgcc      3540
     tcgatcacga tgtccttctc cgtgacgcgg acgcccttct cttcggagcg cttgagtgct      3600
     tcgcggcgca ggcgatcagc cagctcctcg gggaagttga agattttttg cacccgagcg      3660
     cggccgtagc gctgcgcttc ctcggcagcg ggcggtgtgg cggccggtgg cgtggccacg      3720
     gccgcagggg ctaccagcgg cttttctgcc ttgtcggcct ccccgccttc gaggaaggcg      3780
     gtcgggtctt tgggcggctt gaactgggcc gtgttgggct tgcccttcat actcattgca      3840
     tcacctcctt gaagaaggct tccatctcgg caatggcggc ttgatcgcgg cctagctcct      3900
     gaacggtcgc accctcaccg atggcacggc gaaaggccac ccgctcgcag acttttgtag      3960
     gtaatacagt cagcttctgc tcggctagga attccaacat ctcggccgca tccttggtgc      4020
     gcggatcgat gcgggtcagg agcacgcgca cgtccagctc agggttatag tcgcgggcca      4080
     gctcgacaac ttcgagcaag tcggtcatgg ccgctgcgtc cagattggat gcaccgaccg      4140
     ggatcacggc acgctgggcc aacagcagcg cggagcgcag gcccacagaa tcacggccac      4200
     ccgcatcaac gacgacatgc tcaaagccgg tggccagttg cttgccttcg ctgaggatcg      4260
     ccttgccagc gaggcaggtg gtggtgggtg acgggtcgta ctgcgtctca cgacgccatg      4320
     ctgcccagct cgcggccgag gcctgcgggt cgccgtcgat cagcagcgtc ttgccctgac      4380
     gggcgagcat cactgccaga tgcacggcgg tcgtggtctt gccgacgccg cccttggtgt      4440
     tgacacacgc gaagaccatg ggtgctccta tctatgtata tacataccga tgggcagcgc      4500
     agcgactggc catcggcctg cggggtgcat ccccgtccct ttaactctat aagtatatat      4560
     atacctacct accgaaagtg aatggcagca gactttcgcg cttcaagatc attcgtcacc      4620
     gcgacaaaga ggggatgtaa gccggaaccg ccgaaatttc cgtcatccca gctccagtcc      4680
     ggccacgagc gcatccaggt cgatgatctt gccgctcctc tggaaggtgt agtgcccgtt      4740
     cagcaggatg tgccgccatg ccgtcggcgc cgttttttgc ctgctgcgca ctgtgccagc      4800
     cctccgccga cccccacccc ccaccggatt ccgccgcacc gcgccgaccg ccagtcggaa      4860
     acgggctgca atcagttgtt tggtaataag aatagttgta ttattattac caaacaaacc      4920
     cgtcggagtt gcacatggac ccgtcccaag acgcacgtga tcgcatcctt acagccgctg      4980
     actcgctgta tgaccaggcc gggcgtgagg tttttccaac cgtcgatgcc gtgcggaagg      5040
     cggccaaggt caacatgaac gacgcaagca ccgtcatgaa ggagtggcgg cgcatgcaga      5100
     cccgcccagc agtggtggtg caggtgcccg aggcggtaca gcaggtcgcc agcacggccg      5160
     tgctggcgct gtggcaggcc gcccaggacg ccgccaatga cgcactgcgt gccgcccagg      5220
     ctggctggga agcagagcga caggaagcgg atgcgttgag ccagcagatg gccgacgcct      5280
     acgaagccca agcacttgag ctagaagcgg cccaagcacg cattgccgag ctggaagcgg      5340
     ccatgcagca ggccgtcacg gcagcggccg cccaccaggc cgcgatcgac caggtgcgca      5400
     ccgagctggt ggacctacag cagcgggcca gcacggctga ggcccgcgcc agcgagctac      5460
     gcaccgagct ggatcgggcg cacctggtcg ccgccgagca gcgttccgct gccggccagg      5520
     cccgtgagga cgccgcgact ttgcgcggtc gcttggccgc tttcgagggg atggccacct      5580
     cgcccgcccc agtcaaagcc gcccccggca aggggatgta agccgcgccg ccacgcgtgc      5640
     atccacgttg atcatctgcc ctgccaggat gctggttttg tttgggtatc cctttgtcga      5700
     accatcaaaa gccggtactc tgttgccaac cgtgcgaccc taaacaaacc ggttcaccga      5760
     atcgacccta accgtaccga tgaccacctt tgtccgcgcc tacctgcgcg cctccacaga      5820
     cgaacaggat gcccagcgtg ctcgcagcgg cttggatcag tttgcgcgcg atcggggcgt      5880
     tcgcatctgc aactactacg ctgagaacgc gtccggcgca cgcctggacc gagccgagct      5940
     gtttcggttg ctggccgaca gccggccgca tgacgtgttg ctggtcgagg acgtggatcg      6000
     tctgtcgcgt cttggcaggg ccgagtggga gaagctgaaa acgctgatcc gcgaacgatc      6060
     ggtacgcgtg gtcgcggtca atgtaccgac gacgtggcag cacttggccc ccctgcaaaa      6120
     cgagttcgac gctcgcatgt tcggtgcgat caatgacatg ctcctggaca tgctggccgc      6180
     catcgctcgg cgcgattatg aacagcgccg gcagcggcag gcccaaggca tcgcgaaagc      6240
     caaggtcgca ggcaaatatc gaggccgcca aatcgaccgg gcgcgctacg gtgcgatcaa      6300
     tcggctgctg gccagcggca gctcgtggag cgtggtgcaa aagactgtgg gatgcagccg      6360
     cagcaccatc agccaggccg tcaaacacgc aaagctcagc gcatcggcac cgagcaccga      6420
     actcatggcg gcggcatcgg ttgccgtgat tctctggttc catgtcgaaa acgggagtaa      6480
     gttcacccga ggcaaaaagc gggttcggga ggacatcgac tacctgatcg ccacctcaca      6540
     caagagcaca aagctcagtg ataccgaata ccgactggtg attcgttacg ccgacgatgc      6600
     ggatttgaag cagcagatca acgatctact gcacgaaatc ttgcatttgg ccgacctgcg      6660
     caactgcgtg gtcgatgaca tgagtgtcaa gaacgaggca accggttcgt tctgggacga      6720
     atgcgatggc ggctggaaat gagagacgga tttttctggg gttccggctt acaacccctc      6780
     ttaggcggta caatagtagt tagttcgctt aaggagttca tcgtgaccat gaaagttttt      6840
     ctgcataccc gtagcccaga gcaccgggac tggctcaacg agaagcgaga gttcgctcga      6900
     atccccgttg tcggcgagca cgtcgctatt tccagcgacg gtccttggtt caaggtggag      6960
     cttgtggttc acaccccctt tccatgcgag ttcgatgctg aggtctacgc cgttgcagta      7020
     gatcacctgc aggttctcaa cgaggcgttg gatggctagc agcgcggcgt cgcgatctaa      7080
     gggcgtgtcc tagattttgt gtaaccgggc cacaggcagg agactgccac ctaacccgga      7140
     gacaccatga gcccacgcac acatgaggta cccgacgagc tgcttagcag cctgttggtc      7200
     aactacacca aacccgagga tctgatcggc gagaacggcc tgctcaagca gctgaccaag      7260
     cggttggtgg agcgggcgct ggacgcggag atgaccgaac acctcggtca tgacaagcat      7320
     gagccggtcg ccaacgcggc cggcaacacg cgcaacggac gcagccgcaa gacgctcaag      7380
     ggcgagttcg gcgagctgcc gatcgagatt ccgcgtgatc gccacggcag cttcgcgcca      7440
     cagctgatcc ccaagcacca gacccgctgg gccggcttcg atgacaagat cttgtcgttg      7500
     tacgcgcgcg gcatgaccgt gcgcgagatc cagtcgcacc tggaggagat gtacggcacc      7560
     gaggtgtcgc cgagtctgat ttcctcagtc accgatgcgg tcgtcgagga ggtcaaggcg      7620
     tggcaggcgc ggccactgga tccggtctat ccgatcgtct atctggactg catccacgtc      7680
     aaagtgcgcg agggcgcggt gcgggtcaag gcggtgtacc tggccatcgg catcaccatg      7740
     ggcggcgaga aggaagtgct gggcctatgg ctggcgcagg ccgagggtgc caagttttgg      7800
     ctgcaagtcg tgacggagct acgcaaccgc ggggtgcagg acatcttcat tgcctgcgtc      7860
     gatggcctga aggggtttcc cgaggcgatc gaggcggtgt tcccgcagac caccgtgcag      7920
     ctgtgcatcg tgcacatggt gcggcacagc ctgaactacg tctcgtggaa acgccgcgcc      7980
     gaggttgccg ccgatctcaa gcgcatttac gcctgcgcca ccgtcgagga ggccgagcag      8040
     gcactgaccg agttcgaggc caagtgggac gcccagtacc cgcccatcag ccagtcatgg      8100
     cggcgcaatt ggtcacgact gatcccgttc ttcgactacc caccggagat ccgcaaggtg      8160
     atctatacga ccaacgccat cgagtcggtc aacatgagcc tgcgcaagct gaccaagaac      8220
     cgcggcgcgt tccccagcga cgaagccttg atgaaactgt tctacctggc tctgcgcaac      8280
     atcaccaaga aatggacgct gccgatccgc gactggaagg ctgcgctgaa ccgctttacg      8340
     atccagttcg aggggcgact tcctcagcgg taacccaaac cacggttaca caaaattctg      8400
     cacacgctcc gatctaacaa ctcaatcaag ccgaactggt ttcgccagtc ggcttatttc      8460
     gggctttagg catcgaaagg gggatatatg cagatgttgg ccgcggcaaa acttcgtcag      8520
     gcatggggag actcgccctg cgagcacccg cacattgagc aggaatatca cttgggatct      8580
     aacactggcg agtacgtttg tacacaatgc ggagaggcaa aagagggctc cgactggaat      8640
     agacggatat cagatgccta acaattcgtt caagccgaag ttgctagctt gctgtcagca      8700
     aagaatttcc cacgaatttt gcacacgctc ccaaaatatc cgctaaatgt aggacctgta      8760
     tgggtctaac ttgtggggtc taccccatgc cggccagcct ggccccaacg aagccgccca      8820
     ccacgccggc gacaaatgcg aatccagcca gcagcagcac gaaccgccgc gccttgctct      8880
     caagcgccgc attcgcggcg acgagctgcg ctgcgccgct gttgagctga ttcccgatct      8940
     gcgcggccgc gtgtcggcca gcctcagtca gcttttcggc gttcttgtcg atgaccgact      9000
     cgaaattgag cttggcggcc aggaacgcct tgccggccgc gtccgttgtt gccttctcga      9060
     tctttccggc cagcgcctga tctgcttgct cgaagcgacg cacgatggcg tcggcatctt      9120
     gcagcagctc ggccatgagc gcttcgcggg ccgtggatac gtgactcccc ataacgcctc      9180
     ctcacttgaa caacgccttg taggcatcat cgaggttctt gttagccgac ttggcgagcc      9240
     acttcgccgg taatcccccc gcccattagc agacgccaga agtggaattt tctcgtaccc      9300
     tttcccgagg aggttccatg aagaagtccc gctttaccga cagccagatc atcgccgtgc      9360
     tcaagcaggc ccaggccggt gcgcccgtgc cggaactgtg ccgcgagcac ggcatcagct      9420
     cggccacgtt ctacaagtgg cgcagcaagt tcggcggcat ggacgtgtcc atggtcgcgc      9480
     gcatgaagga gctggaggag gagaaccgcc ggctcaagaa gatgtacgcc gaggcgcagc      9540
     tcagtaccga cctgctgaag gaagcgctcg caaaaaaatg gtgaggccat ctcagcgacg      9600
     cgagatggcc caatcggcgg tcacgagcgg gcgcacgaac atccgccacg cctgccagac      9660
     cttcgcggtg agccagacct gcttccgcta ccaggccaag gccagcgagc agaacgcccg      9720
     gatcgccgac tggctgatcc ggttgacgac cgcccatcgc gactggggct ttggcctgtg      9780
     ctacctgtac ctgcgcaacg tgaagggctt tggttggaac cacaagcgga tctaccggat      9840
     ctaccgcgag ttggagttga acctgcggat caagccgaag aagcggctgg tgcgtgagcg      9900
     gccgcagcca ctggcggtgc cggagacgat caaccaagtc tggtcgatgg acttcatgca      9960
     ggaccagctg gccgacggcc gcagcttcag gctgttcaac gtgctcgacg acttcaatcg     10020
     cgagggactg gggatcgagg tcgacctgtc gctgccgtca gcccgggtga tccgatcgct     10080
     ggagcagatc atcgagtggc gcggcaagcc cgccgtgatc cgctgcgaca acggccctga     10140
     atacatcagt ggcgcgttgc tgtcctgggc gcagcggcat ggtatccggg tcgagcacat     10200
     ccagccgggc aagccacagc agaacgccta cgttgaacgc tacaaccgca ccatccgcta     10260
     cgcctggctc gcccaaaccc tgttcgacac catcgaccag gtgcaggaca aagccacccg     10320
     ctggctatgg acgtacaacc acgagcgtcc gaatatggcg ctcggcggca tcacgcctgc     10380
     catgaagttg gcgatggccg cttagctcca cttctggcga ccgctaaaag tggggggatt     10440
     acccgccgag atcatgttga tcgcgtgcgc cttggcgtcc tcgtccttgg cttcacgaag     10500
     cattgcccga tagtccgttt catcggccac gatttccgag acggtctttt tcagcgtccg     10560
     cagccggtcg aaaatctcgt tcttgaatac cacggcttct ggtcgcagcg tgaagctctt     10620
     ggtttcttcg tgcaggccaa agatcatccg aaacaggcgc ggcacgtcgt tggcgtcttc     10680
     cagctcgacc ttgttgaaca ccacgcggat ttttttcgcc ggcacgccga ggctggtgag     10740
     tgtcctgata gtacttagcg tatcggcttg ctgcttcttc tcgctaacgg tcggaacgac     10800
     gtagtagtcg aactcttcgt gggacccctc gaactggccc atctgcttga tgaactcttc     10860
     gacgttggat gcacccacgt ccacgatggc cgaatcgagt gtcatcaggt cctcttgcag     10920
     cccgccgtag tccttgccct tgaagcgctg tgcgtcggtg tccgctgatg atccggcatt     10980
     gatcgtctca atctcgaatt tcggtgcgtt catacgcggc gcaagcaggt gatcaaccag     11040
     cgtggtcttc cccgggtttc cactgaaact aatgacggca actttcattt gcggctcctt     11100
     tctttctgct tggccaagcg ctcatatcgc gcgatgtcct gtgcctgttt tgccgggtcg     11160
     ggtttcatca ggcggtcaag ctcctgcatc gagatcgggc cacgcggtgt aggcggttcc     11220
     gacgaatatg tttcgtctga aacagattcg tcggattggg atgatgccgg cgtcggtgtg     11280
     ccagccgacc gtgagccaac agactccgtc tgctgtctca cggtctttgc ttgatgcttc     11340
     tttcggtatc ggtacaggta cgtcttgagc gtctgaaacg tcaggtcgaa accggcatcg     11400
     gtcaacgctt tgtgaatcgt ccggagctgc acacctgctg cgagcttctt ctcgatctcc     11460
     ggcatcactt cccgtaattg cgccgctttg gtggtcggtt ccgtctgcct gactgcctgt     11520
     tttgcgtctg gcttcgtcat tgatgtccca ccgtcgtcat attgttctct aactgtacgc     11580
     tagttgcacc ccaattgtct tcataaaggc aaccttttgg ccgctattcg tatccagtta     11640
     gtcatctatc cgtccatata atgtctactt tgtgtctcca tcgcccctgc ggccttcggc     11700
     ctatgcgacc tgtacgccct taacccctag agattccggt ccttaacagg cccgaaatct     11760
     caatacacat tacgcacccc ctacggtggt acaaaaggct tgtgagatat ggcttcaggc     11820
     cagattctcc ccacattgaa gtcaatattg tttcaatagg aatttgccgg aaagccttat     11880
     caaagctagc ctaagctcta ttgaagaatc aatagagtaa aaacgccgat gagtaccgca     11940
     aaatctgtgt ccgtttggta cacggaggac gagcgcatcc gggtggaaca agcggccgct     12000
     ctggccggct acaagcacct gtcgaagtac atccgcgaca agtctctcga ccgtggcagc     12060
     catcgcgagt cgagccgcga cagcatggaa gcatgggccg accgacagga acttgtcggc     12120
     cgtttggccg agatcgagcg cagccagaaa ggcgcgcatg cgcttctggc gatgctgctt     12180
     tttctggtgc gcaagaaggc gaccacgggc gaggtcaacg agctggttct cgcatgcgag     12240
     aaatccggcg tgccggccga cgtgctggcc gcctccctgc ccgagctggc cgcactgcta     12300
     acccgcttta cggaggattc gtaatgtcac caaaaggagg cggcaaaggt aatgccccag     12360
     tatatactcg aaacagcagg caaacaggag gcccgttatg tcaacgaaag ccgttttcac     12420
     gatgaagctg gaaccggagt tgcgcgacac gttcatggcc gaagccgccg cagatgaccg     12480
     cccggcggcg caggtcgtgc gcgagctgat gcgcgactac atcacccgcc gtcgcgaggc     12540
     acgggaatac gacgagttcg tgcgtcgcaa agtgcaggtc gctcgcaagc agcgtgacgc     12600
     cggcctgcac ttctccaatg aggaagtgga agccgatgca gccgcgcgcc gcgtggacct     12660
     gctacgccgc gccggagagg ctggattgtg aaagtccgct ggatcgcggc cgcacgtcag     12720
     gaccgcgccg atatcatcga ttacatcgcg gtagagaccc cccgcgcagc gctcaagatg     12780
     gatgatcttt tcagcgaggc agccaagcgg ctgggagagt tccccaagct cggctgcacc     12840
     gggaaaattc ctggtactcg cgagcttatc ccgcatgaaa gctaccggct cgtctacgaa     12900
     gtggacgaag ctgccgacac ggtatgggtg atgaccctta tccacacagc gcgccagtgg     12960
     cccccggcac gggacgacta acgatggtga caaaacgaag ctggccaagc acgtcaaatt     13020
     tgcggcgcac cgtgcttgca ttcaagcttt tgcctgcttt agaaaacgct cacaccccaa     13080
     ggaaagagga aacatgaagt tgttcagcgc ggccgtcatc gccatgtcgg ccttatttgt     13140
     cactcaggcc catgcacagc agcagcccgt gaacacggga cttggcgagt gcgtggactt     13200
     cgtcatcttt gcctccagca cgctcaccgg tcaggtcaac ggcaccacgt accccttcgt     13260
     gtatggccca gccacctatc tggacaagcc gggcagcact gtctacatcc agaactattc     13320
     gtgtgcctcc aacgacatcc ctgggttgta ctccagagtg tccatggtca gccacgagat     13380
     gggccaccta tacctggatc agggctgggt gctcggcaca cgggaggact acatcgccaa     13440
     ggcctgcaca aatgaaggac gggccgtgct caacaactcc acggcgcgca acgagatcct     13500
     ggatacctcc cagggaggcg ccgacatcag cctgatcgcg gcgaacgctc cggcgctgct     13560
     gtccacgatc gccgccgggg gagccgatct ggcgcaacgt gtgggtgatg cattctgcga     13620
     ggctaatgtc acgtccacta ccggtgagaa ctacaaggtg tactacggca acgagtacga     13680
     caaactcaat cccccttcgc aagaggagca ataaaccatg aagactctcg ccgccgccct     13740
     tggcgcgctc gtcctcgcga ctgctccgct cgtgcttgcc gcagccgtac cgcgcgcctc     13800
     cgccgccgct gaaaagcagc tctgggcttt ctcggaaaaa attgcattgg ctcttccagg     13860
     gaatggaaaa gacgtactga cgctcgtctc cccccgcccc gactcggtcg ccatgaccaa     13920
     tgggcagaag actcgcaagc cgtcgaagca aatcgctccg tcgctgttcg cgtcgaacgc     13980
     cgtggtggtc atgggcgcgg acaatcgcgc agattcggca tccttcgagg tgacgggcag     14040
     ctgcgtctcg atggcatcgc tgcggaaaca gtatccgagc ctcatcgtga tggactacgc     14100
     gcgcggcgtc aatgagcatg ccgtctacac cttgggcgcg cagatcggcg atgcgatcgt     14160
     cgcgtactcg tttcctgcca gcaagctcga ttgcatgagc cgtgtgttca tcacgcccgc     14220
     aaagatcacg aagaacaagc tcggaattga atagacgacg agcatgaaat tcgagggcag     14280
     cggtcttatt tcaatacgct gacgtacgag gccgtttgct ccggggtgac atcgggggca     14340
     cagaccaccg gccaggtcga ggcgggaatc aatgccgtga tcgcggcacc gacgacgagc     14400
     cgctggctta aggccgcgct cgccgatgcg ctgcaccgcg attgcgttga tgcggcccac     14460
     gatgccgagc tgctggccga cctatggggt cgccgctgcg attccattct cgggagggtg     14520
     taagcgatgc agaagcacga agccgaggat gccacgctgt tctttggcgt tagtttgccg     14580
     attgctggct ggctcgccgg cacgtatgca gcgaatgtgc cgctgtcacc gttcccgcaa     14640
     gcgctcaccg ctgcgctaca cgcgacgccg aacaatccgt tcatggttgg cggggttgtg     14700
     gccgggttgg gactggccgc gaccaccggg tatctgttcc acgagtacgg cgacgatggg     14760
     ttccggggcg caccgtatcg ccgctggatg cgcggctcgc agatggcgaa ctggcacagc     14820
     gtaaagagca aggtcaacgc ggccaatcgc cgggagaatc gccggcgacg ggccgaacag     14880
     aggggcgcga aggatttgcc ccccatcatg atcggcccca tgccgatgcc gctgcacctt     14940
     gagaaccgta acacgctgat ttgcgcgtcc atcggcgcgg gcaaatcggt tgcgttggaa     15000
     agcatgatct cgtcggccgt gaaacggcgc gacaagatgg ccgtgatcga cccgaacggg     15060
     acgttctatt cgaaattcag ctttcccggc gacacgattc tcaacccgtt tgaccgtcgc     15120
     tcgtcgggct ggacgctgtt caacgagatc aagggcgtgc atgacttcga ccggatggcg     15180
     aaaagtgtca tcccgccgca gatcgatcca agcgatgaac agtggtgcgc ctatgcgcgt     15240
     gacgtgctgg ccgacaccat gcgcaagctg gtcgagacga acaacccgga tcaagacacg     15300
     ctggtcaacc tgctggtgcg cgaggatggt gaagtcatcc gcgcgtttct cgccaacacc     15360
     gattcgcagg gctacttccg cgagaacgcc gagaaggcca tcgcgtcgat ccagttcatg     15420
     atgaacaagt acgtgcggcc gctgcgcttc atgaccaagg gcgatttctc gctgcataag     15480
     tgggtgcatg accccaacgc cggcaatctg ttcatcacgt ggcgcgagga catgcgggcc     15540
     gcgcagcgcc cgcttgtggc gacatggatc gacacgattt gcgcgacgat tctcagtatc     15600
     tccgacgacg cgcaacacct ctcccggcgt ctgtggctgt tcctcgatga gctggaatcg     15660
     ctcggcaagc tcgaatcgtt cgtgccggcc gccacgaagg gccgtaagca cgggctgcgc     15720
     atggcggcct cgatacagga ttgggcgcag ctcgatgaga cctacggcaa ggatgcggcc     15780
     aagaccttgc taggctgctt ccgtaattac ctcatctttg gcgcgtcgaa cgcgctcaat     15840
     gccgacaagg cgagcgagat tcttggcaag cagcacgtcg agcgcatcca gatgacgacc     15900
     aacgcagggg gaagcggtgg aggcggccgc agccgccatg ttgtcgccag tccaccggag     15960
     ccggtggtat tggactcgga aatctcaaac ctcaaggacc tggagggcta cgtcatgttt     16020
     gccgaggact tccccatcgc gaagatcaag ctgccctacg tgaagtatcc gcatcgcgcg     16080
     gccgccatcg acatcaagtg acgggggccg ggccatgctc aatgtgacgc cgattcgcgg     16140
     caacaaccag tacgcggccg cgcattactt ctcggcggcc gacgactact acgccaagga     16200
     gcaccccggc gagtggcaag gccaaggcgc acaggcgctt ggcctgacgg ggccggtgga     16260
     acaggcgcag ctctcgcggc tgctggacgg ccaactcccg aacggcgagc gcatccagac     16320
     gacctttgac ccgaccgaca acaagaagcg catggggctg gacctgacgt tttccgcccc     16380
     gaagtcggtt tccatgcagg cgcttgttgc tggcgacaag gacgtcaccg ctgcgcacga     16440
     ccgcgccgtg acgcgcgcac tggagcaggt cgagcggctg gccgaggccc ggaagaaggt     16500
     caagggaaag agctaccgcg agcgcaccgc aaacatggtc atcggcaagt ttcggcacga     16560
     gatgagccgg gccaaagacc cgcagctaca cacgcatgcg gtcgtgctca acatgacgca     16620
     gcgcgcagac ggcgcttggc gcgccctgtc gaacgaggac atattccgcg tgcagcacga     16680
     ggtagacgcg ctctacaagg ccgagctggc gaggggcttg caagcgcttg gctacgcgat     16740
     acgcctggtc gatgaccagg gcaatttcga gctggaccac atcagccgcg accagatcga     16800
     ggcgttttcg gcgcgtagtc gcgtcatcga ggaagcgctt gccaacgagg gcaagacgcg     16860
     agcgacggcg acaacgcttg aaaagcagat catttcgctt gccacgcggc cgcgcaaaga     16920
     cgagtccgac cgcgagctgg tcaagcagta ttgggtcgaa aaaagccgcg agcttgggat     16980
     cgactacggc ctgcgctcgc agctcgatgg ccgcacctac gaggcaggcg acagcttcgg     17040
     cacccgtggc cgtgagcggg gcgacgccgg cgaccgcatc gcagccacga gcctgccggc     17100
     gagcctcacg ccggcacaag ccgtcgtgca gtacgccatc aaccacctga ccgagcgtga     17160
     ggctgttgtt cgcgaaaccg cgctcacggc cacggcgttg cgtcgcgcgg tcgggctggc     17220
     aggaccggac gaggttcgcg ccgaaatcaa gcggctcgcc ggccaaggcg cgttgatcga     17280
     agccgtgccg gcgtatcgca tggccgaccg caaggacggg ccggcgctct cgtcggccgg     17340
     ctggaaaagc tatctgcaag agctgaaagg ctggtccgac aaacaggcgc agcagtacgt     17400
     cggcaacgcg atcaagcagg gttcgctcgt gccggccgag aagcgttaca cgacacagaa     17460
     ggcgctcgcc cgcgagaaag cgattctcgc catcgagcgc accgggcgcg gagctatcga     17520
     gccgatcatg acggcggccg ccgtcaaaac ggcgttggaa ggcaccgcgt tgagcgccgg     17580
     ccagcgttcg gccgtggaaa ccatcgtcag caccaagaat cggttcgtcg gcatccaggg     17640
     cgacgccggc accgggaaaa cctataccgt gaatcaggcg gtcgcgctca tcaagcaggc     17700
     gtcggccgtg agcgagggct accgcaccgt tgcgctcgcg ccctacggca atcaggtcaa     17760
     ggcgctcaag aacgaagggc tggaagcgca cacgctggcc agctttctgc gcaccaagga     17820
     caagcccatc gacggcaaga cgatcatcgt tctggacgaa tcgggcgtcg tcggcgctcg     17880
     ccagatggaa caggtcatgc gggttgtcga gaaagccggc gctcgcatgg tcttgcttgg     17940
     cgacaccaag cagaccgagg ccatcgaggc cggcaagccg ttcgcgcagc tccagcagga     18000
     cggcatgcag accgcgcgaa tcagcgagat tcagcgccag aaagaccacg agctgaaaac     18060
     cgctgtcgag cacgcggccg agggccgtgt cacgccatcg cttgcgcaca tcaagcacgt     18120
     tgaggagctg aaagagccga tcgagcggca ccgggccatc gtgaacgact acatccagct     18180
     caccgaaccc gagcgccgcg aaacgctgat cgttgcgggc accaatgaag cccgccgcga     18240
     gatcaaccgc atggtgcgcc agtcgctgga cctgaccggc aagggtcggg agttcgagac     18300
     gttgacccgc gtggacatga cgcaggcaca gcgccgcttt gcgccgagct atcagccggg     18360
     catggtgatc cagcccgaga aggacgacca gaaagccggc ctgacgcgag gcgagaccta     18420
     ccgcgtcaag gacgcattgc ccggcaatgc gctggtcttg cagcggcagg acggcaccac     18480
     caccacgatc aacccgcgca aggcgacgca gctcagcgtc taccgccttg agcgcgccga     18540
     gctgtcggtc ggggataccg tgcggatcaa ccgcaacgat cccggccgcg acctcacgaa     18600
     cggcgaccgc atgcgcgtgg ccggcgtgat cggcggcgtc gtcaagctcg aatcggtcga     18660
     gcagcgcgac ggccgaccgg cacgcgcgct tgagctgccg acgaatcgac cgctccacct     18720
     tgagcacgcc tatgcgtcca ccgtccacag cgcgcagggc ttgaccaacg accgcgccct     18780
     catcgcgctc gataccaaca gccgcaccac gtcgatgaat ttgtattacg ttgccatcag     18840
     ccgggcctgc cacgaggcgc gcgtctacac gaactcggtc aaggagctgc cggccgccat     18900
     cgcgcggcgc ttcgacaaga cgacggccct agcgatccag cgcgaacgcc aattgcagcg     18960
     ccgcgacgcc ggtatgcaac ccaaaggcgc agccgacggc aagcaggcgt tgcagcgtca     19020
     gcagttccaa cagcagcgca agcagccggc gagcggaaag aaaccgtccg agtacggacg     19080
     ctttggctag gggctggagg ccggggagca acggaacagc caactcagtt aagcggtttg     19140
     gacaaaccgt cgtttttcgt cacttagcga tgcccaagaa cacggccagg cagcgctcaa     19200
     tttccaccaa cgcatcagcg tctacgcgcc caaaggcccg acctatcttg tcacgcttca     19260
     cggtcatggc cttgtccacc atcacctgag acggcttcag caggccattg tcggtacttg     19320
     gatgaacggt aatgcgcagc agcggcgcag caacaagcgt gcttgtcacc ggcagcaccg     19380
     tcacggtggt gtgttcgtca aactggttgg cctggatgac cagagcgggc cgtggttttc     19440
     cgaagtcgcc ttgcatggcg atggtcacaa agtcacctcg catcattccg tccagccatc     19500
     catgtctgct agcgcctcat ccatgaagcg ctgcatgtcg gtgtcctcca tgtccgcttg     19560
     tgcagcaaga cgacactgac ggcggcattc ctcggcgaag tcaggccgcc gtgtgtccgg     19620
     cacccaaatt tgcaccggac gcagccctgc catgcgcagg gcgtcacggt gcttttgaac     19680
     tcgtgaattg acgtgtgcca tgttggcctc accgttacat gcaacaagtt tacgcctcat     19740
     ttttgttaca tgcaacaaaa gcgggacttt ctgtggttcc ggcttggtgc cccaagaagc     19800
     cgccgacacc gcgcaagccg cgccagttcc agtgactcta ctggtggtca gctcgatcgt     19860
     cgggctttgg gagccggtca tagcgcacga tgccgtcgtg cgtaatggtg aaacgcagat     19920
     cggaagcgac aaatgtctca gcagcaaggc cgccatagac ggaatcgcag acccataccg     19980
     ccatggccaa gctcatcatg gagcgttcca tctcacggtc gcgatccggc ttgttcgact     20040
     ggaacgcttt gaggatctcc gtgccgaaga acgtcacggc accggctgcc cagtccgcgc     20100
     cgtgctcccg tgccatgtcc tgccgagcct cggcggcgac ggtgagcatc aatgcattca     20160
     tcgagatcgc catgcggtgg gcgatctcgc cggcggtgtc gagtaggatg gttgtgactt     20220
     tcatgaggcc gccttgctgg atggattgtt gcatcacgcc gacgtcatct agattccgag     20280
     ggccgtgtcg gagccaaaga gccttgacta ttgctgcgag gtgctcgggc gttcggctgc     20340
     tgcgacccat tggtaaatgg tcgccatgtc ccgctctgct ttcttggccg cgtccatcgc     20400
     tcgcacgaca atatctgcca ttgctcgttg gcataggtca ttccgaatct tcgcaatgct     20460
     gccaacggac aactcggaga tcgcatgagc aaactggtgc aggcgcatga cggcttgccg     20520
     acaatccgct actgcctgat ccgaaacagg cgttctaccg cctagcacgg cgtccagttt     20580
     ccccgcttct tcccggatcg tgtcgccgct cttgcgccag aattcccgaa acggcttgat     20640
     cgcatcggat gactcttccc agaacgcttc gtacagttcg cgcttcctgc gcgcttcggc     20700
     aatttcctgt tcttcgttca tgtgtgctcc atcagtagct tgactggtat tgctgacctt     20760
     gttcccaacg gctttgccag tgcgcaatgt actggccggc taccgccgcg ttgttccaca     20820
     ccacaagcac gttctcgctg ttgcggcgag cggcggccat cgtgtaattg aagctcccgg     20880
     tttccacgtg caggccgtcg gccacgatgt atttgtcgtg gtggatcgga tagacgctga     20940
     ccgtgcgagt cgggatgccg gcatgcacca gcaggttgag cgcctgccgc gatgtgttcg     21000
     agcggctttc cacgagattg ttcttgtagt ccaccacgac agccacatcg acgccgcgct     21060
     tcttggcatc ggtcagggcg cgcacgacgg ccggcgacgt gaaggtgtag ccggccaagc     21120
     ggattgacgt ttttgctgca ccaatgacct tgagcaccaa cgcttctgcc cgaccgtccg     21180
     gcgagaaagc gacctcgaca gtctgcgaat ccggggcgct cgcaggctcg gcggccatcg     21240
     tgttgcgaac cttgtccaac aggccggccg tgaagctgtt gagccccgca agagaggcga     21300
     gggccaacag agccgcgcag acgatagatc gacgcattac cacccctgcc taccagcgca     21360
     cgcgctgctg ccacgtgttg tcgatgaaca cgtcgatggc tcgcggattc tgcgccggct     21420
     gccagatcac cttgtcgaaa acgtccacgg tgtcgctgct gtcgtagctg cctacggtgt     21480
     atgagccgac cgacttcccg acgcaggccc gcgcacccga gctatggccg tagtcgcttt     21540
     gcgactgaga cacttgcggc tgtccgctca gcgtgtacga gccgtcgccg ccccaccatc     21600
     ccggcttgtt ggtgcccgtt ttcttctgcc cctgcacgac ataggaaccg cgtgcggcag     21660
     gttgcaacgg ggccgggcaa gggtcatacg ggtcatagac ctgccgggcg tagctcgaac     21720
     catcattgcc gtccgcgaga tcgcacgtcg ggaacggccg ccccttgctg agatcgtggt     21780
     agagctgatc gatgggggga acgcattcgg acacgccctt cgggccgcca ttggacgcgg     21840
     gattggcaag gcacagcagc accttgcacc catattcgga ggcgtgcgcg gacacagcag     21900
     cagcaccgat aaacagcgcg actatcagtt tcttcatgcc ttcttctcct gagttagctt     21960
     tctcgcatgc gagaaaagcc ggtcaatgca cgaactgcac gaagggcgcg tcctgctgag     22020
     tgctgtttgc cgttgcccgt tgcaccggga cggcttgtgc ttggcgctgc gtctgcactc     22080
     gctcggcagg cgctgcggca acagccggcg cagcgcccgg cgttacgagc tggaccttga     22140
     cagccggctc cttggccgac gccgcatccg tgggtacgac cgactggccg ccctgcggcg     22200
     atccctccgc gaagatcacc cattggctcg acgtcgccgc ctgtttcgcc ggccctgccg     22260
     cgcggccagc agggcgaacg gccacggcac catcggagct ttcgggcttc acggccggca     22320
     caacggggat cggctgagcc gcccccgtcg cgttcgctac gaccttctgc acatagctcg     22380
     gctggccggc tttgtccgct cgaaaaccgc gcgtgaagtt gcccgagtag tagcaactga     22440
     acgcggcccg caaggcgtgc tgatcgtcac ccatctgcgc cttggcgcgc tggaagcagt     22500
     ctttgaggat cgcgctgccc gccttgagat tgcggcacgg ctcgaacacg gtctcgtagc     22560
     tctcgccgta cttggcgagg ttgtaccggt tgacctgtcc caagcccatc gagaaattga     22620
     agccctgccg atccagctcg cgcgccgtgg caaccgcttc agccaggcca cgcggctgat     22680
     gatcgaggcg gccgcccacc acgccgatcg cgtagggatt ccacgacgat tcggtgctca     22740
     ccacaccctt gagcgtgctc gggtgaacgt ccggggcgca ctcggcggcc aacttctcaa     22800
     acggcagcgg ctgtgccggc gtttgcgcac cagcgaacag cggcacaacg gccaacagcc     22860
     cggccgccat cgttatcacg tcacgcacct gcatagatga tctccgaaat gtagcgaccg     22920
     ttgcgctcgg tgtatttcca ctgcacaaca acgtcgattc gtcgcttgac gcgcgcgatg     22980
     acctgctcgc gcgtcatcga cgtgtgaccg tccatcaact cgccaaagcg gtcatacatt     23040
     tcggccggcg aatcggtgtg aatcgtcgtg agcgatccct tgtggcccgt gttgagcatg     23100
     ttcaagaact caaccgcttc cgggccgcga atctcgccca tgatgacccg gtcgggggtg     23160
     agtcgcatgc acgagcgaag caacgttgtg ggcgtcacgg cagcttgccc cgatgcctga     23220
     tggcgcgcgt aggaaaggcg cacgcagttt ggttgcgccg gctcgatttc ccgtgagtct     23280
     tcaatcgtga cgatgcgctc gtgcgcgggg atttcctgca ccaacgcatt gaggcacgtg     23340
     gtcttgccac agtacgtccc ggccgatatg acaatgttct tgtgggccaa cactgccccg     23400
     cgcaggaact ggtcccactc tttcgcgcga tacagctcca gcaagcgagc atcggaatac     23460
     ggctcatcgg tcacgtcgct attgacgaat cggaaagcgc cctgctcctt gtatttcggc     23520
     aggctcatgc gaaccagcga ttgcttacga atcgtcatcg cgatggtgcc ctccggtacg     23580
     acaggcggaa ggatcatttc agtgcggtac gttccgcgct cgaagtctgg aacgccgtca     23640
     tcgagattca ccggaatctc cgccgagagg atcggactct cccgatcaac gtccagactc     23700
     ttgaaagacg ccgtgacctc ggccagtgac gaaagcaact ggtatgtcag ccccggcact     23760
     tcaatttgct cggcgtagta cgcgtctttc tttcgcagcc acagctctcc cggcttgttg     23820
     acctgaatct cggtgacctg cttgtcatcg agatggtcgg ccagcaagga gagcttggta     23880
     cggaaggagg caatctgcga catggctcgg ccctcacggg atgaacgtca cgccgtcgcc     23940
     gtgcttggct gcgtcgatgt catccttgta gatcggtgtg aaatcgaggt ctttgttcac     24000
     gtagatgcga acgcgcgagc cggccggcac ggtgatggtc ggcgggatat tgatgtacgg     24060
     ctgtagcacc gactgcgagg tttgcgcggc tgcctgttgc accgattgcc gataggcggc     24120
     ggtcgagttg tactgatcgc ccgaactcac gccggcgttc gacgcgccgg caccgatgat     24180
     cgacagcagc gcggacatgc cgaaaatctc ggcaaaatgc gtgtccacga tgccgcccat     24240
     gccggccgtg ccgagctggt ccgcgcccgc gctatccagc gccacttgca cgccatccgg     24300
     ccggcgcacc gtgttccaga tcacgaacag ccggtcttgc cccttgcgca cttcggcgct     24360
     gtacacgccg cacacccgcg aaccccacgg aatcagcttg ttccggtctt gctcgccgta     24420
     cacgtcgcgc tgcacggtcg cgcacaccat gccgggcaga tcggagatcg cccgcggttc     24480
     aagcacggcc tcgatgagct tgccctgcaa gaccttgtag ggcaggttgt cgatttgatt     24540
     tgccttgctg accgccacgc cattgccaga cacggcccgc gcaaaacgcg aattcgggtc     24600
     ttgtgcgcca cgctcgccgc taccgccgcc gagcgcgccg gcattcgatg gcccttggtc     24660
     gccgctatcg cccaccggct gcgcagacgc tgccgcctgg ttgtttgagt tcggcgggat     24720
     gatggccgac ttcatgcggg cttcgagtat ccgccgctct tgttcccgcc gctgcatttc     24780
     catctgttcg cgttgggcct tcatcgggtc atcggcttgc gccgcgctcg caggcgttgc     24840
     ggccggcgcg gaagtcacag ccggcacgct ggccggttcc tggtccttga gcttgggcac     24900
     cggcttacgc tcgggaatgc tcagttcgct gttgcccgcc ggcttcgccg gctcgctacc     24960
     gtcgtgcttc atgtaccaga cagcaccgag ggctgccgcc gcgatggcag caatcgcgat     25020
     accgctcatc ttcttcttgc gatcatcggc caccaacgag gcatttgcct gcttttccca     25080
     cgcttggacc gccgcctcgc ggtcatcctg cggcttgttg gtctgatcgc tcatatcagt     25140
     tgcccccgcc agtgctcacc aggccactca cagcgcgctt gtagggattg gcgttgttct     25200
     gcacgcagag gtgagcgttg ccattgcgca gcgtgaacag gcttgccgtg cgttcaacca     25260
     ccaggtattg cccctcgcgt cgcgtgttga cgatggtctc tgtgccgtcc gggccaacgg     25320
     tgtacaccga agggatttct gcgttctggt cgaacatgaa ataggtgaac tggccatcat     25380
     cgaaagcgcg cttcaacggg atggccgtct tgtttcccga cgtgccgtag ccaaggttga     25440
     gcttggccgg atcgaacccg ttgctcatgc gctgcgcgct gcccgcgccg gcgtatgtct     25500
     tcacgttcga gttcggatag acgaagcgga ccaggaacgt catcgccgct tggctcttgg     25560
     agctagtcag cttgaagtag tacgtgcgct tatcggtaat cacggtcagg tttgtggctg     25620
     cgttcggctc caccggcttg aggaaaaggc ggttctggta cggcacggtt tgccatgcaa     25680
     tcgaatcgcc caacgtcacg accttgaccg tttcgtcatt ggcgaactcg atggaggtct     25740
     ggtagccata cgtgccaacg atctcgtaga cctgattcgg gtcatacggc acttgtttga     25800
     cgcgatcatc cgtcaccaac gcatgcggcg acttcgccgc gtgggccggc accgaggcca     25860
     gcgaaatcga cgtgccagca atgagggcaa cagcgagagc aatagggttg aatttcatgg     25920
     tctgtttcct tgtacaagtc ggttactggc ggctcagctc ttggtccttg cggtaggccg     25980
     ttgtggcgta gccaagcgcg ttttcccagc ggtcgccaag tgcaaggggt ttgaacgtga     26040
     aggtgtagcg gacgagcgcg gtgtagtagt cggtcttcgg cgggctcccc gccttctccg     26100
     taatcgactg gaacgacacc tgatacgcat ccttgccgag cgacgtaatg cccgtgatct     26160
     tcgggtagcg ccgaccgccc tgcccgagct ggtaatacgg gttgttcggg ttgtcggggc     26220
     tggtttccgc gtcgtactgg cctgccaccg cttgcgttga gtgcagccgg cagaggtcag     26280
     caaaccgctg ccgccagtcc gggtcgaacg tgttgcagta catgatgaag tcgtacacct     26340
     gactctgaac gaagctttcc tgccccgtga tcgtttcctt gttcaccacc tgctgtttca     26400
     ccacatggcc gttcgcgtcg atgaccgaca ccacgggaat gaccgtgtga acgttggcga     26460
     gcaccgtgac cgcactcgcc atgccgccga cgacgaacag cagcaacccg atgagcagat     26520
     acgcgcggtt gcgttcttgc ttgagcttgt tcgagccgcc caattgggcc gcctgcgtct     26580
     cgttgtcgcc tttaaacgtc cctttcccga aattcatttg attgctcctt tggtgaacat     26640
     ccggcccacc atcatcaaca acgacacgcc ctgcaccgat gcaccgcccg cgagtgcggc     26700
     ggcccaacct ttgacttgca gcatgaaaat gatcaagacg ccttcgacga tgtagaggta     26760
     ggcaacttgc tggacgttaa tacgcgccgc atcggtcaca ctcgccgctt tgccggcctc     26820
     atcaatcgca tcgccaaacg caaggaagcc aaagcgaacg atggcgatga ccaagatgta     26880
     aatgaagcaa aaattcagca tcttgctcag ccagttcatg gcccactgcc gcgtttgctc     26940
     gaagaaaaaa aagccgacga agataggcag caggaccatc gttatagcca agccgaactt     27000
     ggcaatggtc atatagacga gggcgagaat gaacaggatg cagttgatga ggaagaggcc     27060
     aaagccctgc aagatcatgc cgaactgata ccagctcacg ttctgcatta aggccgacac     27120
     ctgaccaacg ttgttataca aagcgtctag catcgaaggc gtggactgtc cggccatgat     27180
     cgttgacgct gcgccttcca tgaacgacgt gaaaaatcca tagatgctct ggcctaaacc     27240
     gccccaattc aaggccgaga acacggccgt tgtcatgaag gctttcgaga gcaccgcgtt     27300
     ccatttcatc ggctcgtatc cggcatatat cttgtagccg tatatcgccc aatacagcac     27360
     cgccaccaaa tagatcggcg tggaaatcgc gtttgcaaga gctggataga tttgtgtcag     27420
     gaacgaggtg gtaacgccgt cggcagaccc aatcattccc tcaatggtca gtgtcgccat     27480
     tggttgtcat ccccataaac gtgcttgaaa tgcgccaaca cgtcgggtga tttaatgtcc     27540
     gcctctgtaa gcgtgacgcc ggtatcggcc ttgacctgtt gaatcacttt gacaacgcag     27600
     ctcggaatta accgcccgcc gaacgatgga tctttgttgt acagctcggc aaagcagtgg     27660
     ccggggaacc agcgcgcaac ggccaccttg tccgcagtca gaaggggatt cccaccgttc     27720
     tgcgtctcga cggaaggtga tggcgtcggc attccttgct gcggtactgg catcggtatg     27780
     atcggctcgc gactcatgat cttaagcagg ccgtaaccac cgatgagcac aacggccgtg     27840
     cccatcaaaa tccatgtcca gagggcctta ggcatttgct ttgctcccat agttaccggt     27900
     gttgagttgc ttgaagtcgc acgcacacgg cgacttgtcg gacttgttcg acgtagttgc     27960
     gcagccggcc agaaccgccc caaggaccaa cacggcgaaa agacgaatgc cctttttcat     28020
     cagccacaac ggaacccatg ccggtgcggt aacaactttc aaaaacatga ggacctgttt     28080
     catttggttg cttcctttgt cggtggactg gtttctcgca tgcgagaaag cggttatttc     28140
     ttccactggt agaagttctg gtttgcggcc gtggcttggt tctgctggtt caccatgttg     28200
     gcttgtaggt tcatgttcat cgcgttcagc ttcgccatcg cgctttgcat catcccgttc     28260
     tcgcccgcaa tgcggttctg caagtcctga gcgtccttga tgttcaccgt cgtatcgacc     28320
     tgctggctca tgcgcgccag attgttgagg tgcgtctgca cttcggcata caacgagtcg     28380
     ccaccggcca acgcagcccg cacggcatcg gtactcatct tgtacgtcgt ggcgttctgg     28440
     gcctgcggat tggcgaacag gtcttgcggc atcgtgttga tgagcttctc gtaggcggcc     28500
     tgcttcgacc cgaacgcccc actctgttgc tgagcaacga cttcctgcca cgaaccaggc     28560
     accaccgagg ccgagctgat ggaatcgctc aggcccattt gcccacggcc atagctgccc     28620
     gtgacggcgg cgtactgatc cttgagggtt ttgtattgct cctgcaactg ctgaaactgc     28680
     tgttgcaact ggagcaccgt tgccatatcg aaggtcggga tgggggttcg gggagcaatg     28740
     gaacagggaa gtcagttaag ccggtatcaa tgaaatgtcg gagcgctggt agcacagcaa     28800
     tgcttgtact tccgcccact gccacatggg cactgatcat ttctcccaat cttaggacct     28860
     tgtctgcgta aaggcccttg ggttgccaat tggcgatgtg aggcaaagta gcgatagatg     28920
     tgcgtcagtc cggcaatcag ggactgaagc aactcatcgc gtttgtccgg cgcaatctct     28980
     ggcgggcgca tggcgggatc aggatcatgt tcatgggtca agatcatgat tggcagcatg     29040
     ggcccgccaa attcttcgct gccgatcaac tcttgccaac tattgggccg taattgaatg     29100
     ccgcgcatga aaccacgtgc ccagtcgtta ccgtgtacgg ccccatccgc atcttcgagt     29160
     agcacgggaa ggtagacatc gtctttctcc agagtgcgga acaattctga tgcaatcgtg     29220
     ttccagtgcc gcatgaccaa gccaagaatt tcggcggctt ggtcattgct gtcgaagcaa     29280
     tggtcttccc cgaatacttg tggcaagtat tcgctgggca aaaccgtttc tggaccacaa     29340
     atgagtgcgg caaagaaccc atcgagcatt tcgagattca ttgcaggtgc gccgactcct     29400
     tcgagaaagt cgcccagccg atcaagctgg gcatcgttca acggttgttg cgtcatttgt     29460
     tgcatggtga atttccaagg tttttaagga tcattcggtt tggtcaacgg tctcagctcg     29520
     ccgcgcgcga cagcttccgg caccgagaac gaatagcgtc cgagcatgtt gatgtgctcg     29580
     tggccgaacg gcgacagccg tgcctcgtct tctggcttca cggggtagcc ttcgctgcgc     29640
     aactgcgtca gcaccgcatc catgtacagc gtgttccaaa gcacgatcat gttcacgacc     29700
     aggccgagcg cgctcaactg gtcttcctgc ccttcgcggt agcgctggaa cagctcgccg     29760
     cgcttgccgt ggaaaacctc gcgcgccagg ctgtggcggc cttcaccgag attcagttgc     29820
     agcagcgtgg cgcgacggcg ggcttcgtcg tcgatgaaat tcaacgtgtg gatggtcttg     29880
     tcgatacggc cgatttcggc gatggcttgc gccaggctgg tgggccgttc atcgacctgt     29940
     aaggtgcgca tgatgcccat cgccggaacc agaccgagct tgagcgagcc gaccagacgc     30000
     agcacatcat cccaatgcgg ggtgatacgg tcgagattca cacgctgccg ggccagcgca     30060
     ttgaggtcgc catagtcggc gtcgggatcg acgcgccaga aacgggtacc gccaacatcg     30120
     gccaggcgcg ggcagaatcg atagttggag aggcggaaca aaccgaacac caaatcgctg     30180
     tacgcgccgg tgtcggtcat gatctgggtc ggctgcaact ccgtttgctg ctccagcaca     30240
     accgctagca aaatcaaact gtcgcgcagc gtgccaggca cagtgatcgc gttcagtccg     30300
     gtgcgctgat cggaaagcaa gttgtaccaa gtgacgccgc gcccgcgatt gaaatacttt     30360
     gggttcggtc cagcgtggat cgtgcgcacc ggcaccacga atcgcatgcc gtcggccgaa     30420
     gccacatcgc cacctcccca ggttcgcgcc agtgcgatac gactttgcgc ggccaccagc     30480
     acggcattgc aggctgtcag cgtgtcgtca cgcacatagt tctgatcgac ccacatcagc     30540
     cggtcgcgct tgagcgccgg agtgtctggc cgcaccagtg gttccgggcc ggtgttgcag     30600
     gcttcggcca tcagcaccgc gcacaggctg gtggtcaggt cggccgcgcg cgcggtgcgt     30660
     tcagtcaggt gcgtgaacgc ttccatgcag ccagtacgac cggcgacttc cagcaggatt     30720
     tccggaagat cgacgcgcgg catgcgcgcc ttgatttcgt tgcgcagcgc gatcaatgaa     30780
     ggcggctcct ccaatgcttc aagcggactg agcaccagtt ccgtcttgtc gccaacgttc     30840
     tcgaagcgca ctgcgtcgtt ctggggcagg cgcgcggcga cgcggcggta ggtttcgtcc     30900
     agctcgcgcg tcagctcgga caacgtggcc tcgggctgcg ccgacaggct cagcgagcgg     30960
     cagacgatag gccgcgaggc ctcccattca gctccggcca gcagcccggc gcgtggatcg     31020
     gcgtagcgcc aactcgggct gatgaacacg tcgcggcggc gaatcgcact gcgcagcttg     31080
     tcgagcgcgc agaacgaata ggctgtggca ttgatgcggc catcatcctg aacgacatgg     31140
     cgttgccacg ccttgccgac gatggccgtg ggcggatcat ggtcgggctt ctcatgcagc     31200
     cattgcaacg cctgcgccaa aggttgcgcg gccggattgg cgtcaaagcg gatgacgcgc     31260
     agcaacgccg gcaggaagcg cgagacggtg gccttgcggg cttccagttc ggtgtagaac     31320
     acatcgttgg gcgggcgcac cagaccgcgc acttcattga gcgcctgggc cagttcatcg     31380
     tggccgatgg cggcatagac gcgctcgcgc agttcgccgt ccggcagggc cggatcgagc     31440
     agcatccggc atgcctcggc cagcgtcgag gcggcccgat ccagatcctt gagggagcgc     31500
     tgcctgacct tacgatcttc tttctcagcc ttggtgaaca gctcgcgcag cagcaggtcg     31560
     agcacatcga tggcatcgtc ttgcgcgctg gcttccaggc agtggacgaa ggccactagc     31620
     gtggcgatgc gtcgcacctc cggcaatcga gccacggcgg ataccttggc agtactggcg     31680
     aagcgggcca gcgctgcgat gcggctcggc ggcacatggg tgcctggcag cttaatgccc     31740
     aagccacgca cggtttcgat tcgcagcaag gccgcaacga gcgccggagc gctgacgcgt     31800
     accggcccct tgcgcaatcg atccagccaa gactgccggc tgccttcgac aagcttgagc     31860
     aagtcatcga ggcgttgtcg ctgctcgggt gtcacgccgt gcaccagtag tcgccacaga     31920
     cgcgactcca tgcgtgagcg tatctcggcg ataaagcgct ccagcaaggt gacgccgggt     31980
     agcagcacct tgtggccgac cagccagccg ttggcgtagt cgaacagcgc actcgggcgg     32040
     tcagtgcccg tccagcacaa cgcgcacaac cagcggccaa ggcggaactg gacgccggta     32100
     cccgtgaact cgcggtagcc atagcgggtg cgaatctcgc tcgtgtgctg ccagcgctgc     32160
     cgagttgtcc ggtagtcaat gacgcaatcg gaagggtcgg cgatgccaag ttgcgacgac     32220
     agcgtatgca gcaccgggct tggcacggcg gtagggtctt ccagaaaggt gccgagaaac     32280
     cgcgccgtgg tcagttgcag cgcataaccg aggcgactgc tgtcgcgtcg cttggtggcg     32340
     atccactcgc ggtcatcgtc gtccaggtgg aaatagcgcg ccagctcttc gctggaaagc     32400
     gtgtctggat agcggccgta gcgttcccgt tgtgtggtgg acaggaagct gaccggcatg     32460
     gcgtcaaagc gcctcggcgc agaaggtgac tggcgtgacg atgcgcgtgc ggccaatgct     32520
     accgcgttgc agcagcccag cgcggcggtc gccagtcaca aggtaatcgg cctcgctggc     32580
     cagtgccatc gccagcagga acgcatcgtt cggatcattg acctcgatgc gatcaggcag     32640
     aggcggcaat acatgcagca caacggcgcg ctgcatgttg ttgatcatcg tgccgacgcg     32700
     atgcgcgggc aggattgcct tgatcttcgg gtaacggctc acgcggcgca gttcatcaag     32760
     ctgcgccgtc cctgtcacca gttcaaagcg tgctgcaagc caaccgcgat agatgatgtc     32820
     gggtgggctg tgcgacgaga tcagcgcggc cagcaatacg ttggtgtcga ggacgacccg     32880
     cattaatgct cacgcgccca ttgcaccgcc tcatcaatga ggtcgttcag ttctgtctca     32940
     cccataccca ccgtagcggc tttggcttgt tccacagccc gctcgaagag gtaggcgcgc     33000
     accgcatcct cgatgaagcg tgacaggtcg cccttgcgac cgccgccttg cgcggcgatg     33060
     aacatgcgga cggactgatc cacgtccggc gatacggcga tgttccagcg cacggtattc     33120
     atgaagctct ctccaatcag agtttatgca catcggtgtt tatacactct ttaagcggtt     33180
     tttttttgca acggttcaat aaaacgatcg tttttatgaa ctctgatggg gcgatcggcg     33240
     cgaggtgtcc gtaagccaac aagcagtctg taatagtggt ttgtacaatc aaagtttgat     33300
     attattaaaa cttaacgagt aaagcaaaat attacgatga aaatcggcta tgcgcgcgta     33360
     tccacgcgcg aacagaaccc agccttgcag gtggactccc tcaaggcggc cggctgcgag     33420
     cgcatttatc aggacgttgc gagcggcgcg aagaccgcgc gcccagcgct cgatgaactg     33480
     ctgggccagt tgcgtggcgg cgacgtgctg gtgatctgga aactcgaccg catgggacgc     33540
     tcactcaagc acctggttga gttggtgggt agcctgatgg aacgcaaggt cgggctgctc     33600
     agcctgaatg accccatcga caccaccagc gcccaagggc ggttcgtgtt caacctgttc     33660
     gccacgctgg ccgagttcga gcgcgagcta attcgcgagc gcacccaggc cgggctgacg     33720
     gccgcgcggg cgcgtggcag ggtcggtggg cgacccaagg gcctgtcgcc gcaggccgaa     33780
     gcgacagcgc tggcggccga gaccctatac cgcgagcgca agctgtcggt cgctgccatt     33840
     gcgcagaaac tgcacttgtc caagagcacg ctgtacagct acctgcggca tcgcggcgta     33900
     gagatcggcc cgtacaaaca atcggcgcag tcgccgataa acgtctccgt ggtcgagagc     33960
     ggaaacgctg accagccgaa ggtcgccacc atcctgctga ccttgcgcat cgagaacaat     34020
     agcaagttcg tgcgcggaaa gaagcgctcg atcgagcatg tcgagttttt tgatcttgcc     34080
     caatacgatg ccacgcggcg gccgaacggg gaatatgaac tgaaggtgcc ctatgacacg     34140
     gatgaagagc tggatgaagc cgtgaacgat ttgctaaccg acatcgcctg cggtgcggat     34200
     gaccgccact gtttctcaga gagccacgcc cgcatggaag gtacagaccg gcactggtga     34260
     aggcttaact gacttccctg ttccattgct ccccgaaccc cggatgccgg tagcgaaggt     34320
     gggcaccgat gcgccgaggg aagcggccag cgcgagggcg acgagggtct ttttcatggt     34380
     catgctcctt tctgcttgag gttgtgcgtg ttcttggcaa gtgcacgctc cataaacacc     34440
     ggcacccact gttcgggatc gtcggtttcc agctcacgaa tgatttcgtc catgagcgcc     34500
     acacccttgt cgttggagga cagcacaggg atgaacgcgg gcatatcgga gagatcgaac     34560
     ttcgccttga tcgactcgtt accgcgccga atcaggaacg tccggttctc gggaggggtg     34620
     tcacgcacga actcgtactc acccggcgtt aggccgagca cgtcaacaag gtcagtacgg     34680
     ttggcttcgc cgttcggcaa atagatcttc gttgccgtct gcttctggat cgagtccgtt     34740
     tcgcagtaga ggtacttggc atccggcgtg acaaagacca gcagaccgtt cttgcggcga     34800
     atctgcatga tgtaactgtc gatcttttcg cgccaatacg cgtgcttgac gaggttctgc     34860
     ccttcttcca gcacgaggat gaacggctcg ccgttcatcg actgctcgat gcgatggaag     34920
     gggtagctca gcacgaccgg cagctcaggc cgagccgagc cgtccttgat gagctgccgc     34980
     atctcgtagc agtagtgccg gcacttggtc aggtcgatgt tgtcgtgcgc gttgtcgaac     35040
     acgccccagt tcgcgccctc gatgccgttg gctccgtgcc atacccgcat gtccttcgcc     35100
     aactcgcctt ggccgaagca ccacgccacg ttgcgcaggc ggcgatctgg ataggccagc     35160
     gcgtagttct cgtggacagc cttcttgaag cgatcaatgt catcgggcac gagcttgccg     35220
     ccgtagcatg tgcgcatgag cgtgagcagc tcgaccagat aggcgcggtt ctccggcgta     35280
     tcgggcaact tcatcggatt ccagcccgta ttgccctgca cggtcagcgt cgtgtgctgg     35340
     ccgcccattg cacgcatgaa cacctttgcg ccttcgcggt tatcaaacca gaacacacgc     35400
     ggacgggcct tgtcggccat cgcaatgaac gcggccagca aggttgtctt acctccaccg     35460
     gtgtccgctg tgagcgccaa atgaccggcg accatccctt ccatttcgcg atggaagttg     35520
     aagtagtagg ccgttccgct ttctgtctcg aaaggcatga tggccggccc ccacaggttg     35580
     ccgtcgatct tgccgactgc gaagttgtgc aacgaggcga agccggcgaa attgcccgac     35640
     ttgatcttgc cgcgccggcc catgaagtgc tgcgcctgac cgggaagctg cgcccaaaag     35700
     aacgtctcca ccgcgaacca ctctcgcacc ggcttgacgc cgagattcac gaacgctttc     35760
     ttgagcagcc cgaccgcacc gtcgagatcg gcaatcgtct gccgcttgtt ctcgatagga     35820
     tcggcaaatt gcgtcgtggc cggcacatgc acgagcatgg tcaggtgatg cagaccattg     35880
     accgagcgac cgcgcgtcaa gtcttgcagg cccttggtaa tctcgtcctt gtcctcttcc     35940
     gccacgccct cacggtcatt gaccgcgata cgccggcgct cctgccgcat gtcgtgctcg     36000
     gcgctgatcc ggtcggtaaa gaagaacgac tgcgtgatga tgtactcgac cggctgcttg     36060
     agaaattcgt caagcatccg cgacggcgtg cgagccggcc actcggccat gctcagcatg     36120
     gccccggccc gcgtgccgct caggttctgg acggccatca tgttgctgag catcttgaag     36180
     tcgagggacg acaccgcgag cgtgcggtcg agctgcatct ccgtgaccgg cacgcgttca     36240
     tcttccagat tgaccaggta gtgcaggaaa ccaccgatct cggtgaaatc ctcaccgaga     36300
     tagtcgagca cttcatcgcg gcgatacacg tcgtgatgac cgtgggagcg ctggaactct     36360
     tgccagctca tcttgaatcg ctcgacggca agctgcgcat cagcacggct taccctatcg     36420
     agaacgaatt ccggccgccg ctggatgcgc agcttacgag caccgtagcc cgacaaggtt     36480
     tgaacgacga ggttagcggc ttcgttgacg tcttttgcct gttcctcgaa cgattcaagg     36540
     tcttctttcg tgaccttgga gcctgacagc aatgaaaacg cgcgatccag gatgccgggc     36600
     gcaccttgtc ggaagcggtt gcggacgatg gagatgtaga tttcgttcac atagaacgag     36660
     cgcttgttat agcgctcgcg ccacgcctga ttgaagcgcc gcgcgaacca tgtgccgccc     36720
     tctcctgccg gatacaggtt caccttgcgg cggatcaggt ggacatagac gccccggtcg     36780
     ctgttggcga tggagcgcaa caccgtgttg cgccggcgct cgaactgctt gatttgctcg     36840
     gcagtcaacg actcgaagta caggccgtcg agcttgataa cctgcaccag accgtcatcc     36900
     ttggtgatga ccgattcgtc gtcgtagtga acggtgtacg ggatcatgtc gcttaaggcc     36960
     atttccttgg cgtcggcggc ggcaccttcc ggcaccggca tcgacagcga catgtcgaac     37020
     ttctctttta aaacctcaac gaggcgcata gcgtcggcat ccccaaaaac gtttattcgg     37080
     acacgttttt aaatgggttg cggccgacat gatgtcgaac aggtacacgt ctttcaggca     37140
     gaccagataa ctgatcagca gtaagaccgg aatcaatacc gccgcccaaa gtgatcgcgt     37200
     gattaacgcg gccatgccgg ggaaatagaa gctcatcgca agactggcca gggtcaaccc     37260
     gcccaccatc gtggggcggg tcatcgcagc gacgagcgat tccccttcat cgtggaattg     37320
     ctcctcggca ctcattggat cgaaccggag gaacgcgcct tgaggtcgga aacgatgttc     37380
     ggcgcgaaga acacaaggcc gataccgagc ccccaaccgc cgagcgtcat caggtcgatg     37440
     cggcccgact tccaacgata cccttggatc gccaaggtga tgatgccgat gtagtagccc     37500
     cactcataaa tgagcaattg cgtgatcgac ttcaggaagg cggtgatccc gccaaacgtg     37560
     ccaccggcgt cttgtgcata tgcgagctgc ggaagaaaga cgagggccat cacgagggcg     37620
     ttcgcggtca gaccgagtgc cttgtctacc ttgtcgccct tgcgcgggcc tactgccgtg     37680
     tccttttcaa tcgcttcgtt cttttccatt ctgaaacctc tcagattgtt aggtgtgcta     37740
     cggggcaaaa actacgaaca cggtctttgt gtgcgggcag ctctccttga tgaaatccac     37800
     agctatgtcc aagcgtttcc agagcttggt tttaccaagc gcggtaacga cctcataagc     37860
     tttgttgtgc gtgggtaact tcaccgtcat ccgccaccac cggctgctct cgtgctccgc     37920
     ctcaaccaga taaaccgcat agtccggttg agcctcatcg agcaccgcca gctctttctt     37980
     ggtcagggtg agcattgctt cctcatcgtt gaaaaacaaa gagggaagta atgccacggt     38040
     cacgttcagc tttccacgct tgggagcggg atagagccga ggaaagcggg ggggaatctc     38100
     tgtgtgcgag aacaaa                                                     38116
//

If you have problems or comments...

PBIL Back to PBIL home page