(data stored in SCRATCH zone)

EMBL: AM039951

ID   AM039951; SV 1; circular; genomic DNA; STD; PRO; 182572 BP.
XX
AC   AM039951;
XX
PR   Project:PRJNA13649;
XX
DT   20-OCT-2005 (Rel. 85, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Xanthomonas campestris pv. vesicatoria plasmid pXCV183, complete genome
XX
KW   complete genome.
XX
OS   Xanthomonas euvesicatoria
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Xanthomonas.
OG   Plasmid pXCV183
XX
RN   [1]
RP   1-182572
RA   Thieme F.;
RT   ;
RL   Submitted (16-JUN-2005) to the INSDC.
RL   Thieme F., Institut fuer genetik, Martin-Luther-Universitaet, Weinbergweg
RL   10, 06120 Halle/Saale, GERMANY.
XX
RN   [2]
RX   DOI; 10.1128/JB.187.21.7254-7266.2005.
RX   PUBMED; 16237009.
RA   Thieme F., Koebnik R., Bekel T., Berger C., Boch J., Buettner D.,
RA   Caldana C., Gaigalat L., Goesmann A., Kay S., Kirchner O., Lanz C.,
RA   Linke B., McHardy A.C., Meyer F., Mittenhuber G., Nies D.H.,
RA   Niesbach-Kloesgen U., Patschkowski T., Rueckert C., Rupp O., Schneicker S.,
RA   Schuster S.C., Vorhoelter F.J., Weber E., Puehler A., Bonas U., Bartels D.,
RA   Kaiser O.;
RT   "Insights into genome plasticity and pathogenicity of the plant pathogenic
RT   bacterium Xanthomonas campestris pv. vesicatoria revealed by the complete
RT   genome sequence";
RL   J. Bacteriol. 187(21):7254-7266(2005).
XX
DR   MD5; e557b353bd440dacf294759338030d74.
DR   BioSample; SAMEA3138194.
DR   EnsemblGenomes-Gn; EBG00001206921.
DR   EnsemblGenomes-Gn; EBG00001206922.
DR   EnsemblGenomes-Gn; EBG00001206923.
DR   EnsemblGenomes-Gn; XCVd_tRNA01.
DR   EnsemblGenomes-Tr; EBT00001776573.
DR   EnsemblGenomes-Tr; EBT00001776574.
DR   EnsemblGenomes-Tr; EBT00001776575.
DR   EnsemblGenomes-Tr; XCVd_tRNA01-1.
DR   EuropePMC; PMC1272972; 16237009.
DR   EuropePMC; PMC2246292; 17927820.
DR   EuropePMC; PMC2289816; 18307761.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF02234; sX15.
DR   RFAM; RF02239; asX6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..182572
FT                   /organism="Xanthomonas euvesicatoria"
FT                   /plasmid="pXCV183"
FT                   /strain="85-10"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:456327"
FT   CDS_pept        456..1748
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="XCVd0001"
FT                   /product="Replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19813"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19813.1"
FT                   /translation="MSTTAEQSPTPSIGADYLVQLGDRIGQMVMRAKDFSHPSKLSPEQ
FT                   GESRRLSLREIADSIGVSHSTVNRVAANMMGPDAAGGTESPKSTGRTGYRYSLAEAVAL
FT                   RKAIAELPEIRKKAKLDRRRGAGEPCVTLGIMNFKGGVAKSTTTAHAGAYLSLHGYRTL
FT                   VIDTDPQATLSTLFGIHPDIELSVEDTLLPYFEGSETSLDYCIRKTEIPTLDVIPSNVG
FT                   LASADLVLPSRQRDMRQAGDLSWFYMKVLAEGIATIEKDYDVILIDCPPSMSYLTTVAT
FT                   QACDALLVPMRPSMPDFASSAQFIRMFGGFQREVDEVVGNAKEFDWIQVLITLGENNNA
FT                   SAEMEAIIRKAYGDLVMGEKFPYLTAVARAAKAMRTIYDVARADTDTRQLSKAMNIVNQ
FT                   LCQSIEARLLLTRARLTAQSNGNQGETEEAV"
FT   CDS_pept        1745..2743
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="XCVd0002"
FT                   /product="Replication protein B"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19814"
FT                   /db_xref="GOA:Q3C0A2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19814.1"
FT                   /translation="MSKQKARSAALLGAMDGEGFPPLAHGAGSGSARPDSSVPALGMVS
FT                   ELARDELRLARERVAQLQGQLDAVAAAGSVQLVDPAKITHTQYRDRDELGFRDEKYEEL
FT                   KEDIRRKGRNEQPILLRPARAENVAAGFEFEVVWGHRRHRVTSELGIPVEAIVRDVTDR
FT                   EAVLLMSSENARREGLSQYEQARKYRTWLKAGLFENMVAIAEAEGVHKATISRIMSIND
FT                   LPDEVFVALKDPRKVTGLFAAKFLQAAETNEEAVESLKDLEKKLTPGELLKKVAPVGPK
FT                   MDPIEFKAGERRIFEAVPVAAEGGTKFSELRLHIELDQDKLRRLAEFAASL"
FT   CDS_pept        complement(3543..4424)
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="XCVd0003"
FT                   /product="Chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19815"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19815.1"
FT                   /translation="MSRGNIEAAGMSCDTAQSLPRDNTMARKIRSAQLTAHRPDRVDYD
FT                   PGTPRLLQSAEGARYRLLAGPAPALPDDLVGGLVLTDAETIAAAARLGTTSPAELTVIE
FT                   KIQLAIALADDVKATALCLLLGERNHPEVWRWTALKRAAQELRGAVLSGSLTRGHARPL
FT                   LPLPSQLQAEWTRRALRGRWSVRTLTSMVAREGKAGTPATPSPAAADTKHLEDQLSQRL
FT                   GSPVRLEWPEAPGTRSLIIGYSDMETLKGVLQELARGPEGTGHLGNAMRSLRIELADAD
FT                   ELDALTGHLLSE"
FT   CDS_pept        complement(4890..6344)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19816"
FT                   /db_xref="GOA:Q3C0A0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19816.1"
FT                   /translation="MYLCAAWLPPGSGLAWCYRAQTSPLMGSHPASDGDGSFFVSVRPA
FT                   PRGRQNAPSVVQAAAIRWRLDWRSQERYHAGYFLCGNVGSELIALPPNRVMTTSTRTEE
FT                   TEAQYRRRVEDLRKRVARIRGQNPADLLPMDLVDDLLGRGHGSEQAATDALAAFKRHRK
FT                   QSSAGERKSGVRMQGSAAEAAAAGVISKATFRQYKAALRAVFQADLETAPTRYDTELLS
FT                   AAIERLDSTPQTGYARKGRAGSALKSKSFKASELALVLREVHKGISESRHSWAVGLKTF
FT                   LEANSLVGLRPCEWAEASIRSGDDGMTVMVVRNAKTTNDRGNGSHRTLLLDDLTTQELG
FT                   ALHEMVELVDRVQSGQILDANGKAVSFDELLKHMRDYLRRLTRQIFPATGNRQHWPTLY
FT                   SLRHQVCADAKQSSTGSAESLRFVAALMGHKTDATATLHYGKRRGGSKGLRVRPSSENV
FT                   ATVEHRDPLSKFSPARDAPRRTKPSR"
FT   CDS_pept        6587..7081
FT                   /transl_table=11
FT                   /gene="dotD"
FT                   /locus_tag="XCVd0005"
FT                   /product="putative DotD-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19817"
FT                   /db_xref="InterPro:IPR031817"
FT                   /db_xref="InterPro:IPR038140"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C099"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19817.1"
FT                   /translation="MRRYQAVLLATCAALSAGCATTRSAGPSASDPAQENLTAAASAIQ
FT                   QSLRDLSEAEQYDKMRAVPGTPRLRTQIPGLERMVTMPWNGPLEPAVMRLAAEGGYEFK
FT                   LLGRQPAVGIVVQVGPEPATISDHLRNLGIQAGTRADIAIEPTAGGRRGIIAIEYSNGG
FT                   L"
FT   sig_peptide     6587..6661
FT                   /gene="dotD"
FT                   /locus_tag="XCVd0005"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        7068..7847
FT                   /transl_table=11
FT                   /gene="dotC"
FT                   /locus_tag="XCVd0006"
FT                   /product="putative DotC-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19818"
FT                   /db_xref="InterPro:IPR031618"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C098"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19818.1"
FT                   /translation="MAVSDAPPNLDQALGAFERNGAEVRVIDAVGELRASAIREDGLSY
FT                   GVRAGLARRSFEIQQLLAKQAPQLDRAFDFGSLLMDRNVLPPVLTEASQVVHSEGTDVL
FT                   RVTDKIYAIARQAQFVTAAPTWRSYVVTEATFSYDPPEPYMAPKSGDERTVWKQAVTTG
FT                   WKAGEQQADQILTESLNRLKRDYQGMLLYRRLLQQGVVSKPYVAEANYGITGDGDKVNI
FT                   NERMLRITALPKMQPHTQWKPIAVPAKPIQPTVRVNP"
FT   CDS_pept        7844..9040
FT                   /transl_table=11
FT                   /gene="dotB"
FT                   /locus_tag="XCVd0007"
FT                   /product="putative DotB-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19819"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C097"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19819.1"
FT                   /translation="MNAVLSDQSLIERALLRSEPTVFDEIGVQQLLVHAKAMGASDVYI
FT                   KTNARVTARIHGRLYRLTRRTLYATEVGSIAGYLYGGPNAEVQLKRGMDLDNAYTFRLN
FT                   RSDSLRFRWNATGAEIDGSFGISIILRELPEIPPAIDKEDLGDDLYGALYPDDGIVMVC
FT                   GPTGSGKSTLLAGMIRDIAENPDSHCHIITYESPVEFVYDKVEKPTTEIESTSIPDHLP
FT                   NFAAAIRNSLRRDPDIIVVGEMRDGETIGAAILASQTGHVVYGTAHSTSVGATFTRTMQ
FT                   SLPKNEQQGMLGGLIDSLRLIICQELVQSTDGKRVALREYLSFGESERRALLTAAMRDP
FT                   AGVPSVAQQLTRERGQTKLMHARKLFAAGRIKEDVVLRFELAEQTARAQVSLLAGEGE"
FT   CDS_pept        9037..9318
FT                   /transl_table=11
FT                   /gene="icmT"
FT                   /locus_tag="XCVd0008"
FT                   /product="putative IcmT-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19820"
FT                   /db_xref="GOA:Q3C096"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C096"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19820.1"
FT                   /translation="MMSGPADWRNTSLMAKFLVFDARACIPFVILFYSPSFAKLGVSIG
FT                   LFLFFSVLSFYKYTLVVLVRRMRCKLAGPVRSGVAWWHRPQRRLYRHR"
FT   CDS_pept        9367..9798
FT                   /transl_table=11
FT                   /locus_tag="XCVd0009"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19821"
FT                   /db_xref="GOA:Q3C095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C095"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19821.1"
FT                   /translation="MNPRRKATINWGIFTMKVLAIFALGVGAISVRSTTDTVGMLLDQT
FT                   GAQVQFMQKLVETNDPALAETAFKYGREVIGSFDATALTQQVLAVYALAAITGVFAIFI
FT                   LLGLPSIDRAGHGKSRWSLRKTSVPNDMKSTPSDGNSND"
FT   CDS_pept        10265..10798
FT                   /transl_table=11
FT                   /locus_tag="XCVd0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19822"
FT                   /db_xref="InterPro:IPR009440"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C094"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19822.1"
FT                   /translation="MAYIDYALDDANNWREGMDPTAPVVVVDVGGRTTDTATIIRGSTV
FT                   DHAASGTINVGVTHVLDHLRSLIMARFGVAGVRPSRLETFLRSGKVQLRGEWHDISAER
FT                   EQAVDLVLQQVRRELQRRVGDAADMQAVLLVGGGAALLASGLKTGYRHLVVPEDPEFAN
FT                   ARGMLKTLRGNVAA"
FT   CDS_pept        11295..12134
FT                   /transl_table=11
FT                   /gene="pilL"
FT                   /locus_tag="XCVd0011"
FT                   /product="putative PilL-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19823"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C093"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19823.1"
FT                   /translation="MKKGLSLLFACLALALANQAQAGFRVASIEPAPKVAGAAASVAGI
FT                   APRSGYVAIDGQEPPPITEALRPSSSGFGLIAVSYVGGPPAVIERRAGMGRDVRLADAL
FT                   KQIAPEGWRGFGKSEIAGSFDPNKLVNWRGGRPWTDVLDILANDNDLSIEVDWNKRHLY
FT                   VGKRDYTTASTNRSSTQRLATALTQTPVQDKQIWSAKAGSTVRETVEQWAQSQSWTVYW
FT                   PMQDLDYRIVAPLTFDGTFVDAVSKFTLLYESAERPLAVGIFVNQKLIRYSEKEAAK"
FT   sig_peptide     11295..11360
FT                   /gene="pilL"
FT                   /locus_tag="XCVd0011"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        12131..13867
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="XCVd0012"
FT                   /product="putative PilN-like Bacterial type II and III
FT                   secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19824"
FT                   /db_xref="GOA:Q3C092"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR013359"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C092"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19824.1"
FT                   /translation="MKYIFTLAAAVTMLTGCSHSIRNADRSYNDVDGEAKKLLIDMRTP
FT                   AVPGQRETVTISNSQWVEPVPMAVTTPKLPAALRCDPGFKTLEPMGLLEFAQAVSESCK
FT                   MAVRVTADALSAFGSGDSNSATSGPSAGASVPVGGMPLPNLPMLPPVTGTAANASGGIG
FT                   GRAGGALLSNIEWKGPLAGLLDLVASRYGLSWRYSERNNSVSIFHVDSRTFQLDAFPNQ
FT                   VDIQSTTHNGMSSQLGSGGGGGGGGGGSGGGASSGGSSGGGVSGTVGSSQTTVTSMKSS
FT                   LYTDVESAIKVLLTPGIGRVALSPSTGAVTVTDTPDVLDRIGSMLERENTTLTKQVTLH
FT                   AKVLSLTLNDANEVGVNWDVVYRSLSRQFEFTTPFQPASSAGTLGASVINTGKFAGTNV
FT                   IVSALSTLGTVNTITSPSLKTLNLRPAPIQIARQIGYIQSAQISQTEGAGTLGGLTPGF
FT                   VTVGFNMTVVPRLLAQNEEMILQYSINISALNELRSEEAGGTKIEMPDIDTRNFNSEVR
FT                   LHAGETLILHGFEQENHSSNRRGMGSPFAWMLGGSARGQRQRTAIVILITPEVGSSISA
FT                   MR"
FT   sig_peptide     12131..12199
FT                   /gene="pilN"
FT                   /locus_tag="XCVd0012"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        13907..15253
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="XCVd0013"
FT                   /product="putative PilO-like pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19825"
FT                   /db_xref="GOA:Q3C091"
FT                   /db_xref="InterPro:IPR009663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C091"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19825.1"
FT                   /translation="MARRKSIDTSIADRQKIGTFVLNGRTFVSGLHWETLDNVSSFMKE
FT                   ARSKGRQWGMDVVATRKGVDLRSKGKSAKYQAGYAPKNRGAAKGMYSLASVLASEFGSN
FT                   WIGAFRIEEERYALAAVVDGSIVPSADRIGTLSEIREELGANFSHLAGSGVLFEHVIAP
FT                   PEFEFGDKQVDLASLLVASKLKPEHRLKPLTLGLSKGELFRLTLFAAIIVAGGALYILY
FT                   QAREEEMLRRADQAQKAARARAEALLNIKPPPPAPPPPWLASAKITDTVAACSAAIDKL
FT                   PLVLGGWIFEKASCNAGGALSAAYKRGHLATANSVLSAAEAAGLPLDFYDAGESGVVNV
FT                   LIHMPSASSEELLAEKQVMARLVSHFQAAGVKFPLQKQAIPETPPGEEPTTSKPNWSTY
FT                   TFEIVTQMPPVALLEGLAPDGLRAETVAVSLDGEAARLTWTINGALYVR"
FT   CDS_pept        15739..17349
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="XCVd0014"
FT                   /product="putative PilQ-like type II/IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19826"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C090"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19826.1"
FT                   /translation="MVASVTSIAPESALPVAEPTKAVRYCRVLTAELGVYFVAESKRAV
FT                   VCLLADADGRSAELVVSSSHKTDPIVLSIFNILRRNAQNITWVTRYTQVSEIAKLYQLH
FT                   STNLVANDDDSARQDQVKGYIREANNMGASDLKIIVVGPYCRIRYTIHGRTKTYHELPA
FT                   AEGMLLSRALYNTMCAEMTGSGLDPNAMQDAQLKADVASQCGLVGSRISTRPANGRGIR
FT                   IVLRLLPPNRSAVQELEDLGYLPDSQIPILREVMALPFGIGLISGVTGSGKSTTLKAII
FT                   ENILRDSDQETDVLTIEDPVEYDIEAEGCTQTPLVYEQDDPEGRRNAWPNALRNAMRQA
FT                   PKIIVPGEIRDSESALIGYEAAVTGHFIWSTVHTFDAPSIIDRFRLLGVADDRLFNPAL
FT                   SVCLVNQSLLPQLCVSCRVPYLVGCAAIPAHVRTSIEEFCEVSKVYLQGPGCEECSGQT
FT                   PGVRGRKVAAEIIRPTAAFMEVFRRQGMVAARTYWVKQMGGITKLAHALTYVHSGLADP
FT                   RHVIRDVAALNTDRLHIGD"
FT   CDS_pept        17351..18448
FT                   /transl_table=11
FT                   /gene="pilR"
FT                   /locus_tag="XCVd0015"
FT                   /product="putative PilR-like integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19827"
FT                   /db_xref="GOA:Q3C089"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C089"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19827.1"
FT                   /translation="MAFADVWDSLSFDGIKSWAFKCYVKLGFGITARINFYESLTLSLD
FT                   NGESVLDTLEQQRAAFDEDGIAVLPAPQLVIINDCIRALTRGDQLADALEEWVGIQEVS
FT                   LVAAGESSGDLVAGLDRVVESLERRQELQRVLKEALMWPAFIGLGIVSAIFYISLELIP
FT                   ELLRMQPKEAWPAPTQKMISIGLFVVGNWFYMLAAFLIAASWLAWALPNLTGRIRDKFD
FT                   KLPFFSTYRVFVGTTFLLNVSALLAAGIPLEQALIDMARYANAYLRERIDDTLRGIKTG
FT                   ANFGQALHFTEHDFPDKDTVRNVKTLAEKKGFEVALEKFTKRWLKQNMKLMERSAAILR
FT                   LIMLLIGAYVIVTMFQGVYGIAQRR"
FT   CDS_pept        18707..20026
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="XCVd0016"
FT                   /product="putative PilT-like type II/IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19828"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C088"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19828.1"
FT                   /translation="MERVAPICCLLRSTASVSRPLCRLLVRRFQISSAAQLPWFLLVPV
FT                   SSSAQQRFLRKSAVALSQTYPSLGHTARRSMAGLGSPGRCRLPKQMLVAVRMPTRSLGR
FT                   SPTKPRVSSMQLKDLPVVDIYLGHDYSLMKDLPGAQAPGSAAPDQLKQELANVRGLCLE
FT                   MFEKSGDPEFALSLDGFVYRVTTFVDTSTHPVFVLSRAASKVIPIERLDIPKHAKEAVL
FT                   SPRTRGIVLVTGEMGSGKTVTATTLFVERLRQTRSIGLALEDPIESNLNGPHGDGWCIH
FT                   VQVSRREGGYREYLIRSMRSRAETIYLGELRDESSAEQAVQLSNMGHLVFTTVHGGDLP
FT                   QAIERILSLSRGLRDPSGMLAEGLAVIIHQKLVHSTALPGGTSIPRLVAKALTLVPAHG
FT                   DERGEAFSKSARALIRTNELSKLQTLIEQQSNAATWRGNP"
FT   CDS_pept        20023..21510
FT                   /transl_table=11
FT                   /gene="pilV"
FT                   /locus_tag="XCVd0017"
FT                   /product="putative PilV-like type IV prepilin"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19829"
FT                   /db_xref="InterPro:IPR007001"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C087"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19829.1"
FT                   /translation="MRIKHRGFVLMELVIALAILAALSIGLISVIRSQAQSKQLAIAAN
FT                   QLVDFTNATEQYVKNEYNTILSSAGTTSPVVISVANLQAAGLLPASYPNANVFGQVPTG
FT                   RSRKASGNTLETLVIYTGGVALSQSDLDELAGLAAQQGVAGGSVGSADTTRAVGFLGAW
FT                   SMPLSNFAISPGAGRAAANVSYTNEARSDTALHRQAIPGRPELNRMSTSIDMANNSIDN
FT                   GGRIAAQDVDAANGMQANQIAIGKSVFGALPYAYETVQINSGLTFRVAAGTKELAAFQS
FT                   DGSSIFRGNLYADSVNATGISRAADLIASNTVQGQDVFANNWFRSRGNGGWYSEQYGGG
FT                   WHMTDTTWIRAYGDKNIYTGGEIRGGAVTAEGRLQANELKLNRIESEGASCSETGLNAR
FT                   SSQGALLSCTLGQWKSGGGISTTIVTGARSAGCSLSSYATCPVGTLVVGGGYMWNQNCN
FT                   GKEEYQFTSFDRPWGNAGWEARVQQALVTAYAICVPY"
FT   sig_peptide     20023..20133
FT                   /gene="pilV"
FT                   /locus_tag="XCVd0017"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        22121..22471
FT                   /transl_table=11
FT                   /locus_tag="XCVd0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19830"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C086"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19830.1"
FT                   /translation="MSLNDFIDGQLVNNTFNRRAVAETANNRDEWMAEAKRLRRELEAT
FT                   IADRDTWKAHGTASIELVRDLRENLAQSSPANPFADRNRLNERLKARKVELVQQMGYRV
FT                   INADADNFTITR"
FT   CDS_pept        22586..23095
FT                   /transl_table=11
FT                   /locus_tag="XCVd0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19831"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C085"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19831.1"
FT                   /translation="MTWRTPSSLKWLIVKHSRLQGEIELLRREAEELDTQVVAQRQRLE
FT                   RAEKNLLAIETSLGMHEVQVDVGDIAAVIPHVNQPIYRHGDLTRNLYAALRIAGDWLTT
FT                   GELVERLTGHTYENCDRKLYERIRRSFRKRLTSLVSKGSVEREFSQGTTDCRQNHTRWR
FT                   LLSGRH"
FT   CDS_pept        complement(23205..23723)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19832"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C084"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19832.1"
FT                   /translation="MMTNTQLNRIPSVELQLLTWLRLVKVGGIPNRVDLKRGGFRVQVH
FT                   PAIHNLDGFGRRVDVLNIAQVVANPRYEGRGWFTGFLELCDELNPWDATYVGSVVNPHL
FT                   PAFLRRQGFIEQQGAQFYRPSKAWRVHHSWSVECASSAQADADAARVEGLLDNFELETI
FT                   MVREAMLQR"
FT   misc_feature    24375..25538
FT                   /locus_tag="IS_1646_pXCV183_1"
FT                   /note="IS element 1646"
FT   CDS_pept        24444..25424
FT                   /transl_table=11
FT                   /locus_tag="XCVd0021"
FT                   /product="IS1646 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19833"
FT                   /db_xref="GOA:Q3C078"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C078"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19833.1"
FT                   /translation="MQLTFGDAEGLGKRKQTRREIFLAEMEQVVPWQQLLGLVAPHYPV
FT                   SGRPGRQPYALATMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPDETTI
FT                   LNFRRLLETHGLAARMLEAVNAHLARKGQSLRSGTIVDATLIAAPSSTKNADHARDPEM
FT                   HQTKKGNQWYFGMKAHIGVDEFSGLVHHVHCTAANVADVTVTHALLHGKEDSVFGDSGY
FT                   TGADNREELQTCKAAFFIAARRSVLQAIGNKRERAREQRWEHFKASVRAKVEHPFRVIK
FT                   RQFGYTKVRYRGLAKNTAQVLTLFALSNLWMKRKQLLPAMGSVRL"
FT   misc_feature    complement(25907..27109)
FT                   /locus_tag="IS_1404_pXCV183_1"
FT                   /note="IS element 1404"
FT   CDS_pept        complement(25939..26964)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0022"
FT                   /product="IS1404 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19834"
FT                   /db_xref="GOA:Q3C082"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C082"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19834.1"
FT                   /translation="MPAAWLQRSLVLPVAQQVRWDERARCQAAQGPGVRERAAEEVAGR
FT                   AVVRERPDQGCTAKKVVSAPARRTLVREWIGRGASERRALAVIGMSASALRYCPREDRN
FT                   GELRERICALAHRHRRYGVGMIYLKLRQEGRIVNYKRVERLYREQQLQVRRRKRKKVPI
FT                   GERQPLLRPSQANQVWSMDFVFDRTAEGRVIKCLVIVDDATHEAVAIEVERAISGHGVT
FT                   RVLDRLAHSRGLPKVIRTDNGKEFCGKAMVAWAHARNVQLRLIQPGKPNQNAYVESFNG
FT                   RLRDECLNEHWFPTLLHARTEIERWRREYNEDRPKKAIGGMTPAAYAQHLANTDIINPG
FT                   L"
FT   CDS_pept        27131..27364
FT                   /transl_table=11
FT                   /locus_tag="XCVd0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19835"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C081"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19835.1"
FT                   /translation="MRKALSSSLPFLPQGSMYRIRSFHLTERERALFDRAVTGDEASPE
FT                   HETLQLLGFKDADLRAYSDLVRYLPRYVEAAI"
FT   misc_feature    complement(27443..28739)
FT                   /locus_tag="IS_Xac3_pXCV183_1"
FT                   /note="IS element Xac3"
FT   CDS_pept        complement(27503..28321)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0024"
FT                   /product="ISxac3 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19836"
FT                   /db_xref="GOA:Q3C080"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C080"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19836.1"
FT                   /translation="MCRVLRVNRSGYYAWLCSPNSERAKEDDRLLGLIKHHWLASGSVY
FT                   GHRKITTDLRDLGERCSRHRVHRLMRTEGLRAQVGYGRKPRFHGGMQCKAAANLLDRQF
FT                   DVTEPDTAWASDFTFIRTHEGWMYLAVVIDLFSRQVVGWAMRDRADTELVVQAVLSAVW
FT                   RRKPNAGCLVHSDQGSVYTSDDWRSFLASHGLVCSMSRRGNCHDNAPVESFFGLLKRER
FT                   IRRLTYPTKDAARAEVFDYIEMFYNPNRRHGSTGDLSPVEFERRYAQRGS"
FT   CDS_pept        complement(28387..28680)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0025"
FT                   /product="ISxac3 transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19837"
FT                   /db_xref="GOA:Q3C079"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C079"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19837.1"
FT                   /translation="MVDSEVSMSSKRYTDEFKIEAVRQVTDRGFKVAEVAERLGVTTHS
FT                   LYAWLRTFGKSGVVHRAEVDQSAEVRRLKAELRRVTEERDILKKAAAYFAKG"
FT   misc_feature    complement(29333..30490)
FT                   /locus_tag="IS_1479_pXCV183_1"
FT                   /note="IS element 1479"
FT   CDS_pept        complement(29447..30427)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0026"
FT                   /product="IS1479 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19838"
FT                   /db_xref="GOA:Q3C078"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C078"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19838.1"
FT                   /translation="MQLTFGDAEGLGKRKQTRREIFLAEMEQVVPWQQLLGLVAPHYPV
FT                   SGRPGRQPYALATMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPDETTI
FT                   LNFRRLLETHGLAARMLEAVNAHLARKGQSLRSGTIVDATLIAAPSSTKNADHARDPEM
FT                   HQTKKGNQWYFGMKAHIGVDEFSGLVHHVHCTAANVADVTVTHALLHGKEDSVFGDSGY
FT                   TGADNREELQTCKAAFFIAARRSVLQAIGNKRERAREQRWEHFKASVRAKVEHPFRVIK
FT                   RQFGYTKVRYRGLAKNTAQVLTLFALSNLWMKRKQLLPAMGSVRL"
FT   tRNA            complement(31579..31671)
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="XCVd_tRNA01"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:34..36,aa:Ile)"
FT   CDS_pept        complement(32545..35127)
FT                   /transl_table=11
FT                   /gene="dotA"
FT                   /locus_tag="XCVd0027"
FT                   /product="putative TraY/DotA-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19839"
FT                   /db_xref="GOA:Q3C077"
FT                   /db_xref="InterPro:IPR027628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C077"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19839.1"
FT                   /translation="MAAPTPMKPGRSPEPRPPHVASFVRHQGTPRSGAKLSPAARGGET
FT                   RCHRACSACGAAMAGLGHPTHLAPKHHRWNFWLHAHFPFPCPVTPKCRRYFRGHHALTW
FT                   SYSMTRSLAVLGALMIPNLARAQDPSKPGFFKPPADDTSVSFIRDVFGSIVDTIMTGQN
FT                   VDQASADTALAAGFEVFGLGILALGMLFVIFTTVKGAVDTAHDGEFLGKKMSSVWVPLR
FT                   TAAGTAFLLPLKSGFSLVQIAVLWIGIHGVGLADQVWLAMLDKMVETGQMGRPHLPDSR
FT                   PLAANILRYEVCAAAMNKQYETEGRALKIEVLPKKTAMINTGDALKFDNILYPGGFLDL
FT                   AQSAAGSAFSVTGLQWSAVGSGGYMNQNVCGELEWQESHESSESNGAPYIDKAPILRAQ
FT                   AQAVQKMVSELRPVAQAIVAGEKPAAGALERVANTYELSLQTAALSVVNRANKNRNSRF
FT                   LTYAKEGGWIFAGTYYNHIIHMSDAIQSAVNSLPASSAQTITDKEAADTLILYQDSLVT
FT                   ANEYIRNSSQSAYRAYEAQNQAIGFTGDKIPSNFEEMKIWLSRPALAGINQMTQEIAGS
FT                   NLSHVAQMKNVGDTIMAVAWTIQGAQFIVAGFGGGLWDDAVTLGSYDIGASIETLTPAV
FT                   AFLFMTLLTAGAFLAFYVPMIPYIIWITGIIKWLTVLFESVIAAPIWAAAHVHPDGDDQ
FT                   GGRAGPGYMIILSVFLRPTLMIFGLVGSIVVAQPVAHYVNLTYITQVQGAMGNSANAIG
FT                   ALIAYTAIYAILMTIVLHSVFGFINWIPDNVLRWIGSAVGMHGIADNEEHGVKGAFFRS
FT                   TESVSKGTGSHKPSGGGGGGSKPVNTGGSEPGGGGTGNDVHSTKLPGA"
FT   CDS_pept        35189..35692
FT                   /transl_table=11
FT                   /locus_tag="XCVd0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19840"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C076"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19840.1"
FT                   /translation="MAALDLAPPKLVEFWRSYAPELGDLVSVMDRAENWTVDREPLLAD
FT                   RLVALGRRMTGPDQARAFVSADVPDLLLFLAYISTSTALRVIHWLDEQDEYQQYGSTVV
FT                   QRLLDAPGHLAGAIALSPLRDLLALRLRVISNTPYFTKLFAPERLAGLGAAITRYRQEA
FT                   VDVS"
FT   CDS_pept        35682..36182
FT                   /transl_table=11
FT                   /locus_tag="XCVd0029"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C075"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19841.1"
FT                   /translation="MSRKIALAPLLGALLLTSGTASAIDAASVQAYCDQVRQSAQQAKQ
FT                   RHVQIFAPRQDPGKTFDDATQSCLDGIMSYKSMFQFKMPSLGDVQGILSQMAKEMLNKQ
FT                   CQAARAQFDRAVQDAVSTVNQSTNQLPGVDVDVSTGSGVTVKPKDGESTIWGSIVNKLG
FT                   GDK"
FT   sig_peptide     35682..35750
FT                   /locus_tag="XCVd0029"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        36182..37318
FT                   /transl_table=11
FT                   /locus_tag="XCVd0030"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19842"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C074"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19842.1"
FT                   /translation="MLLLRRFTALIFSLLVLGTSTLLIFSASTESTACCGDGVVAAAGA
FT                   EAAGASVVTAVGSATTSIITQLQLMDQNVSSGFGRLYEELAKQTAAQRTFEQGAISAQT
FT                   QMYMEERRAEAEEKYALSPRACFETASGVASTVAAGETKEAVNDLNRLMTDRTLNTPNT
FT                   AAAIGRIYKDHAEKYCSAQDAQLGRCTAVAAELQNADVRADVLLGSASLTPAQSDAAKA
FT                   LVANIVNPIPTQNIPTKWENTAQGRAFVSGQLLEQARTSVAANSLNQAVAARTRIPGLG
FT                   SAAMLNRADVSEREMMEAQVRGRFESPDWYKMLAAMSTENLLRELNKQSAFGLWMDYRE
FT                   FSQMERIESLLATDLAVTVKQDSEKRLQQARSAAAKAR"
FT   sig_peptide     36182..36322
FT                   /locus_tag="XCVd0030"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        37318..38148
FT                   /transl_table=11
FT                   /locus_tag="XCVd0031"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19843"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C073"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19843.1"
FT                   /translation="MRPSKAAVIIGISGLLAALPYMKASAAYCCDPWGIPGKTAFAAAG
FT                   TSVVGAITAQVTAVSNYLQLYTSQTWSSGFAKTAEELSKQTAASRTFEQGRLAADTSLY
FT                   MTGVSGAAEEQAQEPALLDQTVTNAVLLSEQFNQQKNNRRRDDAGFAEYMRGDSHEDLV
FT                   SRGREFCDLRGKAAGFCDAIASSTLQNADISYNTISNPGDGQYETLTDAEARAARSFVR
FT                   NVVSATPMASTAGSTPQDEHHEALLLADQAVLSLAAHSLHSVMQNRVRKRENGQ"
FT   sig_peptide     37318..37386
FT                   /locus_tag="XCVd0031"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        38145..38759
FT                   /transl_table=11
FT                   /locus_tag="XCVd0032"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C072"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19844.1"
FT                   /translation="MMIRALAFALLFIVSCGDAAQASAFDMADVIRDSAAKFAATQKVD
FT                   AGSAVKRMDDLLVRDYGARGRIASEHDPRLKSLYTQAARLLMNGNAISGGTLIVIASQE
FT                   SGYSGSKVGPALQAFIGAMLMPADEEDTVLRDFSERANRARSKLGVLRPELQMAAQLRV
FT                   MGAIYHDPIAVDAGVVALNKLSATADEEGAVAGALTAAGAK"
FT   sig_peptide     38145..38216
FT                   /locus_tag="XCVd0032"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        38840..39757
FT                   /transl_table=11
FT                   /locus_tag="XCVd0033"
FT                   /product="putative family M23 peptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19845"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C071"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19845.1"
FT                   /translation="MAFSTLLCAVSSAAQADCLTVPAPSGLVTSVYGWRFHPVFKYWRP
FT                   HRGVDLRAGVGTQLVATHSGVVQVSNSAGGGNEIRIVGDNGWVTRYLHLTRPLVAPGTK
FT                   VSAGQAVALSGNTGHASAAPHLHLELYGKEGKDLNPEPLLCPSPSRKPGADISNGFPVS
FT                   ACNPKGGSCSSAGVPPANGGGPVAGEGQTPPATGYQGTEPASPAPNITQFDDMSTHEIL
FT                   SSEIIKRHGNPDWYRLESERGSLALLTEQAQMRALRLYMRYLNKESRDRVEALLAAKVQ
FT                   RRVQADASERLRRQREAAAKAGPP"
FT   sig_peptide     38840..38887
FT                   /locus_tag="XCVd0033"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        39827..41131
FT                   /transl_table=11
FT                   /locus_tag="XCVd0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19846"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C070"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19846.1"
FT                   /translation="MSKLGALREKAVAEGAAVSSVEEEVPPLPPEAPMDAEFIAGLMAS
FT                   AAGAAGIPDRPPEAFPDVAVAPTVDGAPQGNQAPAGASSPPAGHAVPQGGEPHAVAPSA
FT                   PQAGMDTSDLLHALKGAIERLGPARTQAEVLAAPDAQGAWGEVRGLTAAALALGMASPV
FT                   EQLFRRYGAPGEGLLNAAQLKAPLNMAVAGFKPGAAPLAATQAKAAAAAAGQQAMGGPG
FT                   GGGGGGAGSVGAALAKLVAAPVTIPMAAGSRVWQMMQTRFGPRPKVQPGVDGFSVIRQQ
FT                   FDDAAGRAIDQIAHLRSGPMKSFLTEMAQDPLRPSEQLRRMQGDKKGTYFERAKQLREL
FT                   SAQPEVQGQYKKLNDAMEHLQYRSRRLAEYGHEAGMDVEDIIGDKLESVSKAGEGIPMT
FT                   DGKGKLAELRESLDALIERIREFLRTLFARPGASP"
FT   CDS_pept        41128..41364
FT                   /transl_table=11
FT                   /locus_tag="XCVd0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19847"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C069"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19847.1"
FT                   /translation="MRGSTLADYLGACDRYLSGHEQQFTSPWGLVLLAECAADAGLDLS
FT                   EADVSLDAALEQLAERVGLNRQDDLASLPAPGQ"
FT   CDS_pept        41367..42923
FT                   /transl_table=11
FT                   /locus_tag="XCVd0036"
FT                   /product="putative DNA topoisomerase"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19848"
FT                   /db_xref="GOA:Q3C068"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C068"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19848.1"
FT                   /translation="MGAFVEDLIVIEASGKLKRLYAVLSDLGMRARCIATLGNLLQSPP
FT                   QLRPVSIQKDHVGGYQEAVRIPARPDAYDRVSAEIRSLRGRLFIATDYDQEGHAIAADV
FT                   VALTKQLRPDLAPLRLQLTELTPAALRASFASVRDYDPSLALSGTARRIVDRVIASAYS
FT                   LPSAGVLVGRVTSAIAAMARRGLVPTHEAVLQIPCASGGVPFTARTTVIGESRLQELQS
FT                   AASQVVSLAVSTFEMSTVGQGVNYADFLGGMNEHMGLAEAARLLQDLYEQGVVSYPRTE
FT                   SRGYGARGHARCIEFAHSHGARLGPTAATVLPEGAHEALHIVAPQVLASVDVMKPARLQ
FT                   SSHKAIALSWLSRSMAESVWQVRRDLPDLNQLPDALRGLDWSRDVGALPAWHRRPKANS
FT                   RVLNHQSAILAGLQEQRIGRPSTVVGHVVRAQERALVTPDGGEGPGGTRVLARAPLGLQ
FT                   EPAAAHRIEAVCQKAAGIGLGFAVEEALSIAAGDEAQLASLLTTIDDWTPDDDFTPSYA
FT                   P"
FT   CDS_pept        43329..43754
FT                   /transl_table=11
FT                   /locus_tag="XCVd0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C067"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19849.1"
FT                   /translation="MRLVNIQSFDAASYREFEGIMLEFAKAQGWEFSFQAQPLPLASVF
FT                   NNATFGPALLVAAQVELSLRKIEVDLGLVVQEDNGAMFGRRVEFDPARSHLLTQMWRLT
FT                   QTAYQVDLLPREQNRIVLDLVPAALEPYEAPALQAGQ"
FT   CDS_pept        43756..44811
FT                   /transl_table=11
FT                   /locus_tag="XCVd0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C066"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19850.1"
FT                   /translation="MGMIRRLMTASGEDAGSNAASEPIADLSPESMTAEVGRQDVGATT
FT                   NAAPSPQLPLEAEHGEAVIPPAPTPVNAPTGAQLTLSMLRAMGPIFRAALVYPGPTAPA
FT                   VEWAQAIKVMSDVSAQVAGQLALMRTEELDVAWARRELHPAVAVIVGEHWLHTVIKMQR
FT                   VQRVGDIKLNAEDILPGIVAALKASDDCGNPHLATERSAVAELLPAMALLQVNAQAYQA
FT                   LLQSDTVDLDVPDLSVDAYLQAVAAAVVDAVETQDARAKLSGALHGDEFREALLRSATG
FT                   IVVKAGETAVNESLARLHEAIKASAPARWLSEEPLQQGFPLARTVELIEQGINRLAGTA
FT                   VYIASKLGTKR"
FT   CDS_pept        44808..45305
FT                   /transl_table=11
FT                   /locus_tag="XCVd0039"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19851"
FT                   /db_xref="GOA:Q3C065"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C065"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19851.1"
FT                   /translation="MTEEVPAKKIQAPRVDVTPAPTRRRAIAGVARLARIVYLGDLGEI
FT                   RRTHAYFRDRLQRVLHQGRYARNETFEEAQARLGLTPQDVARRAAELRSQSLLYLGVAG
FT                   VALFVFLLLPLVSNPISHAVMSLLVMVLALSKYSVSRWRQGQCEERNLVPYMSYWLRWW
FT                   RS"
FT   CDS_pept        45302..45985
FT                   /transl_table=11
FT                   /locus_tag="XCVd0040"
FT                   /product="putative lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19852"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C064"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19852.1"
FT                   /translation="MMDAAPPPQLTACVAHAAGTYGLDPDALWAFVRSRKGASAQYVQA
FT                   ENGTMELGLARIPADVARRAERQGFTLQQVMSDDCLNVGLAGLMMAQAGISASRGSSDS
FT                   DCLAGAAQRYQLPLPIFKAVVGEEGGWLGLKKPNKNGSYDYGPAQINSIHLEELSKYGV
FT                   SESQLMWDRCVNLHVSAYRLRFEINRAGDLWRGVGNYHSRTPSLSSSYAERVRRRMAGA
FT                   NGGQR"
FT   CDS_pept        45982..47133
FT                   /transl_table=11
FT                   /gene="icmP"
FT                   /locus_tag="XCVd0041"
FT                   /product="putative IcmP-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19853"
FT                   /db_xref="GOA:Q3C063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C063"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19853.1"
FT                   /translation="MRGRPNSEHDNGPVVVVLGLIVGIGLAWLVAHEQISWLVMWVRLL
FT                   EARVVFFDTEGLQMVYDWVASRHPRDVKIGELYSSGQVTGYYLRWVVLIVLLPMFGWMF
FT                   WRHPARSSAYRQVYSIMKLAWSQVHLYPMLKPILEMNLLTVPLDHPIHGMRALPRRYAR
FT                   RYKMLREMKDIAPDHDRSDLDVIDSKQVLVLSRCREVFAKQIGKEWAGIESLRGYERDL
FT                   LVAFAVQADGTIEDANKNTLQIIQELAIAASAAFKANDPGLIRSKRASELEARVMQSKV
FT                   VARAIRAHGYKRTVLMAMLEAGRKGGVLPAAWFRWLKPVDRVTWYCLCDMGIQPSCVES
FT                   AGARAQYLTERAAGIPVPTPMIEPAINGLREYLNEVIDVEVED"
FT   CDS_pept        47114..47893
FT                   /transl_table=11
FT                   /locus_tag="XCVd0042"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19854"
FT                   /db_xref="GOA:Q3C062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C062"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19854.1"
FT                   /translation="MSKWKIKAVKVPASVARFIPVLGRCADWFERKLRRLYSSMRDRIS
FT                   PPVSVLVKKGRVTIAESVRAGGRVHILEVQPNRAHPLSTIQLQANVLQVGPSTILYADA
FT                   GLAALAYAQVRKAVLPATWSAWILRLVGLIAVVLILRLATVALLGSTAGNAAGGSKLEG
FT                   VSAQMAADPGFSPPSPAPQPLPGASELFGAAAPAGSGDLADQIYQQARAAAAKTEHATM
FT                   PPQPSVNVEGLAGFGLEEGGDQAGPGCDPNLAFKVEQ"
FT   CDS_pept        47904..50471
FT                   /transl_table=11
FT                   /gene="icmO"
FT                   /locus_tag="XCVd0043"
FT                   /product="putative IcmO-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19855"
FT                   /db_xref="GOA:Q3C061"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C061"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19855.1"
FT                   /translation="MSIQGVDKRNEISRERLIRDTRPFFLRLLAGLGAPFAVAVAGLVL
FT                   CVIAVFVPALADVCLLVGLLYALIPRRGVEDVPFRVPKYSGGVDPNEIDSKTGKPKRGR
FT                   GIAFMGNRGQDDAECWGADTDVKRHWFFLGSTGAGKTEGLVSMCINAFIWVSGLLYTDG
FT                   KGDVSLYGKLFSSARIFGREDDFLLLNFMTGNADTQRKRSDKLSNNYNPFVDGNAASKT
FT                   QLLVNLMDSGGDGKGGDVWKGRAISFIATVMPALIDKRDAGSLLLHVGRIREYLPFLKL
FT                   LELLRDPDVLQDNKTRINAFLLDVPGYRADKGEQQANTFFEQYGYQQMQFTRILSSLAD
FT                   TYGHIFKTEQAEIDMRDVVVNRRILVTLLPALESSRPELGNLGKIVVAGVKGMMGSNLG
FT                   NIVEGSKRSVLDARATNAPTPFLTIFDEHGYYLTEDTALMWAQARSLGFWLISAGQDLQ
FT                   AYFRTSKEETKAILGSSNTKVIGKVEDPTETWEMIQAMGGEALISTLSDYDLDVDGVAG
FT                   GYMEGTSVKVERVKRIDLQDLQRQVEGEVHMLFGGDIIRGRIFYADPPSTSEFRLNHFI
FT                   KVLPPSTEGILSLKIDARRYIDQLHEPEIAFANQRPDDPYFSYAADLLRAPGVQKYKGN
FT                   RQGAELGVCLLTGFQTTPVINRGAVSGGGSAGGGLNAQPQPQPQPQPQPQSEEENSAVV
FT                   SASLTQRVDDGAAGEYFDAANLETTSVFAAVKPSPAVPGQPVFSAEESALYAATAVAAS
FT                   SLVDVAVAKDISSLFMDSQNGEPGPLDIEYTHAGLTALGQALGGTSAAASAAADAMIIT
FT                   AAEATSYPAPPTPPSSDVASTRMQSAMDELEALLGSSGAPNEL"
FT   CDS_pept        50461..51081
FT                   /transl_table=11
FT                   /locus_tag="XCVd0044"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19856"
FT                   /db_xref="GOA:Q3C060"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C060"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19856.1"
FT                   /translation="MSFELTSLRRRNLLRSIASGIAAMGTGAVLSPAFARSGFVMPYGH
FT                   ADAYTSATFWAQPRVLRLHRPASNETVDACYWRDGQLDSAGYIRICRLLRDVQAGQAAT
FT                   IDMRLLNLLRGMQGWVEASYGIRDPYQVNSGYRTQATNKSTEGAARHSLHMKGQAVDGL
FT                   HPGLPLEYTGNLFKAFQGGGVGFYLNSKKFIHADVGSVRQWRG"
FT   sig_peptide     50461..50565
FT                   /locus_tag="XCVd0044"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        51069..51857
FT                   /transl_table=11
FT                   /locus_tag="XCVd0045"
FT                   /product="putative periplasmic thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19857"
FT                   /db_xref="GOA:Q3C059"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C059"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19857.1"
FT                   /translation="MARLINAAVGIALLLTSAVVQNAQASEAPKPTLAERHLMASGVKV
FT                   THRFDSVSGLRAIVADNGADKRLFYVTPDGKSLIAGLVFDESGRNVTTEDMGRAGISAS
FT                   GNTTAVTQLQAQKLWQRVQGLKALKDGNRGADIYVFVDPTCQYCHRLMSMVRPYIAAGT
FT                   LQVRWLPVAILSSRSPGLAEAMYKAPNVAQAIQSVSTNMLKPVPESEAIRLQLAQNLLA
FT                   MRDTGQTGVPLVVYRVGQRVVIKSGVPTDAELVALAGGAK"
FT   sig_peptide     51069..51143
FT                   /locus_tag="XCVd0045"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        51901..52344
FT                   /transl_table=11
FT                   /locus_tag="XCVd0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19858"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C058"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19858.1"
FT                   /translation="MQVVSQQRPSVVTTQRSSLDLAQDFYKRHQRIDVADTLLNDLAYL
FT                   YASEALGADECEAFVERMAEEEHMKAIRLDFCHCCMAVNAALYLDDQGVYEAFLPLLDL
FT                   DDEDDALADMKRFVLRKLGEDHEELAADEGAFRARVLLALSRI"
FT   CDS_pept        52552..53637
FT                   /transl_table=11
FT                   /locus_tag="XCVd0047"
FT                   /product="putative antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19859"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C057"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19859.1"
FT                   /translation="MGLLRTLRGSLAVPTPQAAAPAASSHVSGLSPASRPVYDRAAEGT
FT                   GIFVKHIEDGGCPWQQPQSKPLEWPRNELRGTPYHGFNAIALAMSGYDDPRWCTFDQAA
FT                   AKGWRVRAGEKATSIFMWKVQEKETGTYDDDGEPITRKFPLLCRFKIFNFAQISGPEPH
FT                   QPHQLTDTEARKLAEPIVETVGMTVTESATGPTGYNPERDSLVVRPRVAYPSEKHYCAD
FT                   LMNGVLAVAAREAVIGLALPAEAEMTDHQRAQRDLRVEIARSMLAMRTGLPLSPPAAVK
FT                   DAAILTLLQSDRREVFRAAKDAENIMRYALAFNPEVLPTLEDEHREQMSAAVAEGAPEM
FT                   VFDPSEFQFWPAELQQDRPRP"
FT   CDS_pept        53668..54459
FT                   /transl_table=11
FT                   /locus_tag="XCVd0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19860"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C056"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19860.1"
FT                   /translation="MPVTSMSDQLRALSVVASERSVGEIVQNLHKMWESVGRLVPERAT
FT                   VGDRVLFRLAKALFQDKIVVAEGLPEDDLVCEQYDQLQRRYLLSDVEGRRSLVSAIRHQ
FT                   HLMQPVHESEEVMPQTALVRVSGAAYVPITLRVMLPPVSLEAHRQELRLNFVQGTERTF
FT                   GFLPMVDVLEYRKRTHSLVALAPLHRWSRNPGQAVQVTYGDWFCADGYGRALYAAAVSG
FT                   LVVRRGESANGMGGVSPMFALTRAGRRAQLATEPAWSCKCL"
FT   CDS_pept        54745..56130
FT                   /transl_table=11
FT                   /locus_tag="XCVd0049"
FT                   /product="DnaB-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19861"
FT                   /db_xref="GOA:Q3C055"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C055"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19861.1"
FT                   /translation="MQDGGTKRQRGADGDVARLKIPPHSVEAEQSVLGGLMLAPETLDI
FT                   VKDLLVEEDFYRRDHRLIYRSICELDEKGQPYDAVTMGTWFEEQGQLELVGNGAYMIEL
FT                   ASTVPSAANIAGYAKIVRDRARLRELIEHGTEIVNDGYHPGGRETDELIAIAEQRIFSV
FT                   AEGGRVRHTYTDVTTGLKRVVTTLQERYENDSSIIGIPTGLPEFDEMTAGLQDTDLIIV
FT                   AARPGMGKSTLAQGFADSAATRSKKAVAIFSMEMSSDQWFLRMVAAESRVDGQRLKTGK
FT                   LEDEDWAKVMSAMKKLQGLKLFVDDSPALSPDLLRSKARRLKREQDIGLIVVDYLQLMM
FT                   VPGSKENRATVVADISRSLKALAKELRVPVVALSQLNRSLETRADKRPLMADLRESGGI
FT                   EQDADVIVFIYRDDYYNKDSTEKGIAELIIGKQRSGPTGTVRARFSGGITKFEPLGSGA
FT                   NDF"
FT   CDS_pept        56639..57292
FT                   /transl_table=11
FT                   /locus_tag="XCVd0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19862"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C054"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19862.1"
FT                   /translation="MPLNPKHEIYIVGVNVDRYVVYRGSKSKDANSEPAVVKICQGVYM
FT                   QNGLDAESVFNRYGLRIAHYLTPSATISFSTAWHKAPKIGRVFVTGQYQYVRPLFGASD
FT                   RYNIVQSVGKVEPDNPKLHTMETFRDPLGEFTMLCDTPELTLLNMMTATKRHSEKHLNS
FT                   EEMDELLGHLMKEHGGKAGVASALEEVAVMAERTNELRRLIGLLYSPGKSFVSS"
FT   CDS_pept        57295..58281
FT                   /transl_table=11
FT                   /locus_tag="XCVd0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19863"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C053"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19863.1"
FT                   /translation="MANWVDLAEHDLVLLWRPKPGCPHARQMILQTVTSGGSIPPDVVE
FT                   LGFLPEGKQYVRDSTVLLPDEFLQIFPRARMIDVPRDFFEHKHGSNIVHLAGRPAPDLA
FT                   ERVSSPHTAVDVGLMRWALTPRPRFILEARTLIEDGASVVSFGGMERLTRKRATSASLK
FT                   SLMHSLAVRAARDAGAQLPFQVMVDYPDYVYFGGARRTHAAYRANSLVARLSVAERLTR
FT                   GASATVVSTHTGVPDLVLRIQQANGQAELVVAQTSVGAVGLAGVAAGFEITRGRLHLAW
FT                   TSQAQQRGFDPLLASLFLSSLLSGGYEADNVRWDRPVLGPERSTAAA"
FT   CDS_pept        58342..61245
FT                   /transl_table=11
FT                   /locus_tag="XCVd0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19864"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C052"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19864.1"
FT                   /translation="MPQWIDTQADGVALLARTSVSGAKELVLRRIRPDTVVPDAALTYG
FT                   FEPEGEIFVRKDTRFSLTEIRRIFPSAQVADMALEDIVYRVAAPIARLAVPKSARSAEV
FT                   LTPAADLLDVETPAAPSSWAQVPRGRFLMSARSLVDGGVPVVEFEGISHASPQSPKAVH
FT                   EQAVLAAVNAGESLPFAVLVDYPQIAYFGATKRHASTRVAKLLSSLEITERLLEGERAH
FT                   AVLKNDGFDDLVIVREARPEGQRLSLTHYYDKNGQITLDAELVFHIRGGQLHLSETAVE
FT                   NVLRGGEIRSYDAFLANRLAKNWLDQGFAVAEVHWPNQSVPSVVRAVPVSPEMPPTVDA
FT                   PSVAKVAAGPAAGMSMAFVFDSAGAAKLAVGMSQGAALGNLLAECASPSATNSSRSRIG
FT                   QNLSGMLLLEDANGVRYLELRSEEIAEDLSDRGVEHMTISEAQRAGKLTLAQKEPVKGV
FT                   LLFGRPVYRALKLADGSDAFFAIERGAAGESYAYKLDFADGGRPRWLSLGAAWTHGAPS
FT                   DGELMSSRPRPIDAFDQQAFVHEINQAIAVTSQDVLNERYRMLPLDADRITVRKISEQA
FT                   YEFSSADDWLPFGEVRVEQSGDHWRASHGTTSSSLRCSLEAACSWANRTIATQREHYLA
FT                   HLNQTTDGSLQFAIPEQDFTVLRRVLHKASIGEQTSWQGMGIHGDWTVYPKDLRAEIID
FT                   DRKLRIAVRGRELIYEICSMEADPASTYAHYQTEGLRRIGQWLGQVQDDIRWDETVRAH
FT                   PEGGLLKQRMREYQDLQVKHYGAAKFSARVPSTRAREMVLAITDRDVDRLISVIGDNGP
FT                   NNKSTMRLFQSVSGLRPGHSRTTRAEAVYRFCGYSDEQAAQHARRREDLARVRSMEREA
FT                   KARIEAAANMKVSHNGTEKTGKVMIDDVWAQGYTELSTRRQGASTRYMLRNPTTGQYYD
FT                   LKEPLTGYARHLVTIKDSANFVPGPSDEPEDVHTPGY"
FT   CDS_pept        61211..62170
FT                   /transl_table=11
FT                   /locus_tag="XCVd0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19865"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C051"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19865.1"
FT                   /translation="MSRKMSIRRATEDLPMIGRTTTNSRDFEETIGRYFARAIPEGTFT
FT                   EVDRKLPADCHELCRLFRMRPVTLHYGGSDKTLQFEAMVINDRFDKRIFLTNHAKEPLR
FT                   AVIGHELTHRMQIERPDLYRELATAIAAAGVDQERWQAYVQLMRAKSGREGRQLSIGEL
FT                   RSEAVADMVGDLLLDRRLWDALRAPSLAQRVVGWVQSAWRRLTAQAAVQAPLGGAPLAK
FT                   DRLAAITAATVVLQRWAHDVANDPVRRAGLHAVGASCRRAGLRHEADPAAEVIRFTNVA
FT                   GDLVAPDQLPVEVAEAVAALNQTTGELWRAADSVEMRP"
FT   CDS_pept        complement(62667..64172)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0054"
FT                   /product="putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19866"
FT                   /db_xref="GOA:Q3C050"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C050"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19866.1"
FT                   /translation="MHFTSEQEAIIASNAKTIRANAFAGTGKSSTLIGFADARPNERQL
FT                   MVAFNKSIQLEAAGRFPRNVKCKTGHSLAWFPHGAKYDGKLLADIKPFHITGTTTAYTR
FT                   SLPVAVVRVFDQRVIETVKAFLVSADEQMGATHVSLGDSPAEKKYLSEHALLAAAKDVW
FT                   AAMQATSLPMVHDGYLKLYQLSRPRLAYDTIMIDEAQDTNPVLQSILQSQSARLLYVGD
FT                   RHQGIYSFRGSQNAMELVKADASFYLTGSFRFGPAVAEVANRILALKGESAQLRGLGMD
FT                   TIVDQGAFENPRGTAFISRTNAAVFDKANNAVGRGIKVAYVGGVHTYRFEIGEDISKLR
FT                   QFGPADVRDPFIASFESFESLAEYAEAVQDKELTGWAKVVERYGGKRFDQALNRIRAEA
FT                   LQFDSASPEQRDALVVVTAHRSKGLEFDHVELAENFIDTVDEDTGKLRDFSDAERQTIE
FT                   EVNLLYVAATRARKELATNCSIAQLFDPELAPDDHPSASAAIA"
FT   CDS_pept        complement(65905..66366)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C049"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19867.1"
FT                   /translation="MVIRASAFVIKKDIDVPLGSVFAFEESWFFRAQVDDGGDIQEVGI
FT                   NLTDGAKYVVLTNPTSALTLAHGLALELRVIGPIRGPGKPPLASLAWSINGGPAISMVD
FT                   YFLALDGGKETTDVRTKHAFFATHWGAWVIDSNGKPISPDPLFVIGSDS"
FT   CDS_pept        complement(66395..67261)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19868"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C048"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19868.1"
FT                   /translation="MSSRDDLAQVTAERDVLAGLVEQHEARLRNFSADLHHVLMAQLGD
FT                   HEPGAEYMEAWQRLYALIAPVVTGYASTSAELEQAQADHAARLNALVARHDESAATDAI
FT                   VQTDSPEIYELRVGLVHANAAMFTGHRCVHARFSQILSSYRELILRHMPQFTPDEWAAL
FT                   AEMLNDECNEAHYDYLQHLDEDEQLSDQLPHGPFTTDVNRLATVAADRAAQRNAQQRQR
FT                   NADHYDLFAPTVDLLDLASRLSALTDVQRLAAYEKLMWLLYPERCDLVAYDAAKHAAIA
FT                   ELFNGTS"
FT   CDS_pept        complement(67737..67928)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0057"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19869"
FT                   /db_xref="GOA:Q3C047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C047"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19869.1"
FT                   /translation="MDRKTSKDFFVVMFVTGAVCGVTAIYLMASGKQAGPMVLALGFAA
FT                   NILLVVSMVELHFVPDVD"
FT   CDS_pept        complement(68066..69109)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19870"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C046"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19870.1"
FT                   /translation="MAESSRITSTEVFDAIEKLLAAGQPPTHMSVREMLGGRGSGPVLS
FT                   KFIARWFEEHGAEFFIKVGDARSRKPITDIGSQIRHAAEQAAQVLSEAERQRQEALCAR
FT                   ETAAEQRSVMLDAREEALFAAQAKLAERESEQERLIHELQSDKTNLVSRLDQARLDRLQ
FT                   VESELRELSSAIAGVRDELALALQEIAVSQEREQASQLALAEARRERDAASKRFERFED
FT                   AYAKILNAIHLLRESGQEQGTNLLEALQKLSERLELHQTQLDASAAELAAASRRARTLE
FT                   GKLSQSEMKLAAAHGEARTLSAALVERMHMIDQLRAERDAAIALATSVSSSLATISKQV
FT                   ERDGHHG"
FT   CDS_pept        complement(69109..69321)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19871"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C045"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19871.1"
FT                   /translation="METKVFRTVVFEMTDAAKGQAFMKPLIEALGEDVEVAPGVRVTAV
FT                   SLRDEITAIETMEAGIDSAQVRVSL"
FT   CDS_pept        complement(69321..69668)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19872"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C044"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19872.1"
FT                   /translation="MSPYEAALQWIMSNPGSGSANSLAKLMMSLWNSRCAFAVSECVWN
FT                   LDGARSELALRAIERYLKEGETPEFNRVCEQIHEAHPRLWELGDAASRAKAQLREKWEL
FT                   EDRRNEDEEQN"
FT   CDS_pept        complement(69689..72637)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C043"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19873.1"
FT                   /translation="MNENALVVSAVEHGESSRFERLDAPRPGTYWRLLQDVTGEEDGKQ
FT                   IESNPLDAGIVLLLESIEYADGEPHVYKFAAHPGVPEREAYPSLFHADCFWRYWTYCPE
FT                   AALVRERELLALHQEMAQTQARLLEPPPAAKPIANLGYDPSAPTQSEGQALATPEQLRD
FT                   MTVYAERLKKNAEATQKWIAKHSEALKGQGEALARFHMERATVGLAAAQGQLDAVKGIL
FT                   RTVENLKIYTGDGVEVTQLRKGAPAPAELPLTIYQELLSLDEELLLHLEVNGLDHTHLD
FT                   SVATVLADDALLQRLVPAARGMVLCQFRSSYKEFVKPSRPGDIGAAMANQQLNKISQLH
FT                   MLLVRDGEQVYLVEGPEFLQKIKQLMPNAAEQLGHFSGRNGETIRRDDLAYAMAQRRQL
FT                   GALDAYAKVLTMLWGLRDRDVLFADWAVPAFASWLDWGFQERYLRLVDQSVMLGVERPG
FT                   YDAYRQQQNQYLAAGAWVAVRASALFEQRFIPGAFASQETRQFNNRWAHSRVYVLKQRM
FT                   PIIGCVRRDKRGDYIEVPLVHEGYNRSGREITGKLYLCREAMQEVLVLDRVDASDLTYY
FT                   LTSRAQRRSYNDYIQLFQAARTWVAERDSAEGPLRAELRQAVAAARIPHDADALEGAIT
FT                   AALAVARTARRDKCSPAPDSSSYSAYRKGALDTLHALLTDQAGRTAAVDAWCQRQGRRP
FT                   LRLVSTGKGQFKVYLEPVASEHQVLLGDARHASSAAVTFDPHTGEAVLGGWQRELLRAS
FT                   ASEHVIHDWKYITRFAGDPAATSYLDRHDRTIDDGAAKWLAHKSLLGTLRYDQAESLLA
FT                   LPVKQSDSFRRGLDMANLASHAISSRSNKIVRHRLRFAIGIVHARGRPCMLMAEHDSLA
FT                   YCYENANAAGKQACVDLIRAWYKTPEPAVQRLVQGELDWTPCYVDLSAVWTYRDQARCD
FT                   DLDHSGTVFESNVLDPALSEKENSERDIRCMGLTSVGAELFPWLASRTLQAL"
FT   CDS_pept        complement(72647..72871)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19874"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C042"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19874.1"
FT                   /translation="MMAQQLLLPAANEQQIEAKIEAILASRQHCNASGQAGEDVHLIRA
FT                   QLSQKSQESGTAHESVLATNHLTAKQSET"
FT   CDS_pept        complement(72868..73266)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19875"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C041"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19875.1"
FT                   /translation="MSENSQHQVIRNAPAPVIAHGQDNPAPNITPAALAQRLNRYADEL
FT                   SEVGRAYSATLLRAAACAISELLKAKAQAANSTAVPERRDELELQSSEQRSYNSGWNAC
FT                   RAAMLGSHTLPPVQCVDLPEAITAAATK"
FT   CDS_pept        complement(73687..74136)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19876"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C040"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19876.1"
FT                   /translation="MAAKLEIEKEREAVARAVCLACEEVPDHIGDAQGNAHRWQDYLPC
FT                   ADAAIAAFTSHEKGQQASHAVPPAAAPVQVEVLHVSGVPEACKHCGGTAFEWFAHKRAA
FT                   SDVVDGRLRTHEVQCSFVLGCLDCSETLMVVAADTIAGMLSTRSQ"
FT   CDS_pept        complement(74216..74692)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19877"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C039"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19877.1"
FT                   /translation="MATDESSIEPDIFLLQAVVNGEAWEHSWYVPRWGDPDPRRLDGAV
FT                   YEIDGRKIPNLGVYRVKGFYAEPKVPAVLPVDEQRDAERFRWLCDFAINHEEIDRGTPY
FT                   VVYGIGMGDCEPAVASEIRDMIDAAMARDKHWIAAQLQRTDGDKDAKATKAAKA"
FT   CDS_pept        complement(74679..74909)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19878"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C038"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19878.1"
FT                   /translation="MSAPMTLHASRRIERMGMTKTTTLCGRMNARSRDGMNIAGADEAV
FT                   TCKFCLAKAARLAKAAAPPFNTARVHAHGNR"
FT   CDS_pept        complement(74906..75220)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19879"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C037"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19879.1"
FT                   /translation="MTAVVAYWVAIAREHHRWAADTRAQLQDCRRHGLADRRKQLRKEL
FT                   QRQRDRRALAMVKARLTRDEVARVDALRLAELAHLTAGLVPGLTMGGRPVLAISSETSP
FT                   "
FT   CDS_pept        complement(75217..75522)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19880"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C036"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19880.1"
FT                   /translation="MLEAYRRWGICRCQLGHLLAASGAIQCRQSAVLFRLPQADDGLYV
FT                   VATTDDNDQDLCQVFVAQKVPRRTGHGPARYEQRPMTQRVRDRLLAGGFADEQLLP"
FT   CDS_pept        complement(76136..76408)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C035"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19881.1"
FT                   /translation="MTLPDERTRNLLQAGAFLKELAGSQAVPKSVRQEAYRLLRHYPTL
FT                   SDVEAIAQHEERLRDLTQSSFVRPYLTSQFEEDWFRGYPKGPHRT"
FT   CDS_pept        complement(76556..77497)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0070"
FT                   /product="putative cointegrate resolution protein T"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19882"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C034"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19882.1"
FT                   /translation="MTRGITESDVHGAADALVADGERPTVERIRAYLGTGSPNTVVRWL
FT                   ETWWQCLGSRLATDRQVRIATANVPEAVAALAGQWWTLALDHARAQADDAMASDRASLL
FT                   DARETLERDRHAMQAELARLESVTHAAQQAEQLAAARTSELERFVEQLQRQLAELSQQR
FT                   DASALRALGAESANEMLRVQLQELQDAARAERDTLTQHMRANEDRAHAEIDHARQESKQ
FT                   AKQQLAASQREAALDKRRLEEALEHAQGDVSALRQDLTIQQARADALEAQLVKLNDLPA
FT                   ALEAAWQQHVGRSPPKRPKPERSKRDRSKAVT"
FT   CDS_pept        77603..78688
FT                   /transl_table=11
FT                   /locus_tag="XCVd0071"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19883"
FT                   /db_xref="GOA:Q3C033"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C033"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19883.1"
FT                   /translation="MKDNSTSSALAQTVQHLVLPEQLAQQAADAVRELLAEAAAANTTR
FT                   SYASALRYWAGWHAARYGIELALPVPEATVLQFVIDHVQRRSTDGELAWELPPMVDQAL
FT                   VAAGLKAKLGPWTLATVRHRVAVLSTAHRLKQVANPCEQPAIRTVLSRAARAAVKRGER
FT                   PRKKTAITLPELEAMLATCDDSLEGIRDRALLCFGFASGGRRRSEIAAADLRDLRRIGE
FT                   AGYIYRLEHSKTQQAGVTVSSTPDKPVLDRAALALEVWLEASGITEGAIFRRLWKQRVG
FT                   PALSPAAVGEIVQRRARLAALEGDFGGHSLRSGFVTEASRQGVALPAIMQLTEHRAVAS
FT                   VIGYFQTGGAAANPAARLLED"
FT   CDS_pept        78912..80369
FT                   /transl_table=11
FT                   /locus_tag="XCVd0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19884"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C032"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19884.1"
FT                   /translation="MEAGHKSTGVTDTERMLADFCERSFLKLWTYPNPYKEDGKELCDV
FT                   LAVFGDHIFVFFDREKAYSQTPDADPLIAWDRWKRRAIDRQIITAHGAERYLRSGRPIF
FT                   LDAKQTVRFPLEVNRAATVHKIVVAHGAKDACARSSEQNIYGSLAITYCDLDQGHQPRP
FT                   FHVELDRQDPVHLFDSHNLPIVLGELDTISDFSRYLDEKVRAIRRFDVLAYCGAEDLLG
FT                   HYLLNFDQTTNVHRIGFDEPVNGVMIGEGEWHGLVNSALYQNTKREDEVSYFWDELIQR
FT                   TCQNLLDGTLGGNADLLRGQSAIVEMVKEPRFVRRALSSKIRENVINFPDTGGLTRLVS
FT                   LMPSFDPEVGYVFFQLRAPEAIRAQLDYLDKRRTLLEIACGAARNKFPHLRKVIGIGMD
FT                   APKFAGDTNSEDFILMPCEAWPDDVRDHYQALNEDWRFFDTPQLQQYEQTVTQFVPPNE
FT                   AFVGKKVGRNEPCPCGLGKKYKKCHGA"
FT   CDS_pept        80410..81795
FT                   /transl_table=11
FT                   /locus_tag="XCVd0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19885"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C031"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19885.1"
FT                   /translation="MHTISLPRFNALAAWCRFGPTMWILDEIAWFEAADGKLLGVIVRD
FT                   HTDGDFLGIYLAQDRVGRFRHISQTDAFFDTAEAAAAALVAGAPALLARLEAERGQGDE
FT                   EPAPVDFFRLEVARERLHPSFATLLDKEGFSPARAIVEAMMRWYEDVDGNFIEQFQTGG
FT                   FDARLLELYAYALLVENNFSLSREHAAPDFLAEDILGTIAVEVTTVNPTQDRQGNPQPP
FT                   PKITSEDERLAYLKHYIPIKFAGALKRKLGKAYWEMPHVAGKPLVFIIQDFHAAASMTF
FT                   ARTGLINYLYGYEHNAIQDAEGRLVVVATKVTEHRWGGRAAESGFFDLPGAEHVSAVIF
FT                   NSGATLSKFNRIGYVAGFGSRRVRMIRHGTVWNPDPDAAEPIPFAVRVDDPDYAESWTE
FT                   GLDVFHNPRAAIPLNPEHFPAAVHHYLLPDGNINSVQAGGLVQPLASMTNIYILETADV
FT                   KAL"
FT   CDS_pept        82142..83233
FT                   /transl_table=11
FT                   /locus_tag="XCVd0074"
FT                   /product="putative sigma-54-dependent transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19886"
FT                   /db_xref="GOA:Q3C030"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C030"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19886.1"
FT                   /translation="MTAPSSEAEWLALVREGCAGNAPAFQLRLSRLIARLRREKSALAP
FT                   LLAKALTEANSSRLTLARDAAAQQALVSPVDLDSNLALSTVQFPAFVEHAPVWPPAVEE
FT                   SLDGLMREWQNADRLREAGLSPSRTVLLSGPPGVGKTLAATYLAEQLHYPLITLNLAAA
FT                   VNSLLGKTGANLTRVLAHAKAQPCVLLLDEFDALAKRRDDGQDVGELKRVVNVLLQAID
FT                   EWPGTSLLVAATNHEELLDRAVFRRFDLWLRFPDSTARQVETLLAKLGASHAVARQMAP
FT                   ALAGKPLSDASRLVMRARREIALGGGELDEVLMRLALPGATDPAYREGLLQVMRLHADG
FT                   LSMRAIAKHVGVSAATVSRWLNK"
FT   CDS_pept        83244..85442
FT                   /transl_table=11
FT                   /locus_tag="XCVd0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19887"
FT                   /db_xref="GOA:Q3C029"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C029"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19887.1"
FT                   /translation="MAPTPRNTLIANGQALIGDLAWPTGGGPKWHPYDIAVQRDVLHPQ
FT                   LTAVARAAREVSRVYSPRGEVTARLTLHPTFLAKTHFPAHILRDAGLTVLGSRATQVTP
FT                   RVSQGDKQGPQDTAEILVAGTPEGFEAMDRQLGDPAIAKGRQEEFTHIESVLTYAGESK
FT                   LRLDPDTPWPDFVHVTLHAGEHDADLLTAFQTFTLQLGGEISARGFRFVPGLAFVAVQL
FT                   PADSVPELARFERIRLVRSMPRLREQLDLTAALTRKFPTLVLPASRLTAPGPRVAVFDG
FT                   GTQNSFGAHVVELAAPGLPPATVADLAHGVNVTSALLFGPVDPSHTALSAPPWMVEHHR
FT                   VLPTNDSPEQALDVLDRIVTALRIARTADRPYRFANISLGPVATFFDDDIHEWTSRLDT
FT                   ELADGRTLCTAAVGNNGALDGELGRIQPPGDAVNLFAIGAADTRHPKWNRAPYSATGPG
FT                   RSPGFVKPDVLAFGGSPAEPMPVYSPLAGGVVAVGGTSFASPLALRTALGVDVLSQSRF
FT                   DPITLQALLINAAECRRGHKRTDVGWGRIPLGPDAIVHTPLDVVRVVYQGITHPGHPQK
FT                   AVIPVPRGLPAGTRVRIGATFCYRAQVDSAHAINYTRAGLWVRCYKAPGQSLPLFGSGM
FT                   YKSEEELRRDAMRWDTVLNNACTVDAAELDAPYFHINYQVRDESEAVRWEDAVPMPYAL
FT                   IVTLQAPGVADLMTRVQAEFPVLQTLPVEVQVPVDGLS"
FT   CDS_pept        85510..85761
FT                   /transl_table=11
FT                   /locus_tag="XCVd0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19888"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C028"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19888.1"
FT                   /translation="MAKKHESSGPKVTRTASSVLRDSGASKTAKSLAGSTLAQAGTRKV
FT                   SSATTARTAAKALNDGRTSAGTKALAGSVLTQRPGKRK"
FT   CDS_pept        85900..86688
FT                   /transl_table=11
FT                   /locus_tag="XCVd0077"
FT                   /product="putative transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19889"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C027"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19889.1"
FT                   /translation="MVAEGVPRPWEPKMDAPEPDDLENLADPDLVERLRCVDWNDPQFV
FT                   SEERLVQLFLAARTAGHTARVGLCTCELSRRLLRRAMAFAKKNTLVPQHFSDYDEAAHD
FT                   LAGYVWERLLSGTNAEFAARRFGVFFENKSISYLRALLAQCRQRMDSLEEWHQGEHDDS
FT                   DEDDDAQAQPPEDDDCDDADATLRDDATPDRVLGHAMEFHQVHARLRALLTRNEYSVFV
FT                   MLWRKEMKIKEIAAALGVTPRMVNNHKRSIKAKMKKEFNV"
FT   CDS_pept        86685..87308
FT                   /transl_table=11
FT                   /locus_tag="XCVd0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C026"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19890.1"
FT                   /translation="MTSPNRRLSLEDVLDALFLRDDAPTPEMIVQACQAHAEFREEILE
FT                   FAALQAAQAALPDVAESDLEVSDASVMRLQSHVLNLLYGAPPTRADADAVRQAVRSLAG
FT                   QRLQAAAQAIDLGSTVLLHKVLTRAIIDTPRVVFVRLAQFLKVGVDGLVDALGPQLALH
FT                   RSYKAADKPTMVKQESWEQAVAALAVDEAEKARLRAMQDRSDPA"
FT   CDS_pept        87305..90616
FT                   /transl_table=11
FT                   /locus_tag="XCVd0079"
FT                   /product="UvrD/Rep-family ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19891"
FT                   /db_xref="GOA:Q3C025"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C025"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19891.1"
FT                   /translation="MTPFRRARLAAQQLRRQHCPEAAADGLRSFDLIARIAAAEAEDFD
FT                   ISSTRPDDTALCGADAVLVRAFRQILVRDDVEPPDRAFLVAHEFGHWILHPEEQEGCRQ
FT                   VIVSTLNPAEDDTLGAKRVEAYGARERAELQANVFARELLLPRPLARALFLAGHTASWI
FT                   AADLALPLELVRQQLLDALLLPEDGLADDAPEPALTPTDEQRDAARSPVRTSLVVAGPG
FT                   TGKTATLLMRIEHLLANGAKPAELLVLTFSNRAARELVDRLAANGVPDAHEMWVGTFHA
FT                   FGLEFLRKNHERFGLRPGFGVADKMAQIALLEPHIYGLPLRVFNPLGDPLPWLDQAVKT
FT                   MQRAKDELLDAVAFTRVVEAGAVQADAERLALDRDLALLYRTYEALLRANGGLVDFGDL
FT                   ILLPAQALRANRAEFAPSIGRFRHVLVDEYQDVNRASAELVKAIAAQADSLWVVGDPRQ
FT                   AIYRFRGASMRNIVRFADDFPQHREFRLNENWRSFEEIVRVVEHTGRDDNPLQGVLPLG
FT                   GVAPIRGPGGVRPTLVSCEDESIAFGELASRVLGLQAEGTAFREQVILANRHDTCDAAA
FT                   AALVAAGIPVLHLGDVFQRPEVKDLLALLQLFVDRSGSALVRIAQLPGLALPAPDVDVL
FT                   LDHLRHTRPAPLSWLQAPPADLSPAGAQALQRWRDTFGGLTSRDSPWDVICSLLFQRTR
FT                   WLADYANGSDMQAVTRRLALWQIIYYLRVPDGGRVYQTVGTFLTRLRRRLRLADDRDLR
FT                   IPPPEAELLDAVAVMTIHQSKGLEFEAVHLMDVDARHFERSDDAPWLPEVLTQSAGGVD
FT                   EARSEAANRLYVALSRARSSLTLYEEKGYFKAARAPAVQRAAHLLNCVVGTVAYAVGRH
FT                   AAALTALAPQVPVDLREFVTYRTCPRRYYYDVMKQLSPAAGLHPAARIEAAVMRELFVP
FT                   AGGDVSAPVNDVAVELAMLTEEYEPARPHLLAYAVQLLDAGRAWSGTVRAAMASPIDVV
FT                   CDGLPVRVTAHRVTRQDNVVTLHFVRAQPSSAYAKQHKILRWVLKCLNQQFRQYRFQGS
FT                   MYVLSSRVSEHVRPYQDLGFDHLVEMGHELMEGRFPAKPNAWVCSGCRHFLYCPA"
FT   CDS_pept        90720..91226
FT                   /transl_table=11
FT                   /locus_tag="XCVd0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19892"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C024"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19892.1"
FT                   /translation="MSTIRVYVQSEHFSNIKLVEVDDHATIADLKRAALTLLPAGTDPT
FT                   GLSLSIEDDDVDDDEAASKRRLKDLNPDRGVRVHLHRCKQVAVTVRFGGRSEEHPFRPA
FT                   TTIGRIRQWAGRRFGLKAGDIAEHVLQIAGSNEQPDMDTHVGTLVQHPRCAIVFDLVPA
FT                   HRING"
FT   CDS_pept        91226..91696
FT                   /transl_table=11
FT                   /locus_tag="XCVd0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19893"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C023"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19893.1"
FT                   /translation="MAAQVPPDEQSLRADLASACFLSGQDRGRWRLHRLDWPFVFIGVI
FT                   AGNGQEFVLRLDCRGFPTAPPTGTFWDLGAGVRLPDARWPRGGERISLAFRPDWKGGMA
FT                   LYVPCDRESLVGHDAWPAQYPQLIWNPARGISHYLEVVHELLQGIDHERAAA"
FT   CDS_pept        91677..92168
FT                   /transl_table=11
FT                   /locus_tag="XCVd0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19894"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C022"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19894.1"
FT                   /translation="MNAPQLEIAPTLWSAILAHLRQQGAGVRESGGFLLGRVRNGVRVV
FT                   TGFLPYEQLQADALQADFVHLSSASFSRLWDYCATHGLEVVADVHTHRYGAGQSRSDSE
FT                   NPMLAIAGHVALIVPEFAQGPTGFEHLGLYVYQGAHRWARYRGAAVAQVLKFTPPEGER
FT                   "
FT   CDS_pept        92165..93523
FT                   /transl_table=11
FT                   /locus_tag="XCVd0083"
FT                   /product="UBA/ThiF-type NAD/FAD binding fold containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19895"
FT                   /db_xref="GOA:Q3C021"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C021"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19895.1"
FT                   /translation="MTLFDADAMHRLAKLALDAGEVTTPDAALELFRQYRLRIHLGTGW
FT                   ANTLAGQACVLTAVSTASRALLGGVEVTGDLTPVMQVPLFAGQRAADVVAALGGAATAM
FT                   PTPRLPSLMIGDGPPPEGVALTLRPSWDGWCAQVAPADSDDHLTVGDDNPLAGVCAGAL
FT                   AVSEVFSHVRADSPEAGYRRIGLSLWNPLAIEDWNAPENRGPALAYLPTDLWLIGIGHL
FT                   GQAYAWGLAMLPYPAQRRPRLVLQDVDRVTESNLSTCLLVGADDVTARKTRVMARRLEA
FT                   IGFDIDLVDRRFGAQHLLQPGEPTVALFGVDNVAARRDLDTAAFVLIVEAGLGSGYRDF
FT                   RNLRLHTFPGPRPATELWPAQAASQPLTELNTAYQQLAHDSGDLCGVTMLASKAVATPF
FT                   VGAFAASLALAELVRPLHGGCVHASLDCPLRSLTHRLGEPTPANARCAFIALP"
FT   CDS_pept        93531..94070
FT                   /transl_table=11
FT                   /locus_tag="XCVd0084"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19896"
FT                   /db_xref="GOA:Q3C020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C020"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19896.1"
FT                   /translation="MKSSRHSNRHVSVADNTSAPTTWVERKLMFLQAYKGECGVAYLLG
FT                   VLGVFAPTTVALFIIDRPAYLAMGWSQSLLVVGAVGGMVTALLMCGLVIQAVAERRTPA
FT                   SAYERQRLMRDTLVCGSVMAMFAQFAGLTVALTSRMDIPSYAYTVLLIAVGYATAQGAS
FT                   ALLTRARQKVLARIGR"
FT   CDS_pept        complement(94208..94690)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19897"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C019"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19897.1"
FT                   /translation="MPWQNDLRRTSRDAVVAERVIVAVEQLLERDRHLFVHRVGERAIS
FT                   HRLAIYVEAQFPGWDVDCEYDRDNAARKMIPDGTGNDDDEGSAVLPDIIVHRRGPGENH
FT                   VVFELKKSSNRLPDDRDLEKLRAYGRHLGYAHGVFIRFVVGEPNPDISRAEFIYGD"
FT   CDS_pept        94907..96058
FT                   /transl_table=11
FT                   /locus_tag="XCVd0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C018"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19898.1"
FT                   /translation="MGSGGLARQGPGSGDIAQLNSAASLFLQVPMRITNDNYSPIELLA
FT                   EIATRRGTTSADTHRFFQGGKTSHDWLVEEWSSRVDCILESFKRYGIDVNATQFVRDQG
FT                   IDVLLRVPNHQGKEWRLGFQIKSEQEAERDRTKKPGQENMIGTLKRQAHDAFERVDEWW
FT                   ILCCFDLDKHYKLVQGISSELTGGKQNRLIRVIDPRACAAMLRMSEAEVDAFCTLLLCR
FT                   DDAVLRAAREEVAACHPNVGAFVLEHIVPALVDGERVSREEVASFLEEAFRKSERERLE
FT                   DGGGEDDDCEAVIELDEDADEHGSVQDGIDDDEEFEDLDIHEMLQELESNGFLAAGTYD
FT                   DDYRISPTAFPGVCALFFEARVRHGLNDDAAASYMRWLTLRQH"
FT   CDS_pept        96358..98460
FT                   /transl_table=11
FT                   /locus_tag="XCVd0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19899"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C017"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19899.1"
FT                   /translation="MNLEAFRQIVDSAGPGIAVCADDLQRLYEYVGLEGRGSYTRKAVS
FT                   DALYASIRSCFTSGHSAVWRACKSLRRDLIREHVLLGVSLDPYFDVLDHLQDAVRTDGA
FT                   SRASIEGDWNQAIRAALDHVQIHSRDQMNRTMLHARDFQVAEAARTLRDAGFSIRLEAG
FT                   RLGLEETSETALVAAIEDLSAAMGGINVARRIFNAISPHYDVDQQRYHVVRRTSMIGGG
FT                   LAQMPWGYMLQLAAKHARGRKPYKNNDDQWRMLCGLSQAYAAIFDVQPYTPTIYGTMDA
FT                   TGLVPYLQEMAIYDTLFRIPQMRPTDVVKIARGMFSWLDTSVPTKGGWSINHVLEIIDY
FT                   LLDPGRNARGPIFVTESDIRRSCSHIPREIVTQILSEVLSHPLSGANQNFSRPTDAPAP
FT                   EGPNVKSAGHDFFLRPLLRMSDQQFSLLDRSVCAPAFLEAMLTPLRAEIKGLDDKIGVA
FT                   IERFLEAEFASHGVPTGGGDYDVGGNHGECDLIIEMPDTVIFSEVKKKTLTRRAKAGSD
FT                   AHLLVDLANSLLVAQVQAGWHEVRLRQHGHLDLERNGTVMRLELNDRQVERVAVSLFDF
FT                   GSFQDRILLKQFLEATMYATFTPTALNLQSKFAEINAALIEIRDQVVALYPGQNEINQP
FT                   FFNCWFVSVPQLLVLLDGVTNAAGFKRALWSCRHFVTGSSDLYFDLSYRRQLERETAAN
FT                   PVTPAV"
FT   CDS_pept        98677..98829
FT                   /transl_table=11
FT                   /locus_tag="XCVd0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19900"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C016"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19900.1"
FT                   /translation="MVWDAHAKPYCGFLLQVTARRDALAERLEQKLRASGMLGIAPASS
FT                   GAKGQ"
FT   CDS_pept        complement(98928..99539)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19901"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C015"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19901.1"
FT                   /translation="MARGAISADECFVGYVPPTGIVSSPSRSICVDEVARWVRACRDRS
FT                   IVGCTYQSMEEEGPKAVRLSPHALGFDGLRWHIRAYCHERMIFRDFAIGRLGIQIVEEG
FT                   DSHVDPREDVGWTTLVEVVLVPHPKLGRLQREAVARDYGMSSDRHVLTCQKAMLFYTLR
FT                   HLNLESLSVSERAAEQHVIVENVEQVKRWMEEDRAGIQGL"
FT   misc_feature    99590..100815
FT                   /locus_tag="IS_1477_pXCV183_1"
FT                   /note="IS element 1477"
FT   CDS_pept        99654..99920
FT                   /transl_table=11
FT                   /locus_tag="XCVd0090"
FT                   /product="IS1477 transposase fragment"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19902"
FT                   /db_xref="GOA:Q3BZL7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19902.1"
FT                   /translation="MKKSRFSTEQIIGFIKQADAGMAVAELCRRHGFSPASFYQWRAKY
FT                   GGMEADEAKRLKELEVQNTRLKKLLAEAHLDIEALKVGFGVKR"
FT   CDS_pept        99953..100786
FT                   /transl_table=11
FT                   /locus_tag="XCVd0091"
FT                   /product="IS1477 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19903"
FT                   /db_xref="GOA:Q3BZL6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19903.1"
FT                   /translation="MLEHTPLSERRACRLAGLSRDAFRHAPVPTPATQALSARLVELAQ
FT                   THRRFGYRRLHDLLRPEFPSVNHKKIYRLYEEAELKVRKRRKAKRPVGERQKLLASSMP
FT                   NDTWSMDFVFDALANARRIKCLTVVDDFTRESVDIAVDHGISGAYVVRLLDQAACFRGY
FT                   PRAVRTDNGPEFTSRAFIAWTQQHGIEHILIEPGAPTQNAYIESFNGKFRDECLNEHWF
FT                   TSLAQARDVIADWRRHYNQIRPHSSCGRIPPAQFAANYRTQQANNAVPFNPGLYQ"
FT   CDS_pept        complement(100891..101652)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0092"
FT                   /product="cointegrate resolution protein T (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C012"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19904.1"
FT                   /translation="MGASNQTACAVPEAGVIILQLSGGWARFGCFLYQSLPTLVLQAER
FT                   EAGDAARGEVARRTTELAQLEERIAGLTARLAEHQSHARSLEQKHDHAREALEHYRTSV
FT                   KDQREQEQRRHEHQVQELQVALRQANEALTAKNHDLMQLNRENGQWLERHTRLERELTQ
FT                   TRQRADAQQRERDALRLAAAEHQGLQARWTKDVQALEGVRAELAAASALRWRTRKRHRS
FT                   RCNARRQMISRLAKARESSASVPSSSQPGFR"
FT   CDS_pept        101887..102924
FT                   /transl_table=11
FT                   /locus_tag="XCVd0093"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19905"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C011"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19905.1"
FT                   /translation="MRKFKSKYMLGACIVGSIVSAGAAAQVAAINNTGRAEAMSAWETT
FT                   LKHEAPAMEGCFSSTFPDMGWQAVRCGAPPKLVMKPRHVASGNVRTTTDNRVLITGNGD
FT                   DYAARTGRLTHSAVGSFPSVSGVTTGVVQYSLQINTDNDSNPAACAQFGFSSCKTWQQY
FT                   VYSSDADEDSSNGFDPVIFIESWVYADSTSEYDAAGCPSGWDAYEGNACVINSESVRVP
FT                   LVPVSGIAGVKLTGSATSGGVDTVSFSVNGRAYSVSQRASTVDINKIWRLTEFNIFGNG
FT                   ARTQTVSFNRGSHVTVNVAVNDGTTNAPTCLGNAGQTFEQNNLTRGSCSVFGGASPGIS
FT                   FPQSN"
FT   sig_peptide     101887..101961
FT                   /locus_tag="XCVd0093"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(102912..103979)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0094"
FT                   /product="cointegrate resolution protein T (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19906"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BTA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19906.1"
FT                   /translation="MARSGLYKSDVQRARDSLRATGKNPSVDAVRVALGNTGSKTTIHR
FT                   YLRELEEEEGQGVGAKMAVSDALQDLVARLAERLHGEADTVVAQAQARFQAQLQERTQT
FT                   LEQARQEADSLTTQLQRCETVLQAECEASATARSEVASRTTELAQLEERIAGLTARLAE
FT                   HQSHARSLEQKHDHAREALEHYRTSVKDQREQEQRRHEHQVQELQVALRQANEALTAKN
FT                   HDLMQLNRENGQWLERHTRLERELTQTRQRADAQQRERDALRLAAAEHQGLQARWTKDV
FT                   QALEGVRAELAAVRTDLIEERQRREHAEADTLRATVRLSTLEQLLAQLRPPRPVGEQVT
FT                   SGKDETSPDANSQLL"
FT   CDS_pept        104170..104373
FT                   /transl_table=11
FT                   /locus_tag="XCVd0095"
FT                   /product="cointegrate resolution protein S fragment"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19907"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C009"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19907.1"
FT                   /translation="MISVGQYLEAATRPNTQRAYAAATRHFEVEWGGHLPATAEQVARY
FT                   LAAYAGQLALNTLRHRLAALAQ"
FT   CDS_pept        104425..105138
FT                   /transl_table=11
FT                   /locus_tag="XCVd0096"
FT                   /product="putative cointegrate resolution protein S"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19908"
FT                   /db_xref="GOA:Q3C008"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C008"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19908.1"
FT                   /translation="MLKGIQTVHPSQEKRATPLQLTQLGQVVDWLDGAATAAGTRDDAA
FT                   GRLRHLRDRAFVLLGFWRGFRGDELVRLQVQDLELVAGEGMTCFLPHSKSDRQHAGTTY
FT                   KVPALSRWCPVAATMTWVAAAALHEGPLFRAVNQWGGIAAAPLHPNSLVPLLRRIFREA
FT                   GLSSPDDYSGHSLRRGFAGWANANGWDVKALMEYVGWRDVHSAMRYLDGADPFARRRIE
FT                   ASLPEAPALPRPATT"
FT   CDS_pept        105147..108110
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="XCVd0097"
FT                   /product="Tn5044 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19909"
FT                   /db_xref="GOA:Q3C007"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C007"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19909.1"
FT                   /translation="MASIERTAYPQFKRNPVVRELVAAYTPTDAEVAFVAEYTRQPAHR
FT                   LTLTILLKTFQRLGYFPVLDEVPPAVVRHIRSALKLRVQVKPANLANASRYRYYRRIRQ
FT                   FLQVRAYSDGGLKIAARAVYEAAAVMDNPADLINVAIEQLVRDRVELPAFSTLDRLTRR
FT                   IRSLVNGHYFAQIEARLTIDEKQRLEGLLHVEQGRQKSPLHAIKRLPKRSSLQHFQELI
FT                   DHIAELGELVGSEVHLAGIREVKRKHFAAEARALDASELRKFRPGKRYAVLVCLIHRAR
FT                   VQTRDDLAEMFIKRMGNIHNRGREELERLRARYREKTEAIVATMSDVVRVLDHHRGDTE
FT                   AGREIRRLVNAHGGVQTLQADCNAIAAHSGDNHLPLLWPFYKSHRSTILRMVRRLDLAS
FT                   TTEDRSLIDAIELILTQERSRSHWLDEAVDLAFTTQLWRKTIVHRTEVGGEERIHRRLF
FT                   EVCVFSSLANELKSGDVAVRGSETYADYREQLLPWEQCEPLLEDYCKQVGLPATAVGFV
FT                   NALQSRLTQVAELTDQGYLENGQVVIGEDGIPVLKRSKAKEMSCGARALETAVLDRMRE
FT                   RSVIEILCDVAHWTRWPRHFGPLSGSDAKIEQPTERYVLTAFTYGCNLGPAQAARHLRG
FT                   AVSAHMLSFVNRRHVDANKLAAACRDIINSYAGLQLPKCWGDGKSAAADGTKYDLYDQN
FT                   LLASYHIRYGGYGGIAYHHVSDTYVALFSHFIPCGVWEAVYIIDGLLKNTSDIQPDTVH
FT                   ADTQGQSLPVFGLSHLLGIQLMPRIRNWCEYKFFRPDEDIRYEYIDALFRDTVDWDLIE
FT                   THWKDLMQVVLSIKTGKIAASTLMRKLGNYSRKNRLYQAFKALGSAVRTLFLLQYISNR
FT                   ELREQITASTNKVEAYNGFAKYFFFGGEGVIADNDPVEQEKAVQYNDLVSNAVIFYNVV
FT                   EQTRIMKSLMRQGWKITREDVAFLSPYVTSHVKRFGDYLIDVEEVPEPYETELALAG"
FT   CDS_pept        complement(108441..109667)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0098"
FT                   /product="putative replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19910"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C006"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19910.1"
FT                   /translation="MKKISELTAQPTSAEMLQWRDGYRHHLESKGIPPESAADLAAKVS
FT                   YRADLYPTDLAATRPLFQVEPPTAPGEQATDAKVPPLKDSRPDKAKPTKAAKLKRVEPA
FT                   ALERKPKTTTATAREERLIKTAAEIAGERPDDDDRAYMHSIMCQVGLPRSKVDGTSFER
FT                   HSGGAALLVEAGKLWDGKQFVQQPIPYGAMPRLMLAWMNTYAVRFNSPEIPVGDSASEF
FT                   LRMLGQKNITGGERGTFTNFRKQVQALSACRMTLGFNANGRAHTYEGKPIKHFEAWINL
FT                   EEKQRALWPGSVTFSQDYYLTLKDHAVPLDLRAFMELKGSALDLDVYAWLAQRLHRIEG
FT                   RPVVLYWTNLRDQFGQEYQGKEADKDFKKKFLPSLRRVLAVYPDAKVKQVTGGIMLMAS
FT                   PPPIPYKGS"
FT   CDS_pept        complement(109947..111134)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0099"
FT                   /product="putative Zeta toxin of the postsegregational
FT                   killing system"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19911"
FT                   /db_xref="GOA:Q3C005"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040782"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C005"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19911.1"
FT                   /translation="MDEKRFQLSTRKHTAAYEKIERHHFKDTAPADQPQAIILGGQPGA
FT                   GKSGLLEASKQGFADRNVVTINGDELRYYHPQYRDIQKADERRFAELTDPHARPWTKQL
FT                   FDRTIETRRNVVFEGTMREAGPITETMRRLKEAGYYVVARVIAANERDSMAGIHRRYEE
FT                   QKAAKGFGRWSNVQAHDDAYKGMPATLEYIEHNKLADRVQVYDRKGNVLYDNELQGNEW
FT                   KRQPAAKTAIEAERERPPTPEERRQQEAEWATILAMMTARRADEREIERVRDVARQYGG
FT                   QQYPEHKPAEYERQDYGRQQPELRAPETGKTYQGPIVSADDKHVIQSVREAGRELHIQH
FT                   ERLVLNSDRRELLNAGTNVEIRYPYNRVGIVKEWGAKEIQGPASKGIEPKDFGKR"
FT   CDS_pept        complement(111141..111404)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0100"
FT                   /product="putative epsilon antitoxin of the
FT                   postsegregational killing system"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19912"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C004"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19912.1"
FT                   /translation="MNTPLSPIAKTARLEAATETLAEYIGYLNSEIDAEQDKAEPNAGR
FT                   IEALEHELEIVVDERRAITPDNLSLINRALYVYAPLLKPMHG"
FT   CDS_pept        complement(111429..111830)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19913"
FT                   /db_xref="GOA:Q3C003"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C003"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19913.1"
FT                   /translation="MKRYMLDTNTVSHLVKSHPAVSRRVIEVPMTALCMSAITGGELMF
FT                   GLAKVPDAKRLQQAVMELLRRVDVLPWDGAVMERYGSVRADLEKQGKALGSLDMLIAAH
FT                   ALETDSVLVTNDAAFSRVVGLTVEDWTRS"
FT   CDS_pept        complement(111827..112087)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19914"
FT                   /db_xref="GOA:Q3C002"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C002"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19914.1"
FT                   /translation="MSQVAKLFINGRSQAVRLPAAYRFTEKEVFIRQDPETGDVILSRK
FT                   PATWEDFFIALKSADVPANFLDAAERNQGTQDRDPFAGWRE"
FT   CDS_pept        112277..112843
FT                   /transl_table=11
FT                   /locus_tag="XCVd0103"
FT                   /product="Site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19915"
FT                   /db_xref="GOA:Q3C001"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C001"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19915.1"
FT                   /translation="MVLIGYARVSTAEQDTALQTDALRKAGCARVFEDTASGAKADRPG
FT                   LADALAYLRAGDVLAVWRLDRLGRSMQHLIETIAALEARGVGFRSLTESIDTTTPGGRL
FT                   IFHVFGALGQFERDLIRERTKAGLTAAAARGRKGGRKPVVTADKLQRAREHIANGLNAR
FT                   EAATRLKVSKTALYAALQSTSAADS"
FT   CDS_pept        complement(113115..114452)
FT                   /transl_table=11
FT                   /gene="avrBs1"
FT                   /locus_tag="XCVd0104"
FT                   /product="avirulence protein AvrBs1"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19916"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C000"
FT                   /protein_id="CAJ19916.1"
FT                   /translation="MSDMKVNFSSKIIDSTPSEEEVATQQDSYTKSGLVAPSLDSQALK
FT                   KAPRKRVIKENIAALHTSSLERVHQKKVLVQNLAQLQRGLAKINGRVELEELIDGFSVK
FT                   ELLIKRNPKIAEEYGEGNPLMIRSLRFSNPQEVTSKLGAEGKTPAKREVDTICNKSTLH
FT                   DIVMTPASLVKKEVRMNLISEVPRAKDKQKYRGLPSVVYGQSSRRSESDYLTSRNGFGD
FT                   VHSFKSNNAFNSDYEKICGSLSHAEKLGLIERNLTPFIRHDPDRISTDFVHSIEELAEH
FT                   QMLLQSRKPASALRHNEYCTKLELWDAKAIAVGESRALAVATLIEFNLEMLSIAQEIDD
FT                   DGHKSKMVADFIERQLSWLGPQTALDSKSTLERVSAVTIQEREFIANEISRSLRQGVSL
FT                   CTYDKDEAGSHIREMSLLDFRVEEIIEGISIFISSKLLHVTNAGEA"
FT   CDS_pept        complement(114543..115613)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0105"
FT                   /product="putative tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19917"
FT                   /db_xref="GOA:Q3BZZ9"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZZ9"
FT                   /protein_id="CAJ19917.1"
FT                   /translation="MPNKISGSIAPSASSDAMKSADCAENIKEEVVSKHVHQAVPAELA
FT                   DLPSRQPPRSKTALYQVIQKFRDPLPLPPPPTSHPVLAYDRDLGSSDNFRSSDEFDLPE
FT                   SLNPTGWKNLHVSGSGSIASIGQITRLRPSKERPVVVLDAREESHAIVGGYPGTWRTPN
FT                   NWGNAGKSRDEALADEQQRIQALKSQETVHIFHRKDVKSEARNPRGATLSKPLIFSEEE
FT                   LVRAAGAKYVRLTVTDHLSPRADDIDAFIAMEREMAHDERLHVHCGMGLGRTTIFIVMH
FT                   DILRNAAMLSFDDIIERQRKFNPGRSLDNNKDVSDKGRSEFRNERSEFLPLFYEYAKQN
FT                   PKGQPLLWSEWLDHNA"
FT   CDS_pept        complement(115889..116347)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0106"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19918"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19918.1"
FT                   /translation="MASGLMCARPSCSWGVVQKTVGCSRSTISKAVRFAGRTTRAPALA
FT                   STPASLSVTVILWLHVENGSKFTRGKKRVREDVGSLVTRFYDSTKLNDAEYRLVIRYAN
FT                   DADLKERLDGLLHEICHLADLRNCVVDDISVKNEANGLYWDECDGGWK"
FT   misc_feature    116585..117673
FT                   /locus_tag="IS_Xac2_pXCV183_1"
FT                   /note="IS element Xac2"
FT   CDS_pept        116655..116921
FT                   /transl_table=11
FT                   /locus_tag="XCVd0107"
FT                   /product="ISxac2 transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19919"
FT                   /db_xref="GOA:Q3BY12"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19919.1"
FT                   /translation="MKKSRFTDSQIIAVLKQAQAGAPVPELCREHGISSATFYKWRGKF
FT                   GGMDVSMVARMKELEEENRRLKKMYAEAQLSTDLLKEALAKKW"
FT   CDS_pept        116915..117712
FT                   /transl_table=11
FT                   /locus_tag="XCVd0108"
FT                   /product="ISxac2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19920"
FT                   /db_xref="GOA:Q3BZZ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19920.1"
FT                   /translation="MVRPSQRREMAQSAVTSGRTNIRHACQTFAVSETCFRYQAKASEE
FT                   NARIADWLVRLTSAHRDWGFGLCYLYLRNVKGFGWNHKRIYRIYRELELNLRIKPKKRL
FT                   VRERPEPLAVPEAINQVWSMDFMHDQLADGRSFRLFNVLDDFNREGLGIEVDLSLPSAR
FT                   VIRSLEQIIEWRGKPAVIRCDNGPEYISGALLSWAQRHGIRVEHIQPGKPQQNAYVERY
FT                   NRTIRYAWLARTLFDTIDQVQDKATRWLWTYKGFGEQWNREVS"
FT   CDS_pept        complement(117717..118640)
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="XCVd0109"
FT                   /product="Tn5045 resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19921"
FT                   /db_xref="GOA:Q3C0C3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19921.1"
FT                   /translation="MKIGYARVSTREQNPALQVDSLKAAGCERIYQDVASGAKTARPAL
FT                   DELLGQLRGGDVLVIWKLDRMGRSLKHLVELVGSLMERKVGLLSLNDPIDTTSAQGRFV
FT                   FNLFATLAEFERELIRERTQAGLTAARARGRVGGRPKGLSPQAEATALAAETLYRERKL
FT                   SVAAIAQKLHLSKSTLYSYLRHRGVEIGPYKQSAQSPINVSVVESGNADQPKVATILLT
FT                   LRIENNSKFVRGKKRSIEHVEFFDLAQYDATRRPNGEYELKVPYDTDEELDEAVNDLLT
FT                   DIACGADDRHCFSESHARMEGTDRHW"
FT   CDS_pept        118855..119094
FT                   /transl_table=11
FT                   /locus_tag="XCVd0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19922"
FT                   /db_xref="GOA:Q3C0C4"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR031914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19922.1"
FT                   /translation="MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYL
FT                   FERAVEQAKAATVGMGETELNDLIDEAVQWAREH"
FT   CDS_pept        119094..119513
FT                   /transl_table=11
FT                   /locus_tag="XCVd0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19923"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19923.1"
FT                   /translation="MRVVLDTNVLLAALISSHSPPDIIYRGWLAARFELVTGTAQLDEL
FT                   RRVSRYPKIKAILPAHRVGTMINNMQRAVVLHVLPPLPDRIEVNDPNDAFLLAMALASE
FT                   ADYLVTGDRRAGLLQRGSIGRTRIVTPVTFCAEAL"
FT   CDS_pept        119518..122493
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="XCVd0112"
FT                   /product="Tn5045 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19924"
FT                   /db_xref="GOA:Q3C0C6"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19924.1"
FT                   /translation="MPVSFLSTTQRERYGRYPDTLSSEELARYFHLDDDDREWIATKRR
FT                   DSSRLGYALQLTTARFLGTFLEDPTAVPSPVLHTLSSQLGIADPSDCVIDYRTTRQRWQ
FT                   HTSEIRTRYGYREFTGTGVQFRLGRWLCALCWTGTDRPSALFDYANGWLVGHKVLLPGV
FT                   TLLERFIAEIRSRMESRLWRLLVHGVTPEQRQRLDDLLKLVEGSRQSWLDRLRKGPVRV
FT                   SAPALVAALLRIETVRGLGIKLPGTHVPPSRIAALARFASTAKVSAVARLPEVRRIATL
FT                   VAFVHCLEASAQDDAIDVLDLLLRELFTKAEKEDRKVRQRSLKDLDRAASTLAEACRML
FT                   LDPALPDGELRERVYAAIGHDELAQALNEVRGLVRPPNDVFYTELEARKATVSRFLPAL
FT                   LRVIRFDANPAAQPLAQALQWLHEKPDHDPPTAIVGKAWQRHVVQDDGRINATAYSFCA
FT                   LDKLRSAIRRRDVFISPSWRYADPRAGLLAGAEWEASRPIVCRSLSLSAQPEATLSELT
FT                   RELDETYRRVAARLPQNDAVRFENVGDKTELVLSPLEALEEPPSLIALRNEIKARMPRV
FT                   DLPEILLEVAGRTGCMEAFTHLTERTARAADLTTSLCAVLMAEACNTGPEPLVRPDTPA
FT                   LKRDRLMWVDQNYVRDDTLTACNAVLVAAQSRIALARTWGGGDVASADGMRFVVPVRTI
FT                   HAGPNPKYFNRGRGVTWYNLLSDQRTGLNAITVPGTLRDSLILLAVVLEQQTELQPTQI
FT                   MTDTGAYSDLVFGLFRLSNYRFCPRLADVGGTRFWRVDPDADYGDLNALARQRVNLDRI
FT                   TPHWDDVLRLVGSLKLGLVPAMGIMRTLQVDERPTSLAQAIAEIGRIDKTIHTLNFIDD
FT                   EARRRATLLQLNLGEGRHSLAREVFHGKRGELFQRYREGQEDQLSALGLVVNMIVLWNT
FT                   LYMDAVLTQLRSEGYPVKPEDEARLSPFGHEHINMLGRYSFSVPEAVARGELRPLTKPN
FT                   DP"
FT   CDS_pept        122512..123210
FT                   /transl_table=11
FT                   /locus_tag="XCVd0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19925"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19925.1"
FT                   /translation="MQQMTQQPLNDAQLDRLGDFLEGVGAPAMNLEMLDGFFAALICGP
FT                   ETVLPSEYLPQVFGEDHCFDSNDQAAEILGLVMRHWNTIASELFRTLEKDDVYLPVLLE
FT                   DADGAVHGNDWARGFMRGIQLRPNSWQELIGSEEFGGPMLPIMILTHEHDPDPAMRPPE
FT                   IAPDKRDELLQSLIAGLTHIYRYFASHRQLATQGPLRRQGPKIGRNDQCPCGSGRKYKH
FT                   CCATSAPTFH"
FT   CDS_pept        123354..124199
FT                   /transl_table=11
FT                   /locus_tag="XCVd0114"
FT                   /product="putative cointegrate resolution protein S"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19926"
FT                   /db_xref="GOA:Q3BZZ0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19926.1"
FT                   /translation="MARYLAAYAGQLALNTLRHRLAALAQWHQAHGFADPTRAPVVRKV
FT                   LKGIQTVHPSQEKRATPLQLTQLGQVVDWLDGAATAAGTRDDAAGRLRHMRDRAFVLLG
FT                   FWRGFRGDELVRLQVQDLELVAGEGMTCFLPHSKSDRQHAGTTYKVPALSRWCPVAATM
FT                   AWVAAAALHEGPLFRAVNQWGGIAAAPLHPNSLVRLLRRIFREAGLSSPNDYSGHSLRR
FT                   GFAGWANANGWDVKALMEYVGWRDVQSAMRYIDGADPFARQRIEASLPEAPALPRPATT
FT                   "
FT   CDS_pept        124208..127168
FT                   /transl_table=11
FT                   /locus_tag="XCVd0115"
FT                   /product="Tn5044 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19927"
FT                   /db_xref="GOA:Q3BZY9"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19927.1"
FT                   /translation="MASIERTAYPQFKRNPVVRELVAAYTPTDAEVAFVAEYTRQPAHR
FT                   LTLTILLKTFQRLGYFPVLDEVPPAVMRHIRSALKLRVQVKPANLANASRYRYYRRIRQ
FT                   FLQVRAYSDGGLKIAARAVYEAAAVMDNPADLINVAIEQLVRDRVELPAFSTLDRLTRR
FT                   IRTLVNGRYFAQIEARLTIDEKQRLEGLLQVEQGRQKSPLHAIKRLPKRSSLQHFQELI
FT                   DHIAELDELVGSELHLAGIPEVKLKHFAAEARALDASELRKFRPARRYAVLVCLIHRAR
FT                   VQTRDDLAEMFIKRMGNIHNRGREELERLRARYREKTETIVATMSDVVRVLDHHRGDTE
FT                   AGREIRRLVNAHGGVQTLQADCNAIAAHSGDNHLPLLWPFYKSHRSTILRMVRRLDLAS
FT                   TTEDRSLIDAIELILTQERTRSDWLDEAVDLAFTTQLWRKTIVHRTERGEERIHRRLFE
FT                   VCVFSSLANELKSGDVAVRGSETYADYREQLLPWEQCEPLLEDYCKHVVLPATAVGFVN
FT                   ALQSRLTQVAELTDQGYLENGQVVIGEDGIPVLKRSKAKEMSCGARALETAVLDRMPER
FT                   SVIEILCDVAHWTRWPRHFGPLSGSDAKIEQPTERYVLTAFTYGCNLGPAQAARHLRGA
FT                   VSAHMLSFVNRRHVDANKLAAACRDIINSYAGLQLPKCWGDGKSAAADGTKYDLYDQNL
FT                   LASYHIRYGGYGGIAYHHVSDTYVALFSHFIPCGVWEAVYIIDGLLKNTSDIQPDTVHA
FT                   DTQGQSLPVFGLSHLLGIQLMPRIRNWREYKFFRPDEDIRYEHIDALFRDTVDWDLIET
FT                   HWKDLMQVVLSIKTGKIAASTLMRKLGNYSRKNRLYQAFKALGSALRTLFLLQYISNRE
FT                   LREQITASTNKVEAYNGFAKYFFFGGEGVIADNDPVEQEKAVKYNDLVSNAVIFYNVVE
FT                   QTRIMKSLMRQGWKITREDVAFLSPYVTSHVKRFGDYLIDVEAVPEPYETELALVV"
FT   CDS_pept        127474..128784
FT                   /transl_table=11
FT                   /locus_tag="XCVd0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19928"
FT                   /db_xref="GOA:Q3BZY8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19928.1"
FT                   /translation="MGTNAAIEKTQQPPLRQATVLVPAAKMPEFTKRLEALNKKAAKFG
FT                   LDALTVELAHVTPYLQQRRVHGAGEEVTLVPWTTSAPLPADAVGLIDMHSLLLRFPLVK
FT                   LGDWHVVAQLDATPAAGALVFAVTDVADDRTEAARRRDHPMHCEHCHTARARKQIYLLR
FT                   NTNTGAYQQVGSTCLQDFTGIDPARALFLAKLADFQRYADALGDQAAAGAAGAVATLDY
FT                   LARVVFLCESSSFIPVSKARELRIDATYLQATELSDAHRRNPAAGRAFAAARERLQAEA
FT                   AAVVAWFAGREPTDAFEANVKAVLASDTIKADARHLATAAAAVPTYQRHQSAAQLLLRA
FT                   ARSAHVATEGDKLERPLRVYQVATIDSHFGPQERVSLVDDDGNCFTWRTAAAPGELLRP
FT                   SNRERRFDAGFKIKKHITSQGTAITEISHVRVKRWLP"
FT   CDS_pept        129011..129280
FT                   /transl_table=11
FT                   /locus_tag="XCVd0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19929.1"
FT                   /translation="MLINGVVVDDIALDEVKDADKIVINGGVVFADENDRAGCSATSHF
FT                   NRWKKAQTTQFVSVQVSNDDVQALQELLAQFGQGRTNFKVTLGS"
FT   CDS_pept        129663..130436
FT                   /transl_table=11
FT                   /locus_tag="XCVd0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19930"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19930.1"
FT                   /translation="MVILCAQQNPKPHHQTRRNDREHDAMTHNEAITAPETSPQLVSIP
FT                   PQVIQAAAIASAGGAAEWNLLSARAQQEAHADCEVIIRTAVSALRQAGVASDGSDASTI
FT                   TTIRRLRAALELIATQGPHFGHDGTQETWMHWADIARKALTDQAAGYKHLSPQPDQIPT
FT                   ISQQREPSYWTETLLASAEKLRVRIGGQPDGDADDLERLAAAIRAPNGYIVKVGGAAYR
FT                   YDLCASTAAYAREAALATGLEPEDFTVEPFLVIHP"
FT   CDS_pept        130456..130926
FT                   /transl_table=11
FT                   /locus_tag="XCVd0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19931"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19931.1"
FT                   /translation="MTPTSSRIQRVRQAGSEHQVVTVQSPKQASARYCKRPCPDCPWRV
FT                   DAVGKWPAEAFRASAETAYDMATHTFACHSAGATNPRLCAGFLLRGADHNLSVRLERMH
FT                   GRVGSDVEDGGQILYPSYVAMAVANGVPSNDPALQACRESYFEAQQVDSGEQ"
FT   CDS_pept        130923..131813
FT                   /transl_table=11
FT                   /locus_tag="XCVd0120"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19932"
FT                   /db_xref="GOA:Q3BZY4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19932.1"
FT                   /translation="MTTAPEVSDFAVNQPVLGKLTERALARFQKAIDRRKKRYLDFDKF
FT                   RDHAAARIRALASENEQIAYFLSYGFYVLEGGKTAGWDDSVVKVQFGSRPYLTAYSEPQ
FT                   LVYGEMSKSLRVFTEQGASLLYQRGDDGHVMCLLYPASSEREPKTVSMVVLKVVNDPSN
FT                   LLNDRLLRSHLKTLAAYMAVTSLDGSPTMLQRCRYWWLHLTKQRTIGGVVRPRQIQVIA
FT                   GKLLLWVATVAFSGIALFLIQRRWPEKDAVTPAVLQASQAAQRSARVKRSSECWNRSET
FT                   QWRHLLQPGRRHRRQ"
FT   CDS_pept        131923..132363
FT                   /transl_table=11
FT                   /locus_tag="XCVd0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19933"
FT                   /db_xref="InterPro:IPR021686"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19933.1"
FT                   /translation="MHSEFDPWHPSSAAIARVKNALTAPTRHDCGGIVEIRSHREVFGR
FT                   NYGNWPWVYFCTHCRARVGMHPFTDIPLGTLADEPTRNARTAAKTLFEQLWRRADSPLS
FT                   RSAAYAWLANQLSLPMSACHFGLFDIATCERARLACRQYLEP"
FT   CDS_pept        132385..133605
FT                   /transl_table=11
FT                   /locus_tag="XCVd0122"
FT                   /product="putative integrase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19934"
FT                   /db_xref="GOA:Q3BZY2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19934.1"
FT                   /translation="MTRPPAPRPTNEHTKRVRARSPYLVTPQARELQNALQALAAPPEG
FT                   PLVLADIPVVVLGVRFDLSPEQIERATAVLQDLYKHDIKPYADNSRKAIRSDWRHWVAF
FT                   CAQGDRVCMPVQLDDLVEFLNSLIAAGYKRATLEHLLFTLKLASRLWSCTCPTETLQFR
FT                   WYWQQQCREQLTARNHQAPALNVETVDNIVEAPTRASGLAGLLELRDMVYVSMSYDLLG
FT                   RASEMVRLRWSDVRFDADVDGGATCTIARSKTDQQGAGVALYLSPRSAHLLDTWQTQRL
FT                   LAADYLWPAARLEYLHNPYVFHRLPRHKLFKPGPTADAKRLRWDAHLNVREADRIIKRA
FT                   AGDQFSAHSARVGAAQDMTRAGMDLPAIMQQGRWNTPTMPARYAENELATRAGKNRQTA
FT                   LAKLKNS"
FT   CDS_pept        133673..134068
FT                   /transl_table=11
FT                   /locus_tag="XCVd0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19935"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19935.1"
FT                   /translation="MLTNEGTHQLVEESGLFDARTALNTLTRLEYNGLPVLASYDLTTT
FT                   KLRVTWNVPAQCRIQVPEPMVGETLAALRYLSGIALRRSFTKGIWRTTVVIASWQLTDV
FT                   DEDDDTEQDLSQTQATLHLALPFGSQI"
FT   CDS_pept        134115..135140
FT                   /transl_table=11
FT                   /locus_tag="XCVd0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19936"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19936.1"
FT                   /translation="MGGNALKTVATHRLSAASYRQLAAQVMDTLQSESGFRVELVRSFG
FT                   AKADFGDMDVIADRSTLPADVAALMRHLFNPHEVVSNGNVLSFDVAAFQVDLVCVPASE
FT                   YDTARDYFAFNDLGNLMGRTAHRMGFTYGHNGLRYKVRDGDYLVADLTVTSEMPAAFAF
FT                   LGYDYRRFDQGFHTLEEVFAFAASSAHFNPAAYPLESRGHRDRVRDQKRQNYRLFLEWL
FT                   QTAGVAAGASADLQREHHLQRALKQFPAFAEALSQSQEALAGARRRKQLFNGQIVAELT
FT                   GLEGRELGQLMRELHDAYPGGRAAFVSWLDQLQDHDLTPLHAYIEQVAADLDLQESKCH
FT                   P"
FT   CDS_pept        135638..136363
FT                   /transl_table=11
FT                   /locus_tag="XCVd0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19937.1"
FT                   /translation="MTPLPQTIVQSHMLDIFCPLAEDIGNLADWAAVAVALFGAIAVFQ
FT                   LSRAANATARGVKRVAEREARDRRAAAAREGRLLLIYLENEFRQALTAFGTLATGLDVV
FT                   DHDSFIDSGYARAQFLSEADGISLKLSREMFHRLHVLVDKDAHDIARVVSGLSVLQQAA
FT                   AEAASIDLSETMPGVDGASWNEFRRETLSERFVLLRKGAAEMQVILIRLIQEAVAAKVV
FT                   AGAQHHTLENNARGPSTAG"
FT   CDS_pept        complement(136408..137496)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0126"
FT                   /product="putative membrane-associated acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19938"
FT                   /db_xref="GOA:Q3BZX8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19938.1"
FT                   /translation="MEVSKPRPLQSLQALRALAAAAVVVYHLINAEVVYGGGLQILGGL
FT                   AHLGFAGVDMFFAISGFIMVMVSSGKFGDRRGALDFLAKRFIRIFPLYWLCTGAIALVL
FT                   SVRPGLLDPALLDRSLIRSLFLLPQEGGPLLVVGWTLTFELFFYLMTAMALAFGSERNI
FT                   PFMLCGWAVALALLQWVPVQGPWAQLVTSPLAFEFIAGAAAAILWKSLSPRQGVVVLCA
FT                   AVALALLAAWTLLNRSDFGQTHGVRTLAFAIPCALTLAAAARLELAGWWPVSRWAAALG
FT                   DASYSLYLTHVFVLSLSGRLWIAVAPTGTITMNALFLASSFIACCVVALLTYRFVERPL
FT                   LDLGNRWLAHIRLGAQAGSLPR"
FT   CDS_pept        complement(137795..138079)
FT                   /transl_table=11
FT                   /gene="csrA2"
FT                   /locus_tag="XCVd0127"
FT                   /product="carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19939"
FT                   /db_xref="GOA:Q3BZX7"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19939.1"
FT                   /translation="MKIRRGRATLTIAGLGAHEPGTYDLRVGAHLMVREHVTITVHGIS
FT                   DGQVKLDIVAPRAVPVHREEVAARIRAEMQVQVCSHRAQVGLPLAAAPV"
FT   CDS_pept        complement(138454..138753)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0128"
FT                   /product="histone-like family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19940"
FT                   /db_xref="GOA:Q3BZX6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19940.1"
FT                   /translation="MNKSALASAIAHRHAMTQAEASSIVDTVTEVVALMLLEHGRVNIN
FT                   RFGRFRLQHKPPRQARNPKTGETVQVGERVAVQFTAADELKRRFLDSKNGNRLE"
FT   CDS_pept        138942..139295
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="XCVd0129"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19941"
FT                   /db_xref="GOA:Q3BZX5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19941.1"
FT                   /translation="MPRKSECRVDCMGFVANEPQLRQANGTPVVNLVVIENEYWKDAEG
FT                   TRKERSHAHSIAFWGPYAETVSKLVQKGSYVRVKGNLRYKPIEGQQYDKAAEIRGDDFS
FT                   LLDDPRERDESPD"
FT   CDS_pept        139391..139768
FT                   /transl_table=11
FT                   /locus_tag="XCVd0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19942"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19942.1"
FT                   /translation="MVTALNALPVALVDSEAHAIWVHIRGRAAVKKSGQGAAFRRVVRA
FT                   DYAGRLRLHSNSPWRPFCPAAGDDQAIEVSLIRVGRILDKTEFDGPEWDRLQKHGLDAF
FT                   LIEAIATRSFRGAMRRIFGST"
FT   CDS_pept        140015..140833
FT                   /transl_table=11
FT                   /locus_tag="XCVd0131"
FT                   /product="putative adenine-specific DNA methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19943"
FT                   /db_xref="GOA:Q3BZX3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19943.1"
FT                   /translation="MSREALLSQYMTPDWAAALCLERFLPDLGPDDLVFEPTCGRGAFL
FT                   RAVPLHVPAVGMEVDPTLAAYAAATTGRAVLVGDVLRDPLPSGITAIVGNPPFRVSFVN
FT                   QLLARAHGLLPEHGRVGMLLPYFIFQTASNLEAIARDWSIEQTMLPRNLYPRLRHPLCF
FT                   AVLTKDHHKRLVGFALFHELAAVNRLQRRYKQLLQEGVGSVWTAVVQAALEQLGGTATL
FT                   AEIYREVEGHRPTTNAWWQAKVRQVLQRSFRRVAPGTWAIPTPHHAAVAA"
FT   CDS_pept        140849..141427
FT                   /transl_table=11
FT                   /locus_tag="XCVd0132"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19944"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19944.1"
FT                   /translation="MRDILLATCLILGAAAAPAHASENISLHVKVTNGSKVLVDTNLLT
FT                   TPGAPAQARVGSDIRYVSSTTVYSRGKRSSLGGKKGTPVDRPPAERTYATLFDGVDITV
FT                   YPEPLAEAVGSPDKVLLRTRVSLSRLNGMEHTGEGDARIDLPSVQNFRTQSNTVVAWGS
FT                   PQVISYKSAGDEAADDYRIEVTPSTAKAR"
FT   sig_peptide     140849..140911
FT                   /locus_tag="XCVd0132"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        141441..142664
FT                   /transl_table=11
FT                   /locus_tag="XCVd0133"
FT                   /product="putative site-specific DNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19945"
FT                   /db_xref="GOA:Q3BZX1"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR025745"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19945.1"
FT                   /translation="MADTGAQLDLFQMDHVLQAYEGGSVVDNNELYEHVRAAAGVSQQV
FT                   MEARQPIGASGQHHSVAKRRVRWMQQTARRLGLLERVPERRGAWRLTEEGKRRTGKAAP
FT                   GVALLAFSTDLGLAIWGSWESVFPRLDEKIVLCLTSPPYPLRKPRAYGNPPIHLYVDFI
FT                   VKALEPIVRNLADGGSIALNLSNDIFEAGLPSRELYLERLTLALCDTYRLHKMDTLIWS
FT                   NPSKPPGPVRWASMTRQQLNVSWEPILWLTNNPRNCVSDNRRILEPHSDRHQRLMARGG
FT                   EHREAVNSDGAYRIHQGSYGRPTDGRIARNVLMHGHRCAEAQACNHFAAEQGLAPHGAP
FT                   MPLALADKLVRFLSRPDDLVADPFGGRLTTGKAAEQNGRRWICTELIADHLHSALPRFP
FT                   QAVPGPSF"
FT   CDS_pept        142680..143591
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="XCVd0134"
FT                   /product="recombination associated protein / putative
FT                   exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19946"
FT                   /db_xref="GOA:Q3BZX0"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19946.1"
FT                   /translation="MAFFRNLTLFRFPTATDFSEVDQLLPAVVLKPVGPLEMNSRGFMS
FT                   PFGREQQVTLSHRLGDFLWLTVGGEDKILPAAVVNDALARKISEIEAKEGRKPGGRERK
FT                   RIKDDLIHELLPRAFVKSSRTDAVLDLRNGYIAVDTSSRKTAESVMSQIRGLLGSFPAM
FT                   PLNAEVAPRGVLTGWIAGEPLPEGLSLGEECEMKDPVEGGATVRCSAQELRSDEIDRHL
FT                   DAGKQVTKLAMVLDDHLSFVAGDDLVIRKLKFLDGALDQLEEADQEGLRAEFDARFALM
FT                   SGELRRLFSLLETAFKLSAAEA"
FT   CDS_pept        143593..143835
FT                   /transl_table=11
FT                   /locus_tag="XCVd0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19947.1"
FT                   /translation="MSALARLLDIPRAAPPHDLEHTLALLDDMRRQIDALGDISRNYGQ
FT                   LNHKLKQRKLQDIHLKLRDMRDDLAQRVVPSIKET"
FT   CDS_pept        143837..144010
FT                   /transl_table=11
FT                   /locus_tag="XCVd0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19948"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19948.1"
FT                   /translation="MRIAVWPTGDWCEVKESAEFSQQNALGDDFAVYTAATVATAERIA
FT                   ANVEAGRPPLAA"
FT   CDS_pept        144018..144770
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="XCVd0137"
FT                   /product="thiol:disulfide interchange protein"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19949"
FT                   /db_xref="GOA:Q3BZW7"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19949.1"
FT                   /translation="MNRLALPLLLTLSLAACGDDSTPNASSGLDLAQAAVSKLAPHAKV
FT                   TGVERAAVPGLLQVTVDGSQVIYISENGQHLLAGQIIELASKDNLTERATSALHRKMLA
FT                   ELPPERKIVYAAEDPKHTVTVFTDVDCGYCRMLHEHIPDYNKAGISIEYVLYPRSGLQS
FT                   PTYATSVSVWCAQDRKQALIAVSTGGELTPAQCTNPVAEDYALGQRLGVTATPAIFAED
FT                   GRQVGGLLPPAQLLAVLDGRAQRGPTQP"
FT   sig_peptide     144018..144071
FT                   /gene="dsbC"
FT                   /locus_tag="XCVd0137"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(145224..145910)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19950"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="InterPro:IPR036806"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19950.1"
FT                   /translation="MANSLSPAQITRIKRQAKKLVRETSITHAEALDRSATAHGFANWS
FT                   LLSKACVAPGGRPELATKEAIRRAAIRYYLHGDQDEEDPSTYYCARCDSFCLPDHFEND
FT                   ALHRGQSHEMRYLESIERWSERGTVWRSRYRRPEDAPNLLAAKAVALNLAYQQSRSAFH
FT                   RWLLAQVDRDDIVSDLAVDVRADKTFPVGASSRQEIERYLARHGDHVLEALERAWLEFS
FT                   TAHGKG"
FT   CDS_pept        146321..147313
FT                   /transl_table=11
FT                   /locus_tag="XCVd0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19951"
FT                   /db_xref="InterPro:IPR022550"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19951.1"
FT                   /translation="MKFNMIVDEGLRLAANMETRYDAWLQASRAIADGRLQWKTSGGHD
FT                   YLYRIIDSKGNGTSLGPRSPATEAMMESFQNAKLTVQNTWATLEREGKMYRSLRLPRIA
FT                   SYGAQVLRELDISGLLGDSVLVVGTNALCAYALEAGQLLSSTLDATEDFDLTWVRDVSN
FT                   APPALQAPSVFGVLKSVDSTYTINTERPFQARNSHGNEVELLIAESLAGLPTYERLRPI
FT                   PLPEQNWLLPGTRISHITCGMDGLPARVVAPDPRWFALHKLWLADKESRNVLKKGKDRE
FT                   QGDTVLHLVNDHMPHFPLDDAFEDSLPDELRPYFEDWKQENGLTPPGMR"
FT   CDS_pept        complement(147335..147730)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19952"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19952.1"
FT                   /translation="MASFDDMDADAGCRLWPMQYRLSGDGMLQGVDAVDALHLSGADAR
FT                   ALLTAAMDSAWRAQWEADMHCISEDEAGRIIVSAWMTLVEFREFFCGRNSATDADVRRV
FT                   LGEVRAAINSWRDNGVEVVELAAQRQL"
FT   CDS_pept        complement(147733..149760)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0141"
FT                   /product="DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19953"
FT                   /db_xref="GOA:Q3BZW3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19953.1"
FT                   /translation="MGALAKIRRQARPLLAGIRSDGFRVGLSTGFHPDIVATLKERGAS
FT                   WSASSRTWVLPADDNIGPLLDELGHKGGLRLAYDRSAAQAQLAAALLSPEVDAFAPDLD
FT                   VKIYPVAADGGYVVDTRYDSLVVSCLRALGGRLLSSKEGWYVQRSLEQLLGDLAAKAGV
FT                   LRGHVFIHEGEIRIDRTSGGYEAEERPTINVSGAEVKRGQGGDEEGEEGRLAIVLQPLQ
FT                   RQNVDPQWFAEATASMSLLDHQPAGILHLLAANSALLGDEPGLGKSRQSAAALHLMPGT
FT                   GCRLLVAPASLLINWSREILAVDPNAQIAILDKEGIHAEPDWLIASYEKLGVIVQAITD
FT                   GVIAPRAVVFDEAHSIIQPTASRTLNAFLVAQKVPRRYLLTATPILNRIVELHTLLRLS
FT                   GHPLGDMERGDFAKEFAGSQEARVLLAQRVSEWMLRRPKSVLGLDAKVQEPRYLELSGA
FT                   QGVEYRRMAADPSLTALAKIGRLRQYLERQKADWLIETIAGFEPSDKALIMCEFQDTVE
FT                   YLAEEFAKAGIEVVTFLGKHSKARKQQAIDRFQSEPTVRCFIGTTKAAGVGHTLTAANI
FT                   VCFASLPWTNALKKQAEDRAWRYGQKRVVTVLVPLFAGTIDEQAMALIQHKAAIENDLL
FT                   EDPTTAILNMDAPSNDPEDASEISERDPEYAAILQYAKVA"
FT   CDS_pept        complement(149763..150383)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19954"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19954.1"
FT                   /translation="MTPNTDPVDRHQARVYALSAALASVLPYALSRAEDLHDLHDNGEA
FT                   DSHTPDAHLKAAAAYEGAQQLLQEVSIEAASRGLSARDVGSRLAFALELYSMAPFIGQQ
FT                   YGEYALQTAREAVRKWRLGSAGEGTTDAALMALARPLRECLEDYLDLPGITSQYGQVNF
FT                   DHGAGAVDAYWTLRLAELTPPAAHELVCVAGGEEVEDSPRPGV"
FT   CDS_pept        complement(150380..151387)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19955"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19955.1"
FT                   /translation="MMIRGLPYEGNVILPVVLLGEGNQVIPFRDVCYRDLWRSDLVSEV
FT                   DPSAPEQGHAAYYTVLLTSGGADSAYDVDIDVLDYRSAELVGELCDSLHRAEKALMRAT
FT                   ARSVDPDQRVMAIQTIEDCARAWLRCNRAVPVTVNAEGALTQQPLARPRQGLCVDELES
FT                   SSSTAFWQVRELLPQAVSSLMVNLVDREDAKMFDFLYEQLITVREFGLTLRPWVMGGAQ
FT                   GEPPLSRSFYEALNVDPQPWAIPAFDLKPEAWLVALRERGFDFDPASTSIEDDLVDLRN
FT                   EDGEAVVGRRLASRIAWSVDHFCARHNLTREDLQLVARETMPAAADAASMGMKQ"
FT   CDS_pept        complement(151384..152028)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19956"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19956.1"
FT                   /translation="MRLTAASDSEQYIRSRPMKKQTLTYTKDPRYTVELDYTEGHPDDP
FT                   GAGTPAMVCGPNGTSGTFFCVRDTGWLNEGERNGHEVPPGVKQWLEEREDLVDGYVNAA
FT                   FAYASNHHRDAVSPADTEASPMIQEFTVASEGASLDEVEIVGASIDDDQFQFLLDTNGT
FT                   VYARDQNGVVMELSFDMDGESLVALPMKETATGLEQMSDDEWREHVPRMSP"
FT   CDS_pept        complement(152000..153505)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0145"
FT                   /product="putative cytosine-specific DNA methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19957"
FT                   /db_xref="GOA:Q3BZV9"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19957.1"
FT                   /translation="MLRKLPAQTALAAATQVASALPRNGQAGFPAHVQVSYTKLGHSRG
FT                   QPRLWLEGLRLGKCGFLPGSKFRVELDLVNRQVRLKVDAAGDRTVSKREKAVVGGEIRQ
FT                   TPIVDVTGGALSDVLGEGARVRATLAAGQIVFDLHPADLALEQREKSTREHVRDGYLTE
FT                   ATLCAGAGVSTLALKEGLEREGLRTRVDWIVDREGAYLELASQNNDAIGSDTRLYEASL
FT                   EEIDAQALSHVDVLQVSLPCTGHSLSGKAKRKLDNAEQHPTDGLAVYGLLRILEVVNPS
FT                   IVVSENVEQARDSASYDLVRAYLDAQGYVMSDVVLDVKVAGTIENRKRWWFCAISKGLA
FT                   ESYSMANLPAQPRLYETLGDALDASAHSDESRWRAYEYLAEKNARDAAAGKGFKRQLVT
FT                   PDATEVGTIGRGYAKARSTEAFLIREDGLQRLLSPVEHARVKGIPEKLVVGASTTLAHE
FT                   ALGQSILFGHAAAIGESLAVHLKSRVGSTPEADIDEADRGFRF"
FT   sig_peptide     complement(153446..153505)
FT                   /locus_tag="XCVd0145"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(153499..153903)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19958"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19958.1"
FT                   /translation="MSVRRMVRAPISASTRDDLRRNCNTTQAVVETAARASKILEPRDA
FT                   YKEFRAAQDHFEVGCWLVYYRQQMAGEGAHEAIYECAELLRRHGLQEPTRNFETVFGFG
FT                   IDCYWSVVASQPRGRGAGEVCQMQPEVRAC"
FT   CDS_pept        complement(153900..154697)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19959"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19959.1"
FT                   /translation="MDNNLQPLYVSEAERQVMAAALSDFARTGQVTRDRAVDAGNHELA
FT                   VSLTTQLDAAAAALVRLQSAAPKAEAVDLGDRLKLHGTAAGLLGGSLAESPLWARSRHS
FT                   QLPASEGTQWETDRRGVAELVVGHLKEMMADLPAPAGHQWKLYERHELTWYMGGPGNSV
FT                   SAFLEPLNMHGKRADQSHGEVRVFLDEPRATIFLGTGPMVEGQHRSVFADGAAHTSGKS
FT                   YAETLLVAKTLIASSMAINQHVATLQASAAAEPEDEYEGAFKP"
FT   CDS_pept        complement(154705..155046)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19960"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19960.1"
FT                   /translation="MNVVKKPSIHYTLVSVDGCERTTSYCPASEGYRDYHDSGWTPREP
FT                   EQHTARAELEIDWGGGRHQMLKLEGHQHRDIEMYDKLPELLEAIGSGDQPETALQDALT
FT                   VESRPAMAG"
FT   CDS_pept        complement(155461..155757)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19961"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19961.1"
FT                   /translation="MLIEVKVSRADFLADARKEHRIKPALGAGKWRYFMCPEGLINVDE
FT                   VSERWGLLWVSDKGTGWRRAAVMTGCSLRGRMRKSVVRMSLVQRASWIRRFAC"
FT   CDS_pept        complement(156028..156768)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19962"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19962.1"
FT                   /translation="MKRQPSMALAVVPVFQPVIDLLNGEALYFEALARSTSKRSHGELL
FT                   SFAETYGFIELVDLAMLDQATEFLARSPGIRIGVNASVSTIERNCGPLVAAVFMHLQEA
FT                   DRLVVEITESIAVTNPRVVHSFIAGVRAAGAKVAFDDFGDGCFSFEDIVRFNPDIVKLA
FT                   GVMLGRRSEYSRDISRVLALAEGQGFIVVAENIDTEEKRQACIDMGIRYGQGFLLGELA
FT                   STPIRTTAPASLDTRRDTRVSVKS"
FT   CDS_pept        156843..156980
FT                   /transl_table=11
FT                   /locus_tag="XCVd0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19963"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19963.1"
FT                   /translation="MREHCSEQLAKLVRASTCSDRCHDMALVIHYFHTLTATRKLQPQF
FT                   "
FT   CDS_pept        complement(156994..159180)
FT                   /transl_table=11
FT                   /gene="traE"
FT                   /locus_tag="XCVd0152"
FT                   /product="DNA topoisomerase TraE"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19964"
FT                   /db_xref="GOA:Q3BZV2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19964.1"
FT                   /translation="MPEFKLYVAEKPSVGKALAGHLAKSAPAVGRSGSHIEGSNWAVCW
FT                   LRGHVYQLAEPDYYIERTYPEAKRGANGRFPWLFDHLPLLPANDEWRLVPVSDKAEMID
FT                   AVRKLLTRATVVVHAGDIDREGQLLVDEVLEDLRCRVPVKRVLPKAIDDVSVQRVLADE
FT                   RDNRDFARMRDAAIARGRADWLVGMNYSRCVTLQAREAGSTGHVSIGRVQTPVLGLIAS
FT                   RELEIRNFKPVDYLVLTAMIAVQAGKFRAKWRPRNGQPGIDENGRLLDAAVAAMVHQQV
FT                   AGKTGRIAEYRDEQKNENAPLPFSLDELQRLASRRYGMGLEQTLKVVQGLYDSKLVTYP
FT                   RTDCAYLPMSQHAEAAEIVQAVREGFRGTDLPAQLSQLDIGRKSRAFDDKRVTAHHGIV
FT                   PTPKAANLEALSREERLIYEDIARRYLAQFMPPHTYRKVSVRAEVANHDFIASGRTTLK
FT                   PGWKELYGKAEQAADDDAAPQDKGDDVNLPAMRQDEAARCEGLDRENKKTEPPSRFTDD
FT                   TLLEAMVNIHKYVTTPQVKAHFVAMLKKSEAGADDQAQGCGIGTPATRHTFAPKLIEIG
FT                   VVEHIAGKKKAKFFAPTAAGLALYEALPRSLTVPDATAVWDMAFAKIEAGEITLEQFMA
FT                   FQARQINAMLAEIRQLRIVLPDLGPRRVPPTKTAGKRKTASKGGKKANGGSGAPCEKCA
FT                   KGTMQLRNSSRGPFYGCSNFPVCKHTAPADSAAA"
FT   CDS_pept        159287..159685
FT                   /transl_table=11
FT                   /locus_tag="XCVd0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19965.1"
FT                   /translation="MTTTGRTKAKPVKSAAVRKGSATTTTARKSAPAKASTPAKTPPPA
FT                   QEVAGKSVVSPRSAEMKEARRFALTHNFGLSSRIRDLLDSKRPVLQIFIDENLPLAKVQ
FT                   EFIQRKYGPKIPAKALSTYLEANFKAKK"
FT   CDS_pept        complement(159704..160042)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19966"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19966.1"
FT                   /translation="MSIWAQICEALPVPEEFGTECPYVRFSHVADDGGEGEDLTLEYQE
FT                   ADPASPATIQVSHSEWRLVAGQQRTLPLLSVTLQAESGEPVESESVRRIAASLAAALMQ
FT                   ASSFRLIR"
FT   CDS_pept        complement(160051..165309)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19967"
FT                   /db_xref="GOA:Q3BZU9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19967.1"
FT                   /translation="MRSSMDANTLVRWVRLDPANPRVRLVGAQFPSGTRKLVLLGGDQV
FT                   APSTLSALAQLGFYQSPRGLVLRDELKFTLGELRRAFPGAEPVEVPVGRVVRALPRRAN
FT                   AGDPVNSGDLQANNIIGAIRELGCNSAGETVFESELGRFARRDHEVVGRESELAGATGA
FT                   SRFLRAPDAVELAGCADGFVVEMRRGKPMRYADLRRWAAVVNDAAEEQVETSPLLRVWQ
FT                   EAVEAALVRTLGAHGAADVPAFELARRLEEGQPPFKARTTSSIVNQQYSTTLPLAVAVQ
FT                   HIAGDQRGKLLLEPTIGNASLVSLIRDATIHSVDIDPARVASVRRDRPDIVVSVGDFLA
FT                   DPPPSPATDGKFDTVLCNPPFGGLARPVMVDRLKVGRLDHLVLVNSLRLRRDDGLAVYI
FT                   VGGDNALDSKAGEVRGGSRYLFNWLADHYQVDVVEVDGGLYAKQGAGFPVRLVVIGAKG
FT                   ASASPIPERLDVLQDHESVIAWARNMRARYAQAPAPALLLKQVAVESTPAFDASHLDVS
FT                   SNRIVLSEATPEPMFDAMDLDLPADSIEAAVHTAQASTDHANPLPPGGEEDSAANVSAV
FT                   DENSYQSPYIAQSRVGEASAMIPRNLQTATRSALERIVDEHGDIDEFVAKNLHWRVDEM
FT                   REREYLSPEQVDAVALCIYAEQYGRGCLEGDQTGLGKGRVMAAMARYAVLRGRQTVFLT
FT                   ETPTLFTDFWRDVQDIGSADLFKPMIVNDGVPVYDPKSGETLVPATPRSTLQRALAEDA
FT                   IPSEFNLVLATYSQFNRNANTSAKARWISGAARDSQLLLDEAHNAAGDSNTGRNIAAAI
FT                   EASRSVTYSSATSMKGAKNVLIYSALFPQSVDVAGLPETLQTGGEVLQEVLSGMMARDG
FT                   VFIRREHDLSALTFDTVADSTRLERNIELSDKLAEILELMNFVSGDINVMVSERNKEIE
FT                   KLRELIPEQERKGARMGAISMNFGSRLFSIYRQFQMAIKTELAIDRAIAALEAGKKPVI
FT                   VLENTMESLLRDVITNSRADGFEDLDQELANAAAAVNAEQDLAAGVDLGQDIVFADVLR
FT                   RMLDKLRYYSETTGYGEVVRRDVTSKETLKLIASIESLIGEFPDLPASPLDQIRTRLEE
FT                   AGYAADELSGRSLRIERRTDGVTGEAKSVATVRPERPKARIVREFNMGETDALLLTRAG
FT                   STGISLHASEKFDDQRQRVLIELQSAADVNVRVQFFGRVNRKGQVSSPEVETLSSGLIG
FT                   EARPIAMQNAKMRKLSANTTANQDSAALDRNVPDFINVVGDQVARRYLESNPLIAHRLD
FT                   IDLDIEGDDSGFQQEAYFITKLTSRLVMLRNAEQEAIYEEITSEYTRIIKELDEKGLNP
FT                   FKSKDLDLRATEDSRIVFEGGNAQSGSVFEQPVFLKTISYTEEVLPLRPMDVKARCDRT
FT                   EARFDSAYGHPLARVLTRMAGSLERLAPKLLQEGAQGRKESVDELLAATEVNAVKRLRD
FT                   RIDFIARTLPRCAPGALTTFSGAENARTEGVMVDITLPNNEKKMHNPGQYTVLIAVPGQ
FT                   SQLVERSLYALMEDPAFSTRPVGSPASGLWEAFDAAPAGLITRTRCVLDGNLFKAAQMA
FT                   AANKIGSCVMYTDQHGARHRGVMLNAGIRPDHINSLRVRIETPSVASWLIQEHPDIQLS
FT                   TNSQGEYELDRHAAIERDGPLLKMTVPGTKAWGGKYFSSEPLCELTGEFAGTRAYMVAR
FT                   FSPDKLPEVLRILTSIGVSMYGPSEVRAAINDFILGKYGYTNDCDAGHPAFSLAG"
FT   CDS_pept        complement(165376..166632)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19968"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19968.1"
FT                   /translation="MSALRSLRESAAPKGGGRTPNTFAAVLQVSTAVVEKVGDKESLKL
FT                   TGIVLNEVPGAGRDLPVAVEFRGDDAERAVSNFVKGHGGSRKIFDKPENAAGSVLTLES
FT                   CYLTDQMSDDDRMVVSSRWVNTLQKVNEATHSDRSFLEGVMATSPRVSFENPNYREGNE
FT                   EPRTITIPVSQEKFTARVQTEHGTFSREFDRAWGIERLNKLSKDAKPSVFIDTVEPNNA
FT                   KLVTSEEELRAALTEQLGRGTRALALLRVTDGEEVIDRLVYGQYKREGDEYLPDPAATL
FT                   EELFKNNVFRDIANTDLLAGLADGTLKIDSIPGYRLSYAGNPLKDDNAAYKLVSDLKAN
FT                   KVTRYEIAFGKEPNRFASVVLPGVARNDTIAGFSPINVIADRPGRHAAHEIATAHIDAK
FT                   AQAAVAPEPEDEPADSPAP"
FT   CDS_pept        complement(166833..167162)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19969"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19969.1"
FT                   /translation="MMPAHGQSCTVQLGVPVGAAAEAKDLASAVWAHAAPAFGGQTSVR
FT                   EALERLRADPMRTRDIGFALRLADEVAPSPAAAHTAPLVLRNLVAELAGLTTVEEHKQL
FT                   AASWQ"
FT   CDS_pept        complement(167159..167962)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19970"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19970.1"
FT                   /translation="MSKTKISVSGLAHLLAQLLGYDIYTLSRAANIPRANVASWLGGNI
FT                   RGLRVNTIVELMGMLGLRLDAGAWRLDSQRVHFWRVKLGAFTKVEDALAAVELLSRLLG
FT                   ANSAITQVHPPKAVRGRSGLARTDQYMIGGGQCRVVVSVTQPFFRKVRVTPDVAKGTMW
FT                   RDDNRHHTMQIQASHWRQVLARDMTVKEFDQAFEQSMGAMDWGDLALAARQFNLTPEDL
FT                   LGWVRERYEPDTGSQAAADDIEVAGSQNVILLGRDIAPRRTGSYG"
FT   CDS_pept        complement(168022..168681)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19971"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19971.1"
FT                   /translation="MTTKVANDEAESAMRSRMAAALGFVVGTQRWQGVSLQKVAVEAET
FT                   HRSNLSSFIRSHGGRRNISDVKLRAVLFALGLHWDLTLTRSLHRWDLGAEDHLMGGLRV
FT                   LLDVMGRYSVGVVTTAGCRESFFLLIADGGAVAMLRATGEVASGVAKLLGVDRILVDSD
FT                   RAVSEAVQRIWLTQDVAVAEKMVRGLMDSCGVAEVGIGRRDEAIREHESRQLIATA"
FT   CDS_pept        complement(168678..169250)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19972"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19972.1"
FT                   /translation="MALVVHGDGCMTNLHAMRRKVHADSLKPRNIELVPATGALGIQFE
FT                   RGSNRGGGFRRCGVVHMAIPSEWTLNLTSGQPSAEVFDPVARRAQGDESIEALQQQAFV
FT                   ERPHLVAFHRMLVSLTAADLASAARGGRDQRLEAGPGGHTYIAADVLVPAAGRDQFDAE
FT                   AWLSGHGHGLLRCSRKCTIIVRSKACK"
FT   CDS_pept        complement(169241..169597)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0161"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19973"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19973.1"
FT                   /translation="MLALINMAGVFGAAQAQVVNRLTPPQLEPAAAASTPTQAASRAPV
FT                   TEYAPISPPAASVLTVVSPLQDQIAAELAFLPNETNDEYTERMRTRYDQVKKNAQRVDA
FT                   EHAARMRALVQAWR"
FT   CDS_pept        complement(169614..172661)
FT                   /transl_table=11
FT                   /gene="icmB"
FT                   /locus_tag="XCVd0162"
FT                   /product="putative IcmB-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19974"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19974.1"
FT                   /translation="MKIVEQIADIAEGALAYFSSSVKQSVADYLDIEYTEDETTFVLKD
FT                   GSRMTLLRVNGSRRMIGVDEFREIDGRLTNSLKAFMRGGGHALSCIFESDPDLVEREVR
FT                   EAQKPMRDTAVRIGLNLEDLFEEDVAMLRESCSAERCWVALYTRPSAFTATELKRDVAA
FT                   RMELLKDNPIPTMEDAPNLFRVIAGLKSRHDSFVSSFMQEMAAAEISLVQLEVHDACRD
FT                   MRMSIDREFTAAEWRPSLPGDKIPVREQRRNPADMSGALWPRLDRQLAPRNIREESSTS
FT                   CTVGSIAYKPMYIFMHQSGSETVPFQALFRRVRDTRAPWRIKFQIESGGLTSLGFKRLI
FT                   TAIIGFTNPENGLMRAAADRIEYLVREQNELDVKLRVDLTSWAPAGNAKLLEDRTSKLA
FT                   RAVQAWGGTDVRELSGDPVQALVATTPGLSLNSPATVACAALADVTQMLSFYRPASPWD
FT                   FGALMFNSPDGKLFPFQPSSSVQSNWINTVIAEPRAGKSVLVNAMNLAFTLSPGLTDLP
FT                   YIAIIDIGRSSSGFTSLIREAATEQSKHQVVQFRMRMRPEDSVNPFDTQLGCRRPLPHE
FT                   EALAVNFTTLLMTPPGEPHPADGMAGLCAGVIDYAYKHFADNAQPRRYSPQTEGAELVD
FT                   RAIVAHGLHVDRNTTWWEIVDQLFSRGDIHAASLAQRYAVPTLTDLAAVSRERQFSDLY
FT                   GEKLTNSGEPLLQAFARMLSEAIRRYPILSRPTAFDVGDARIVSIDLDEVAKQGSAVAD
FT                   HQTNVCYMLARHAAARNFYLREEHIDSFPPEYKGHHEQRIREIRQNRKHLVFDEVHRTS
FT                   KAAAVQNQLELDAREGGKWGVMLTLISHRPQDFPEAVLSFSTGNFVLSPTDDDSAELMR
FT                   DKWQASPTVLHAAKKHIRPPTAKDGSTMVVIFKTRSGPVTQLLNLKMGGIRLWAFSTSN
FT                   EDSYVRDVLYSQIGGQETRRLLAALYPAGTLLPEIERRKLALQNSGVMVDSEKEDGVIN
FT                   ELIREIKGKYDAARLQGAVAQGDRRA"
FT   CDS_pept        complement(172923..174167)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19975"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19975.1"
FT                   /translation="MGAKYFGSVRFDIDDPNAGGWASVEGGEAFRIANASSLDSSTVWW
FT                   TNLSFDSMWKANIHRLPNVKRTTYMHSWRRGDGQDAFCESWGLVRRRYTEKTIAEALSA
FT                   IFAQVMRVAARRYNVDLSQREVFPYDTLADEIRSRLLPVADPSLGPEADGAIGESHLYY
FT                   NTCMTPHHRTEDYVDVCFSKPAVAYAREMTQTIIPSDQVEYLDQQSLPPFGKRLDWVLN
FT                   DPRPVLARVSVADVHPDFANLISYGNGGRAGTNRNWLTQPEILLLSNFARVEIESAYVF
FT                   SEYRQMPSQCLLPDDITDLQAMTPNTQILATNHWIGLCRENPYRLEPGKSSERRTSPRA
FT                   AWLTSVDRFQMFTNALSLHQAGFTVCYYGAGVVVARVPKYNYRDAYEVAVSAGMLAPTT
FT                   MSEDIDVQEDLQDVG"
FT   CDS_pept        complement(174157..174909)
FT                   /transl_table=11
FT                   /gene="icmJ"
FT                   /locus_tag="XCVd0164"
FT                   /product="putative IcmJ-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19976"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19976.1"
FT                   /translation="MRDILLSVARASQRLIPAAGHGGRKDKEHAGSREALLGQARFLRR
FT                   CAFCDFKFGGVADECEVHHLDGDHANNTADNLTLACVLCHMPHHLDLASRRWADSPGAL
FT                   IYLPELTQAELSSLLQAIAYTIAVGSAEMKPGEVVTVAEQAGHDIYPHVVYARLTARAA
FT                   QVEGTKNGESQRHQLSSPVVMARVLQSMSDADYADRGQLLAGVRYLAPLDPIVELAKSW
FT                   LVDGSGFKNLDLASWREIAAAAGVANGG"
FT   CDS_pept        complement(174921..175325)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0165"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19977"
FT                   /db_xref="GOA:Q3BZT9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19977.1"
FT                   /translation="MMIRNKRTWLAMATLLLVCLSLLTPFGAFAQDQMSGAPDVKTIAQ
FT                   NGTETANGVFTLIQSLVCLVGFIIVCIGVYGFYRVNKEKGQGQASIATSFVGCIVGVLM
FT                   VMLPLTVGTLGKTVFGDQAGRPQRINITPQ"
FT   CDS_pept        complement(175361..175891)
FT                   /transl_table=11
FT                   /gene="icmC"
FT                   /locus_tag="XCVd0166"
FT                   /product="putative IcmC-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19978"
FT                   /db_xref="GOA:Q3BZT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19978.1"
FT                   /translation="MNDVSQMLANLEGVAPYVSALIQTIASLMGVLFTVQGLYKFKQHT
FT                   ERGEAHLGTAFLYLVSGVALVNLALSTDAAFGLLYGNSGASVQHLVAYKPTDSMPTQAA
FT                   MVMKVIVLLLQVYGLFFTVTGWVQVRKLNDNRSGGEVTFRSTMFRILGGAALLNIVLTV
FT                   NTLAKLLGFGRVF"
FT   CDS_pept        complement(175901..176722)
FT                   /transl_table=11
FT                   /gene="icmG"
FT                   /locus_tag="XCVd0167"
FT                   /product="putative IcmG-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19979"
FT                   /db_xref="GOA:Q3BZT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19979.1"
FT                   /translation="MAKYMLIGFVVLIVAFVGWFGYKLMNRGGAATDTLSIPVQEQAAV
FT                   PMTGAPATAVNPYGVPGETANGQIAASAAADAPVSLTADQGTPGGGESAPAQQNDHAAG
FT                   VQAEQQIAQPQSAAQQPPVAVATSQSSATPQATPASDQSAVAETELEALRARVMELEKR
FT                   VATMTASGRAVATAPRTQPARRNAAPARPKSRDSATRPAPSSVTAAAKPEPVPASGIQL
FT                   KAVLEGRAWLQLKNGETVSVAPGDTIPGAGTVSAVDVERNEVRLNNGTSLR"
FT   CDS_pept        complement(176852..178099)
FT                   /transl_table=11
FT                   /gene="icmE"
FT                   /locus_tag="XCVd0168"
FT                   /product="putative IcmE-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19980"
FT                   /db_xref="GOA:Q3BZT6"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19980.1"
FT                   /translation="MMAQQESDIKLRAGNIASALKHGPTRLIFIGGIVLSLVVVVLAFS
FT                   FMGGGKPANNGEVVLESVPEPTVAPSGQTLTNTKAYEALAQQSDIQALKQAQQTGGTAM
FT                   PMPRPGQAAAEAKGEVTIDGTGVNMNAVPEPAAAAATTAQAQSAEATARLQQHEQQVQA
FT                   RYAIMSKQYDNLVGRWISVQTPVSVAVNQERKAGEAEDAQVGSASVASTASDDMAETTS
FT                   GALLRANDTYLGITLGDATTDDRLPLVRARILNGPGKGSVMRGTIETSEFAPGGFIHFT
FT                   SLTPPSGAQKRDAVEIDAVAIDPTTSRASVGDVNRHTASRMASLFFSSVLSGVSEGLIA
FT                   GGQQENVVTTGQTVVVQKDAFNDRQLALVGLGKVGTNATQMLQPTINRKPTASIGQKTE
FT                   IGVLFLSDVPASAFGK"
FT   CDS_pept        complement(178096..179037)
FT                   /transl_table=11
FT                   /gene="icmK"
FT                   /locus_tag="XCVd0169"
FT                   /product="putative IcmK-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19981"
FT                   /db_xref="InterPro:IPR022073"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19981.1"
FT                   /translation="MILGRMFLASAALLASAAAMAQAPAAAAAGAAAVPLQQAPAAPPA
FT                   GTTVPAPGLPILPEVNEVAFDRVKANAAPLTPEQIRDLRRLVDDAERAASIAARGTPRP
FT                   VSTSVVANLAPGAEPAVVRLAYGAVTNVLFVDGIGNALPITSPDLMKGGFDAFPVAENS
FT                   NVLKLFPTQPYATGNISVSLKGVSAPVPLMLITGQREVDYRVDVRVIGGNIAQKLAGSG
FT                   SAGSAVTTTMLEFITGAIPQGAVALKSDSPDVQAWAYNGAYYVKTPLTLLSPAYRNPGK
FT                   SPDGTSYYEIPPTPIVVVSISGSPKHVKIEAP"
FT   sig_peptide     complement(178975..179037)
FT                   /gene="icmK"
FT                   /locus_tag="XCVd0169"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(179034..179867)
FT                   /transl_table=11
FT                   /gene="icmL"
FT                   /locus_tag="XCVd0170"
FT                   /product="putative IcmL-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19982"
FT                   /db_xref="InterPro:IPR021055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19982.1"
FT                   /translation="MQSVSNYAVLPTAKGHIRWHISLTRLLWCRILVNDFQTVVARRMD
FT                   DSPKPPASSKAKPDAVSPLGGYPPLAIDVAKLAFYGRHFGKLVAAILILSFAQCAQVGW
FT                   NMFKERREVRREYFGVDFKTGRMVRLVPLNEPYLAKPAMLTRVQECVQGANTYDFVNFQ
FT                   QSFQSISTCFTDGGWNAFAQELERVGTLKAVRRQRLVTQAVATGVPVIIGEQQIGGVLT
FT                   YTVQMPIRVSFQGGEGGRGLATQNLLITATVQRVPEYENQYGIGISAYTAEERRQ"
FT   CDS_pept        complement(180223..180744)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19983"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19983.1"
FT                   /translation="MQPVHPDNHVFTVAGRVAGLGDQKGAYVIATSPEELVARFRDWDF
FT                   EVTSIASLADVRQSVEILDAIASCSAEVGAEEYLDLFPVEPGQRRQSSNVFTFVGKYVG
FT                   GGRVSEATAMAGFGTAADASALSGYLRSAGFDVLSVMSHSEALDLQAEMRLVACDALAD
FT                   EAHLVNLKEL"
FT   CDS_pept        complement(181061..182371)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0172"
FT                   /product="putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19984"
FT                   /db_xref="GOA:Q3BZT2"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19984.1"
FT                   /translation="MTALAKPASHSKQSHQDRNECDKAPANMIVRKHVGAIQIFNSLTL
FT                   LQRKVFAALLLNGYDELPNFSIISHQIPIGVLSYLAGFNSKNTPYLKESLTGLVTSPVQ
FT                   WNILRSDGRAAWAVSATLASARIEDGVVYYSFSPELRKRLYDPEVSGVLSASVTRLMKS
FT                   SPALALYENCMVYAEEGVTPAFALPDLKGLLGVAGNSTYDDFGKFKDKVLNPACREVNR
FT                   VAPIQLEPILNRSARKVVSVAFAIKILGDGGSDKMREQADPFHGRDTDLVTRLQEEMTL
FT                   GYGSVVKLFEQHSDERLRAVRDYVVARFQEGKVQKHKLAPYFLRVAENATPESLSQKQT
FT                   TLTLEARKPASEKPKDEATLAAESAEAERRLQLQARLHTAEARLDALDSEQRAKLEESF
FT                   RQQLAADNKLIYDSLRKHEFSGPLYRKLLIQHVAAND"
XX
SQ   Sequence 182572 BP; 35689 A; 55656 C; 54787 G; 36440 T; 0 other;
     ttttttttag acaaacaata catacaaggg ccagcttggc gaattgtaac atactgataa        60
     ataagaattt ctgtgcgcaa acctcccctt gaatggggag taatcgccca ctcaatgggg       120
     cgtaacctcc ccgcttctgg ggaacgaaca cccctgatat ggggagtcgt gtcagccggg       180
     gcctccccag tggtggggtg aactcgcccc ataactgggg aactctccct ttttctgggg       240
     agccccatga atagggaggt tggggatagc tgggcacgcg cttgtcgggt gcgatcggct       300
     cccgctgcgg cgggacgacg cgtagatatc caccccattc ctggggcgct tgtggtcaat       360
     ctcgctaaat tgttgttgac gtgttccatt taatcggcac aatacggtaa aaatggaaca       420
     cgcgcaacac aacctcaagc agacatggag acagtatgag cacgaccgcg gagcagtccc       480
     ccaccccgtc cattggcgcc gattaccttg tgcagcttgg cgatcgcatt ggccagatgg       540
     tcatgcgtgc caaggacttt tcccacccaa gcaagctgag tccggaacag ggcgagagcc       600
     gccggctgag cttgcgggag attgccgact cgattggcgt cagccattcg acggtcaacc       660
     gggtggccgc gaacatgatg ggtccggatg ctgctggcgg cactgaaagt ccgaagtcca       720
     cggggcgcac cggttacagg tatagcctgg ctgaagcggt ggcgttgcga aaagcgatcg       780
     cggagctgcc ggaaatccgg aagaaggcca agctggaccg gcgccgtggc gccggcgagc       840
     cctgcgtgac gttgggaatc atgaacttca aggggggcgt cgcgaaatcg accaccacgg       900
     ctcacgccgg cgcttacctg agcctacacg gctaccgaac cctggtgatc gacaccgacc       960
     cgcaggcaac gctgtcgacc ctcttcggga ttcatcccga tatcgaattg tctgtcgaag      1020
     acacgctgct cccttatttc gagggttccg agacgtcgct tgattactgc atccgcaaga      1080
     cggagatccc cacgttagac gtgatcccgt cgaacgtggg gttggcgtcg gcggatctgg      1140
     tgctgccgtc gcgtcagcga gatatgcgtc aggctggcga tctgtcgtgg ttctacatga      1200
     aagtcttggc ggaaggtatc gcaaccatcg agaaggatta cgacgtgatc ctgattgact      1260
     gcccaccttc catgtcctac ctgaccacag tggccaccca ggcctgtgat gcgttgctgg      1320
     tacccatgcg tccttcgatg ccggattttg catcctccgc tcagttcatc cggatgttcg      1380
     gcggcttcca acgagaggtg gacgaggttg tcggcaacgc gaaagaattc gactggatcc      1440
     aggttctcat tacgctggga gagaacaaca atgcctcggc ggaaatggaa gccatcatcc      1500
     gcaaggcgta tggggatctg gttatgggtg agaagtttcc ctatctgacg gcagtcgccc      1560
     gggcggcgaa agcaatgcgc acgatctacg acgtagcccg tgcggacact gacacccgcc      1620
     agctgagcaa ggccatgaac atcgtcaatc agctgtgcca gtccattgag gcccgcctcc      1680
     tgctcacgcg tgcgaggttg actgcacaga gcaatggcaa tcaaggcgag actgaggagg      1740
     cggtatgagc aagcagaagg caagaagcgc ggcgctgctg ggggcaatgg acggcgaggg      1800
     cttcccgccg ctcgcccatg gtgctggttc cggttccgcc cggccggaca gctcggttcc      1860
     ggccttggga atggtgagcg agctggcccg cgatgagttg cgcctggcgc gcgagagggt      1920
     ggctcaactg caggggcaac tcgacgccgt ggcagcagcg gggtcggttc agctggtaga      1980
     ccccgcaaag atcacccaca cgcagtatcg cgatcgggac gagctcggat tccgcgacga      2040
     gaagtatgag gagctgaagg aagacatccg gcggaaggga cggaacgagc agcccattct      2100
     cctacgtccc gctcgcgccg agaatgtcgc tgccggcttc gagttcgagg tcgtctgggg      2160
     gcatcggcgt catcgcgtga catcggaact gggcatcccg gtggaagcga tcgtgcggga      2220
     tgtaactgat cgcgaagcgg tgctgttgat gtccagtgag aatgcgcgcc gggagggctt      2280
     gagccagtac gagcaggctc gaaagtaccg gacctggctt aaggctggtc tgttcgagaa      2340
     tatggttgca atcgccgaag cagaaggcgt ccacaaggca acaatcagtc ggatcatgtc      2400
     gatcaacgac ctccctgatg aagtctttgt tgccttgaag gatccgcgaa aggtcaccgg      2460
     cctatttgcc gcgaagttcc tccaggcggc tgagacaaat gaggaagccg ttgaatctct      2520
     caaagacttg gagaagaaac tgactccggg tgagcttctt aagaaagttg cgccggtcgg      2580
     ccccaagatg gatccgatag agttcaaagc gggggagcgg cggatcttcg aggcggttcc      2640
     tgtcgccgct gaaggcggca ccaagttcag cgaactgcga cttcatatcg aacttgacca      2700
     agacaagttg aggaggttgg cagagttcgc cgctagcttg taagccggtc tacatggcag      2760
     tgagataagc ccgcgcaagc gggctttttc ttgtcctgcg cttcagctcg gggctagttg      2820
     catggtgcaa ttcagggcgc atcggtatcg ccacgagttg tggggcacga cagagcgggg      2880
     tggtgacggg cggtagaggg ggggcgccgt cgagggaggt gcgggcaagg cgacagtttc      2940
     acgagcgacg ctgcaatcgg gttgcacggt gcaactcggg cgatccctgc tcatgcgcga      3000
     gccgcaggga ggcgccgtag gacgggtgtt gccagcgtac acgggcggcc caaggaaccg      3060
     cgcggtcctg ccagttgcac cgtgcaacta gaggtacgga ttgccaccat cgcgagttgc      3120
     acggtgcaac tccaggcgcg tcttaccatc atcaggagtt gcacggtgca actgtcacca      3180
     acaccagcca ccgatgccgg ggaggggggg cggcagaatc gggttgcacg gtgcaacttg      3240
     agcgctcccc tgcgaccact ccgcgagctg cagggacacc ggtagctcgc gggtgttgcg      3300
     gcggggatcg ccggtcccag gaatcgcgtc ggctgtgtca gttgcacggt gcaactccag      3360
     gcgcgtctta ccgtcatcac gagttgcacg gtgcaactag caccagcacc acccactggt      3420
     gccgggggag gggagccggc ggaatcgggt tgcaccgtgc aaccgtctgt cgggtcctta      3480
     gggcttaccc tcacaccggg taaggtaagc cccgacacgt aatctcccca tctatggggg      3540
     gattactcgc tcagcaagtg ccccgtcaaa gcatcgagct catcagcatc ggcgagttcg      3600
     attcgcaggc ttctcatcgc gttgccgagg tggccggtgc cctcagggcc ccgggcgagc      3660
     tcctggagca cacctttcaa tgtctccata tcggagtagc cgataatcag cgaccgggtt      3720
     ccaggcgctt ctggccactc cagtcgtacg ggtgatccca gtcgctggct tagctggtcc      3780
     tctaggtgct tagtatcggc tgcggccggg gatggggtag ctggtgtccc agccttgccc      3840
     tcccgcgcca ccatagatgt cagcgtgcga accgaccacc tgccgcgcaa cgcccgcctg      3900
     gtccattctg cctgcaattg tgaaggcagg ggcagtaggg gcctggcgtg gccgcgggta      3960
     agcgagccag ataggacggc ccctcgcagc tcctgcgcgg cgcgcttcag tgcggtccaa      4020
     cgccagacct cgggatgatt acgctcgccc aggagaaggc agagagcggt cgccttgaca      4080
     tcgtccgcca gcgcaatcgc cagctggatc ttctcaatca cggtgagctc tgctggggaa      4140
     gtggttccga gcctggcagc ggccgcaatt gtctccgcat cagtgagcac gaggccgcct      4200
     accaaatcat ccggaagtgc gggcgctggc cctgcaagca ggcggtaccg cgctccctca      4260
     gcggactgca gaaggcgggg cgtgccgggg tcgtagtcca ctcgatccgg gcggtgggcc      4320
     gtgagctggg cagaacgaat cttgcgggcc atagtattgt cacgtggcaa tgactgtgca      4380
     gtgtcgcacg acattccagc cgcttcaata ttgccacgtg acaatatcta gtgagccgac      4440
     ttagcgggcg cccgacggag ggcggttggc tggtagccca gccgcgcctc ggctgggctg      4500
     ggctgcgctc cgcttgaacc ggggagcccg gtcatactcc agctattgcc acgtggcaat      4560
     aagttcgcca ccgcaggccg gtaccggctg gggatttcta gcgtaatcac ccccgatgtg      4620
     ggggagccgc ggcgcacagc gcacatatgt gggtctccta tgcatgcgct ggtgtgggtt      4680
     gactccaatt ctccccatat gtggggcgca caatagtgct ctgtatttgg gcgtagaaag      4740
     ccagggagac cgccccagcc tctcatgcaa gcgacgcgca tatatgtgcg ccgaatgcag      4800
     cgcgcttgtt tgagttgcac ggtgcaaccc gaaccctccg agttgcacca tgcaaccgaa      4860
     ccaccgagtt gcaccctgca actcggtgac tagcggcttg gcttggtgcg tcggggcgcg      4920
     tcccgcgctg ggctgaactt cgacagcgga tccctgtgtt ctacggtggc cacgttttcg      4980
     cttgacggcc gaacgcggag tcccttgctc cctccacgac gcttgccgta atgcaaggtg      5040
     gctgtcgcgt ctgtcttgtg gcccatcaac gcggccacaa acctcaagga ttcggcggag      5100
     ccagtagatg attgcttggc atcggcacag acctggtgtc gcaaggaata gagcgttggc      5160
     cagtgctgcc gattgccggt cgccgggaag atctgccggg taagccggcg taggtaatcc      5220
     ctcatgtgct tcaacagctc gtcgaagctg accgcctttc cattggcgtc caggatttga      5280
     ccgctctgca cgcgatctac gagctcaacc atctcgtgta gcgcgccaag ctcttgtgtc      5340
     gtcagatcat ccagaagcag cgtgcgatgg cttccgttgc cgcgatcgtt tgtggtcttg      5400
     gcattgcgga cgaccataac ggtcatcccg tcatcgccgg accggatcga tgcctcagcc      5460
     cactcgcatg gtcgcagacc cacgaggcta ttcgcctcaa gaaaggtttt gaggccaacg      5520
     gcccaggaat ggcggctctc ggagatcccc ttgtggactt ctcgcagcac caaggcgagc      5580
     tcggatgcct tgaacgactt cgacttcaga gcagagcccg cccgcccttt gcgcgcgtat      5640
     ccggtctgcg gcgtcgaatc gagccgctcg atcgcggcgc taagcaattc ggtgtcgtat      5700
     cgggtgggcg ccgtctccag gtcagcctga aacaccgcgc gcaaagcagc cttgtactga      5760
     cggaaggtgg ctttggatat gacaccggca gcggccgcct cggcagcaga accctgcatc      5820
     cggacgccgc ttttcctttc gccggctgaa gactgctttc gatggcgctt aaaggcggcc      5880
     aatgcgtcgg ttgccgcctg ttcgctgcca tgtccccgtc ccagtaggtc gtcgaccaga      5940
     tccatcggga gcagatcagc cgggttctga ccacgaatcc tggccacccg tttacgcaag      6000
     tcctcgactc gacggcggta ctgggcttct gtttcctcgg tgcgggtgct cgttgtcata      6060
     actcgattcg gtggcagggc aatcaactcg ctccctacgt taccacacag gaaatacccc      6120
     gcgtggtaac gctcttggct acgccaatcg agacgccacc gaatggcggc agcttggaca      6180
     acggagggtg cgttctgccg gccccgaggg gcagggcgca cggaaacgaa aaagctccca      6240
     tcgccgtccg aggccggatg cgatcccata agaggggatg tttgcgcccg atagcaccaa      6300
     gcaagaccgg agccgggtgg cagccaagcc gcgcacaaat acatgccagg gagtccctat      6360
     ggtctgcgaa gtcgcgcgtt agcgacacat atacgtgacc gtgcacagag ccggcctgtc      6420
     acattcgttc gcatatatgc gacgcgagta cacggtggaa gtgtcggtgc cgagtggtga      6480
     tgtgatgctg tggggggttg attgcagaga tacggcggga taacctgcgc cacaaatgtt      6540
     gtgtaatcca tgccacgtat tcaccaacga aaggcaacgt gccccgatgc gtcgctacca      6600
     agctgtcctc ctcgccacct gcgcggctct atccgctggc tgcgccacca ccagatcagc      6660
     gggaccatcc gcgtcggacc cggcgcagga gaatctcacc gccgcggcat cggccatcca      6720
     gcaatcgttg cgcgacctct cggaagcgga gcaatacgac aagatgcgag ccgtgcccgg      6780
     caccccgcgt cttcgcacgc agattccggg cctggagcgg atggtgacca tgccttggaa      6840
     cggtccgctg gagccagccg tcatgcgttt ggctgcggag ggcggctacg agttcaagct      6900
     tctcggcagg caaccggctg taggcattgt ggtgcaggtc gggcccgagc ccgcaacgat      6960
     ctccgatcac ctgcgaaatc tgggcattca ggccggcact cgcgctgaca tcgcaatcga      7020
     gccgactgct ggcgggcgcc gcggcattat cgcaatcgag tacagcaatg gcggtctctg      7080
     atgccccgcc gaacctagac caggcgcttg gtgcgttcga gcgaaacggt gctgaggtcc      7140
     gtgtgattga cgcggttggc gagttgcgcg cgtccgccat tcgtgaggat ggactgtcgt      7200
     atggcgttcg cgctggactt gcccggcgct ctttcgagat ccagcagctg ctggccaagc      7260
     aggcaccgca gctggaccga gcctttgatt tcggctcctt gctcatggat cgcaacgtcc      7320
     ttcccccggt gctgactgaa gcgagtcagg tcgttcattc agagggcacc gacgttcttc      7380
     gtgtcaccga caagatctat gcgatcgcgc gtcaagcaca gttcgtaacg gccgccccta      7440
     cctggcgctc gtacgtcgtt accgaggcga ccttctccta tgacccaccc gagccataca      7500
     tggcacccaa gagtggggat gagcgaacgg tatggaagca ggcggtcacg accggttgga      7560
     aggcagggga gcagcaggca gaccagatcc taaccgaatc gcttaacagg cttaagcgtg      7620
     actatcaggg aatgctgctg taccggcgcc tgcttcaaca gggcgtcgtc agcaagccat      7680
     atgtggccga ggccaactac ggaatcacag gcgacgggga caaggtgaac atcaacgagc      7740
     gcatgctgcg catcactgcg ctgcccaaaa tgcagccgca cacacagtgg aagccaatcg      7800
     cggttccggc aaagcccatt cagccaactg ttcgggtgaa cccatgaacg cggtgctctc      7860
     cgaccagagc ctgatcgagc gggcgctgct gcgatcagag ccgactgtct tcgacgaaat      7920
     cggtgtccaa cagcttctgg tccatgccaa agcgatgggc gcctcggacg tatacatcaa      7980
     gacgaatgcc agagtcaccg cgcggatcca cggccggctg taccggctca cgcgccgcac      8040
     gctgtatgcg acggaggtgg gctccattgc cggctacctc tacggcgggc ccaacgccga      8100
     ggttcagctc aagcgcggga tggacctgga caatgcatac acattccgcc tcaatcgctc      8160
     cgactcgctg cgcttccgtt ggaacgcgac cggcgcggag atcgacgggt cgttcggtat      8220
     ctcgatcatc ctccgcgaac ttcccgagat tccaccggca atcgacaaag aagacttggg      8280
     cgatgacctc tacggcgcct tgtacccgga cgacggcatc gtgatggttt gcggtccgac      8340
     cggatcaggc aagtcgaccc tcttggcggg catgattcgg gatatcgcag agaaccccga      8400
     ttcgcactgc cacatcatca cctacgagtc gccggtggag tttgtctacg acaaggtcga      8460
     gaagccgacg actgagattg aatcgacctc catcccggat cacctgccga actttgccgc      8520
     tgcaatccgc aactcgctcc ggcgtgaccc agacatcatc gtggtcggtg aaatgcgcga      8580
     cggcgagacg attggtgcgg ccatccttgc ttcgcagaca ggtcacgtgg tgtatggaac      8640
     ggcacacagt acttctgtcg gcgctacttt cacacgcacc atgcagagcc tgccgaagaa      8700
     cgagcagcag ggaatgttgg gtggcctcat cgactcactg cgcctcatca tctgtcagga      8760
     gctcgtccag tccaccgacg gcaagcgcgt ggcgttgcgt gagtacctgt cattcgggga      8820
     aagcgagcgc cgcgcgctcc tgactgccgc catgcgggat cctgcaggtg tgccatcggt      8880
     cgcgcagcag ctcacccgcg agcgcgggca gaccaagctg atgcacgcac gcaagctttt      8940
     cgctgccggt cgcatcaaag aggacgtggt actccgcttc gagctcgccg agcagaccgc      9000
     aagagcgcag gtaagtttgc tggccgggga gggtgagtga tgtcaggacc ggcagattgg      9060
     cgcaacacgt cactgatggc caagttcctg gtctttgacg cgcgcgcatg tatccccttc      9120
     gtcatcctgt tctacagccc gtcgttcgcc aagctgggag tgtccatcgg gctgttccta      9180
     ttcttctcgg tcttgtcctt ttacaagtac acgctcgttg tgctcgtgcg gcgcatgcgc      9240
     tgcaagctcg cggggcctgt gcggtccggc gtcgcctggt ggcatcgccc acaacgccgc      9300
     ctgtatcggc atcgctgagc caagcgcaac tcaccagata cgcaactaag cgagagaacc      9360
     gtacccatga atccgcggcg aaaggccact atcaactggg gcatcttcac aatgaaggtg      9420
     ctcgcaatat tcgcgctcgg cgtaggagcg attagcgtta ggagcaccac cgacacggtg      9480
     gggatgctgc ttgatcagac cggcgcacaa gtgcagttca tgcagaaact cgtcgaaacc      9540
     aatgatcctg cacttgcgga aacggcattc aagtacggtc gcgaggtcat cggttccttc      9600
     gacgccacgg cgctgacgca gcaggtcctc gcggtttacg cgctggcggc aatcaccggc      9660
     gtcttcgcaa tcttcattct cctcggattg ccgagcatcg accgggcggg ccatggcaaa      9720
     tcgcgttggt cgctgcgaaa gacatccgta cccaatgata tgaaatcgac cccttccgat      9780
     ggcaattcca atgactgagt ccaatcccat tcttgttgcc gtcgacgacg gttttcgcca      9840
     gatcaagctg gtaaccgcag atcgccgcca cgcgcagctg agcgtggcgc gcccagggtt      9900
     taccctgggc ggcgcactgg gctccgcagg gggtgacgcg ggcgcgggcg cctaccgcac      9960
     gcagggccgg gatttcactg ttgatccgga cattgaaggc gaggacacgc gctttgacga     10020
     ctatgcgcta tccgatatca accgcgtcct ggtgcatcac gccctctacg ccaacgggct     10080
     gagcggtcgc gatgtcgtgc tggcttcggg cttgccgttc ggactttact tccgtgccgg     10140
     tacaaccgaa tccaacggag atctgctcaa gcgcaagatg gagaacctgg ctatccccgt     10200
     tgagtcgatg gacggtcgca agcctccccg cattgtcggt cagtttgtcg gtgcgcaggg     10260
     cctgatggcc tatatcgatt acgctcttga tgacgccaac aattggcggg aaggaatgga     10320
     ccccaccgcg ccggtagtgg tggtggatgt aggcggccgt accacggata cggcaacaat     10380
     tattcgtggg tcgaccgttg atcacgcagc gtcagggacg atcaacgtcg gtgtcacgca     10440
     tgtgctcgac catctgcgca gcctcatcat ggcgaggttc ggtgtcgcgg gcgttcgtcc     10500
     ttcgcgactg gagacgttct tacgatcggg aaaggtgcaa ctgcgtggcg agtggcatga     10560
     catctctgct gaacgcgagc aagccgtcga cctggtactg cagcaagtcc ggcgcgaact     10620
     gcagcggcgg gtgggcgatg ctgcagacat gcaggcagtc ctgctcgtcg gcggcggcgc     10680
     cgcgctgttg gccagcggcc tgaagacggg gtaccggcac ttggtggtgc ctgaggatcc     10740
     cgagttcgcc aatgcgcgag gcatgctgaa aacgctgcgt ggaaacgttg ccgcatgagc     10800
     gatgacgcgc cgtccggaaa gctgatgcgg atccgcgtct acgaggacga cgcggagatg     10860
     aatgcaattc tcgatcgatt caatcaggtc cgcgagaact cgcgcaaccg gcgaggacgc     10920
     gcgcgccggg gtgcagagag cgaatggctc agacggatcc ttgtcgccgg ctatacccag     10980
     ctccacgggc cgttctatgc ggctcaggga agcccgacag taggtcctga accgccgaca     11040
     ttggaggtgc ctcgtgcgcc acgccgagcg cccaccgctc gtgcaaaggc tgatgatccg     11100
     cccatcgcgc cggaaataac agggccagat aaacaaacaa aagttgcaca ttcggcgcct     11160
     tcgtcgaata atgatacggc gcaacaacaa cggcactcgg ccgctcccat gagcggcgat     11220
     ggcctcgact tcaagctgct gctgggcggc ggcaacagca tcgtttcgag ccccaaccct     11280
     acgtcggatg ccacatgaaa aaaggtctct cgctcttgtt cgcctgcttg gcgttggcac     11340
     ttgccaacca ggcacaagct ggtttccgcg tggcgtcgat cgagcctgcg ccgaaggttg     11400
     cgggtgcagc ggcgtccgta gcagggattg ctccgcgaag cggctatgtg gcaatcgatg     11460
     gccaagagcc accgccgatc acggaagcgc tgcgtccgag ctcttcaggg ttcgggttga     11520
     tcgctgtctc atacgtgggt ggtccgccgg ctgtaattga gcgccgtgcc ggtatggggc     11580
     gcgatgtacg gctcgctgac gcgcttaaac agatcgcgcc ggagggctgg cgtggatttg     11640
     ggaaatctga gatcgccgga tcattcgatc caaacaagct tgtcaactgg cgtggcgggc     11700
     gtccgtggac ggacgtgttg gacatcctcg caaatgataa cgatctgtcg atagaggtcg     11760
     attggaacaa acgccatttg tacgtcggca agcgtgacta cacgacagct tcgacaaaca     11820
     gatccagcac gcagcgcctc gctacagcat tgacgcagac ccccgtgcaa gacaaacaga     11880
     tttggtccgc gaaggctgga tcgaccgtac gagagacggt agagcaatgg gcgcaatcac     11940
     agtcctggac ggtgtattgg ccaatgcagg atcttgacta tcgaatcgtc gcgcctctga     12000
     cattcgatgg aacgtttgtc gatgcggtca gcaaattcac cctgctctat gaatccgccg     12060
     agcggccact ggcggtggga atttttgtca atcagaagtt gatccgctat tcggaaaagg     12120
     aagcagcgaa atgaagtaca tcttcaccct ggctgcggcc gtcactatgc tgactggatg     12180
     ctcgcacagc atccgcaatg ccgaccgctc ttacaatgat gtcgatggtg aagcgaagaa     12240
     gctgctgatc gatatgcgga ctccggccgt tcccggccaa cgggaaaccg tcaccatttc     12300
     caactcgcaa tgggtggaac cggtgccgat ggcggtcact actcccaagc ttccggcagc     12360
     tctgagatgc gacccaggat tcaaaacctt ggagccaatg ggtcttcttg aattcgcgca     12420
     ggctgtttcg gaatcctgca agatggcagt gcgcgttaca gcagatgcgc tatccgcttt     12480
     tggcagtggc gatagcaata gtgcaacgtc cggaccgtct gcaggtgcat ctgtgccggt     12540
     tggcggtatg cctctaccaa atctcccgat gttgccacct gtcacaggca ccgctgccaa     12600
     cgcaagtggt ggaatcggtg gtcgcgccgg cggagctttg ctaagcaaca tcgaatggaa     12660
     aggcccactg gccggcttgc ttgatctcgt cgcctcgcga tatgggcttt cttggcgcta     12720
     cagcgagcgg aataacagcg tttcgatctt ccatgtggat agccgcactt tccagctgga     12780
     cgcgttcccc aaccaagttg atattcagtc aacgacccac aacgggatga gctcacaatt     12840
     gggctccggt ggcggtggcg gtggcggtgg cggtggcagt ggcggtggcg ccagcagcgg     12900
     cggatccagt gggggtggtg tcagtggcac agtcggaagc tctcaaacga ccgttacgtc     12960
     aatgaagtcc tcgctgtaca ccgatgtcga aagtgcaatc aaggttctgc taactcctgg     13020
     catcggccgt gtcgcgcttt caccgagcac aggtgcggtg acggtgacgg atacgccgga     13080
     tgtgctcgat cgtattggga gcatgctgga gcgggagaac acgacactta ccaagcaggt     13140
     gacgttgcac gcgaaggtgc tttcgctgac ccttaacgat gcaaacgaag taggcgtgaa     13200
     ttgggacgtg gtgtacaggt cgctgtcgcg tcagttcgaa ttcaccaccc cctttcaacc     13260
     cgcgtccagc gcaggaacac tgggcgcgtc agtcatcaac acgggcaagt tcgccgggac     13320
     caatgtcatc gtttctgctc tgtcgacact tggtaccgtc aacaccatca cttcgccttc     13380
     gttgaagaca ttgaacctgc gtccggcgcc catccagatc gctcgccaga ttggctatat     13440
     ccagagcgca cagatctcac aaaccgaggg tgctgggacg ctcggcgggc tgacccccgg     13500
     atttgtcact gttggcttca acatgacggt ggttccccga ctccttgcgc agaatgagga     13560
     gatgattttg cagtactcga tcaacatctc ggctctgaat gagttgcgga gcgaagaggc     13620
     tggcgggacc aagatcgaaa tgcctgacat cgacacgcgc aacttcaaca gcgaggtccg     13680
     actgcacgct ggggaaacgc tgatcctcca cggattcgaa caggagaatc actcgtcaaa     13740
     tcgccgcggc atgggcagcc cattcgcatg gatgctgggt ggaagcgcta gaggacagcg     13800
     tcagcgcacg gccatcgtga tcctgattac cccagaagtc ggatcttcaa tttcggctat     13860
     gcgctgattg ctgaatcaca gaacaaactt aggacacacc catagcatgg cgcgccgtaa     13920
     atcgatcgat acatctattg ccgatcggca gaagatcggc acgttcgtcc tgaatggaag     13980
     aacgttcgta agcggtctgc attgggaaac cctcgacaac gtgtcctctt ttatgaaaga     14040
     ggcgcgtagc aagggtcgcc agtggggcat ggatgtcgtc gcaacccgta agggcgtcga     14100
     cttgcgctct aaggggaaaa gcgcaaagta tcaggctggc tatgcgccca agaaccgcgg     14160
     cgccgccaag ggcatgtact ccctggcctc agtacttgcg agcgaattcg gcagcaactg     14220
     gatcggtgcg tttcgcatcg aagaggaacg ctatgcgctg gcagccgtcg tggatggcag     14280
     cattgttccg agtgctgacc gaatcggtac gctgtcagaa atccgcgagg agctaggcgc     14340
     caactttagt cacttagctg gttcaggcgt gctctttgag catgtgattg cccccccaga     14400
     gtttgaattt ggtgacaagc aggttgatct agcatcgctg ttggtcgcct cgaagttgaa     14460
     gccagagcac aggctaaagc cacttacgct ggggttgagc aagggtgagc tgtttcggct     14520
     aaccctcttc gcggcgatca ttgtcgctgg cggcgcgctg tacatccttt accaggcaag     14580
     ggaagaagag atgctgcgtc gcgctgatca ggcgcagaag gcagcacgcg cccgcgcaga     14640
     agctctgcta aacatcaagc cgccgccacc ggcgccacct ccaccttggc ttgcctctgc     14700
     aaaaatcact gacacggttg ctgcatgttc ggctgctatc gacaagctgc cgctggtatt     14760
     gggcggctgg atcttcgaga aagcctcgtg caatgccggc ggagcgctct ccgcggccta     14820
     taagagggga cacttggcta cggccaatag tgttctttct gcggccgagg cagcgggact     14880
     gccgctcgat ttctacgacg ccggtgagtc tggtgtcgtc aatgtgctta tccatatgcc     14940
     gtcggccagt agcgaagagc tattggcgga aaagcaggtg atggcccgac ttgtctcaca     15000
     tttccaggcc gcaggcgtca agttcccgct gcagaaacag gcgatccccg aaacgccgcc     15060
     aggggaagag ccgactacga gcaaaccgaa ctggtcgacg tacaccttcg agatcgtgac     15120
     gcaaatgccg ccagtggcgc tgttggaagg gctggcacct gatgggctgc gggcggaaac     15180
     agtcgcagtc agtctagacg gggaggccgc taggctgact tggaccatta acggagcact     15240
     ttatgtacgg taacaaatgg ctcaccggct tgcttatgct gacgctggtt gcaggtgttg     15300
     aggctcagga ttcggtaccg accgtcggcg agctatccag aatccaagcg gctacgctgc     15360
     tactgaaagc acgagcagaa caagctaagg tgcaaagcga attatccggt gacagcacta     15420
     aggccggtgc gacgccattg attgagccaa cgatcgcacc ggtggtctcg cgtgtatacg     15480
     gcgtgggaga caaactgaag gccaggtttc tctatgaggg cggagcttct accgatgaag     15540
     tagtgggctc tttgattcct ggtgactacc gagttgtggc ggtttccatg gatcgagtga     15600
     tcgttgagcg tcacggaaag cgcttagaac tcgcattctc cggaaccccg cctgtcgccc     15660
     caaagacgaa agagcaggtt ccgcagccgc cgtatgcctt ccctagcatg atgcctccgg     15720
     caaggacggg tggttaaaat ggtcgcgagc gtaacctcga ttgcgcctga gtcggcattg     15780
     ccagttgctg aacccacaaa ggcagttcgg tactgtcgcg tgctcaccgc agaactgggc     15840
     gtctacttcg ttgcggaaag caaacgcgcc gttgtgtgcc tacttgctga tgcagatggt     15900
     cgtagcgccg agcttgtggt gtcgagctcg cacaagactg atccgattgt gttgtcgatc     15960
     ttcaatattc tgcggcggaa cgcgcaaaac attacttggg tgacacgcta cacgcaggta     16020
     tcagaaattg cgaagcttta tcagctgcac tccacgaacc tcgtcgctaa cgacgatgat     16080
     tcagccaggc aggaccaagt caaaggatac atccgagagg ccaataacat gggcgcttcg     16140
     gacttgaaaa tcatcgttgt aggaccgtat tgccgaatca ggtacacgat tcacggtagg     16200
     acaaagactt accatgagct accggctgct gaaggtatgt tgctctcgcg tgcactgtac     16260
     aacacgatgt gcgcggagat gacaggctcc ggtctcgatc ccaacgcgat gcaggacgcg     16320
     cagttgaagg ctgatgtggc cagccaatgt ggcttagtcg gctcgcgtat ttcgacacgt     16380
     ccagccaacg gtcgaggtat ccgaatcgtt ttgcgcttgc tgccgccaaa tcggtctgca     16440
     gtccaggagc tcgaagatct cggttacctc cctgacagcc aaatccccat cctacgggaa     16500
     gtgatggcct tacccttcgg catcgggctg atttccggag ttacaggctc cgggaaatcc     16560
     accacgctta aggcaatcat tgagaacatc ttgcgtgata gcgaccagga gacggacgta     16620
     cttacgattg aagatcctgt tgagtacgac attgaggcag agggctgcac ccaaacaccg     16680
     ctcgtctatg agcaggacga ccccgagggg cggcgcaatg cgtggcccaa tgcgctgcgt     16740
     aacgcaatgc gccaagcgcc aaaaatcatc gtgcccgggg aaattcgtga ttcggagtcc     16800
     gctctgatcg gctatgaagc ggccgtgaca ggtcacttca tttggtccac ggtgcacaca     16860
     ttcgatgctc cgagcatcat cgatcgtttc cggctcctgg gtgtggcaga tgatcgtctg     16920
     ttcaatcccg cactttcagt ttgccttgtc aaccaatccc tgctgccgca actctgcgtt     16980
     tcctgcaggg ttccttacct cgttgggtgc gccgcaattc cggcacatgt acgcacgagc     17040
     attgaagagt tttgcgaagt cagcaaggtc tacttgcagg gaccaggctg cgaggaatgc     17100
     agcggccaaa caccaggcgt gcgcggtcgt aaggtggctg ctgaaatcat cagaccgact     17160
     gcagcgttca tggaggtctt caggcgacag ggaatggttg ctgcccgaac ttattgggtc     17220
     aaacagatgg gtggcataac taaactcgct cacgcgctga cctacgtgca ttccggcctg     17280
     gcagatccac gccatgtgat cagagacgtg gccgcgctta acactgatcg cttacatatc     17340
     ggagattgag atggcattcg ccgatgtatg ggattcgctc tcgtttgacg ggataaagag     17400
     ctgggcattc aagtgctatg tgaagctcgg ctttggcatt acagcgcgga tcaacttcta     17460
     cgagtctttg accctttctc tcgacaacgg tgagagcgtt ctggacacgc ttgagcagca     17520
     acgagctgcc tttgatgaag acggaattgc ggtattgcct gcgccacagc tggtgatcat     17580
     caatgactgt attcgtgccc tgacacgtgg tgaccaattg gctgacgcgc tcgaagagtg     17640
     ggttggcatt caagaggtct cactggtcgc ggccggtgag tcgtcaggtg acttagtagc     17700
     aggtttggac cgcgttgtgg aatcactgga gcgcaggcaa gagcttcaac gtgtgctgaa     17760
     agaagctctg atgtggccgg cattcatcgg cctcgggatt gtatctgcga ttttttacat     17820
     ctcgctggag ctgattcccg agctactgcg gatgcagcca aaggaggcgt ggccggcacc     17880
     cactcagaag atgataagca taggtctctt cgtcgtcgga aattggtttt acatgctcgc     17940
     tgcatttctg attgctgcta gttggctggc ttgggccctc cccaatctca ctggccgcat     18000
     acgagacaaa ttcgacaagc tgccgttttt ctcgacgtat cgtgtgtttg tcggaacaac     18060
     atttctgctc aatgtgtcgg cgttgctggc ggccgggatt ccacttgagc aggcactgat     18120
     tgacatggcg aggtacgcaa atgcatatct gcgcgaacgc atagacgaca cgttgcgtgg     18180
     catcaaaacg ggtgccaact tcggtcaagc actgcacttc actgagcatg actttcctga     18240
     caaggacacc gtcagaaacg tcaaaacatt agctgaaaaa aagggctttg aggttgcgct     18300
     agagaaattc actaaacgct ggctcaagca aaatatgaag ctgatggaac gatcagccgc     18360
     cattttgcgc ctgatcatgc tgctgatcgg agcgtatgta atcgtaacga tgttccaagg     18420
     cgtttacggt atcgcgcagc gacgttaaaa caggtttttt ttaaaaatga cgttcaattc     18480
     taaatggaga caacaatgaa gcgttccagc agtttctcat tccggcgtag ccaatccggt     18540
     gtatcactcg ttgagttagt gatcggcatg gtcattcttg gcgcgattgt tattgcaatc     18600
     cttggtgttg cccgcggtgc acgcggttcg tccaaggtgc agacggagag ccaaaattac     18660
     aatgcgctga ttgagtgcgc ccgcaacatg aagtcggcgg gcacttatgg agcgagtggc     18720
     accaatctgc tgcctgctgc gatcaaccgc cagtgtatcc cgaccactat gccggttact     18780
     ggtacgacgg tttcaaatca gttcggcggc gcagttacct tggtttctac tggtaccggt     18840
     ttcatcttca gcacagcagc gattcctacg gaagtctgcg gtggcattgt cacagaccta     18900
     tcccagtctg gggcatacag cacgaagatc aatggcggga ctgggatcac cgggccggtg     18960
     tcggttgccc aagcagatgc tggttgcagt tcggatgcca actcgatcgc ttggacgatc     19020
     tccaactaag ccgcgagtca gttcaatgca gctcaaagac ctgcctgttg tcgacatcta     19080
     tctgggacac gactatagcc tcatgaagga tctgccgggc gcgcaagcgc ccggcagtgc     19140
     cgcgcccgat cagctcaagc aagagctggc gaacgtaaga ggcctatgcc tagaaatgtt     19200
     cgagaagtcc ggcgatcctg aatttgcttt gagcttggat ggctttgtgt accgtgtgac     19260
     aacattcgtt gataccagca cacacccagt gtttgttctt tcacgcgcgg cgagcaaggt     19320
     tattccaatt gaacgattgg atattcctaa gcatgcgaag gaggctgtgc tttcccctag     19380
     gacacggggc atcgttctag tgacaggaga aatgggatct ggaaagacag tgaccgcgac     19440
     aacgcttttc gtcgagcgtc tgcgacagac tagatcaatc ggccttgccc ttgaagatcc     19500
     cattgagtct aacctcaacg gcccgcacgg ggacggctgg tgtatccatg tccaagtctc     19560
     gcgacgagag gggggatacc gcgagtatct gattcgatcg atgcgttcac gcgcagaaac     19620
     aatctatctc ggtgaactcc gcgatgaatc atcggcagag caggcagtgc agctcagtaa     19680
     catggggcat ctggtgttta caaccgtgca tggtggtgat ttgccgcagg caatagagcg     19740
     cattctgtct ctctctagag gcttgcgcga tccatctggc atgttggccg agggtttggc     19800
     agtgatcatt caccaaaagc tagtgcattc cacggctctg cctggcggca cctcaatacc     19860
     tcgcctggtt gccaaggcgt taacgcttgt gccggcacat ggggacgagc gcggcgaggc     19920
     tttttcgaaa tcggccagag ctctgattcg caccaatgag ctctcaaaat tacaaacgtt     19980
     aattgagcag caatccaacg ccgcaacatg gaggggcaac ccatgaggat aaagcaccgc     20040
     ggttttgtat tgatggaact agtgatcgcg ctggcgatct tggccgcgct aagcattggc     20100
     ctcatctcgg tgatacgttc ccaggcacag tccaagcagt tggccatcgc cgcgaatcag     20160
     ctagtcgact tcacaaacgc aaccgaacag tacgtcaaga atgagtacaa cacgattcta     20220
     agctctgccg gcacaacaag cccggtagtg atctctgttg ccaacctgca agccgctggc     20280
     ttgctgccgg ccagttaccc taatgcaaat gtcttcggcc aggtgccgac aggtcgatcc     20340
     cggaaggcgt cgggcaatac gttggagacg cttgtgatct acacaggggg cgtagcgtta     20400
     tcccaatcag acttggacga gctcgccgga ttggcggcgc agcaaggcgt ggccggtgga     20460
     tcggttgggt ctgcggatac cacgcgtgct gtgggttttc tcggggcgtg gtccatgccc     20520
     ttgtccaatt tcgctatttc gcctggtgcc gggcgcgctg ccgcaaatgt cagttacacc     20580
     aacgaagcgc gatcggatac tgcacttcac cgacaggcca taccagggcg gcctgaactc     20640
     aatcgcatga gcacgtcaat tgatatggcg aacaacagca tcgacaacgg ggggcgaatt     20700
     gccgcccagg atgttgacgc ggcaaatggt atgcaagcta accagatcgc gatcggtaaa     20760
     agcgtctttg gagctttgcc ttatgcgtac gaaacggtgc aaattaactc agggttgacg     20820
     tttcgcgttg ctgctggaac caaagaactt gcagcatttc aatccgatgg cagctctatt     20880
     tttcgcggca atctgtacgc agacagcgtg aatgcaaccg gcataagccg cgctgctgac     20940
     ctcatcgcct caaacactgt gcaaggccag gacgtttttg cgaataactg gtttcgcagc     21000
     cgcggcaatg gtggctggta ctcagagcag tacggtggtg ggtggcacat gaccgatacc     21060
     acatggatcc gggcatacgg cgataagaac atctacactg gcggtgagat acgtggaggt     21120
     gctgttactg cggaaggacg cctacaggct aacgaattaa agctaaaccg aattgaatcg     21180
     gaaggagcct cctgctctga aactggtctg aacgcacgaa gcagtcaggg tgctttgctg     21240
     agctgcacgc tgggacaatg gaagagcggg ggcgggatta gcaccacaat agtgaccggt     21300
     gcacgctctg caggttgcag cctttcttcg tatgcaacct gtcctgtcgg aacactcgtc     21360
     gtaggcggag gctacatgtg gaatcagaac tgcaacggca aagaggaata tcagttcaca     21420
     tcgtttgata ggccatgggg aaacgctggt tgggaagcgc gcgtccaaca agcgttggtg     21480
     acagcctacg caatatgcgt accatattga gagggatcaa cctatgttca acattgctgt     21540
     gacgggtttt tttttctcgc ttctcatcac gctgtcgatg ggaagcgctg cgctttcgca     21600
     gcagcgggcc atgttcggcg aagctgcagt gattgcgcag agcattgcgc tttacggtgt     21660
     caaagtcgca aattatcgct tggcgaatac gacatttagc ggtagcgctt cagactccgt     21720
     tcttaatctg cctgggtatt acgtcaagtt tcccggtacc ggtaacatga tttcgggagg     21780
     gcgttcatac atctatatgg ctggcgtaga gcgtgggatc aaggggtacg tgtatcgaaa     21840
     cctggatagg tctggcgcaa caatcggcta cgccaccggc ggccgtttgg tcagtgccgg     21900
     tgggacggat cagggggctc tgccggcagg gataccgtcg gactcagtag tcctggttct     21960
     ctgacttgag tgggcggctt gagtgcgtgc ataggttact gtggagggtg caactggtcc     22020
     gcgtgctctt tgttggctgg ccagtgcttt cggtgcttgc caagccgatt tcttcgtggc     22080
     aggataatcg cgcgcttagc acgggctgcg gagacattca atgagcctca acgatttcat     22140
     cgacggtcag ctggtcaaca acactttcaa tcgtcgggcg gttgctgaga ctgctaataa     22200
     ccgcgatgaa tggatggctg aggcaaagcg cctgcgtaga gaacttgagg ccacgatcgc     22260
     cgatcgggac acctggaaag ctcacggtac tgcctcgatc gagctcgtac gggacttgcg     22320
     cgaaaatctt gcgcagtcta gtccagcgaa cccattcgcg gatcggaaca ggcttaacga     22380
     gcggctgaag gcgcgcaagg tggagctggt gcagcagatg ggctaccgag tcatcaatgc     22440
     ggacgcagat aatttcacca tcacgcgctg acgcagcggt tatcgcgtcg agaataaggc     22500
     ccctccgggg cctttcttcg ttgtgtgcgc taattggtag cagaagcccc atgaaaattc     22560
     tgggaggact ttttacagtc ctcccatgac ttggcgcacc ccatcctcac tcaagtggtt     22620
     gatcgtaaag cactcccggt tgcaggggga gattgagctg ctgcgccggg aggcagaaga     22680
     gctggatact caagttgtcg cgcagcgaca gcgcttggag agggcagaga agaaccttct     22740
     tgcgatcgag acatctcttg gtatgcacga agtgcaagtc gacgttggtg acattgccgc     22800
     agtcattcct catgtcaatc aacctattta taggcacggt gacctaactc gaaacttgta     22860
     tgccgcgctg agaatcgcgg gggattggct gacaaccggc gagttggttg agcgcctgac     22920
     ggggcacact tacgagaatt gcgaccgcaa gttgtacgag aggatccggc ggtcgtttcg     22980
     gaaacgcctg acctcattgg tttccaaggg aagtgtagag cgagagtttt cccagggcac     23040
     cacggattgc cgacagaatc atacccgctg gcgtctgctg tccggcagac actagccagc     23100
     acttacggac gtcgcttacg gatgatgttg agagaaatga aaggatggaa tccccgaagc     23160
     tcgggcagac ctccggccgc aggctgagac atgcgcctca cagctcaacg ttgcagcatt     23220
     gcctctctta ccataatcgt ctccagctcg aagttgtcca gaagcccttc tacgcgtgcg     23280
     gcgtctgcat cggcctgtgc cgaggatgcg cattcaaccg accagctgtg gtgaaccctc     23340
     catgccttcg aaggtcgata gaactgcgct ccttgttgct cgataaatcc ttgccggcgg     23400
     agaaaggcag gcaagtgggg attcacgaca ctgccgacat acgtcgcatc ccacgggttt     23460
     agctcatcac atagttcaag gaaaccagtg aaccagcctc ggccttcata tcgcggattg     23520
     gcaacgactt gcgcaatgtt gagcacgtcg acgcgccgac caaatccatc tagattatgg     23580
     atggccggat gcacctgaac tctgaagcct cctcgtttta gatccacacg gttcggtatc     23640
     ccccccactt ttacgagtct tagccacgta agcaactgaa gctctacgct cggaatcctg     23700
     ttgagctgag tgttggtcat catgcacgat accttttaat tattctggtg gctttcacgc     23760
     cggtaccagg ctatccctgc ccaagaaata gtcgatgtcc aactccgtct cgcggtgatt     23820
     gccttggaag tatcctcgcc accaggttga tcggggggac tgcaccatgc ttttgagaag     23880
     agcgtgaacc cgagatatct ggcaagcccg acggaaattc tccctccaga ccatttcgca     23940
     cgcgtagtcc tggatgtact ttgggcggaa cccgtgcgaa acgccgtact cgtggcgtcg     24000
     aatcctactg ttccagctct ccgccgcgtt gttattcact ccttcgtcag tggagtactc     24060
     gtgggagtgc tggaccgagt agtgctcaaa ccagctaccc agccgattat aagccgggct     24120
     ctcatctgac atcaccagcg atcctcgctg gatgaagcgc tgggcgagtg cgatgacatt     24180
     ggcctcgttc tctgccctgc acacgaacgc catcacgcgc tcggagccgg cccctttatc     24240
     ccctgtctga cagatggaaa tcacgacccg cttgtccatg cgcttgcgcc agttcctgcg     24300
     cgtcattcct gcagaaaccc atggcttgga gggatcattt ggaggtttct tgccgtaccg     24360
     aactttcagt gcgtccttag ggaacctctg aacaacgcac cacagatacg cgacactacc     24420
     cgcctgatgt tgaggggtga tccatgcaac tgacgttcgg tgacgctgag ggcctgggca     24480
     agcgcaagca gacgcgccgg gagatcttcc tggccgagat ggagcaggtc gtcccgtggc     24540
     agcaattgct cgggctggtc gcgccgcact atcccgtgtc gggccggcca ggtcggcagc     24600
     cgtacgcact ggcgacgatg ttgcggattc atctgctgca gcagtggtat gcgttgagcg     24660
     atccggcgat ggaagaagcg ctgcacgaga tcccgacctt gcggcggttt gcccagctcg     24720
     gtggcttgga caacgttccg gacgagacca cgattctcaa ctttcggcgc ctgctggaga     24780
     cccatggcct tgccgcgcgg atgctggaag ctgtcaacgc gcatctggcg cgcaagggcc     24840
     agagcctgcg gtcgggcacg atcgtcgatg cgacgctgat cgcggcgccc agttcgacca     24900
     agaacgccga ccatgcacgc gaccccgaga tgcatcagac caagaagggc aatcagtggt     24960
     atttcgggat gaaggcgcac atcggcgtgg atgaattttc cgggctggtg caccacgtcc     25020
     attgcacagc cgccaatgtc gccgacgtca cggtgacgca cgcattactg catggcaaag     25080
     aagacagcgt gttcggcgac agcggctaca ccggtgcgga caaccgcgaa gaactgcaga     25140
     cctgcaaggc tgcattcttc attgccgcca ggcgttcggt gcttcaagcc atcggcaaca     25200
     agcgggagcg tgctcgggaa cagcgttggg aacacttcaa ggccagcgtg cgcgcgaagg     25260
     tggagcatcc gttccgggtg atcaagcgcc agttcggtta caccaaggtc cgctatcgcg     25320
     gcctggcgaa gaacaccgcg caggtgctga cgctgtttgc gctgtcaaac ctgtggatga     25380
     agcgaaagca gttattgcct gctatgggga gcgtgcgcct gtaacgcagg caacaccctg     25440
     caaacgcgcc ggaaacggca aaaaaatcga ggatctgagc gccgtcagcc tggccgatgt     25500
     agttgggctc atcctccgac gccgttgatc agaccatccc taaagggctg cgtcgttgtt     25560
     ttcacgacaa atgaccgctg gccagctcgg cgatctgaca gttgcagggt ggtacttatg     25620
     caggcattac ccgcacgcca tgggggatag cggtcgcgta gaccggcggc accgactcgc     25680
     gtggacagac tgcgtccacc accagctacc gcgcgccata tatcgcaacg cgccgtgctt     25740
     tagccggggc agaagattca tagggccgcg gccaatccac gtacttgatg tcggcgacgc     25800
     tgggcagctg ggcgatcgcg cagctgcagg ccgataccgg tgccggcgtt acaagcaccc     25860
     agtgggagtc gcagcctcac ctgccaacgg tgctgactgg cgccgacgac gtccccccgc     25920
     cctgagtagc ggcctggttt agagtccggg gttgatgata tcggtgtttg ccagatgttg     25980
     ggcatacgca gccggcgtca tgccgccgat tgctttcttg ggtcggtcct cgttgtattc     26040
     gcgtcgccag cgttcgattt cggtgcgcgc gtgcagtaac gtcgggaacc agtgctcgtt     26100
     gaggcattcg tcgcgcagtc ggccgttgaa ggattcaaca taggcgttct ggttcggttt     26160
     gcctggctgg atgagccgta gttgcacatt acgggcatgc gcccaagcga ccatcgcctt     26220
     accgcaaaac tccttgccgt tgtcagtgcg gatcaccttc ggcaaaccgc gactgtgcgc     26280
     cagtcggtcc agcacgcgcg tcaccccgtg cccggagatc gcgcgctcca cttcgatggc     26340
     gaccgcttcg tgggttgcat cgtccacgat caccagacac ttgatcaccc ggccttcggc     26400
     ggtgcggtcg aacacaaagt ccatcgacca cacctggttg gcctgcgatg gccgcagcag     26460
     cggttgacgc tcgcctattg ggaccttctt gcgcttgcgg cggcgcactt gcagctgctg     26520
     ctcgcgatac aaccgttcca cacgcttgta gttcacgatg cgcccttctt gccgcaattt     26580
     gagatagatc attcccacgc catagcggcg atggcgatgt gccaacgcac agatgcgttc     26640
     gcgcagttcg ccattgcgat cttcgcgcgg gcaataccgc agtgcactgg cgctcatgcc     26700
     gatcactgcc aacgcacgac gctcgctggc accacgcccg atccattcgc gcaccagcgt     26760
     acgacgcgcc ggtgcgctta ccactttttt cgcagtgcat ccttgatcag gtcgttctcg     26820
     aacaactgct cggccagcaa cttcttcagc cgcgcgttct cggactccag gtccttgagc     26880
     cgcttggcat cgggcacgct catcccaccg aacttgctgc gccacaggta gtacgaggct     26940
     tcgctgaagc catgccgccg gcacaggtcc ttgatggcga cgccgctttc ggcttcgcgc     27000
     agaaagccga tgacctgctc gtcagtaaaa cgtttcttca cgtccaatct cctcggggta     27060
     gggaattgga ctccaaactg aggcgctact caaaattggg gggacgtcgc cggcggccaa     27120
     ggcgaagaag gtgcgcaagg cattgagctc ttcgctacca tttcttccgc aagggtcgat     27180
     gtacaggatt cgatccttcc atcttaccga gcgagagaga gcgctgtttg atagggcggt     27240
     gaccggggac gaggcgtcgc cggagcatga gacactgcag ctgctcggtt tcaaagacgc     27300
     tgacctgcgc gcttattcgg atttggtcag ataccttccg aggtatgtcg aagctgcgat     27360
     ctagacggct gagcatcctc gtatcagaac acctatcggc tgagcagggt gatcttccat     27420
     ggatgcgagc tgagtcatgt ctccaagcaa tgggggttcc acatctggca tggcactgat     27480
     acgcccaggg ttccgtagac actcaagacc ctcgttgcgc gtagcgccgt tcaaactcta     27540
     caggtgacag gtcgccagtt gaaccgtggc ggcggttggg gttgtagaac atctcgatgt     27600
     agtcgaatac ctcggcgcga gcggcgtcct tggtgggata ggtcagccgc ctgatccgct     27660
     cgcgtttgag caggccgaag aagctctcca cgggtgcgtt gtcgtggcag ttgccacgcc     27720
     gactcatgct gcacaccaag ccatgggacg ccaggaaact gcgccagtca tcgctggtgt     27780
     agacagaccc ttggtccgaa tgaaccaagc aaccagcgtt gggtttgcgc cgccacaccg     27840
     cagacaacac cgcctgcacg accaactcgg tgtcggcccg atcgcgcatc gcccagccga     27900
     cgacctgcct ggaaaacaga tcgatcacaa cagccaaata catccagcct tcatgcgtgc     27960
     ggatgaaggt gaaatcgctc gcccaggccg tgtccggctc cgtcacgtcg aactgtcggt     28020
     caagcaggtt ggccgccgcc ttgcactgca ttcctccatg gaagcgcggt ttgcgaccat     28080
     agcccacctg ggcacgcagt ccctcggtgc gcatcagccg atgcacccga tgacgactac     28140
     aacgctcacc cagatcgcgc agatccgtgg tgatcttgcg atgcccatag acactgccgc     28200
     tggccagcca gtggtgcttg attagtccaa gcaagcgatc atcttccttg gcgcgctcac     28260
     tgttgggcga gcacaaccag gcgtaataac ccgaccggtt gacccgcaat acccggcaca     28320
     ttgcacacac cctgaattcc ccgcagtggg cttggcagtg ggcttgcatg aaggcgtact     28380
     ttgcctttac cccttggcaa agtacgcggc ggcctttttt aggatgtcgc gctcctcggt     28440
     cactcgacgc aactctgcct tcagccgccg aacctcggcg ctctggtcca cctcggcgcg     28500
     atgcaccacg ccagacttgc cgaacgtgcg cagccaggcg tacaggctgt gcgtcgtgac     28560
     acccagccgc tcggcgactt ctgccacctt gaacccacga tcagtcactt gccggaccgc     28620
     ctcgatcttg aactcatccg tataccgctt gctgctcata gacacctccg aatcgaccat     28680
     tttccatggc cttgagacgt ctaggaaacc ctgggcgtat cacacgtctg ccccattcgg     28740
     ctccggagag cttattctca atacgaggcc aaacccttca atgcgatctc taggcgagta     28800
     tttctagaca ccgacgttgt caacgcttcg gtcaaattcg tttctcagat atttgagcag     28860
     gaatttctgc ccgacctgga gcctaccctt gccgaggaag tgaagtatct catcaacatt     28920
     gttgccttaa gcgagggcgg gcgctgcggg agattgttag cgaagctctg aacaacgcac     28980
     cacagatgcg caacactacc tgcctcatgt tgaggagtga tccatgcaac tgacgttagc     29040
     catcaacaag gagagtcacg gtgactgaaa tttcaaatct acctcagttc ctcattgcag     29100
     tagcggaact tcttgaaaca attgatcgtg gtaaagaggt gcttttcagg ttacagttcc     29160
     gccgagaatt gtctcccgtg attgaagata cagcgggacg cttgagagaa ttttcagagc     29220
     ggctttatga cgtcgaatcc agagattatg aggggctcta cgctgccggg ctcacggata     29280
     tgcatctatc tttaaaattg gaatcctttc agtcatcgtt gcaggcgttt aggatggtct     29340
     gatcaacggc gtcggaggat gagcccaact acatcggcca ggctgacggc gctcagatcc     29400
     tcgatttttt tgccgtttcc ggcgcgtttg cagggtgttg cctgcgttac aggcgcacgc     29460
     tccccatagc aggcaataac tgctttcgct tcatccacag gtttgacagc gcaaacagcg     29520
     tcagcacctg cgcggtgttc ttcgccaggc cgcgatagcg gaccttggtg taaccgaact     29580
     ggcgcttgat cacccggaac ggatgctcca ccttcgcgcg cacgctggcc ttgaagtgtt     29640
     cccaacgctg ttcccgagca cgctcccgct tgttgccgat ggcttgaagc accgaacgcc     29700
     tggcggcaat gaagaatgca gccttgcagg tctgcagttc ttcgcggttg tccgcaccgg     29760
     tgtagccgct gtcgccgaac acgctgtctt ctttgccatg cagtaatgcg tgcgtcaccg     29820
     tgacgtcggc gacattggcg gctgtgcaat ggacgtggtg caccagcccg gaaaattcat     29880
     ccacgccgat gtgcgccttc atcccgaaat accactgatt gcccttcttg gtctgatgca     29940
     tctcggggtc gcgtgcatgg tcggcgttct tggtcgaact gggcgccgcg atcagcgtcg     30000
     catcgacgat cgtgcccgac cgcaggctct ggcccttgcg cgccagatgc gcgttgacag     30060
     cttccagcat ccgcgcggca aggccatggg tctccagcag gcgccgaaag ttgagaatcg     30120
     tggtctcgtc cggaacgttg tccaagccac cgagctgggc aaaccgccgc aaggtcggga     30180
     tctcgtgcag cgcttcttcc atcgccggat cgctcaacgc ataccactgc tgcagcagat     30240
     gaatccgcaa catcgtcgcc agtgcgtacg gctgccgacc tggccggccc gacacgggat     30300
     agtgcggcgc gaccagcccg agcaattgct gccacgggac gacctgctcc atctcggcca     30360
     ggaagatctc ccggcgcgtc tgcttgcgct tgcccaggcc ctcagcgtca ccgaacgtca     30420
     gttgcatgga tcacccctca acatcaggcg ggtagtgtcg cgtatctgtg gtgcgttgtt     30480
     cagaggttcc tttagggaca ctgcaagaga ggaccgactt gaggaaacct tagagaaaag     30540
     caaaaccctc ttgggcagcc ttgcaggtgc gatcccgggc tttggttcct ttgcgcaaga     30600
     gcttatagaa tttcttctca aagagttaaa gcgacggctc tttggccgcc gctagctcga     30660
     tcacgttata acctatgaca agcctggacg accaatttga cgtcttctca aacaccctgc     30720
     gactgcttgc ggaacaggtc gtggggctca gttacttcct aagaaaaata aagaagccgg     30780
     aagagggcat ctcgaacatc gaggcagctt tcaacaatgt gctgagcagc ctgtatgggc     30840
     tcatgtgcgc gttgaagaac gccggcgcat gtagttcgct ttacgagtat gaagcgattt     30900
     ccacgttact ttgtatacgt cacgtcctgc agcatcaacc cgggcgcgtg aggaacaacc     30960
     tgcgcgactc ttgggcgaag agggtgcacc ctgatgcggg gctacttcga ttccctgttc     31020
     tcgctgatcg ccttcctgcg caaccttttt acatccatat cggatggata tgtgacggta     31080
     ttgccgcaag taacaacgcg aaacaacgcc cgagcttagc ggccttctgg aatctagaag     31140
     ggattcgagc ggaagcggaa aaggctggat tttccctgca agtcagctac gtttgtgcca     31200
     tgagcttagt ccaagaagcg gcgaggactg tggtgagcaa ctacagcgca caccttaaag     31260
     cgtacggtga agacagcgaa gtgtatctac agcatttcgg ggatgttgcc cctgttgacc     31320
     cctacagatt tgcaatcaca gcgcagaact aatccgattc acaatgagca tggatttcta     31380
     tcgaaagcac ctgtcgggcg ttgcttgccg cgttgcctca ctaccgtagc ttgcgaatat     31440
     gcttcgtgtg agtgctcaaa aacaaaggca cctgcaaacg ctcaagggta tttacccgcg     31500
     ccatctgacg tctagggttg tgtggttcag agccgagacc tgtagcgagg ccaggccctc     31560
     ttgtacctca catgctaatg gtgcccctgg ccgggatcga accggcactt gccgcttatc     31620
     tggcgctgac gggatataaa tccgctgctc taccaattga gctacagggg cgtgatctgt     31680
     cggatcacac ccgtattcgg aagtagcaag gatcgtagag cctgagcatg aaagaaggat     31740
     agcacgctca catcgcattg catcgttagt caatggatga gacgcggacg gaccggtcta     31800
     gaatttgggg catctgctac caattagcgg ttgtgtgcgc gtgttatcgg gggaggccta     31860
     aagggctgtc gctccttctc gttcctttcc tagacgcccg atcatcgatc tcggaccgat     31920
     ttggcggctt agtcccgctt ggcccgctcg atggacccag cacaagctgg ggtcgcccag     31980
     cacgtggtag gtccggtgta ggctacgagc tattacagtc acagggggcg gcaatatggc     32040
     acgcgataag cgttacggtg acagcccggt tgttccttcc aagcagggtg ctcggcccgc     32100
     ggggtggggc atagtggcca ccgctgggtt gttgggtttg atttgctttg tggctgtctc     32160
     gggtaggcgt ggacagcaga tgtccagtgc aaaagaatcg ccgcctaacc ccccattgct     32220
     cagtgcagcg ccgattgaag ccccgatcag aacgacgatg ttttcaattg gcgaggcgtg     32280
     caacgggatg tcaattgtta gtgcgcttgt gtctggcgca gcctggcatt tatcgacagt     32340
     gggatccgca actcctgcat tgactgccat tacatcaggg tggaacgtga cgggcgccct     32400
     gttcgcattc ggatccgcgc tactcgggac catcggattg ttcctcaaga aaaaatgagc     32460
     tttcggtggc gtgttacgtt cagtcaaaca aaaagccccg aaaggggctt tttgctttga     32520
     gttgctttcc tgctcgcgag gttcttaggc tcccggaagc ttggttgaat ggacgtcgtt     32580
     tccagtgcca ccaccaccag gctcgctgcc tcccgtattg acgggtttgc tcccgccgcc     32640
     gccgccgccg ctgggcttat gagagccggt gcccttagac acggattcag tgctgcggaa     32700
     aaaggcgccc ttcacaccgt gttcctcgtt gtcggcgatg ccgtgcatac caaccgcaga     32760
     gccgatccag cgcaagacat tgtccgggat ccagttgata aatccgaaca ctgaatgcag     32820
     cacgatagtc atcaggattg cgtaaatggc ggtatacgcg atcaatgcac cgattgcgtt     32880
     tgcagagttg cccatcgccc cctgcacttg cgtgatgtat gtaaggttga cgtagtgtgc     32940
     gaccggttgc gcgacgacaa tggaaccaac taggccgaag atcatcagcg ttggccgcag     33000
     gaacacggac agaatgatca tgtagccagg gccggcgcgt ccgccctggt catcgccatc     33060
     gggatggaca tgggctgctg cccagattgg cgccgcaatc acagactcga agagcacggt     33120
     caaccacttg atgatccccg taatccagat gatgtaggga atcattggta cgtagaaggc     33180
     cagaaatgca ccggccgtca gcagtgtcat gaaaaggaag gcgactgcgg gcgtcaaggt     33240
     ttcgatgctg gcgcctatgt catagcttcc cagcgtgacc gcatcgtccc ataggccgcc     33300
     gccaaagccg gcaacaatga attgcgcacc ttgaattgtc cacgcgactg ccatgatggt     33360
     gtcccccaca ttcttcatct gtgcaacgtg ggatagattg cttcctgcaa tttcctgagt     33420
     catctgattg atgccagcca gggccggacg agacaaccat attttcattt cttcgaagtt     33480
     tgagggaatc ttgtcaccgg taaaaccaat cgcttggttc tgcgcctcat atgctcggta     33540
     cgcggattgg gagctattgc ggatgtactc gttcgccgtg acaagcgagt cctgatagag     33600
     gatcagtgtg tcagcggcct ccttgtcggt aattgtctgc gcgctcgatg ctgggagcga     33660
     attgaccgct gattggatcg catcgctcat atggatgatg tggttgtagt aggtgccggc     33720
     gaatatccag ccaccctctt ttgcataggt gaggaatcga ctgtttctat tcttatttgc     33780
     gcgattcact acactgagtg ccgctgtctg cagggaaagc tcgtaggtgt ttgcaaccct     33840
     ttcgagagcg ccagcagcag gtttttcacc cgccacgatg gcttgcgcta caggacgcag     33900
     ctcactgacc atcttttgga cggcctgtgc ttgagcgcgc aagatcggcg ccttgtcaat     33960
     gtagggcgcg ccgttgcttt cagacgattc gtgggactct tgccactcaa gctctccaca     34020
     tacattctga ttcatatacc cacctgagcc cacagctgac cactgcaggc cagtaacgct     34080
     gaaggcagaa ccagccgcgc tttgggcaag atcgagaaat ccccctggat acaggatgtt     34140
     gtcgaacttg agtgcgtcgc ccgtgttgat catggctgtc ttcttgggca atacctcgat     34200
     tttcagcgcc ctgccttcgg tctcgtactg cttgttcatt gctgcagcac atacttcata     34260
     gcgaaggatg ttggcggcaa gaggccgcga atccggcaaa tgcgggcgcc ccatttgccc     34320
     ggtctctacc attttatcga gcatagccaa ccacacttgg tcagccaggc cgaccccgtg     34380
     tatgcctatc caaagcactg cgatttggac caacgaaaat cccgacttta ggggtagcaa     34440
     aaacgcagta cccgctgcgg tacgcaacgg aacccagaca gacgacattt tcttgcctag     34500
     gaactcacca tcgtgggctg tatcaaccgc tcccttgacc gtggtgaaaa tcacaaacaa     34560
     catacccagc gcgaggattc caaggccaaa cacctcgaat cctgcagcca atgctgtgtc     34620
     tgccgaggcc tgatctacgt tttggccggt catgatcgta tccactatcg agccgaacac     34680
     atctcgaatg aaagatacgc ttgtgtcgtc tgccggcggc ttgaagaaac cgggctttga     34740
     gggatcttgc gcgcgcgcaa ggttaggaat catcagtgca cccagcaccg cgagcgaacg     34800
     tgtcatggag tagctccagg tgagggcgtg gtgtcctcgg aagtaccgcc ggcacttggg     34860
     cgtgacgggg catgggaatg ggaagtgggc atggagccag aagttccacc ggtggtgttt     34920
     aggtgcgagg tgagtcgggt ggccaagtcc tgccatcgcg gcgccgcagg cgctgcaggc     34980
     gcgatggcaa cgggtttcac cgccacgggc ggcggggctg agcttggcgc cggatctggg     35040
     cgtgccttga tgtcggacaa acgacgcaac atgtggtggt ctcggttcgg ggctcctgcc     35100
     tggcttcatc ggagtaggcg cagccaaatt gacgagcgcg ccacaaacga tgttaaacta     35160
     aggcataaca tatagtgacg gatgtgacat ggctgcgcta gacctcgcac cccccaagct     35220
     cgtcgagttc tggcgtagtt atgccccgga actgggggac ttggtcagcg tcatggatag     35280
     ggccgagaac tggactgtgg atcgggagcc actcttagcc gatcgcctgg tcgcgctcgg     35340
     ccgccggatg accgggccag atcaggcccg cgcgttcgtt tcggcggacg tgcctgactt     35400
     gctcctattt cttgcctata tctccaccag cacagcccta cgcgtcatcc attggttgga     35460
     cgagcaggat gagtatcagc agtacggatc caccgttgtc cagcggctgc tggacgctcc     35520
     aggtcactta gccggagcga ttgcgttgtc accgttacga gaccttctgg cgctacgcct     35580
     gcgcgtcatc agcaacacgc cgtactttac taagctcttc gctccggagc gccttgccgg     35640
     gctcggggcg gccattaccc gctaccgcca ggaggctgtc gatgtctcgt aaaattgccc     35700
     ttgcgcccct gctgggcgcg ttgctactca ctagcgggac cgcgtcagca atcgatgccg     35760
     catctgtcca agcttactgc gaccaagttc gacagtccgc tcaacaagcg aagcagagac     35820
     acgtgcagat ctttgctccg agacaggatc cgggtaaaac attcgacgat gccacccagt     35880
     cgtgcttgga cggcatcatg tcttacaagt cgatgtttca gttcaagatg ccttcgctcg     35940
     gcgacgtgca ggggatcttg agtcagatgg cgaaggagat gctgaacaag cagtgtcagg     36000
     ccgcgcgcgc acagtttgac cgtgcagtcc aagacgccgt ttcaaccgtt aaccaatcca     36060
     ccaatcagtt gccaggcgta gatgtggacg tctccaccgg cagcggtgtg actgtcaagc     36120
     cgaaagacgg cgaatctact atttggggtt cgatcgttaa caagcttgga ggcgataaat     36180
     aatgctgctt cttcgccggt tcaccgcact tattttttcc ttgctggtgc tgggtacctc     36240
     gacgctgctg attttctctg catccacaga gtcgacagct tgttgtggtg acggggtggt     36300
     ggcagccgcc ggcgcagagg ccgcgggtgc atcggttgta actgcggttg ggtcagctac     36360
     caccagcatt atcacgcagc tgcagttgat ggaccaaaac gtgtccagcg gctttggacg     36420
     cctgtacgaa gagcttgcca agcaaaccgc ggcgcagcgc acctttgagc aaggtgcgat     36480
     ttcagcgcag acccagatgt atatggaaga gcgtcgcgcc gaggcggagg aaaagtacgc     36540
     gctttcgccg cgtgcatgtt tcgagaccgc aagtggcgtt gccagtacgg ttgccgccgg     36600
     cgagaccaaa gaagcagtca acgatctgaa tcgcttgatg accgaccgca cgctcaatac     36660
     gccaaacact gccgccgcta tcggcaggat ctacaaggat cacgctgaga agtactgttc     36720
     ggctcaggat gcccagctag ggcgctgcac agcagtggct gctgaattac aaaacgccga     36780
     cgtgcgggct gacgttttgc tgggctctgc gagcctgacg cccgcgcagt cggatgctgc     36840
     gaaagccctg gtcgcgaaca tcgtcaatcc gatccccacg caaaacatcc ccacgaaatg     36900
     ggagaacacg gcgcagggca gagcatttgt ttcggggcaa ttgttggaac aagcacgcac     36960
     gtcagtagcg gccaattcgc tcaatcaagc cgtcgctgca cgcacgagaa ttcctggtct     37020
     cgggtcagca gcgatgctaa atcgggctga cgtgtccgag cgggagatga tggaagcgca     37080
     ggtgcggggc aggtttgagt cgcccgactg gtacaagatg cttgccgcta tgagcacaga     37140
     gaacctgttg cgggaactga acaagcagtc tgctttcggc ctctggatgg actacagaga     37200
     gttctctcag atggagcgta tcgaatctct gctggcgaca gatcttgccg ttacggttaa     37260
     gcaggacagc gaaaagcggc tgcagcaagc tcgctcggcc gcagccaagg cgcgctgatg     37320
     aggccctcca aggctgccgt cattatcggc atcagcggac ttcttgctgc tctgccatac     37380
     atgaaagcca gcgcggcgta ttgctgtgac ccatggggta tacctgggaa aacggcattc     37440
     gccgcagctg gaaccagcgt cgttggtgcc ataaccgcac aggtgactgc tgtatccaac     37500
     tacctgcagc tctacacgtc gcagacctgg agcagcggat ttgccaagac agctgaggaa     37560
     ctgagcaagc agaccgcggc cagcaggaca ttcgagcaag gtcgccttgc agctgacacg     37620
     agtttgtata tgacaggcgt gtcaggcgca gcggaagagc aggcgcagga gcctgcgttg     37680
     ctcgatcaga ctgtcaccaa tgccgttctg ctctcggaac agtttaatca gcagaaaaac     37740
     aaccgtcgtc gggacgatgc cggctttgcc gaatacatgc gaggggattc gcacgaggac     37800
     ctcgtttcga ggggtcggga attttgtgac ctgcgcggaa aagctgccgg attctgcgat     37860
     gcgatcgcgt cctccacgct acagaacgcg gatatctcgt acaacaccat cagtaatcca     37920
     ggtgatgggc agtacgaaac gctcacggat gctgaagcta gggccgcgcg ttctttcgtg     37980
     cgcaatgtcg tctctgctac accgatggca agtacggcag gttcgacgcc ccaggatgag     38040
     catcacgaag cgctgctact ggcggaccag gccgtgttgt ctcttgctgc acacagtctg     38100
     cacagcgtca tgcaaaatcg cgttcgtaaa agggagaacg ggcaatgatg attcgagccc     38160
     tggcattcgc acttttgttc atcgtcagtt gcggtgatgc ggcccaggca agtgccttcg     38220
     atatggcaga cgtcattcgc gactctgcgg ccaaattcgc agccacacaa aaggtcgatg     38280
     ccggcagcgc agtcaagcga atggacgatc tactagtacg tgactatggc gctcggggac     38340
     gcatagcgag tgagcacgat ccgcggctga aatctctgta cacgcaggcc gcccgattgc     38400
     tgatgaacgg taacgcaatt tctggaggca cgttgattgt cattgcttcc caagaatctg     38460
     ggtacagcgg gagcaaggtt ggcccagcac tacaggcatt tattggcgca atgctgatgc     38520
     ccgcggacga ggaagacacg gtcctgcgcg actttagcga gcgagccaac agagcgcgat     38580
     ccaaactcgg cgttttgcgt cccgagctcc agatggcagc tcagctccgt gtgatgggag     38640
     cgatctatca tgatccgata gcagttgatg ccggtgttgt tgcactcaat aagctatcgg     38700
     caacagcaga cgaggagggt gccgttgcag gcgcgttaac tgctgcgggt gccaagtgac     38760
     gggggtcagg acaagccgag tcggtgctca aacagcagct cagggcgcgc ggacaaccag     38820
     ttcgcgccga attgcgctta tggccttctc gaccttgctg tgcgcggtga gttcggcggc     38880
     gcaggctgat tgcctcactg tacccgcgcc gtccggattg gttacctcgg tttacggctg     38940
     gcgtttccat ccggtcttca agtactggcg gccgcatcgc ggcgttgacc ttcgtgccgg     39000
     ggtcggcacg caactcgttg ccacgcacag cggtgtcgtg caggtgtcga actcggcagg     39060
     gggcggcaat gagatccgca tcgtcggtga caacgggtgg gtgaccaggt atctccattt     39120
     gaccaggccg ctggtggcgc ctggcaccaa agtgagcgcg ggtcaggcgg tcgcactgtc     39180
     tggcaacacg ggccatgctt ccgcagcacc tcacctgcat cttgagctgt acgggaagga     39240
     aggcaaggat ctgaaccccg agccgttgct gtgcccctcg ccgtcgcgca agcccggcgc     39300
     agatatatcc aatggctttc cggtctcggc gtgcaatccg aaggggggca gctgctcatc     39360
     ggctggtgtg cctcctgcga acggtggagg tccagtcgcg ggggaaggtc agacaccccc     39420
     tgccacgggc tatcagggga ccgagcctgc atcgccggcg ccgaacatca ctcagttcga     39480
     cgacatgtct acccacgaaa tcctcagcag cgagatcatc aagagacacg gcaatccaga     39540
     ttggtatcgg ctcgaatcag aacggggttc gttggcattg ctgacagaac aggcgcaaat     39600
     gcgggcgctg cgcctgtata tgcgctacct gaacaaggag tcgcgtgacc gagtcgaggc     39660
     gctgttggcg gcgaaggtac agaggcgtgt ccaggcggat gccagtgagc gactgcgccg     39720
     gcagcgcgag gcggcggcca aggcggggcc tccttgaata gtgatagaca cgccacggcg     39780
     atttgtataa aaatggcact catataccaa tgagagtggc gcagacatga gcaagctcgg     39840
     tgcattgcgt gagaaggctg ttgcggaggg ggcggctgtc tccagcgtgg aagaggaggt     39900
     cccgcccttg ccgcccgaag cacccatgga tgccgagttt attgcaggtc tgatggcgag     39960
     cgccgccggt gccgccggta ttcccgatcg cccgcccgaa gcgtttccgg acgttgcagt     40020
     cgcccccacg gtggatggtg ccccgcaggg caaccaagcc cctgcaggtg ccagcagccc     40080
     acccgctggg cacgctgtgc cgcagggcgg tgagccgcat gccgtggccc ccagcgcacc     40140
     acaggccggg atggacacgt cggacctgct gcatgcattg aagggtgcga tcgagcgtct     40200
     cggcccagct cgaacccaag cagaggtcct cgccgctccc gacgcgcaag gtgcatgggg     40260
     ggaggtgcgt ggattgaccg ctgcagcgct tgctttgggc atggcgtcgc ctgtcgagca     40320
     gctattccgg cgctacggtg cgcctgggga gggactgctg aatgccgcgc agctgaaggc     40380
     gccattgaat atggcggtgg ctgggttcaa gccgggggct gccccgctgg cggccactca     40440
     ggcgaaagct gcggccgcag ccgccggtca acaagccatg ggcggacctg gcggtggcgg     40500
     tggcggtggc gcgggcagcg tcggcgcagc gcttgccaag ctcgtagctg cacccgtcac     40560
     cattcccatg gcggccggca gccgtgtgtg gcagatgatg cagacccgct tcgggccgcg     40620
     gcccaaagtg cagcctggcg ttgacggctt cagcgtgatt cggcagcagt tcgatgacgc     40680
     cgccggtcga gccattgatc agatcgccca cctgcgctca ggcccgatga agtctttcct     40740
     gaccgagatg gcgcaggatc cgctgcgtcc gtccgagcag ctgcgccgca tgcaaggtga     40800
     caagaagggc acgtatttcg agcgagctaa gcagcttcgc gagctttctg cccagccgga     40860
     agtgcagggt caatacaaga agctcaacga cgcgatggag cacctccagt acaggagccg     40920
     acgcctggcc gaatacgggc acgaggctgg catggatgtg gaggacatca tcggcgacaa     40980
     gctggaatcc gtgtccaaag ccggcgaggg cattccgatg accgacggca agggcaagct     41040
     ggcagagctg cgcgagtcgc tagatgcgct gatcgagcgg atccgcgagt tcttgcgcac     41100
     gttgttcgca aggcccggcg cgtcaccgtg agaggctcga cgttggccga ctacctcggc     41160
     gcctgtgacc ggtacttgtc cggtcatgag cagcagttca ccagcccgtg ggggctggtg     41220
     ctgcttgccg aatgcgcagc agatgcgggc ctcgacctca gcgaggcgga cgtatcgctt     41280
     gatgcggcct tggaacagct cgccgagcga gtcggcctca atcgtcagga cgacctggcg     41340
     tccctgccag cgccggggca atagcgatgg gcgcattcgt agaggatctg atcgtcatcg     41400
     aggcatcggg caagctgaag cggctgtatg ccgtgctatc tgacctcggc atgcgcgcac     41460
     ggtgtatcgc cacgcttggc aacctccttc agtcacctcc gcagttgcgc ccggtctcca     41520
     tccagaagga ccacgtcggt ggataccaag aagctgttcg catccctgca agacccgacg     41580
     cctacgaccg ggtgagcgcc gaaatccggt cgctgcgagg acgtctgttc attgcaactg     41640
     actatgacca ggaagggcat gcaatagccg ctgacgtggt tgcactgaca aagcaattgc     41700
     gcccagatct cgctccactg cgtctgcagc tgaccgagct tacgccggcg gctctgcgtg     41760
     cgagcttcgc cagcgtgcgc gactacgacc cgtccctggc actgtctgga acggcgcggc     41820
     gcatcgtcga tcgcgtgatc gcctcggctt actcgttgcc ttcggcaggt gtcctggtgg     41880
     ggagagtgac cagcgcgatc gctgcgatgg cacgccgcgg gctggtgccc actcacgagg     41940
     ccgtgctgca gatcccgtgt gccagcgggg gagtgccttt cactgctcgg acgacggtga     42000
     ttggagaatc ccgtctgcag gagctgcaaa gtgccgcaag tcaggtcgtg tccttagcgg     42060
     tctctacctt tgagatgtca acggttgggc agggcgtgaa ttacgctgac tttctcggcg     42120
     gcatgaacga acacatggga cttgctgagg cagcacggct gttgcaagac ctctacgaac     42180
     aaggtgttgt cagctacccc agaacggaaa gccggggtta tggcgcgcga ggtcatgcac     42240
     gttgcattga gtttgcccac agtcatggcg cacggttggg gccgacggct gcaaccgtgc     42300
     tacccgaggg agcgcatgaa gcgctgcaca tcgtggcccc ccaggtgctg gcctcggtgg     42360
     atgtgatgaa gccggcgcgt ctgcagagca gccacaaggc catcgcgctg agctggttgt     42420
     cccgttcaat ggcggaatcg gtatggcagg tacggcgaga tttgccggac ctcaatcaac     42480
     ttcccgatgc gctgcgggga ttggactgga gcagggacgt gggagcgttg ccggcatggc     42540
     accggcgtcc taaggccaac agccgtgttc ttaatcacca gtccgcgatc ctggccggtc     42600
     ttcaggagca acgcataggc cgacccagta cggtggtcgg tcacgtcgtg agggcgcagg     42660
     aacgcgcttt ggtgacgcca gacggaggcg aaggaccagg tggcacgcga gtcttggccc     42720
     gcgcgcctct ggggctacag gaaccagcag cggctcaccg catcgaggcg gtctgccaga     42780
     aggcagccgg cataggcctt ggatttgcgg tggaggaggc gctatcgatt gccgccggcg     42840
     acgaggcgca gttggccagc ctcctgacaa ctattgacga ttggacgcca gatgatgatt     42900
     tcacgccttc ctacgccccc tgagctcgcc gcagtggtga catgggcgcg tcgccaccgt     42960
     tggttggtgg ccacaacggg cgtagcgtta tgcctcttag cgtggctgag cgtcgtgatc     43020
     gactcatcca gatcgctgtc ccaggcggag cttgcctccc tccggcagtt cgccgagcag     43080
     accggcgtgc cagcggttga agcaaggctc aaggaagcag agcgcaacgg atcggtgtct     43140
     tttagagagg cgcaggcggt gatcgaagta gcgaaggcct acgggcccga atacggactc     43200
     gcgagcgacg ctccctgaaa tcctccgacg gcgagtgcgt attctggcgt cttggaacgt     43260
     attcctgcgt cttgcgatcg ccacaaccgt tggttaatat tggcgcgtga ttccacttac     43320
     gttaggtaat gcgccttgtg aatatccaat cgtttgacgc agcttcatat cgcgagttcg     43380
     aggggatcat gctcgaattc gccaaggcgc aagggtggga attcagcttt caagcgcagc     43440
     cgcttccgct ggccagcgtg tttaacaacg caaccttcgg tcccgctctc ttggtcgccg     43500
     cgcaggtaga gctgtccctg cgcaagatcg aggttgatct cggcctggta gttcaagaag     43560
     acaacggagc tatgtttggc cgccgcgttg agttcgatcc ggctcgatct cacctgctga     43620
     ctcagatgtg gcggctgacc cagacggctt accaagtcga cctgcttccg cgggagcaaa     43680
     accgcatagt cctggacctg gtgccagcgg cactggagcc atacgaagcc cccgcgctgc     43740
     aggccggtca gtaacatggg gatgattcgt cgattgatga cggcctctgg tgaggacgct     43800
     gggtcgaatg cggcctcaga gccgatcgcg gacttgtctc cggaatcaat gaccgctgag     43860
     gtaggtcggc aggacgtcgg agcgaccaca aacgcggctc cctcaccgca gctgcctctt     43920
     gaagcagagc atggcgaggc ggtgattccg ccggcgccga caccggttaa cgcaccgacc     43980
     ggtgctcagc tcaccctgtc aatgttgcgt gcaatggggc ccatcttccg cgcagcgctg     44040
     gtctacccag ggccaacggc gccggcggtg gagtgggcac aagccatcaa ggtcatgtcc     44100
     gacgtgtccg ctcaggtggc tggccaactc gcgctcatgc gcaccgagga actcgacgtt     44160
     gcgtgggccc gccgggagct gcaccccgcc gtcgctgtga ttgtaggcga gcattggcta     44220
     cacactgtga tcaagatgca acgggtgcag agagtcggcg acatcaagct caacgccgaa     44280
     gacatactgc ccgggatcgt ggcagcgctg aaggcctccg acgactgtgg caatccgcac     44340
     ctggcaaccg aacgttcagc tgttgccgag cttctgccgg cgatggcgtt gctccaggtc     44400
     aatgcgcagg cataccaagc gcttttgcag tccgacacag tcgatctcga tgtgccggat     44460
     ctctccgtag atgcgtatct gcaagctgtc gccgcggccg ttgtcgacgc agttgagacc     44520
     caggacgcca gggcaaagct cagtggtgct ctccacggtg atgagtttcg ggaggccctc     44580
     ctgaggtctg caaccggcat cgttgtcaag gccggggaga ccgcggtgaa cgagagtctg     44640
     gcccgcttgc atgaggctat caaggcatcg gcgcctgctc gctggctcag cgaagagccg     44700
     ctgcagcagg gcttcccctt ggcccgcacg gttgagttga tcgagcaggg cattaaccgc     44760
     ctagcgggga cagcggtcta tatcgcctcc aagctgggga ccaagcgatg acagaggaag     44820
     tcccggcaaa gaagatccag gcacctcggg tcgatgtgac gccagcgcca acccgacgca     44880
     gggctatcgc cggcgtcgcg cgcctggcgc gtatcgtcta cttgggggat cttggtgaga     44940
     tccggcgaac gcacgcgtac ttccgcgatc gtctgcagag ggttctgcac caagggcgct     45000
     atgcgcgcaa cgaaacgttc gaggaagcgc aggcacggct cggcctcacg ccccaggacg     45060
     tagcccgacg cgccgctgag ctgcgcagtc aaagcctgct gtacctgggc gtggccgggg     45120
     tggcgctgtt tgtcttcctg cttttgccac tggtgagcaa tccgatcagc cacgcggtga     45180
     tgagtctgct ggtgatggtg ctggccctca gcaagtactc cgtaagccgc tggcgacagg     45240
     ggcaatgcga agaaagaaat ctggtgccct acatgtccta ctggctgcgc tggtggaggt     45300
     catgatggac gccgcaccgc ctccacagct gaccgcctgt gtggcacatg ccgcaggcac     45360
     ctatggtctt gatcccgacg cgctctgggc gttcgtgcgc agtcgcaagg gtgcgtctgc     45420
     gcagtacgtg caggcagaga atggaacgat ggagcttggg ctggcgcgca tcccagccga     45480
     cgttgcgcga cgggctgaaa ggcagggctt caccctccag caggtcatga gcgatgactg     45540
     cctgaacgtc ggtctggcag ggctgatgat ggcccaagca ggcatcagcg caagtcgcgg     45600
     ttccagtgac agcgactgcc tcgctggcgc ggctcagcgc taccaactgc cactgccgat     45660
     ctttaaagct gtcgttggcg aagaaggcgg ctggctcggg ctgaaaaagc caaacaagaa     45720
     cggatcctac gattacggtc cggcgcagat caacagcatc cacctggaag agctatccaa     45780
     gtacggagtc tcagaatcac agttgatgtg ggaccgctgc gtgaacctgc acgtgtcagc     45840
     ataccgactg cgatttgaga tcaaccgcgc tggcgatctt tggcgcggcg tgggcaatta     45900
     ccattccagg acgccgtcac tcagtagtag ttatgcagag cgcgtccgca ggcggatggc     45960
     gggtgcgaac ggaggccagc ggtgagaggg cgcccgaact ccgagcacga caacgggccg     46020
     gtggtggtcg tgctgggact gatcgttgga attggcctcg catggctcgt cgctcacgag     46080
     cagatctcat ggctggtgat gtgggtacgc ctgcttgaag caagagtggt cttcttcgac     46140
     acagagggtc tgcagatggt gtacgactgg gttgccagcc ggcacccacg cgacgtgaaa     46200
     atcggagagc tctacagttc tggccaagtc accgggtatt acctgcggtg ggttgttctg     46260
     attgtgctgt tgccgatgtt tggatggatg ttctggcggc acccggcgcg ttcaagtgcg     46320
     tatcgacagg tctatagcat catgaagctg gcgtggtcac aggttcacct gtacccgatg     46380
     ctaaagccga tcctggaaat gaacttgctc acggtgccac tggaccatcc cattcatggg     46440
     atgcgtgcat tgccacgtcg ttacgcgcgc cgctacaaga tgcttcggga gatgaaggac     46500
     attgctcccg atcatgatcg tagcgatctc gatgtgatcg acagtaagca ggtattggtg     46560
     ctctcccgtt gcagggaggt attcgcaaag caaattggca aggaatgggc cggaattgag     46620
     tcgctgcgag gctatgagcg cgacctgcta gtcgcattcg ctgtgcaggc cgacggaacg     46680
     atcgaggacg ctaacaagaa caccctgcaa atcatccagg agctggcgat tgctgcgtca     46740
     gctgctttca aggcgaatga tcctggcttg attcgatcga agagggcatc ggagctcgaa     46800
     gctcgggtga tgcagagcaa agtggtggca cgcgccatcc gcgctcatgg ctacaagcgc     46860
     actgttctga tggccatgtt ggaggccggt cgcaaaggcg gcgtgcttcc cgccgcgtgg     46920
     ttccgttggt tgaagcccgt tgatcgtgtg acctggtact gcctgtgtga catgggcatc     46980
     cagcccagct gtgtggagtc cgccggtgcg cgagcgcagt acctcaccga acgagcggct     47040
     ggcatcccgg taccaactcc gatgattgag ccagcaataa atggtttgcg cgaatacttg     47100
     aacgaggtga tcgatgtcga agtggaagat taaggctgtc aaggtcccgg cgtccgtcgc     47160
     caggtttata ccggtgctcg gtcgctgtgc ggattggttc gagcggaagc ttcgccggct     47220
     ttacagttcg atgcgcgatc gcatcagtcc gccggtgtcc gtgttggtca aaaagggcag     47280
     ggtcaccatc gcagaatcag tccgtgctgg cggccgcgtt catattctgg aggtccaacc     47340
     aaaccgggcg cacccgcttt ctacgatcca gctgcaggcc aatgtgctgc aggttggtcc     47400
     gagcactatc ctctacgccg acgcagggct ggccgcactg gcctatgctc aggtgcgcaa     47460
     ggcagtcttg ccggcgacat ggtcggcgtg gatcctgcgt ctcgttggcc taattgccgt     47520
     ggtgctcatt ctgcgtctgg cgacagtggc gctactcggc agcacggcag ggaacgcagc     47580
     cggcggcagc aagctcgaag gggtgtccgc ccagatggcg gccgatccgg ggttctcccc     47640
     gccatcgccg gcaccgcagc ctttgcccgg agcttccgag ctcttcggcg ctgcagcgcc     47700
     ggcggggtcg ggcgatctcg ctgatcagat ctaccagcag gcccgcgctg ccgctgcgaa     47760
     gaccgagcat gcgacgatgc cgcctcagcc gagcgtaaac gtggaggggt tggccggatt     47820
     cgggcttgaa gaaggtggtg atcaggcagg gccgggatgc gacccgaatc ttgcgttcaa     47880
     ggtggagcag taagtagcca gccatgagca tccagggcgt cgacaagcgg aatgagatct     47940
     cgcgggaacg gttgattcgc gatacgcggc cgttcttcct gcggcttctc gctggactgg     48000
     gtgcgccatt tgcggttgcc gtggccggac tggtgctctg tgtcatcgcc gttttcgtcc     48060
     cggcgctggc agacgtttgc ttgctggtgg gccttctgta cgcgctcatc cctcgccgtg     48120
     gagtcgagga tgttccgttc cgtgttccga agtactctgg cggagttgat ccaaacgaga     48180
     tcgactcgaa gacgggcaag ccgaaacgcg ggcgcggaat tgccttcatg ggcaaccgtg     48240
     ggcaagacga tgccgaatgc tggggcgccg ataccgacgt caaacgacac tggttctttt     48300
     tgggttctac cggcgcaggt aaaaccgaag gacttgtgtc gatgtgcatc aacgctttca     48360
     tctgggtgag tggtttgctc tacacggatg ggaagggcga tgtaagcctg tatggcaagc     48420
     tattctcatc agcacgaatc ttcggtcgcg aggatgactt cctgctgctg aacttcatga     48480
     ccggcaacgc cgatacgcag cgaaagcgct cggacaagct gagcaacaac tacaacccgt     48540
     ttgtggacgg caatgctgcc tccaagacac agttgctggt caacctgatg gattcgggcg     48600
     gggacggtaa gggcggagac gtatggaagg ggcgtgcgat ttccttcatc gcgaccgtca     48660
     tgccggccct gatcgacaaa cgagacgcag gctcactgct cctgcatgtc ggccggatcc     48720
     gtgagtacct gccgttcctg aagcttctcg aactattgcg tgacccggac gtattgcaag     48780
     acaacaagac gcgcatcaac gcgtttttgc ttgacgtgcc cggctatcgg gcggacaaag     48840
     gcgagcagca ggcaaacacg ttctttgaac agtacggcta tcaacaaatg cagttcacgc     48900
     gcatcttgtc gtcgcttgct gacacgtacg gtcatatctt caagaccgag caggccgaga     48960
     tcgacatgcg cgatgtggtg gttaaccgtc gcatcctggt aaccctgctg ccggccctgg     49020
     aaagctcccg gccggagctc ggcaatctcg gcaaaattgt agtcgctggc gtgaagggca     49080
     tgatgggctc gaacctgggc aacatcgtgg aaggctcaaa acggtctgtt cttgacgccc     49140
     gcgctaccaa tgcgcccacg ccgttcctta ccatctttga cgagcatggc tactacctga     49200
     ccgaggatac ggcccttatg tgggctcagg cgcggtcgct cgggttctgg ctgatttcgg     49260
     caggacagga cctgcaggcg tatttccgga cgtcgaagga agaaacgaaa gccatccttg     49320
     gtagctccaa taccaaggtc attgggaagg ttgaggaccc caccgagacc tgggagatga     49380
     tccaagcaat gggcggcgaa gcgctcataa gcacgctcag cgactatgac ctggacgttg     49440
     acggggtggc cggtgggtac atggaaggaa cgtccgtcaa ggttgagcgt gtcaagcgca     49500
     tcgacctgca ggatctccag cggcaggtcg agggcgaggt gcacatgctc ttcggcggcg     49560
     acattatccg cgggcgaatc ttttacgctg atccgccgtc cacctctgaa ttccgtctca     49620
     accatttcat caaggtgctt ccgccaagca ccgagggaat cttgtccctc aaaatcgatg     49680
     cgcgcagata catcgatcag ctgcacgaac ctgaaattgc cttcgcgaac cagcgcccgg     49740
     atgatcccta tttttcttac gcggctgatt tgctgcgggc gccaggggta caaaaataca     49800
     agggtaaccg gcaaggagca gagctcgggg tgtgtctgct tacaggcttc cagacgacgc     49860
     cggtgatcaa tcgaggtgct gtatctggtg gcggcagcgc cggcggtggt ctcaatgctc     49920
     agccgcagcc gcagccgcag ccgcagccgc agccgcagtc cgaggaagag aacagtgcag     49980
     tggtgtcggc gagcttgact cagcgtgtgg atgatggagc tgccggtgaa tatttcgatg     50040
     cagcgaacct cgaaacgaca tccgtatttg ccgcggtgaa gccttcgcct gcagtgcctg     50100
     gccaacctgt cttcagtgcg gaagagtcgg ctctgtatgc ggccacggcc gtcgcagcat     50160
     catcattggt cgatgtagca gtagcgaagg acatcagctc attgttcatg gattctcaaa     50220
     atggagagcc tggaccgttg gatatcgagt acacgcacgc cggcctgacc gcacttggtc     50280
     aggcgctcgg tggaacgtcg gctgctgcct ctgcagccgc tgacgcgatg attattactg     50340
     cagcggaagc gacctcatat ccggcgccgc ccacgccacc cagtagtgat gtagcgagca     50400
     ctaggatgca aagtgcgatg gatgaactcg aagcactgct cggcagttca ggagcgccga     50460
     atgagctttg aactgacttc cctccggcgg cgcaatcttc ttaggtcgat cgcaagcggc     50520
     atcgctgcga tggggaccgg tgcagtattg tctcccgctt tcgcgcgcag cggctttgtc     50580
     atgccgtatg ggcatgcaga tgcctatacc tccgcaacat tctgggccca gccacgggtg     50640
     ttgcgtcttc accgacccgc cagcaacgaa acggtggatg cttgctactg gcgcgatggt     50700
     cagcttgata gcgctggata catccggatc tgtcgactct tgagagacgt ccaggccggg     50760
     caggctgcaa cgatcgacat gcggctgctg aatctgctac gcggtatgca gggttgggtt     50820
     gaggcgtcct atggcatccg ggacccctat caagtcaaca gcggatacag aacacaagca     50880
     acgaataaga gcacggaggg agctgcgcgg cactctttgc acatgaaggg ccaggccgtt     50940
     gatggcctgc atcccggcct accgctcgaa tacacgggga acctcttcaa ggcctttcaa     51000
     ggcggcgggg tggggttcta tctaaacagc aagaaattta ttcacgcaga cgtagggagt     51060
     gttcggcaat ggcgaggttg atcaatgcag cggtaggtat tgcactactg ctgacaagtg     51120
     cggtagtgca gaacgcccaa gcgtcggaag cgcccaagcc gacgttggcc gagcgccatc     51180
     tcatggcgtc cggcgtcaag gtgacccacc gattcgattc tgtatctggg ttgcgcgcga     51240
     tcgttgctga caacggcgca gacaagcgtc tgttttacgt caccccggat ggcaaatctc     51300
     tgatcgcggg actggttttt gacgaatcag ggcgaaacgt caccacggag gacatggggc     51360
     gtgcgggcat ctcggccagt ggaaacacga ctgccgtcac acaattgcaa gcacagaagc     51420
     tttggcagcg agttcaaggt ctgaaagcgc tcaaggatgg caatcgcggt gccgatattt     51480
     acgtcttcgt cgaccccaca tgtcagtatt gtcatcgact catgagcatg gtccgcccgt     51540
     acattgcagc aggcacgctg caggtacgtt ggttgccagt ggccatcctc tcttcgcgca     51600
     gtccaggcct agctgaggcg atgtataaag cacctaatgt ggcgcaagca atccagtccg     51660
     tctcgaccaa tatgctcaag ccagtgcccg agtctgaggc catccgcctg caattggcgc     51720
     agaatttgct agcaatgcgt gacaccggtc aaactggcgt tcccctcgtg gtttatcggg     51780
     tgggccaacg agtggtgatc aagtctggcg taccgacgga tgcggagctc gtagctctcg     51840
     ctggcggcgc taagtaatcc gcaaggaagg acaatcgtag ttttgaacca ggggaacacc     51900
     atgcaagtcg tctctcagca acgcccatcc gtggtcacca cacagcgctc gtcgctggat     51960
     ctcgctcaag acttctacaa gcggcatcag cgtatcgacg tggcggacac tttactcaac     52020
     gacttggcat acctctatgc cagcgaggct ttgggcgccg acgaatgcga agcatttgtc     52080
     gaacgcatgg cggaggagga acacatgaaa gccatccgtc tagacttctg ccattgctgc     52140
     atggcagtca acgcagcgtt gtatcttgat gaccagggcg tctatgaggc ctttctaccg     52200
     ctgctggacc tggacgacga ggatgacgca ctcgcggaca tgaagcgctt tgtattgcgc     52260
     aagctggggg aagaccacga ggagctcgcg gcagatgagg gcgcgttccg agctcgtgtt     52320
     ctcttggcgt taagtaggat ctgagcagaa acgaacgggc gttgacgcgc cactttcgtt     52380
     tgcatatagt caaggcctag agggtgataa aagtggcacc catccctggt ccgaaggaga     52440
     acgaaatgca gacgaaccca aacgaattta cctggaagga agcccgcgag atgggcttgg     52500
     atgcggcacc agccgacatg gtgccggacg aaggtgagcc ggaggcctga catgggtctc     52560
     ctgagaaccc ttcggggtag cctagcagtc cccacgccac aggccgccgc accggcggcc     52620
     tcttcacatg tgtccggcct cagcccagcg tctcgtccgg tatacgatcg ggccgcggaa     52680
     ggcaccggca tctttgtaaa gcacatcgaa gacggtggtt gcccatggca gcagcctcaa     52740
     agcaagccac ttgagtggcc tcggaacgag ctacgtggca cgccttacca cggattcaat     52800
     gcgatcgccc tcgctatgag cgggtatgac gatccccggt ggtgcacatt tgaccaagcc     52860
     gccgcgaagg gctggcgggt acgcgctggt gaaaaagcga cctccatctt catgtggaag     52920
     gttcaggaaa aggaaaccgg cacgtacgac gatgacggtg agccgatcac gcggaagttt     52980
     ccgcttttgt gcaggttcaa gatcttcaac ttcgcccaga tttccggccc ggaaccgcac     53040
     cagccgcatc agctgactga caccgaagcg cgcaagctgg ccgagccaat cgtggaaacc     53100
     gttggcatga cggtcacaga gtcagcaact gggcctacgg gctacaaccc agagagggat     53160
     tcgctggttg tgcgtccacg tgtcgcctat ccgtctgaaa agcattactg cgccgatctg     53220
     atgaacggtg tcctggcagt cgcggcgcgt gaggcagtga taggccttgc tttgcctgca     53280
     gaagcggaga tgactgatca ccagcgtgcc cagcgcgatt tgcgagtgga gatcgcgcgc     53340
     tcgatgctcg cgatgcgcac cggcttgccg ctgtcgccgc cggcggcggt caaggatgcg     53400
     gcaatactga cgctactgca gagcgacagg cgcgaggtgt tcagagctgc aaaggatgcg     53460
     gaaaacatca tgcgttacgc cttggcgttc aacccggagg ttctcccgac actggaggac     53520
     gagcatcgtg agcagatgag cgccgcggtc gccgaaggtg ccccagaaat ggtgttcgac     53580
     ccgagtgagt tccagttttg gccagcagaa ctgcagcaag atcgcccgag gccgtagtgc     53640
     ttcggtgttg ccataatagg aggcgccatg cctgtaactt cgatgagcga tcagctacgc     53700
     gccttgagcg tcgttgctag tgagcgctct gtcggcgaaa ttgttcagaa tctacacaag     53760
     atgtgggaga gcgtcggtcg tctcgtgcct gaaagggcca cggtcggcga ccgggttctt     53820
     tttcgactgg ccaaggctct atttcaggac aagattgttg ttgctgaagg gctgccggaa     53880
     gacgaccttg tctgtgagca gtatgaccag ctgcagcgtc gatatctatt gtctgacgtc     53940
     gagggccgtc gatcgctagt gtcagcaatt cggcaccagc acctgatgca gcctgtgcac     54000
     gagtctgagg aagtgatgcc ccaaacagcg ctagtgcgtg tctccggtgc cgcatacgta     54060
     cctatcacct tgcgtgtgat gcttccgccg gtctcgctgg aggcgcatcg ccaggagctg     54120
     aggctaaact ttgtgcaggg cactgaacgc acattcggct ttttgccaat ggttgacgtg     54180
     cttgagtacc gtaagcgtac acattcattg gtggcgctgg cgccattgca tcgctggagc     54240
     aggaaccctg gccaggcggt gcaagtaacg tacggggatt ggttttgcgc agatggatac     54300
     ggcagagcac tttatgcagc agcagtatcc ggactcgttg tccgccgcgg cgagtcggcc     54360
     aatggaatgg gaggagtgtc gcccatgttc gcgctgacgc gcgcagggcg cagggcgcag     54420
     ctggctactg aaccagcctg gtcttgcaaa tgcctttgat cacttcaatg gcatcgaaaa     54480
     cagcacggcc tggattgatg ccgacggact gggggttgct ttcgacacga acacgggcgc     54540
     gatcctggga agcctgagcg aggtcgacga ctctaccgca ccgactcacg tcgacctagg     54600
     ccaatgcccg gagcgtcccg tggccgggca agcgtacagc tatgagggac taacgctcta     54660
     taacgaggac ggagcctaca gcgtgccgga catagggact atgcttcctg gttgacaatg     54720
     actaacgcat tctgagggat gaccatgcag gacggtggga cgaaacgaca gcgcggtgca     54780
     gatggggacg tcgcacggct caagataccg ccgcattccg tggaggctga gcaatccgtt     54840
     ctgggcggtc tcatgcttgc gccggagact ctggatattg tcaaggatct ccttgtggag     54900
     gaagacttct acagacgaga ccataggctc atctacagat cgatttgcga acttgacgag     54960
     aaaggtcagc cgtatgatgc ggtgaccatg ggcacctggt tcgaggagca gggtcagctc     55020
     gaattggtcg gtaacggtgc ttacatgatt gagttggcca gcaccgtgcc ttcagccgcc     55080
     aacatcgcgg gctacgccaa gattgtgcgc gatcgtgccc gccttcggga actcatcgag     55140
     cacgggaccg aaatcgtcaa tgacggctac caccctggtg gtcgggagac ggatgaactc     55200
     atcgcgatcg ccgagcagcg tattttcagc gtggccgaag gtgggagggt gcgtcacaca     55260
     tacacagacg tgaccacggg tttgaagcgc gtcgtcacaa cgctgcagga gcgctacgag     55320
     aacgacagca gcatcatcgg cattcctacc ggtcttcctg agttcgatga gatgaccgct     55380
     gggctgcagg acacggatct aatcatcgtt gcggctcgac ctggcatggg taagtcgacg     55440
     ttagcccagg ggttcgcaga cagcgcggct actcgctcga agaaagcggt ggcaatcttc     55500
     tctatggaga tgtcgtcgga ccaatggttc ctgcgcatgg tggcagccga aagtcgcgtc     55560
     gacggacagc ggctcaaaac cggcaagctg gaggatgagg attgggcgaa ggtaatgtct     55620
     gccatgaaga agctgcaagg cctcaagcta ttcgtcgacg actcaccagc gctaagtccc     55680
     gatctgttgc gctcaaaggc acgtcgattg aagcgcgaac aggatattgg cctgatcgtc     55740
     gtcgactacc tacagctaat gatggtcccg ggatcgaaag agaatcgcgc gacggtggta     55800
     gctgacattt ctcgaagtct gaaagcgcta gccaaggagt tgcgagttcc ggtggtagca     55860
     ctgtctcagc tcaatagatc tttggaaaca cgggccgaca agcgtcccct catggcagac     55920
     ctacgcgagt caggcggcat cgagcaagac gcagacgtaa tcgtcttcat ctaccgggat     55980
     gactactaca acaaggattc cacggagaag ggaattgccg agctgatcat cggcaagcag     56040
     cgcagcggcc cgactgggac cgtacgggca aggttctccg gaggaatcac caagttcgag     56100
     ccgctggggt cgggggcgaa cgacttctaa cagccatact cagggacgaa aatgacatca     56160
     gggcgggcga ccgccctgtg tcctttaagg ccgtgctgaa aaacgctggc ggaggttgtc     56220
     cttcgcgtcc agcccggctt cacgtacctg gccgaatgct accgggtcag ctacaggctt     56280
     agcctgcgaa ttgagaaagg gtgcagctag ctgctggcgc aactgagcca agccggagct     56340
     gagggactga ggtgtggcgg tatttaggct catgccgaag tcctggtgta tgcgtacaat     56400
     ttacgtcagg ttatacatgc ttgtaacggc caaaccccca tgcactacag ggggtttggc     56460
     cgattttgcg agtcagttgg cagaaaccag cgaccggacg gtaacgtgcg ggcggtgatt     56520
     tagcaactaa agtgtgcggt ccgtaacgtt tctggggggt gaatgcgcct cctgggactg     56580
     tttcgggcca ctttcattgg catatatgtt agtattatac acagacagga gtagcgcaat     56640
     gcccctcaac ccgaagcatg agatctatat cgtcggcgtt aatgtcgacc gatacgtcgt     56700
     gtatcggggg agcaagtcca aggatgccaa ctctgagcca gcagtcgtca agatctgcca     56760
     gggcgtctac atgcagaatg gcctggacgc agaatcagtg ttcaatcggt atggtttgcg     56820
     tattgcacat tacctgacac cttcagcgac gatcagcttc tccaccgcgt ggcacaaggc     56880
     ccccaaaatc gggcgtgtct ttgtcactgg ccaatatcaa tatgtgcgtc ccctgttcgg     56940
     tgccagcgat cggtacaaca ttgtgcagtc ggtggggaag gtcgagcctg ataaccccaa     57000
     gttgcatacg atggaaactt ttcgcgatcc gctgggcgag ttcacgatgt tgtgcgacac     57060
     gcctgaactg actctgttga acatgatgac cgccaccaag cggcattcgg agaagcacct     57120
     caacagcgag gaaatggatg agcttctcgg ccatttgatg aaggagcacg gcggcaaggc     57180
     aggcgtggca tcggccctag aagaagtggc ggtgatggcc gagcggacga atgagcttcg     57240
     tcgcttgatc gggctgctct acagtccggg caaaagtttc gtttccagct gactatggcg     57300
     aattgggtcg acctggctga gcatgacctt gtgctgcttt ggcggccgaa gccgggttgc     57360
     ccgcatgcac gccagatgat cttgcaaacg gtgacctccg gcggatccat accgccggac     57420
     gttgtcgaac tgggcttctt gccagaagga aagcaatatg tgcgtgattc aacggtgctg     57480
     cttcctgatg aatttctgca gattttcccg cgcgcacgga tgattgatgt tccgcgcgat     57540
     ttcttcgagc acaagcacgg aagcaacata gttcacctag ccggaaggcc cgcaccggac     57600
     ctggccgagc gagtttccag cccgcatacc gccgtagacg tcgggctgat gcgatgggca     57660
     ttgacgcctc ggccgcgatt cattctagag gcgcgaacgc tgatcgaaga tggcgcttcc     57720
     gtggtttcat tcggcggtat ggagaggttg acgcgaaaga gagccacatc cgcttccctc     57780
     aagtccctca tgcactcgct tgcagttcga gccgcgcgcg atgctggcgc gcaactgccc     57840
     ttccaagtga tggttgatta cccagattac gtgtacttcg gcggcgcccg ccgaactcac     57900
     gcagcctacc gggccaacag tctcgtcgcg cgtctgtcag ttgcagagcg attgactagg     57960
     ggcgcgtccg ccacggtggt cagcacacac acaggggttc ccgacttagt gttgcgcata     58020
     cagcaggcaa atggtcaggc cgagctggtc gtggcgcaaa catccgtcgg cgcagtaggg     58080
     ctcgccggcg tagccgccgg tttcgaaatt acgaggggtc gccttcacct cgcgtggacc     58140
     agccaggcgc agcagcgtgg atttgacccc ctgttagcgt cgcttttttt gtcaagcttg     58200
     ctaagcggcg gctacgaagc cgacaacgtt cgctgggatc gccctgtgct tggtccggaa     58260
     aggagcactg cggcagccta atcatgggga gttacgccca acagcacggg tgggtgctga     58320
     gcatttgaat tggatgtacc gatgccccag tggattgata cccaagcgga cggcgttgcg     58380
     ctgctcgcga gaactagcgt gagcggtgcc aaagagctcg tcttgcgccg cattcgaccc     58440
     gacaccgttg tgccagatgc tgcccttacc tacggttttg aacccgaggg tgagatattc     58500
     gtccggaaag acacccgttt tagtctgacg gagattcgtc ggatctttcc gtctgcacag     58560
     gttgcggata tggcgctgga ggacattgtc taccgcgttg ccgcgcccat agccaggctg     58620
     gccgtgccga agtcggcgcg gtcagcggaa gtgcttacgc cggccgcgga tcttctcgat     58680
     gtcgaaacac cagcagcccc atcaagctgg gcgcaggtgc cgcgtggacg gttcttgatg     58740
     agtgcgcgat cgctggtaga cgggggcgtg ccggtagtgg aatttgaggg gatctcccac     58800
     gcttcgcccc agagcccaaa ggcagttcac gagcaggccg tgctagccgc tgtgaatgca     58860
     ggtgagagcc tgcccttcgc cgtcctggtt gactaccctc agattgccta tttcggggcc     58920
     acgaagcggc atgcctccac acgggtggcg aagcttctgt cgtcccttga gatcaccgag     58980
     agactgttag aaggcgagcg tgcgcacgcg gtcctcaaga acgatggttt tgatgacctt     59040
     gtcatcgtcc gcgaggcgcg gcccgaaggg cagcggttgt cgttgaccca ctactacgac     59100
     aagaacggtc agattacctt ggacgccgag cttgtgttcc acatccgtgg tggccagctc     59160
     cacctgtctg aaacggctgt cgaaaacgta ttgcgcggcg gtgaaattcg aagctacgac     59220
     gcgttccttg ccaaccgctt ggccaagaac tggctcgacc agggtttcgc ggttgctgag     59280
     gttcactggc cgaatcaatc tgtgccttca gtagtccgtg ctgtgccggt ctcaccagag     59340
     atgccgccca ctgtcgatgc tccctccgtg gcaaaagttg ccgctggccc ggccgccggg     59400
     atgtcaatgg ccttcgtctt cgactctgca ggagccgcca agctggcggt cggcatgagc     59460
     caaggcgccg ctctgggaaa cctgctcgcc gaatgcgctt cgccgtcagc gaccaattcc     59520
     tcgcggagcc ggatcggcca aaacttgtcc ggaatgttgt tgctagaaga cgcgaacggc     59580
     gtgcgatacc tcgaacttcg ctccgaagag atagcagagg atttgagcga ccgcggcgtg     59640
     gagcacatga ccatcagcga ggctcaacga gccgggaagc tgacgcttgc ccaaaaagag     59700
     ccggtcaagg gcgttctgct cttcgggcgc cctgtctatc gcgcactaaa attggccgat     59760
     ggctcggatg cctttttcgc catcgaaaga ggcgctgccg gcgaaagcta cgcatacaag     59820
     cttgacttcg ctgacggtgg ccgcccccgt tggctgtcct taggcgcggc ctggacacac     59880
     ggagcgccaa gcgatggcga gctcatgagc agccgaccac gtccgatcga cgcgttcgat     59940
     cagcaggcgt tcgtgcatga aatcaatcaa gcgatcgcag tgacctcgca agacgtgctc     60000
     aacgagcgct atcgcatgct gccgcttgat gctgacagga tcaccgtgcg caagatatcg     60060
     gagcaggctt atgagttcag ttcggccgat gactggttgc cattcgggga agtgcgtgta     60120
     gagcaaagcg gtgaccattg gcgtgcttcg cacggcacga cgagctcatc gctccggtgt     60180
     tccctggagg ctgcatgctc atgggccaat cgcacgattg ctacacaacg cgagcactat     60240
     ctcgcacacc tcaatcaaac cactgacggg tcactgcagt tcgccatccc tgagcaggac     60300
     ttcaccgtgc ttcgacgggt gctgcacaag gcgtcgatcg gcgagcagac atcgtggcaa     60360
     gggatgggta tccacggcga ctggacggtc tatcccaagg atctccgagc cgagatcatt     60420
     gatgatagaa aactgcgtat tgccgtacgc ggacgcgagt tgatttatga gatctgttcg     60480
     atggaggcgg acccggcctc aacctatgcg cactaccaga ccgagggtct gcgccggatc     60540
     ggccagtggc tcgggcaagt gcaggacgac atccgctggg atgagactgt gagagcgcat     60600
     ccggagggtg gactattgaa gcaacgcatg cgtgagtatc aggacctgca ggtcaaacac     60660
     tacggtgctg caaaattcag tgcgcgtgtt ccatcgacac gagcgcgcga gatggtgctc     60720
     gcgatcaccg atcgagacgt tgaccgtttg atcagtgtga ttggcgacaa tggacccaac     60780
     aacaaaagca cgatgcggct gtttcaatcg gtgtccggcc tgaggcctgg acacagcaga     60840
     accactcggg ccgaagcggt ctaccgcttt tgcgggtata gcgatgagca agccgctcaa     60900
     cacgcacgga ggcgtgaaga cctggcacgt gttcgctcga tggagcgaga ggccaaggcg     60960
     cgcattgagg cggctgcgaa catgaaggtc tcgcacaacg gcactgagaa gacgggcaaa     61020
     gtcatgatcg atgatgtgtg ggcgcagggc tacacggagc tctctacccg acgccaaggc     61080
     gcttcgaccc gctacatgct gcgcaatccc accactggcc aatactacga tctgaaagag     61140
     ccgctaaccg gttacgcccg gcacttggtc accatcaaag acagcgccaa cttcgtgccg     61200
     gggccatcag atgagccgga agatgtccat acgccgggct actgaggacc tgccgatgat     61260
     cgggcgcact accactaact ctcgggattt cgaggagacg attgggcgct acttcgcgcg     61320
     cgcgatccca gaaggtacgt ttacagaagt tgataggaag ctgccggccg actgccacga     61380
     gctgtgccgg ttgttccgga tgcgtccggt cacgcttcac tatggtggct ctgacaaaac     61440
     gctgcagttc gaggcgatgg tcatcaatga tcgctttgat aagcgaatct tcctcaccaa     61500
     tcacgcgaaa gagccccttc gcgcggtgat cggacacgag cttacgcatc gaatgcagat     61560
     tgagcgtccc gacctatatc gcgagctggc cacggcgatc gctgccgcag gcgtggacca     61620
     agaacgttgg caagcttacg tgcaactgat gcgcgccaaa tcgggacgag aaggccgcca     61680
     gctttcgatc ggagagctcc gcagcgaagc cgtagccgac atggtaggtg atctgctcct     61740
     tgataggcgt ctatgggacg ccctgagagc tccatcgctc gcccaaaggg tcgtgggctg     61800
     ggtacagagc gcgtggaggc gtctgacggc tcaggcggcc gtccaggcgc cgctgggcgg     61860
     agcgccgttg gcgaaggatc gtctggcggc gattactgcg gcgacggttg tcctgcagcg     61920
     ctgggcacac gatgtcgcaa acgatcctgt gcggcgggcc ggtctacatg cggtaggggc     61980
     cagttgccgc agagctgggc tacggcatga ggcggatcca gccgctgaag taattcggtt     62040
     taccaatgtc gccggtgacc tggtcgcccc cgaccaactg cccgtcgaag tcgcagaggc     62100
     ggttgcggca ctcaatcaga cgacgggcga gctatggcga gcggcggact cagttgagat     62160
     gcgcccttag gcaagtccat cagtgcctaa gggccggccc agggtgacgc tccaaatcgc     62220
     gcgcaaggcg aaccagaacg cacatagcag catcgcaaag cccgcggtgc tgcagccagc     62280
     gccaaccgca acgcgaatta actccgaggg taggtaaatc ctgacctggt cgacaatgat     62340
     gggataccgg gtgaagtaaa gcccgacgcc acacaggagg gctgcgctgc ccacagaaaa     62400
     agccaggcat cgccataggc gagcacgtcc tttagggtcc agaacgaacc acagcacgtt     62460
     cggctgccgg cccagcacca acatacccgc ctgagtggcc agcaacatag ccagcggcgt     62520
     agtgaatagg aacggcccca tcaccagagc agcaaatatc gcggccgctg ccacaccgct     62580
     gacccaccac gtttgatggc gcagctgcac acagacgaag gccgcgacag gcaccgccac     62640
     caatggtacg aacccgccta gattgttcat gcgatagctg ccgaagcact ggggtggtca     62700
     tccggagcaa gctccgggtc gaagagctga gcgatactgc agttggtggc cagctccttg     62760
     cgagcacggg tggcagccac gtagagcagg ttgacctcct cgatcgtctg acgttctgca     62820
     tctgagaaat cacgaagctt tccagtgtct tcgtcgaccg tgtcgataaa attttccgca     62880
     agctcgacat gatcgaactc caaacccttc gaccggtgcg cagtcacaac caccagtgcg     62940
     tcgcgctgtt caggggaagc actgtcgaac tggagtgcct cggctcgaat ccggttgagc     63000
     gcttggtcaa accgcttgcc gccataacgc tcgaccactt ttgcccagcc agttaactcc     63060
     ttgtcctgca cagcctccgc atattcggcc aggctctcga aggactcgaa agaagcgatg     63120
     aagggatccc ggacatcggc tggaccgaac tgccgaagct tcgagatatc ttcaccaatc     63180
     tcgaaccgat aagtgtggac gccgccgaca tacgccacct tgattcctct gccgactgca     63240
     ttattggcct tgtcgaagac cgcagcgttg gtgcgactga tgaaggcagt gccgcgtgga     63300
     ttctcaaagg ctccctggtc aacgatcgtg tccatgccca aaccgcgtag ctgtgcagat     63360
     tcgcccttca gagcgaggat gcgattggct acttcagcaa ctgcaggacc aaagcggaag     63420
     gagccagtga gataaaacga ggcatcggcc ttgacgagct ccatagcatt ttgcgagccg     63480
     cgaaatgagt agataccctg atgcctatcg ccgacgtaca gcaatcgcgc gctctggctc     63540
     tgaagtatcg actgcagcac aggattggtg tcctgtgcct cgtcgatcat aatggtgtca     63600
     tatgccaagc gcgggcggct gagctggtag agcttcaggt agccgtcgtg caccatcggc     63660
     aggctggttg cctgcattgc cgcccaaaca tcctttgcag ctgcgagcaa cgcgtgttcg     63720
     cttaggtatt tcttttcggc aggtgaatca cctagcgaaa cgtgagttgc acccatctgc     63780
     tcatccgccg acactagaaa tgccttcaca gtttcgatga cgcgttggtc gaacacacgc     63840
     acaacagcaa ctggtaacga acgggtgtat gcagtagtgg tgccggtgat gtgaaaaggt     63900
     ttgatatcgg ccagaagctt cccgtcgtac tttgcaccgt gagggaacca tgccaacgaa     63960
     tgtcccgtct tgcactttac gttgcgtgga aagcgcccag cggcctccag ctggatagat     64020
     ttgttgaacg caaccatgag ctggcgctca ttgggacgtg catctgcaaa gccgatcagc     64080
     gtagaagatt ttcccgtccc agcgaatgca ttggcacgga tagtcttcgc gttcgaggcg     64140
     atgatcgcct cttgttctga ggtgaaatgc acgtctattc tccgccactt tggttggcat     64200
     atgctatacc agcaaagcaa gaaatactaa cgtatgcctc ccgtttgctg ccttagacta     64260
     gtgcggccgc agcgacaatc taaggggatg ggctcagtac caaacccaag ttgtcaacat     64320
     ggccggccat gtggtcacga actctgtcca acacatcgtc aggcgcaaat gccgagtccg     64380
     ggagatcacg tcggggaata tccagtgcga tacggaaaga ctcaaatcca agctgttcat     64440
     agagtccggt cggtcctcca gaagcgctgt agacgtactt ccattgctgc gctgcggagt     64500
     cgggaactgg ctccaaggtg aactctgccc cgtcctgctt gtaatccaac ccaaggacgc     64560
     gcgcaacctc cttgcctacg tcgactaaca gttggaactt gggaacaatt ggctcaaggc     64620
     gttcatcagc atcacagagc tgccatactt taacgacttc gctagaaatt aaagacatgt     64680
     tcgtgaccct cgattaaatg gatacatctg cttaattgct taactgtctg acgtgtctct     64740
     atgaccagtc ttctgctttt ccggctccgt cacgccatcc attgagaacg aacagcacta     64800
     cctcgtcaga cagctttagc ctcggaacaa ctggtaatgc cgatcccaaa gcccgtagaa     64860
     ctttaagctc gtctccagtg aggacggaca cgtgctgcag ccacaatccg acgacatgct     64920
     cagtgcttgt cgcagccgca agttcaacaa tctctgcgag ttcgtccgct tttagcggcg     64980
     cgcatgctga ccaaggaaga atgcgagacc accaccacca ccgcctactt gccgcaggct     65040
     tgtgggcagt aagcgcccgc tcttcgggcg tgagacggct cattggggga atattgcaat     65100
     gactttgcat ctgggttcca gcgtcaatgg cgagtgcgac gaatccatga ggagaagcgc     65160
     tgcaattccg ccaggtttgg cggccggctg gcggcaaccg ctgtgatcaa ctcagaaact     65220
     aaatcggcgc gaataaccgg gcagccatcg gtcagagtct cgacttccac gtcaacgccg     65280
     aaaagctcga atcgtggtgc tgttgcctga aatttaccat gcatcgctga actccttttc     65340
     ctcggacggg tccatgcctt gagcggcacc tctaaaacat aacacaacgg ttgtggcgaa     65400
     acgacgtggt acagcacaat tctggatgcc gcgccgctac ggcgctcagc ccacggccag     65460
     gcggtagcgc tcggcaccaa cattaagagc aggagcggtc tcagatttta agacggacag     65520
     gtgcatagtg cgtcacatgg gcaagcgcaa acgacctcga atcgatcctt ggctgtttgg     65580
     cccacctggt gtttgcgacg catgtggcgg tccgtgcggc acgatggatc aagccgggat     65640
     cgtttgctac ttctgttttg caggcgtgtt catgcatcgc tcgttctggc aatttgcacg     65700
     ctgccctagt tgcaagggca cagatttttt ctgtgttgac tgctgcggcc gcgcttatgt     65760
     ttcgacgcca cgcgatgaca tcgatgtgga cgagttacgg cgatgctggg aatcggttgt     65820
     tgcacgccac accgccaccg gcgaggactt gcccgcgccg gtggcggtgt tgaaaccgta     65880
     gatcttcaac cggcacagtg ttggttatga gtcgctaccg atgacaaaca gcgggtctgg     65940
     actgataggt ttaccattgg aatcgatcac ccacgcgccc cagtgcgtag caaaaaaagc     66000
     gtgctttgtg cggacatctg ttgtctcttt acctccgtca agagcaagga agtagtccac     66060
     cattgaaatg gccgggccgc cattaatgct ccatgcgaga gacgcgagcg gtggcttgcc     66120
     tggtccacga attgggccaa tcacacggag ctcaagtgct agaccgtggg caagcgtgag     66180
     ggcacttgtg ggatttgtga gcaccacata tttcgcaccg tctgtcaggt tgatccccac     66240
     ctcttggatg tcgccaccat cgtcaacctg tgccctgaaa aaccagcttt cttcgaaggc     66300
     gaacactgag cccaagggga catcaatatc ttttttgatc acgaatgcgc ttgctctgat     66360
     caccattgag ttcctccgtt agcagttcat ggattcaaga cgtgccgtta aaaagctcgg     66420
     cgatcgcagc atgcttcgct gcgtcgtatg ccaccaggtc gcagcgctcc ggataaagca     66480
     gccacatcag cttctcgtag gcagcgaggc gctggacatc ggtcagcgct gataacctcg     66540
     atgcaagatc gagcaagtcc acggtggggg cgaagaggtc gtaatgatcg gcgtttctct     66600
     gtcgctgttg cgcattccgt tgggcggcgc ggtcggcagc aacggttgcc agtcgattca     66660
     cgtccgtcgt gaaagggccg tgcggcaact gatccgatag ctgctcatcc tcatccaagt     66720
     gttgcaggta gtcgtagtgc gcctcgttgc actcgtcgtt gagcatttcg gccagcgcag     66780
     cccactcgtc cggagtgaac tgcggcatgt gccgcaggat caattcgcga tacgaactta     66840
     ggatctggga gaaccgcgcg tgcacgcagc ggtggccggt gaacattgcc gcgttggcat     66900
     gcaccagccc gacacgcaac tcgtagatct ccggcgagtc ggtttgcacg atggcgtcgg     66960
     ttgcggcgct ctcatcgtgg cgcgccacta gggcattgag gcgtgctgcg tgatcggcct     67020
     gggcttgctc tagttctgcg gatgtggacg catagccagt gaccacgggc gcgatcagtg     67080
     cgtacaggcg ctgccatgct tccatgtact cggctcccgg ctcatggtcc ccgagctggg     67140
     ccatcagcac gtggtgcaga tccgcgctga aattccgcag ccgggcttcg tgctgctcca     67200
     ccaagccggc cagaacgtcg cgctcggctg tcacctgagc aaggtcgtcg cggctgctca     67260
     tgtgaagaat aggcggataa agacaacgaa cgcgctcata cacgccatat aaagcagcga     67320
     gtacacatag caagcatcgc cgctaatcaa cccttggcgc tttgcgagga gcaatcccaa     67380
     caccatcact acagtcacgc cggcggcaat atgagagatg ttatcgagga tcatgattga     67440
     tttctggcga gctttagcgg aacagagaga gtcggtgtca tacagtcgtg gcagcagctc     67500
     acgtagctga ggcctgtcac gcgctgccag catccacgga ccagtaaaag cgaagcaagc     67560
     gttgcaggta cgaatctctc cgccgtcagc agaccagcgg ccacaatagc taggctggcc     67620
     ggcgtgaagg tcatccagca cagcgatgat cgactccgcg ctggcgactc gaaaatcaag     67680
     caccggtttt tcaatgttca ttctaggagt tttggttggg tccatcacgt cgtccatcaa     67740
     tccacatccg gcacgaaatg cagctcgacc atgctgacca ccaacagaat gttagccgca     67800
     aagcctaggg caagcaccat cgggccggcc tgcttgccac tggccatgag ataaattgcg     67860
     gtcacgccgc agaccgctcc ggtgacgaac atgactacaa agaaatcttt gctagttttc     67920
     ctatccacgg cttgcctctc ttgacggatt catttgccgg actacgcacc cacatctcag     67980
     cggctgcgac tgcccgagcg cggccccatc aacagggcaa acacgcgtaa ggtttgacag     68040
     gtgcaattgc tcagcgtctc gtcattcacc catgatggcc atcgcgctcc acttgtttgg     68100
     agatggtcgc cagacttgaa gacaccgagg tggcaagtgc gatagccgca tcgcgctcgg     68160
     cgcgtagttg atcgatcatg tgcatgcgtt caactaaggc cgcagaaaga gtgcgtgcct     68220
     cgccatgcgc tgctgcgagc ttcatttctg actgcgatag tttgccctcc aatgtcctgg     68280
     ctctgcgcga ggctgcggcc agctcagcag cacttgcatc gagttgcgtc tgatgtagct     68340
     ccaggcgctc agaaagcttt tggagtgctt cgagcagatt cgttccctgt tcttgacccg     68400
     actcgcgcaa gagatgtatg gcattcaata tcttcgcgta tgcatcttca aagcgctcga     68460
     aacgcttact cgccgcgtca cgctcacggc gggcttcagc caatgcaagt tgacttgcct     68520
     gttcacgctc ctggctcact gcgatttctt gcagcgcaag agccagctca tctcgcacgc     68580
     cggcgatggc ggaactcagc tctcgaagtt cagactcaac ctgcagccga tccagacgcg     68640
     cttgatcgag acgcgacacg aggttggttt tgtccgactg aagctcgtga atcagtcgct     68700
     cttgctcact ctctcgctcg gccagcttcg cctgcgcagc aaacaacgcc tcctctctcg     68760
     catcgagcat caccgagcgt tgctccgcag cagtctctcg ggcgcacagc gcctcctgcc     68820
     gttgccgctc tgcctcagag aggacctggg ctgcttgctc cgcagcgtgg cgtatctggg     68880
     atccgatatc ggtgatcggt ttgcgcgagc gcgcgtcgcc aaccttgatg aagaactcgg     68940
     caccgtgttc ttcaaaccat cgagcgatga actttgagag cacaggacca ctaccgcgac     69000
     cgccaagcat ctcgcggacg ctcatgtgcg tcggcggctg ccccgcagca agtagcttct     69060
     cgatcgcatc gaacacttct gtcgatgtga tgcggcttga ctcggccatt acaggctgac     69120
     cctgacttgt gccgaatcga ttccagcctc catcgtctca atggcagtga tctcatctcg     69180
     cagacttacc gcagtgactc gaactcctgg ggcgacctcc acgtcttcgc ccaaagcctc     69240
     tataagtggc ttcatgaatg cctgcccctt ggcggcgtcg gtcatctcaa acaccaccgt     69300
     acgaaacact ttggtttcca tcaattttgc tcctcatctt cattgcgacg atcttccaat     69360
     tcccattttt cccgcaactg ggcttttgcg cgcgacgcgg cgtcgccaag ctcccacagg     69420
     cgcgggtgtg cttcgtggat ctgctcacaa accctgttga actccggggt ttcaccctct     69480
     ttgaggtagc gctcgattgc ccgcaacgcg agctcgctcc gggcgccatc aagattccag     69540
     acgcattcac tgacagcaaa agcacagcgc gaattccaga gcgacatcat cagcttcgcc     69600
     agactgttgg cgcttccgct tcctgggtta ctcatgatcc actgcagtgc agcttcgtat     69660
     ggcgacatcg ggattctcct gaatgaaatt acaaagcctg cagcgtgcga gatgcgagcc     69720
     aagggaacag ctcggcgccg acggacgtga gccccatgca gcggatgtcg cgctcgctat     69780
     tctccttctc gctgagcgcc gggtcgagca cattgctctc aaacaccgtg ccactgtgat     69840
     caagatcatc acaccgcgcc tgatcccggt aagtccatac ggcggatagg tcgacgtagc     69900
     agggggtcca gtcaagttct ccctgtacaa ggcgctggac ggcgggctcc ggtgtcttgt     69960
     accaagcccg gatgaggtcg acgcacgcct gcttgcccgc cgcattggcg ttttcatagc     70020
     aatacgccaa gctgtcgtgc tcggccatca gcatgcaagg acggccacgc gcatgtacga     70080
     tcccgatcgc aaaacgcagc cggtgccgga cgattttgtt gcttctgctg ctgattgcgt     70140
     ggctggccag attcgccata tccagtccgc ggcgaaacga atcagactgc ttcaccggca     70200
     gtgccagcag gctttcagcc tggtcgtagc gcagcgttcc cagaagtgac ttgtgcgcca     70260
     accatttcgc cgcaccgtca tcgatcgtcc gatcgtggcg gtccagatag gacgtggccg     70320
     ccgggtcccc cgcgaacctg gtgatgtatt tccagtcatg gatgacatgc tcactcgccg     70380
     aggcccgtag gagctcgcgc tgccacccac cgagaacggc ctccccagta tgaggatcga     70440
     aggtgactgc tgcggaggag gcgtgccgcg cgtcgcccag cagcacctgg tgctcgctgg     70500
     ctactggttc caggtagacc ttgaactggc ctttaccggt tgacaccaat cgcagcggcc     70560
     ggcgcccctg ccgctggcac caggcgtcca ctgccgcagt gcggccggcc tggtcggtca     70620
     gcaaggcatg caaggtgtcc agggcgcctt tgcggtaagc tgaatagctg ctgctatccg     70680
     gcgccggcga gcatttgtcg cgacgggcag tgcgcgcaac agccaacgca gcggtgatcg     70740
     ccccttccag ggcatccgcg tcgtgcggga ttcgcgcagc agcaaccgcc tggcgaagct     70800
     cggcccgtag tggaccctca gcgctatcgc gctcggcgac ccaggtgcgg gcggcttgga     70860
     acagctggat atagtcgttg tagctccgac gttgcgcacg cgaggtcagg tagtaggtca     70920
     ggtcgctggc gtcaactcga tcgagcacca ggacctcctg cattgcctct cgacacaggt     70980
     acagcttgcc agtgatctcc cggccggacc ggttgtatcc ctcgtgcacc agaggtactt     71040
     cgatgtagtc gccacgctta tcgcggcgca cacagccgat gatcggcatg cgctgtttaa     71100
     gcacgtatac cctgctgtgg gcccaacggt tgttgaactg gcgagtttct tgtgatgcga     71160
     aagcgccggg aatgaagcgc tgctcgaaca gagctgaagc ccgaacggcg acccaagcac     71220
     ccgctgccag atattggttc tgttgctggc gatacgcgtc atagcctggt cgctcgacac     71280
     ccagcatcac gctctggtcg accaggcgca gataccgctc ctggaagccc cagtcgagcc     71340
     acgaggcaaa cgccggcacc gcccagtcgg cgaagagcac gtcgcgatcg cgcaaccccc     71400
     aaagcatcgt gaggaccttg gcataggcat ccagcgctcc gagctggcgg cgctgtgcca     71460
     tcgcgtacgc gaggtcgtcg cggcggatgg tctcgccgtt acgaccactg aagtgcccga     71520
     gctgctcggc cgcgttgggc atgagctgtt tgatcttctg caggaattcg gggccttcga     71580
     ccagatacac ctgctcgcca tctcgcacca gcagcatgtg cagctggctg atcttgttga     71640
     gttgctggtt tgccatggcc gcgccaatgt ctccgggacg cgaaggcttg acgaattcct     71700
     tgtagctgct gcggaactgg cagaggacca tgccacgtgc cgccggcacc aggcgttgca     71760
     gcagcgcgtc gtcggccagc accgtcgcca ccgagtccaa gtgcgtgtgg tctagcccgt     71820
     tgacttccag gtgcaacaga agttcttcgt cgagtgaaag caactcttgg tagatcgtca     71880
     atggaagttc ggctggcgcc ggcgccccct ttcgcagttg ggtcacctcg acaccatcgc     71940
     cggtatagat cttgagattc tccaccgtgc gcaaaatgcc cttgaccgcg tccagctgcc     72000
     cctgggcggc cgccagtccc actgtggccc gctccatgtg gaagcgggcg agcgcttcgc     72060
     cctggccttt cagcgcctcg ctgtgtttcg cgatccactt ctgggtcgct tcggcgtttt     72120
     tcttgagccg ctcggcatag accgtcatgt cacgcagctg ctcgggcgtg gccagcgcct     72180
     ggccctcgga ttgggtcggg gcgctggggt cgtagccgag attggcgatc ggcttggccg     72240
     ctggcggcgg ctccagcagg cgcgcctgcg tctgcgccat ctcctgatgc agcgccaaca     72300
     gctcgcgctc gcgcaccagg gccgcttcgg ggcagtacgt ccagtatcgc cagaagcagt     72360
     ctgcatggaa caggctgggg taggcctctc tttcgggcac gcccgggtga gcggcgaatt     72420
     tgtagacgtg cggttcgcca tcggcgtact cgatcgattc cagcagcagc acgatgccgg     72480
     catccagggg attgctctcg atctgcttcc cgtcttcctc gccggtgacg tcttgcaaca     72540
     ggcgccagta agtgcccggg cgcggcgcgt cgaggcgctc gaatcgggac gactcgccat     72600
     gctcgacggc actgaccacc aaggcgttct cgttcacatc tattccttag gtttccgact     72660
     gcttggcagt caggtggttc gtagcgagga cagactcgtg agccgtgccg ctctcttggg     72720
     atttctgcga cagctgggct cggatcaggt gcacatcctc tccggcttgg ccgcttgcgt     72780
     tgcagtgctg ccggctggca aggattgctt cgatcttcgc ctcgatctgt tgctcgtttg     72840
     cagcaggcag cagcagttgc tgggccatca cttcgtcgca gccgcagtga tggcttcggg     72900
     cagatccacg cattggaccg gcggcagcgt gtgggaccca agcatggcgg cgcgacaggc     72960
     gttccagccg ctgttgtagc tgcgctgctc cgatgattgc agttcaagct cgtcgcgcct     73020
     ttcgggcacg gccgtgctgt tcgctgcctg cgctttcgct ttcagcagct cggagatcgc     73080
     gcaagctgca gcgcgtagca atgtcgcgct ataagcccgt cctacttccg agagttcatc     73140
     cgcatagcgg ttcaatcttt gggcaagcgc cgccggagtg atgttcgggg cagggttgtc     73200
     ctgtccgtgg gcaatgaccg gcgctggcgc attgcggata acttggtgtt ggctgttctc     73260
     agacattgtc ttctccgctt gaagtgtggg taagcatggc tacgtgctgg tactgggttc     73320
     gacagcaagt acgcgaggtg ccgcgtgtac ctcgcgacct tctttcggtt tacgactgcg     73380
     tcccgccgac cgggttggcc tccaggctca gaagggcgtg acggcccgtc tgtgtgattg     73440
     cgtaaccgcg ttgttcgccc tcgcggtccc agtagtcgat catcttcatt cgctccaagt     73500
     ggtggagcgg tctaacgacc atgagtgccg cgccctgcgc gttgggtttt tctctgcgcg     73560
     ggacgatgtc tccgctgccg atcaagcagt atccaatcgt gctgggggtc attcgctctt     73620
     tgcttgatgc aagccggagc aagatcgcca tttcaattcg gctcacgcat cctctcctgc     73680
     cgcttcctac tgggaacggg tgctgagcat cccggcaatc gtatcggctg ccacaaccat     73740
     caatgtttcc gagcaatcca ggcacccaag cacaaagctg cactgcacct cgtgcgtccg     73800
     tagacggccg tccacgacat cggacgcggc gcgcttgtgt gcgaaccatt caaacgctgt     73860
     gccgccgcag tgcttgcacg cttccggcac gccggacacg tgcagcactt ccacctgtac     73920
     aggagcagcc gcgggcggca cagcgtggct cgcctgctgt cctttctcgt gcgatgtaaa     73980
     agccgcgatc gctgcatcag cgcaaggcaa gtagtcttgc cagcggtgag cattgccttg     74040
     cgcatcccca atgtggtccg gcacctcctc gcatgccaga caaacagcac gtgcgacagc     74100
     ctcgcgctcc ttctcgattt caagctttgc agccatgtgc gttctccgat ttctttgcag     74160
     tttttttcga actggtggac tgccgcaacg cagctcatgg gcctacgcgt ctgcgctacg     74220
     ccttggcggc cttggtggcc ttggcatcct tgtcgccatc cgtccgctgg agctgggcgg     74280
     cgatccagtg cttatcgcgt gccattgcgg catcgatcat gtccctgatc tctgaggcca     74340
     cagcgggttc gcagtcaccc attccgatgc cgtagacgac atagggcgtg ccgcgatcaa     74400
     tctcttcgtg gttgattgca aagtcgcaga gccagcggaa ccgttcggcg tcgcgctgct     74460
     cgtctaccgg caaaaccgcg ggcactttcg gttcggcata gaatcccttg acccggtaga     74520
     cgccgaggtt cgggatcttc ctgccgtcga tttcgtatac ggcaccatcc aggcgcctgg     74580
     gatccggatc gccccatcgg gggacgtacc agctgtgctc ccacgcttca ccattgacca     74640
     cggcctgcag caagaaaatg tcaggctcaa tgctgctttc atcggttgcc atgtgcgtgc     74700
     actcgtgctg tgttgaaggg cggtgcggcg gcctttgcca ggcgtgccgc tttcgcgagg     74760
     cagaacttgc aggtgacggc ttcgtcggcg ccagcgatgt tcatcccatc gcggctgcgg     74820
     gcgttcatgc ggccgcaaag cgtggtggtc ttggtcatgc ccatgcgctc gatgcggcgg     74880
     ctcgcgtgca gagtcatggg cgcgctcacg gcgatgtctc gctgctgatg gccagcaccg     74940
     ggcggccgcc catcgtcagc ccgggcacca ggccggcggt caggtgcgcg agctcggcca     75000
     gccgcagggc atcgacgcgg gcgacttcat cccgcgtaag acgtgctttc accatcgcca     75060
     gtgcgcggcg atcgcgctgg cgctgcagtt ccttgcgcaa ttgcttgcgt cgatccgcca     75120
     gcccgtgacg ccggcagtcc tgcagctggg cccgggtatc ggcggcccag cggtggtgct     75180
     cccgggcaat ggccacccag tacgcgacga cggcggtcat gggagcagct gctcgtcagc     75240
     gaacccgccg gcgagcagtc gatcgcggac ccgctgggtc atcgggcgct gctcgtaccg     75300
     cgcaggacca tgcccggtcc gcctcggcac tttctgagcc acaaacacct gacacaggtc     75360
     ctgatcgttg tcgtccgtgg tggccaccac ataaaggccg tcgtccgctt ggggcaagcg     75420
     gaacagcact gctgattgcc gacactgaat cgccccactg gcagccagca gatgccccaa     75480
     ctggcaccga caaatgcccc aacgtcgata ggcctccaac aaattgcctc tttttcagag     75540
     cgctaccggc aagctgcccc gaattcgacg acagaactgg gcaccgcact ctttgatggt     75600
     ccaccgacgc accttgagta tccaattaac gcagtcaaag agacccatag ttccgggaac     75660
     ctagtaatga gtgcctggtt ttccccgtcg cgcactctag ggggcaaaca attgaaggtg     75720
     ccccggcgtt tggcgtcctt gcttgccgct gcctgtcact gcttttgggc tatgaggcat     75780
     tccactggcc agctcggtcc gcacccgcgc catcttgcta gccggtggta gcgacgatct     75840
     catcttgggg gtaattagca ttggcggccg caagttggcc tgcgtgcctg gcctgagcct     75900
     cgggtgcacc gtgctcctgc atggcacggc gggtccgatc ggtctcaccc agcgcaagct     75960
     tttgcggcgg cgccaacgga gtccaaaatt ccccgcgctc ccgctggtgc tgtcgccccc     76020
     tgtgcttgca gtcacacatt caacggagcc agttgctgat cctggcgttc gctgcggccg     76080
     aaggctagtg gagctagcga tgcgcgcgaa tgcctaggag gatacgtgcc gtcactcagg     76140
     tccgatgagg acctttgggg tagccgcgga accagtcctc ctcgaactgc gaggtcagat     76200
     acggccgcac aaacgacgat tgggtgaggt ctcgcaaccg ctcttcatgc tgggcgatgg     76260
     cttccacatc actgagtgtt gggtagtggc gcaacagccg gtaggcttcc tggcgcacag     76320
     acttgggcac ggcttggctt ccggcgagtt ccttaagaaa cgctccggct tgaagcaggt     76380
     tgcgagtgcg ctcgtcaggc agggtcatgt gactgctcac caaagctaag gaattcttag     76440
     cgtaacgctt gaccctgctc gcgttccagc ggcgattgcg cggatggcgg gccgcgtttg     76500
     gttaccgaac tcttagacat gctcctaggt aacacggcat ggcgcttgtt gtgcatcacg     76560
     taaccgcctt actacgatct cgcttagacc gttcgggttt tgggcgctta ggtggactcc     76620
     gtcccacatg ttgctgccac gctgcttcga gtgctgccgg caaatcgttc aatttgacga     76680
     gttgcgcctc aagtgcatct gcgcgtgcct gctgaatcgt gaggtcttgg cggagcgctg     76740
     aaacatcgcc ttgcgcgtgt tctagcgctt cctcaagtcg gcgcttatcc agcgctgcct     76800
     ctcgctggct ggcagctagc tgctgcttgg cctgcttgga ttcctgacgc gcatgatcga     76860
     tctccgcatg tgcccggtct tcgttggcgc gcatatgctg ggtcaaggtg tcgcgctcgg     76920
     cacgcgctgc atcctgcaac tcctggagtt ggacccgtaa catttcattg gcgctttctg     76980
     cgccgagggc gcgtaaagct gaagcgtcac gctgctggct aagttcggcc agctgacgct     77040
     gcagctgctc gacaaagcgc tccaactcgg acgtccgtgc ggcggcgagt tgttcggctt     77100
     gctgagcagc gtgggttacg ctttctagtc gggcaagctc ggcctgcata gcgtgccggt     77160
     ctcgctccaa cgtttctcgg gcgtctaaga gggatgcacg atcagaagcc attgcgtcat     77220
     cggcctgggc tcgggcgtgg tctagcgcca acgtccacca ctgccctgcc agggccgcga     77280
     cagcttcagg cacgttggcc gttgcgatcc ggacctgacg gtccgttgcc aagcgagaac     77340
     ccaaacactg ccaccaagtc tccagccagc gcacaactgt gttcggtgac cctgtaccca     77400
     gataggcgcg gatacgctca accgtaggtc gttcgccatc tgcaacaagt gcatcggcag     77460
     cgccgtgcac gtcggattcg gtgatgcctc tggtcatcga aaatgcctcc cgtattggcg     77520
     ccctgccccg cagttgacgt actcgcgata agtgatgatt atcgtggcta cgcctactta     77580
     ttcgtagtga aaattacata ctatgaagga taattccacc agcagcgccc tcgcccagac     77640
     ggtccagcac ttggtgctgc ccgaacagct ggcgcaacag gcggcggatg cggtgcgcga     77700
     actgctcgcc gaagcggccg ccgccaacac cacccgcagc tacgccagtg ccctgcgcta     77760
     ctgggccggc tggcatgcgg cgcgctacgg catcgagctc gccttgccgg tacccgaagc     77820
     cacggtgctg cagtttgtga tcgaccacgt gcagcgccgc tcgactgacg gcgagctggc     77880
     gtgggagctg ccgccgatgg tggaccaggc cttggtggcc gccggcctga aggccaagct     77940
     tgggccctgg accttggcca ccgtgcggca tcgggtcgcc gtgctgtcga ccgcgcaccg     78000
     gctcaaacaa gtggccaatc cctgcgagca gccggcgatc cgcacggtgc tgagccgggc     78060
     cgcccgggct gcggtcaagc gcggtgagcg accgcgcaag aagaccgcga tcaccctacc     78120
     cgagctggag gcgatgctgg ctacctgcga cgacagcctg gaaggaatac gggatcgcgc     78180
     cctactctgc ttcgggtttg ccagcggtgg gcgccggcgt agtgagatcg ccgccgccga     78240
     cctgcgcgac ctgcgccgga tcggcgaggc gggctacatc taccgcctgg agcacagcaa     78300
     gacccagcag gccggcgtca ccgtgagctc gaccccggac aagccggtgc tcgatcgggc     78360
     cgctctggca ctggaggtct ggctcgaggc gtccggtatc accgaggggg cgattttccg     78420
     gcggctgtgg aagcagcgcg tgggccctgc cctgtccccg gccgcggtcg gcgagatcgt     78480
     gcagcggcgt gcgcgccttg ccgcgctgga gggggatttt ggtggtcaca gtctcaggtc     78540
     ggggttcgtg acggaggcga gtcgccaagg cgtggcgctg ccggcgatca tgcaactgac     78600
     cgaacaccgt gcggtagcga gcgtgatcgg gtactttcag acaggcggag ccgcagctaa     78660
     tcctgctgct cgcttgctgg aggattgatt gccctgagcg gactataggc gtgggggctt     78720
     tatcacggac ggcggccggc aaggcgtcgc ccttcccgcc ttgatggcgc tcaccgaaca     78780
     ccgctcggtg gcgcaggcga tcggttactt ccagggcgcc aagatcaccc acaaccctgc     78840
     ggcccgcttg ctcgacgacg gtgcggaacc cgcccgctag actgcatcgt tcccgtcgag     78900
     gagtgtttcg tatggaggcc ggccacaagt ccacgggggt gactgacacc gagcgcatgc     78960
     tcgcggattt ctgcgagcgc tccttcctga agctatggac ctacccgaac ccttacaagg     79020
     aagacggcaa ggagctgtgc gacgtcctgg cggtgttcgg cgaccacatc ttcgtctttt     79080
     tcgatcgaga gaaggcctat tcgcagacgc cggacgccga tcccctgatc gcctgggacc     79140
     gctggaagcg acgcgcgatc gatcgccaga tcatcaccgc ccacggcgcc gagcgttacc     79200
     tgcgcagtgg ccgcccgatc ttcctggacg ccaaacagac cgtgcgcttc cccttggagg     79260
     tgaaccgggc agccaccgtc cacaaaatcg tggtggcgca cggcgcgaaa gacgcgtgcg     79320
     cgcgcagttc cgagcagaac atctacggca gcttggccat tacctactgc gatctggacc     79380
     agggccacca accccgcccc ttccacgtcg agctggatcg gcaggatccg gtgcacctgt     79440
     ttgacagcca caacctgccg atcgtcctgg gcgagctcga cacgatcagc gacttctcgc     79500
     gctacctcga cgagaaggtt cgagccatcc gacgcttcga cgtgctggcg tactgcggcg     79560
     cagaggacct gctcgggcac tacctgctca actttgacca gacgacgaat gtgcacagga     79620
     tcggcttcga cgagccggtc aacggggtga tgatcggcga aggcgaatgg cacggcttgg     79680
     tgaattcggc cttgtatcag aacaccaagc gggaagacga ggtctcctac ttctgggatg     79740
     agttgatcca gcgcacctgc cagaacctgc tggacggcac tctgggtggc aacgccgacc     79800
     tgctccgcgg ccagagcgcc atcgtcgaga tggtgaagga accgcggttt gttcgacgcg     79860
     ccctgtcgag caagattcgc gagaatgtca tcaacttccc cgacaccggc ggattgacgc     79920
     gtctcgtgtc cctgatgccg tcgttcgatc cggaggtcgg ctacgtcttc ttccagttgc     79980
     gcgcacccga ggcgatccgc gcgcagctcg actatctcga caagcgacgc accttgctcg     80040
     agattgcgtg cggcgcggcg cgcaacaagt ttccgcacct gcgcaaggtc atcgggatcg     80100
     gcatggatgc gcccaagttc gccggggaca ccaactccga ggacttcatc ctcatgccct     80160
     gcgaggcatg gccggacgac gtccgcgatc actaccaggc gctcaatgag gattggcgct     80220
     tcttcgacac accgcagctt caacaatacg aacagacagt cacccagttt gttccgccga     80280
     acgaggcttt cgtcgggaag aaggtcgggc gaaatgaacc gtgcccctgt ggattaggca     80340
     agaagtacaa gaagtgccac ggcgcgtgat ccgtgcgccg gccgcgatcc cgcccggtat     80400
     ccttgcgaca tgcacacaat ttccctgccc cggttcaatg cgttggcggc ctggtgccgc     80460
     ttcggcccga ccatgtggat tctggacgag atcgcctggt tcgaagcggc cgacgggaag     80520
     ctgcttgggg tgatcgtgcg tgaccacacc gacggcgact tcctcggcat ctatttggct     80580
     caggatcgcg tcgggcgctt ccgccatatc agccagaccg acgccttctt cgataccgcc     80640
     gaggccgccg ctgctgcgct cgtggccggg gccccagcgt tgttggcccg cctcgaggcc     80700
     gaacgtggcc aaggcgacga agagcccgcg ccggtggatt tcttccggct agaggtggcg     80760
     cgtgagcgcc tgcatcctag cttcgccaca ctcctggaca aagaaggatt tagtccggca     80820
     cgagccatcg tcgaggcgat gatgcgctgg tacgaggacg tcgatggcaa cttcatcgag     80880
     cagtttcaaa ccggcggctt cgatgcacgc ctacttgagc tctatgcgta cgccttgctg     80940
     gtcgagaaca acttttcgct ctcgcgcgag cacgccgctc ccgatttcct cgccgaagac     81000
     atcctcggca cgatcgcggt ggaggtcacg accgtcaacc cgacccagga tcgccaaggc     81060
     aatccgcagc cgccacccaa gattacctcc gaggacgagc gccttgccta cctcaagcac     81120
     tatatcccga tcaaatttgc tggtgcgctg aaaaggaagc tcggcaaggc gtactgggag     81180
     atgccgcatg tcgccggcaa gcccttggtg ttcatcatcc aggatttcca cgcggccgcc     81240
     tcgatgacct tcgcgcgcac cggactgatc aattacctgt acgggtacga gcacaacgcg     81300
     atccaggatg cagagggcag actcgtcgtg gtggcgacca aggtgacaga acatcgctgg     81360
     ggcggcagag cggcggagtc gggattcttc gatctgcccg gggccgagca cgtcagcgcc     81420
     gtgatcttca acagcggcgc gaccctgtcg aagttcaacc ggatcggtta cgtggccggc     81480
     ttcggctccc ggcgggtccg gatgatccgg cacggcaccg tctggaaccc ggatcccgac     81540
     gcggccgaac cgatcccgtt cgcggtgcgc gtcgatgatc cggactatgc cgaatcgtgg     81600
     accgaaggcc tggatgtctt tcacaacccc cgcgcggcga ttccgctcaa ccccgagcac     81660
     tttccagcgg ctgtgcatca ctacctgctg ccggacggaa acatcaattc agtccaggca     81720
     ggcggcctcg tgcaaccgtt ggcctccatg accaatatct atattctcga gacggccgac     81780
     gtcaaggcgc tgtagtctcc cgccgcgacg gcgtcgccac cctaccaagg atccgtcagg     81840
     tccttccgct cggcgcggcg cgcgaggcca cgatccgtac ccgatccccg ctcgccagcc     81900
     cttcgggcgc gctgttgacg atgcgcaaag tctggtcgag ctgttcgctc agctccacca     81960
     catggcccag atcgcgggcg atgacgagcg gccgcagttc gacgacctca ccggggccca     82020
     ctactgtgat gcacacgccg gtgcgcccga tgatcagcaa gctcggcggc agccccgtgg     82080
     cccttgcact gttgcacgcg atggtgcaac actgtgaaac gcgtgcaaca gcggggcgat     82140
     catgacagca ccatcttccg aggcagagtg gttggcactg gtgcgggagg gctgcgcggg     82200
     caacgcccct gccttccaac tgcgcctgag ccgattgatc gcgcgcctgc gccgggagaa     82260
     gtccgccttg gccccgctgc tggccaaggc gctgactgaa gcgaacagtt ctcgtctcac     82320
     gctcgcccgc gatgccgccg cgcagcaggc cctggtcagc ccggtcgacc tagacagcaa     82380
     cctggccctg tccacggtgc agtttcccgc cttcgtcgaa cacgcgccgg tctggccgcc     82440
     tgcagtcgaa gagtcgctcg acggcctcat gcgcgaatgg cagaacgccg atcgcctgcg     82500
     cgaggcgggg ttgtcgcctt cgcgtactgt gctgctgtcc ggccccccgg gtgtcggcaa     82560
     gaccttggcc gcgacgtact tggccgaaca actgcactac ccgctgatca cgctcaacct     82620
     ggccgcggcc gttaacagcc tgctgggcaa gactggcgcc aacctcacac gcgtgctcgc     82680
     gcacgccaag gcgcagccgt gcgtgctctt gctcgacgag ttcgacgccc tggccaagcg     82740
     gcgcgacgac ggccaggacg tgggcgagct caaacgcgtg gtcaacgtgc tgctgcaagc     82800
     catcgatgaa tggccgggca cgtcgttgct ggtggccgcg accaatcacg aagagctgct     82860
     cgatcgcgcc gtgtttcgcc gcttcgacct gtggctgcgc ttccccgaca gcacggcgcg     82920
     ccaagtcgag acgttgctcg ccaagctggg ggccagtcat gccgtcgcac ggcagatggc     82980
     gcctgccttg gccggcaagc cgctctccga cgccagtcgt ctggtcatgc gggcgcggcg     83040
     cgaaatcgcg ctgggcggcg gcgaactcga cgaggtgctg atgcgtctgg ccctgccggg     83100
     tgcgaccgat ccggcctatc gcgagggttt gctgcaggtc atgcgcctgc atgccgacgg     83160
     cctgtcgatg cgtgccattg ctaagcacgt cggggtgagt gccgccaccg tctcgcgctg     83220
     gttgaacaag taggagcgca cgtatggccc ccaccccgcg caacacgctg atcgccaatg     83280
     gccaggccct catcggcgac ctggcgtggc caacgggcgg cggcccaaag tggcacccgt     83340
     acgacatcgc agttcagcgc gatgtcctac atcctcagct cacggccgtg gcccgggcgg     83400
     cgcgcgaggt ctcgcgtgtc tactcgccgc ggggcgaggt caccgcgcgg ctgacgctgc     83460
     atccgacctt cctggccaag acccacttcc ccgcccacat cctgcgcgac gcgggcttga     83520
     ccgtgctggg ctcgcgcgcc acgcaggtca cgcctcgcgt cagccagggg gacaagcagg     83580
     gcccgcagga caccgccgag atcctggtgg cgggcacgcc ggagggattc gaggcgatgg     83640
     atcgccagct cggcgatccg gccatcgcca agggccggca ggaagaattc acgcacatcg     83700
     aatcggtcct gacatacgcc ggcgagagca agttgcgcct ggacccggac accccgtggc     83760
     cggatttcgt gcacgtcacc ttgcatgccg gtgagcacga cgccgacctg ctgaccgcgt     83820
     tccagacctt caccttgcag ctgggcggtg agatcagcgc acgcgggttt cgcttcgtgc     83880
     cggggttggc cttcgtcgcg gtccaactgc cggccgacag cgttcccgag ctcgcgcgct     83940
     tcgagcggat tcgtctggtc cggtcgatgc cgcgcctgcg cgaacaactc gatctcaccg     84000
     cggccctgac gcgcaagttt cctaccctgg tgctgccggc ttcgcggctg acggctccgg     84060
     gcccccgcgt ggccgtgttc gacggcggca cgcagaactc cttcggcgcc cacgtggtcg     84120
     aactggctgc gcccggcttg ccgccggcga cggtcgcaga cttggcgcac ggggtcaacg     84180
     tcacctccgc cctgctgttc ggcccggtcg atccgtcgca caccgcgttg tccgcaccgc     84240
     cgtggatggt cgagcaccac cgcgtgctgc cgaccaacga cagccccgag caggccctcg     84300
     acgtgctcga ccgcatcgtc accgccttgc gcattgcgcg cacggccgac cgcccgtatc     84360
     gcttcgccaa catcagcctg gggccggtgg cgaccttctt cgatgacgac atccacgagt     84420
     ggacctcgcg gttggacacc gaactggcgg acggacgcac gctgtgcacg gctgcggtgg     84480
     gcaacaacgg cgcgctagac ggcgagctcg gtcgtatcca gccgcccggg gatgccgtga     84540
     atctgttcgc gatcggtgcc gcggatacgc gccaccccaa gtggaaccgc gctccgtaca     84600
     gcgcaaccgg ccccggccgc agcccaggat tcgtgaagcc ggacgtactc gcgttcggcg     84660
     gttcccctgc cgagccgatg ccggtgtaca gcccgctggc gggcggcgtc gttgccgtgg     84720
     gtggcaccag cttcgctagc cccttggcct tgcgcacggc gctcggcgtg gacgtgctga     84780
     gccaatcgcg ctttgatccg atcacgttgc aggccctgct gatcaacgcc gccgaatgcc     84840
     ggcggggcca caagcgcacc gacgtgggct ggggccgtat tccgctgggc ccggacgcca     84900
     tcgtgcacac cccgctagat gtcgtgcgcg tggtctacca gggcatcacc caccccggcc     84960
     atccgcagaa ggcggtgatc ccggtgccgc gcgggctccc ggccggcacc cgggtgcgca     85020
     tcggtgcgac gttctgctat cgcgcgcagg tcgattctgc ccacgcgatc aactacaccc     85080
     gggcgggtct gtgggtgcgc tgttacaagg cgccgggcca gagcctgccc ttgttcggca     85140
     gcggtatgta caagtccgag gaagaactgc gccgcgacgc gatgcgctgg gacacggtgt     85200
     tgaacaacgc gtgcacggtc gacgcggccg agctcgacgc gccctatttc cacatcaact     85260
     accaggtgcg cgacgagagc gaggcggtgc gttgggaaga tgcggttccg atgccctacg     85320
     ccctgatcgt gacgctacaa gcgccaggcg tggccgatct gatgacacgg gtccaggcgg     85380
     aatttccggt cctgcagacc ctgccggtcg aggtccaggt gccggtggac gggctgagct     85440
     agcgccaaca cacgccgcgg gcctcagggg cagcccgccg cgtccccttc gccccgacgg     85500
     agaagccgca tggccaagaa gcacgagtcc tcgggtccga aggtgacgcg cacggcgtcc     85560
     tcggtgttgc gcgacagtgg cgccagcaag accgccaaga gcctggcggg cagcaccctc     85620
     gcccaggccg ggacccgcaa ggtctcctcg gcgaccacgg cccgtaccgc ggccaaggcg     85680
     ctcaatgacg ggcgcaccag cgccggcacc aaggccttgg ccggcagcgt gctcacacag     85740
     cgacccggca agcgcaagta gggacatggc gcgcggggcg cgcctgcccg ccccgtcccc     85800
     gggtcgccag ccggcgcctg ggagcagcga aaccggagag gccgcagcca tttccgattt     85860
     ctgctggggt ctgcgacttg cactagaggg atgcccgcca tggtggcgga gggtgtcccc     85920
     cgaccatggg aaccaaagat ggacgcaccc gaacccgacg atctagaaaa tttggctgac     85980
     ccggacctgg tcgaacgcct gcgctgcgtc gactggaacg acccgcagtt cgtcagcgaa     86040
     gaacggctcg tacagctgtt cttggcggcg cggaccgcgg gccacaccgc ccgggtcggc     86100
     ctgtgcacct gcgaactgtc ccggcgtctg ctgaggcgcg cgatggcctt cgccaagaag     86160
     aacacgctgg ttccgcaaca cttctccgac tatgacgaag cggcccacga cttggccggg     86220
     tacgtgtggg aacgcctgct cagcggcacg aatgccgagt ttgccgcgcg ccggttcggt     86280
     gtgttcttcg agaacaagtc gatttcgtac ctgcgtgctt tgctcgccca atgtcgccag     86340
     aggatggaca gcctcgagga atggcaccaa ggcgagcacg acgactccga cgaggacgac     86400
     gatgcgcaag cgcagccgcc cgaggatgac gactgcgacg atgccgatgc caccttgcgc     86460
     gacgatgcga cgccggatcg cgtgctgggt cacgcgatgg agttccacca ggtccacgcg     86520
     cggctgcgag ccctgctcac ccgcaacgaa tattcggtct tcgtgatgct gtggcgcaag     86580
     gagatgaaga tcaaggagat cgccgctgcg ctgggcgtca ccccgcgtat ggtcaacaac     86640
     cacaagcgca gcatcaaggc caagatgaag aaggagttca atgtatgact tcgcccaacc     86700
     gtaggctttc gcttgaggac gtgttggatg cgctgttcct gcgagacgac gcgccgacgc     86760
     ccgagatgat cgtccaggcc tgccaggcgc atgcggagtt ccgcgaggag atcttggagt     86820
     tcgcggccct gcaggcggcg caagccgccc tgcccgacgt agccgagtcc gacctggagg     86880
     tttccgacgc gtccgtgatg cgcctgcaaa gtcacgtact caatttgctg tacggcgcgc     86940
     cgcccacccg cgccgatgcc gacgccgtcc gccaggcggt gcgttcgttg gccgggcagc     87000
     gcctccaggc ggcggcccag gcgattgact tgggctcgac cgtgctcctc cacaaagttc     87060
     tgacgcgggc gatcatcgat acgccgcgcg tggtgttcgt acgcttggcg cagttcttga     87120
     aagtcggagt ggacgggctc gtggacgcct tggggcccca actggccttg caccgcagct     87180
     acaaggccgc ggacaagccg accatggtca aacaagaatc gtgggagcag gccgtggccg     87240
     ccctcgccgt cgacgaggcc gagaaggcac ggctgcgcgc aatgcaggat cggagcgatc     87300
     ctgcgtgacg ccgtttcggc gagcgagatt ggccgcgcag caattgcgcc ggcagcactg     87360
     tccggaggcc gccgccgatg gcctccggtc attcgatctg atcgcccgta tcgcggccgc     87420
     cgaggctgaa gatttcgaca tctcctcgac gcgtccggac gacacggcgt tgtgcggagc     87480
     tgatgccgtt cttgtgcggg cctttcgcca gatcctggtg cgcgacgatg tcgaaccgcc     87540
     ggaccgggcg ttcctggtgg cgcacgaatt cgggcactgg atcttgcacc cggaagagca     87600
     ggagggttgc cggcaggtca tcgtcagcac cctcaatccc gccgaggacg acaccctcgg     87660
     tgccaaacgc gtggaggcgt acggcgcccg agagcgggcc gagttgcagg ccaacgtgtt     87720
     cgcgcgcgag ctgctgctgc cgcgcccgct ggcccgtgcg ctgttcctgg ccggccatac     87780
     cgcatcctgg atcgccgccg atttggcgtt gccgctcgaa ctggtcaggc aacagttgct     87840
     cgatgccctg ttgctccccg aggacgggct cgcggacgat gcgccggagc cggccttgac     87900
     gccgaccgac gaacagcgcg atgccgcgag atcgccggtg cgcacctcgc tcgtggtcgc     87960
     cggaccgggc accggcaaga cggccacttt gctcatgcgc atcgagcacc tgctcgcgaa     88020
     cggcgccaag cccgccgagc tgttggtgct aaccttttcc aatcgggcgg cgcgagagct     88080
     agtcgatcga ctcgcggcca acggggttcc cgacgcgcac gagatgtggg tgggcacctt     88140
     ccatgccttc ggcctggagt tcttgcgcaa gaaccacgag cgcttcgggt tgcgaccggg     88200
     gtttggtgtg gccgacaaga tggcccagat cgccctgctc gagccgcaca tctatggtct     88260
     gcccctgcgg gtgttcaacc cgctgggcga tccgttgccg tggctggatc aggccgtcaa     88320
     gacgatgcaa cgcgccaagg acgaactgct ggatgcggtg gcattcacgc gcgtcgtcga     88380
     agcaggcgcc gtgcaggccg acgccgaacg actggcgttg gaccgcgacc tggccctgct     88440
     gtatcgcacc tatgaggcgt tgctgcgggc caacggcggc ctcgttgact tcggtgacct     88500
     catcctgttg cccgcgcagg ctctgcgcgc caaccgggct gagttcgcac ccagcatcgg     88560
     ccgcttccgg cacgtgctcg tcgacgagta tcaggacgtc aatcgcgcca gcgcggaact     88620
     ggtgaaggcc atcgccgcgc aggccgacag cctgtgggtc gtcggcgatc cgcgacaagc     88680
     gatctaccgc tttcggggcg cctcgatgcg caacatcgtc cggttcgcgg acgattttcc     88740
     ccagcatcgc gagtttcggc tcaacgagaa ctggcgcagc ttcgaggaga tcgtgcgcgt     88800
     ggtcgagcac accggccgcg atgacaatcc cctgcagggc gtgctcccgc tcggcggcgt     88860
     cgcgccgatc cgcggcccgg gaggcgtgcg cccgacgctg gtcagctgcg aagacgagag     88920
     cattgcgttc ggcgaactgg cctcgcgggt gctcgggctg caagccgaag gcaccgcctt     88980
     tcgcgagcag gtgattctgg ccaaccgcca cgacacctgc gatgcggccg ccgccgccct     89040
     ggtcgccgcc ggcatcccgg tcctgcacct gggcgatgtc ttccagcgtc ccgaggtcaa     89100
     ggacctgctg gcgctgttgc aactgttcgt cgatcgctcg ggcagcgcct tggtgcggat     89160
     cgcgcagttg cccggcttgg ccttgccggc tcccgacgtc gacgtgctgc tcgaccacct     89220
     gcgacacacg cgcccggcgc ccttgtcctg gctccaggcg ccaccggccg acctgtcgcc     89280
     cgccggcgcg caggcgttgc aacggtggcg cgacaccttc ggcggactca cttcgcgcga     89340
     cagcccgtgg gacgtgatct gctcgctgtt gttccagcgg acgcgatggc tcgccgatta     89400
     cgcgaacggc agcgacatgc aggctgttac ccggcgattg gccttgtggc aaatcatcta     89460
     ctacctgcgc gttcccgacg gagggcgcgt ctaccagacc gtgggcacgt tcttgacccg     89520
     gctacgccga cgcttgcgct tggccgacga tcgcgatttg cggattcccc cgccggaggc     89580
     cgaactcctg gacgcggtcg ccgtgatgac catccaccaa agcaagggct tggagttcga     89640
     agcggttcac ttgatggatg tcgacgcgcg ccattttgag cgctcggacg atgcgccgtg     89700
     gcttccggag gtcttgaccc aatccgccgg cggcgtggat gaagcgaggt cggaggccgc     89760
     gaacaggctg tatgtggccc tgtcccgcgc gcgatcgtcg ctgaccttgt acgaggaaaa     89820
     gggctatttc aaggcggccc gcgcacctgc agtgcagcgc gccgcgcact tgctcaactg     89880
     cgtcgtcggg accgtggcct acgcagtcgg ccgccatgcg gccgcactca cggcgctggc     89940
     gccgcaggtg cccgtggatc tgagggagtt tgtcacctac cgcacctgcc cccgtcgcta     90000
     ctactacgac gtgatgaagc agctcagccc ggcggcgggg ctgcacccgg ccgcgcggat     90060
     cgaagcggca gtgatgcggg agctgtttgt gccggcgggc ggggatgtat ccgcgccggt     90120
     caatgatgtt gcggtcgaac tggcgatgtt gacggaagag tacgagccgg ccaggccaca     90180
     cctgttggca tacgccgtgc aattgcttga tgccggacgc gcttggtccg gcactgtccg     90240
     cgcggcgatg gcgtcgccga tcgacgtcgt gtgcgacggc ttgccggtgc gcgtgaccgc     90300
     tcatcgcgtc acgcggcagg acaatgtcgt cactttgcat tttgtgcgtg cacagccatc     90360
     cagtgcgtat gccaagcagc acaagattct tcggtgggta ctcaagtgct tgaaccaaca     90420
     gttccggcag tatcgctttc agggcagcat gtacgtattg agctcgcgcg tttccgagca     90480
     cgttcgcccg taccaagact tggggttcga ccacctcgtc gaaatgggac acgaactgat     90540
     ggaaggccga tttccggcca agcccaacgc ctgggtatgc tctggatgtc gacacttcct     90600
     gtattgcccg gcgtgaatct cgccgcagtt cgacttccga ttcgtttttg tcgctgcgac     90660
     ttactcctta agggccacgc aatttcgtgc ggcccgcagc cgaaaaggag taacaccaca     90720
     tgtccaccat tcgcgtctat gtgcagtcgg agcacttctc caacatcaag ctggtggagg     90780
     tcgacgacca cgccaccatc gccgatctca agcgcgccgc gctcaccctg ctcccggccg     90840
     gcaccgatcc gaccggcctg tcgctgtcca tcgaggatga cgacgtcgat gacgacgagg     90900
     ccgcatcgaa gcgccgcctc aaggacctga acccggaccg cggggtgcgc gtgcacctgc     90960
     accggtgcaa gcaggtcgcg gtcacggttc gcttcggcgg acgctcggaa gagcatccgt     91020
     tccgcccggc gacgacgatc ggtcgcatcc gccagtgggc gggtcgccgg ttcggcctga     91080
     aggcgggcga catcgccgaa cacgtcctgc agatcgcggg ttccaacgag cagccggaca     91140
     tggacacgca cgtgggcacg ctggtgcagc acccgcgctg tgcgatcgtg ttcgacctcg     91200
     tgcccgcgca ccggatcaac ggctgatggc cgcgcaggtg ccgccggatg agcagtcctt     91260
     gcgcgccgac ctcgcgtcgg cgtgcttcct gtccggccag gatcgcgggc gctggcggct     91320
     tcaccggctc gactggccgt tcgtcttcat cggcgtgatc gccggtaacg ggcaggagtt     91380
     tgtgctgcgg ctcgactgcc gagggttccc gaccgctccg cccacgggca cgttctggga     91440
     cctgggcgcc ggcgtgcgtc tgccggacgc gcgatggcct cgcggcggcg agcggatcag     91500
     tctggccttc cggcccgact ggaagggcgg gatggcgctg tacgtgccct gcgaccggga     91560
     gagcctggtc ggccacgacg cctggccggc gcagtacccg cagctcatct ggaaccccgc     91620
     gagggggatc tcgcactacc tcgaggtggt gcacgaactg ctacaaggaa tcgaccatga     91680
     acgcgccgca gcttgagatc gcgccgacgc tgtggtcggc gatcctcgct caccttcgcc     91740
     aacagggcgc gggggtgcgc gagagcggcg gcttcctgct gggccgggtc cgtaacgggg     91800
     tccgcgtggt caccggcttc ctgccgtacg agcagttgca ggcggacgcg ttgcaggcgg     91860
     acttcgtgca tctgtccagc gccagcttca gtcggctctg ggactactgc gccacgcatg     91920
     gcctcgaagt cgttgccgac gtgcacacgc accgttacgg cgcaggacag agccgcagcg     91980
     acagcgagaa cccgatgctg gcgatcgcgg ggcacgtggc cttgatcgtt cccgagttcg     92040
     cgcaggggcc caccggcttc gagcaccttg ggctgtacgt ctaccagggc gctcatcgtt     92100
     gggcgcgcta ccgcggagcg gccgtggcgc aggttttgaa gttcacaccg ccggagggcg     92160
     aacgatgact cttttcgatg ccgatgcgat gcaccgcttg gcgaagctgg cgctggacgc     92220
     tggcgaagtc accacgccgg acgcggcgct tgaactgttc cgacagtaca ggctgcgcat     92280
     ccacctgggc acgggctggg cgaacacgct tgcgggccag gcctgtgtcc tcacggcggt     92340
     cagtaccgcc tcgcgagccc tgctgggcgg cgtggaagtg accggtgatc tcaccccggt     92400
     gatgcaggta ccgctgttcg cgggccagcg tgccgcggac gtcgtggcgg cgctcggcgg     92460
     cgccgcgacc gcgatgccga cgccaaggct gccgtcgctg atgatcgggg acggtccgcc     92520
     gccggagggc gtcgcgctca ccttgcgccc gtcctgggat ggctggtgtg cgcaggtcgc     92580
     ccccgccgac agtgatgacc acctgacagt cggcgacgac aacccgttgg cgggcgtctg     92640
     cgccggtgcg ctggccgtga gcgaggtgtt ctcccacgtg cgcgccgact cgccggaggc     92700
     gggctatcgc cggattggcc tatcgctgtg gaacccgctg gcgatcgagg actggaatgc     92760
     gcccgagaac cgggggccgg cactggcgta cttgccgacc gatctgtggt tgatcggcat     92820
     cgggcacctc gggcaggcct acgcctgggg tctggcgatg ctcccctacc ctgcgcaacg     92880
     ccgaccacgg ctggtcctcc aggatgtcga ccgcgtaacc gaatcgaact tgagcacttg     92940
     cctactggtg ggcgccgacg acgtcacggc gcgcaagacg cgcgtcatgg cacgacgcct     93000
     ggaggcgatc ggcttcgaca tcgacctggt ggatcgccgc ttcggcgcgc agcacctgct     93060
     gcagccaggg gagccaaccg tggcgctgtt cggcgtggac aacgtggcgg cgcggcgcga     93120
     tctcgacacc gcggcgtttg tcctgatagt cgaggccggg ctgggcagcg gctatcgcga     93180
     ctttcgtaac ctgcgcctgc atacctttcc cgggccgcgc ccggccacgg agctgtggcc     93240
     ggcccaggcc gcgagtcagc cgttgacgga gctcaacacc gcataccagc agctcgcaca     93300
     cgacagcggc gacctgtgcg gcgtgacgat gttggcctcc aaggcagtgg ctacgccgtt     93360
     cgtgggcgca ttcgccgcga gcctggccct cgccgaactc gttcggccgc tgcatggcgg     93420
     ctgcgtccac gccagccttg actgcccgct gcgatcgctc acgcatcgtc ttggtgagcc     93480
     cacccctgcg aatgcgcgct gcgcgttcat tgcactgccc taggacagcg atgaaaagct     93540
     ctcgccactc caatcgacat gtttcggtcg cagacaacac ctcggcgccg acgacctggg     93600
     tcgaacgcaa gctcatgttc ctgcaggcgt acaaaggcga atgcggcgtc gcctatctgc     93660
     tcggcgtctt gggcgttttc gcaccgacga ccgtcgcctt gttcataatc gatcgaccgg     93720
     cgtacctggc gatgggctgg agccaatccc tgctcgtggt cggcgccgtg ggcggcatgg     93780
     tgaccgcgtt gctcatgtgc ggcctcgtga ttcaggccgt ggccgagcgc cgcacgcccg     93840
     cgtctgccta cgagcgccaa cgcttgatgc gcgacacgtt agtgtgcggg tcggttatgg     93900
     cgatgtttgc gcagttcgcc ggcctcaccg ttgcgctcac ctcgcgcatg gacatcccaa     93960
     gttatgccta caccgtccta ctgatcgcgg tgggatacgc cacagcccaa ggagcctcgg     94020
     ccttgctgac gcgcgctcgg cagaaggtgc tagcacgcat tggccgctga gtgcgcacgc     94080
     agcacgccgc tagctcggag tgagggcgcg aagctgtcag gcgagaccca ctgggcacca     94140
     tctgcgcaca aaggcacact tctcgatgac gcgacggcgg catcggcccg cctcgtcgcg     94200
     gtcgagatta gtcgccgtag atgaactccg cccggctgat gtcggggttg ggctcaccca     94260
     cgacgaaacg aatgaaaacg ccgtgtgcgt atcccaggtg acgcccgtac gcacgcagtt     94320
     tctccagatc ccggtcatcg ggcagacgat tgctggactt cttgagttcg aacacgacgt     94380
     ggttttcgcc ggggcctcgg cggtgaacga tgatgtccgg caggacggcg ctgccttcgt     94440
     cgtcatcgtt gccggtccca tccggaatca ttttccgcgc cgcgttatcc cggtcgtatt     94500
     cgcagtcgac gtcccagcca gggaactgtg cctccacgta gatcgctagc ctatgcgaga     94560
     tggcccgctc accgacacga tgaacgaaga ggtggcggtc acgctccagc agttgttcca     94620
     cagcaacaat tacgcgctcc gcgacaacag catctcgcga ggtgcgtcgc agatcgtttt     94680
     gccacggcat tgactctact cccttggata cggcggctcc aggttgcccc cgcggttgcc     94740
     cccgcgtcgc caagcgtagc taccctacag gtgacgatca atggcttggt tggccgcaac     94800
     cggtcgaaat ccccccgccc aatcctggga gcggagcaca aggcaatgcc ctgggcttgg     94860
     gacttgcggt tcatgtgcct cgcgaccatg atccgcagat gtccccatgg gttccggtgg     94920
     tttggcacgc caagggccgg gatcaggcga cattgcgcag ttaaactccg ctgcttcact     94980
     attcctccaa gtcccgatgc gaatcaccaa cgacaattac tcgcccatcg aactcctggc     95040
     tgagatcgcc actcgacgcg ggactacatc agccgacacc catcgttttt ttcagggtgg     95100
     caagacgagc catgattggc ttgtcgagga atggtccagt cgagtcgact gcattcttga     95160
     atcgttcaag cgctacggta tcgatgttaa tgccactcag ttcgtccgag accagggaat     95220
     cgacgttctg ctccgcgtcc cgaaccatca gggcaaggag tggcgtttgg ggttccaaat     95280
     aaagtccgag caagaggccg aacgggatcg caccaagaag cccggccagg aaaacatgat     95340
     tgggacttta aagcgccagg ctcacgacgc atttgagcgc gtcgacgagt ggtggattct     95400
     ctgctgtttt gacctggata agcactacaa actcgtccag ggtatcagct cagaactgac     95460
     tggaggcaag cagaaccggt tgattcgtgt cattgaccct agagcctgcg cggccatgtt     95520
     gcgtatgagt gaagccgaag ttgatgcgtt ctgcacgttg cttttgtgca gagatgatgc     95580
     agtcctgcgg gctgcccgtg aggaggtggc tgcctgccac ccgaacgttg gggcttttgt     95640
     gcttgaacac atcgttcctg cgctagtgga cggagagcgc gtttctcgcg aagaggtagc     95700
     gtcgttcctt gaagaggcct ttcggaagtc tgagcgtgaa agacttgaag acggcggagg     95760
     tgaggatgac gactgcgaag ctgtcatcga gctcgatgaa gatgctgacg agcacgggag     95820
     tgtgcaagat ggcatcgacg atgacgagga attcgaagat ctggatatcc acgaaatgct     95880
     gcaggaactg gagagcaatg gttttctggc agcaggcacc tatgacgatg actatcggat     95940
     atcgccaacg gcgtttcctg gtgtctgtgc gctgttcttc gaggctcggg tcaggcacgg     96000
     actcaacgat gacgcagcgg ccagctacat gcgttggctt accctccggc agcactagca     96060
     gagcagagac cgttgctcag gccgaggcac tgggctcgtg gatgccgaca ttagcaccgc     96120
     cggcgcagtt caccgcgcat tggggagcaa tgccgtcccg ttccttaccc gcgataaatc     96180
     gatctaatct gctccttctg atgtctgctc tcgaccactt gcggccgccc gacgctcccg     96240
     cagatcagcg atttgaaagg cggcagtggc tggaagcaga ccttgctcgt tgagacggca     96300
     acatccgcag ccagccgctt gctggcacta gcaccgtgtt taggtagtag gaagactatg     96360
     aatctcgagg cattccgcca aatcgttgac agcgctggac ccggcattgc agtgtgcgcg     96420
     gacgatctcc agcggctcta tgaatatgtg gggctcgagg gccgcggctc ctatacgcgc     96480
     aaggcggtgt ctgatgccct gtatgcgagc atccggagct gctttacttc gggtcactct     96540
     gcggtttggc gcgcttgcaa gtcgctgcgt agggacctca ttcgcgagca tgtgttgctc     96600
     ggtgtgtcgc tcgatccgta tttcgatgtg ctcgatcatc tgcaggatgc cgtccgtacc     96660
     gatggcgcat cccgtgcgtc aatcgagggc gactggaatc aggcaattcg ggctgcgctc     96720
     gaccatgtcc agattcatag cagggaccag atgaaccgga caatgctcca tgcccgtgat     96780
     ttccaagtgg cggaggcagc tcgtaccttg cgcgatgcag gattttctat tcggctggag     96840
     gccggccggt taggtcttga ggaaacatcc gagaccgcgc tagtcgcggc tattgaagat     96900
     ttgagcgccg ccatgggtgg gatcaatgtt gctcgtcgga tcttcaacgc gatttcaccg     96960
     cactacgatg ttgatcagca gcgctatcac gtcgtgcggc gtacctccat gattggaggc     97020
     ggactcgccc agatgccatg gggctatatg cttcagttag cggccaagca cgcccggggc     97080
     cgtaagcctt acaaaaacaa cgacgaccaa tggcgcatgc tttgcgggct gtcgcaagcg     97140
     tatgccgcca tttttgatgt tcaaccgtat acgccgacca tctacggcac gatggatgcc     97200
     accggcctcg tgccgtacct tcaggaaatg gcaatctacg acacgctgtt tcgcatcccg     97260
     caaatgcgtc cgacggatgt ggtgaagatt gcacgcggaa tgttcagttg gctggacaca     97320
     agcgtgccaa cgaagggggg atggtcgatc aaccacgtgc tggaaatcat tgactacttg     97380
     ctcgaccctg gccgcaatgc gcgcgggccc atcttcgtga ccgaatccga tatccggcgc     97440
     tcctgctcgc acattccgcg tgaaatagtg acacagattc taagtgaggt actcagccat     97500
     ccgttgtccg gggcgaacca gaatttttcg cgcccgaccg acgctcccgc ccccgaaggt     97560
     cccaatgtca agagcgcggg acatgacttc tttctccgcc cgctccttcg gatgtcggat     97620
     cagcagtttt ccttacttga tcgttcagtc tgtgctccag cttttttaga ggcaatgctg     97680
     acgcccttac gagcagagat aaaggggctg gacgacaaga ttggcgtggc aatcgaacgc     97740
     tttcttgagg cggagttcgc ctcgcatggc gtgcccaccg gcggcgggga ctatgacgtc     97800
     ggcggaaatc acggcgaatg cgatttgatc atcgagatgc ccgatacagt gatcttttca     97860
     gaggtaaaga agaagacgct cacaaggcgg gcgaaagcag gatccgatgc gcacttgctg     97920
     gtggatcttg cgaatagtct tttggtcgcc caagtgcagg ccggatggca cgaggtgcga     97980
     ctgcgccagc atggccactt ggaccttgaa cgtaatggaa ccgtcatgcg cttagaatta     98040
     aacgaccggc aggtcgaacg ggtggcggtg tccctctttg acttcggcag tttccaggat     98100
     cgaatcctcc taaaacagtt cttggaggca accatgtacg cgacctttac tccgaccgcc     98160
     ttaaacttgc agagcaagtt cgcagagatt aatgcggcac taatcgagat tcgcgatcag     98220
     gtggtggcgc tctatcccgg tcagaatgag ataaatcagc cattcttcaa ctgctggttc     98280
     gtcagcgtac cgcagttact ggtccttttg gacggggtca ccaatgcggc tggttttaag     98340
     agggcacttt ggagttgccg acatttcgtg accgggagtt ccgacctgta tttcgatctt     98400
     tcatacagga gacaattaga aagggagacg gctgcgaatc cagtcacgcc ggctgtctag     98460
     tgactacatt tttaaatcgc cgacgaagct gtcgcggcca ctaggtcgga gctcagcttt     98520
     catcccggat gccgccatcg tgcttcccct tggcatcagg cagcaacggg tcggaagctg     98580
     cccttccctt aaccacgata aacatcccta atccccagct ccgctggtgt ccgcttagtt     98640
     gcgcgcctac gcagcagcca gctgatcacc aagtacatgg tatgggacgc gcatgccaag     98700
     ccctattgtg ggtttctgtt gcaagtcacc gcacgccggg atgcactggc tgagcgactg     98760
     gagcagaaac tgcgggcgag cggcatgtta ggaatcgctc cagcatcttc cggcgccaaa     98820
     ggccagtgac ctgagctcgt taaagccaag cgcctgctgc cgtcccgacg ctcctgccca     98880
     gcttgacggc ttcgcggtgg cttgcaaagg cgcacgtttc atccgcgtca cagcccttgt     98940
     attcctgcgc gatcctcctc catccagcgt ttcacttgct cgacgttctc aacaatgacg     99000
     tgctgttctg cggcacgctc actgactgaa aggctttcca ggttcagatg acgcagtgtg     99060
     tagaacagca tcgccttttg gcaggtcagc acgtgtcgat ctgaagacat gccgtagtcg     99120
     cgcgctaccg cctcccgttg caagcggccc agtttcgggt ggggtaccag tacaacctcc     99180
     accagtgtgg tccatccaac gtcctcgcgc gggtccacgt ggctgtcgcc ttcctcaacg     99240
     atctgtatcc ccagacggcc gatcgcaaaa tcccgaaaga tcatgcgctc atggcaatac     99300
     gcccgaatat gccatctcag cccatcaaac cccagtgcgt gaggcgacaa gcgaacggcc     99360
     ttcgggccct cctcctccat cgactgatac gtgcagccca cgatgctgcg atcgcggcaa     99420
     gctcgcaccc agcgggcaac ctcgtccacg caaatcgacc gggacgggct ggacacaatc     99480
     ccggtagggg gcacataccc gacaaagcac tcgtctgcgg agatggcgcc ccgggccaag     99540
     ccgtacagct cgaacagata gtgcagcgca ctggaacgcc ccgaaacggt gacctgcccc     99600
     cactgagccg taccagctga agctataaag tccgtgaacc caagaggacg gacatgaaga     99660
     agagcagatt cagcaccgag cagatcatcg ggtttatcaa acaggccgac gcgggcatgg     99720
     ccgtggcaga gttgtgccgt cggcatggtt tcagcccggc cagcttttat cagtggcggg     99780
     ccaagtacgg ggggatggag gccgacgagg ccaagcggct gaaagaactg gaggtccaga     99840
     acactcgatt gaagaagttg ctggccgagg cgcacctgga catcgaagcg ctgaaggttg     99900
     gcttcggggt aaaacgctag ccccgcaacg caagcgcgag gcaatccgac gaatgctcga     99960
     acacaccccg ttgagcgagc gccgggcttg ccgccttgcg gggctgtccc gcgatgcttt    100020
     ccgccacgca cccgtgccga cgccagccac gcaggcgctg tcggcgcggc tggtcgagct    100080
     ggcccagacc caccgccgct tcggctatcg ccgactgcat gatttgttgc gcccggagtt    100140
     tccatccgtg aatcacaaaa agatttatcg cctgtacgag gaagccgagc tgaaggtgcg    100200
     caaacggcgc aaggccaagc gtccggtggg tgagcggcag aaactgctgg cgtcctccat    100260
     gccgaacgac acctggagca tggacttcgt gttcgatgcg ctggccaacg cacgccgcat    100320
     caagtgcctg accgtggtcg acgacttcac tcgcgagagc gtggacattg ccgtggatca    100380
     cggcatcagc ggggcttacg tagtgcgcct gctcgatcag gcggcgtgtt tccgtggcta    100440
     tccacgcgcg gtccgcaccg acaatggccc cgagttcacc agtcgcgcct tcattgcctg    100500
     gacgcagcaa catggcatcg agcacatcct gatcgagccg ggtgccccca cgcagaacgc    100560
     ctacatcgaa agcttcaacg gcaagttccg cgacgagtgc ctcaacgagc actggttcac    100620
     ctcgttggca caagcccggg acgtgatcgc agactggcga cgccactaca accagatcag    100680
     gccgcacagc agttgtggtc gcatcccgcc ggcacagttc gccgccaact accgtacaca    100740
     acaagccaac aacgcagtac ccttcaaccc cgggctttat cagtaatcac tggtacggac    100800
     gatgggggca ggtcatagac ccatgtcgat ctcctgcagt gactgtagga gcaagtttgg    100860
     ggggggggga gctttccgat tcgcttcgcc ttaccgaaat cctggctggg acgacgaagg    100920
     cactgacgcg gaggattccc gagccttcgc caagcggctg atcatttgcc tgcgggcatt    100980
     gcaccggctg cgatggcgtt ttcgagttcg ccaacggagt gcgctggccg cagccaattc    101040
     ggcgcgcacg ccttccagcg cttggacatc tttggtccag cgcgcctgca ggccttggtg    101100
     ctcggcggcc gccaggcgca gcgcgtcgcg ctcgcgctgc tgggcgtcgg cccgctggcg    101160
     tgtctgcgtc agttcccgct ccagccgggt atggcgttcc agccactggc cgttttcccg    101220
     gttgagctgc atcaggtcgt ggttcttggc ggtcagcgcc tcgttggcct gccgtagggc    101280
     aacctgcagt tcctgtacct ggtgctcgtg ccggcgttgt tcctgctcac gctggtcctt    101340
     gaccgaggtg cggtagtgct ccagggcttc cctggcgtgg tcgtgcttct gctccaggga    101400
     gcgggcgtgg ctttggtgct ccgccagtcg cgccgtgagg cccgcgatcc gctcctccaa    101460
     ctgagccagt tcggtggtgc ggcgggccac ctcgcccctg gcggcgtcgc ccgcctcgcg    101520
     ttctgcctgc agtacgaggg tcggcaggga ttgatacaaa aaacagccaa atcttgccca    101580
     accgcctgat aattgaagaa ttatcactcc ggcttccggc actgcgcatg ccgtctggtt    101640
     cgatgcgccc atcgccagcg ccgcgcgacg cctgaccgag ctggcccgcg cgcatgctgg    101700
     accgcgacct ccacgtctgg cggtttagcg ctggtctcgc gccattttat gaattgtgat    101760
     cgaggacgaa gtaacgcgtt gccgcagaag tagcacttct ctaacgcggc gattacttcc    101820
     gattttgtgc gccgcatatt tactaaaatt ttactgtaat ttaactatca aaccagaaga    101880
     aagaccatga gaaaatttaa atcgaagtac atgcttggcg cctgcatcgt tggaagcatc    101940
     gttagcgcgg gtgcagcggc gcaggtcgct gcaataaaca atactggccg tgccgaggct    102000
     atgtctgcat gggaaactac gctcaagcac gaggctccgg ctatggaggg ctgctttagc    102060
     tcgacatttc cggacatggg gtggcaggcg gtacgctgtg gcgcaccgcc gaagttggtc    102120
     atgaagccac gacacgttgc cagcggcaac gttcgtacca ccaccgacaa ccgtgtgctc    102180
     atcaccggca atggcgatga ctacgctgca cgcacgggca ggctcaccca ctcagccgtc    102240
     ggttcgttcc cgagcgtaag cggcgtgacc actggggtag tccaatactc gctgcaaatc    102300
     aataccgaca acgacagcaa ccccgccgct tgcgcgcagt tcggtttttc ttcgtgcaag    102360
     acctggcaac agtacgtcta ctccagcgac gccgacgaag actcaagtaa tggctttgac    102420
     ccggtcatct tcattgaaag ctgggtatat gcggacagta cctcggaata cgatgcggcg    102480
     ggttgcccgt ccggctggga tgcttacgaa ggcaacgctt gcgtgattaa cagcgaatcg    102540
     gtgcgagtgc ctctggtgcc agtttcgggc atcgctggtg tcaagctgac cggttctgcg    102600
     acctcggggg gcgtggatac cgtgtcgttt tcggtgaacg gaagggccta cagcgtgagt    102660
     cagcgcgcct ctacggtgga tatcaataag atctggcgcc tgaccgaatt caacatcttc    102720
     ggcaacggcg ccagaactca gacggtgtcg ttcaatcgcg gctcgcacgt cacggtaaac    102780
     gtagccgtaa acgatggtac gacaaatgcc ccgacttgcc tgggcaatgc cggccagacg    102840
     ttcgagcaga acaacctgac gcgcggtagt tgctccgtct ttggtggcgc ttcgcccggc    102900
     attagctttc ctcaaagcaa ctgactattt gcgtctgggg aggtttcgtc cttcccagac    102960
     gttacttgtt cgccaacggg gcgcggtggc cgcagctgcg ccaggagctg ttccagcgtg    103020
     ctcagacgta ccgtggcccg caaggtgtcc gcctcggcat gttcccggcg ctggcgctct    103080
     tcgatcagat cggtccgcac cgcagccaat tcggcgcgca cgccttccag cgcttggaca    103140
     tctttggtcc agcgcgcctg caggccttgg tgctcggcgg ccgccaggcg cagcgcgtcg    103200
     cgctcgcgct gctgggcgtc ggcccgctgg cgtgtctgcg tcagttcccg ctctagccgg    103260
     gtatggcgtt ccagccactg gccgttttcc cggttgagct gcatcaggtc gtggttcttg    103320
     gcggtcagcg cctcgttggc ctgccgtagg gcaacctgca gttcctgtac ctggtgctcg    103380
     tgccggcgtt gttcctgctc acgctggtcc ttgaccgagg tgcggtagtg ctccagggct    103440
     tccctggcgt ggtcgtgctt ctgctccagg gagcgggcgt ggctttggtg ctccgccagt    103500
     cgcgccgtga ggcccgcgat ccgctcctcc aactgagcca gttcggtagt gcggctggcc    103560
     acctcgcttc tggcggtggc gctcgcctcg cattcggcct gcagtacggt ctcgcagcgc    103620
     tgcagctgcg tcgtgagtga gtcagcctct tgccgggcct gctccagcgt ttgggtgcgc    103680
     tcctggagct gcgcctggaa gcgcgcctgg gcctgcgcca cgaccgtgtc ggcctcgccg    103740
     tgcaaccgct cggcgaggcg ggcgacgagg tcttggagtg cgtcgctcac ggccatcttc    103800
     gcgccaacgc cttgcccttc ctcctcttcc aactccctca gataacggtg aatggtggtc    103860
     ttggaaccgg tattgccgag cgccacccgg accgcatcga cagacggatt cttgcccgtt    103920
     gcgcgcaggc tatcgcgggc acgctgcaca tcgcttttgt acagcccaga ccgtgccatc    103980
     cgtcactcca cgtatttcgt aacgtattac ataccatgta attacgtacc attcaacacg    104040
     ttagataaac cggtggcggt gtcgagctca cgcgggataa tctagaatta tcccgcctga    104100
     taccggtttt tcggctaagc tcgcacgcgg gccgttacac cccagcccat cgggcgactg    104160
     gaggagccga tgatcagcgt tgggcagtac ctggaagccg ccacccgacc caacacccaa    104220
     cgcgcttacg ccgcggcgac ccgccatttc gaggtcgagt ggggtggtca tctgccggcg    104280
     accgcagagc aggtggcgcg ctacttggcc gcctacgccg ggcaactcgc gctaaacaca    104340
     ctcaggcacc ggctcgcagc actggcccag tgacaccagg cgcacggttt cgccgacccc    104400
     acgcgggcgc ccgtcgtacg caaggtgctc aagggcatcc aaacggtgca tccgagtcag    104460
     gaaaagcgag ccacgccact acagctcacg cagttgggtc aggtcgtgga ttggctcgat    104520
     ggcgccgcaa ctgcggccgg aacgcgtgac gatgcggccg gtcggctccg gcacctgcgc    104580
     gatcgcgcct ttgtactgct gggcttttgg cgcggtttcc gcggcgacga actggttcgc    104640
     ctccaggttc aggatttgga gttggtggcc ggcgaaggca tgacctgctt cctgccgcac    104700
     agcaagagcg atcgccagca cgccggcacc acctacaagg tcccggcact gtcgcgctgg    104760
     tgcccggtgg ctgccaccat gacctgggtc gcggcagccg ccctccacga ggggccactg    104820
     tttcgcgcag tcaaccagtg gggcgggatt gccgccgcgc cactccaccc caacagcctg    104880
     gtgccgctgc tacggcggat cttccgcgag gcggggctga gctctccaga cgactacagc    104940
     ggccactcgc tgcggcgcgg ctttgccggc tgggccaacg ccaacggctg ggacgtcaag    105000
     gcgctgatgg agtacgtcgg ctggcgcgac gtgcactcgg cgatgcgtta cctcgacggg    105060
     gccgatccgt tcgcccgccg gcgcatcgaa gccagtctgc cggaagcgcc cgcgctgcca    105120
     aggcctgcaa cgacctgagg ggctggatgg cgtcgatcga acggaccgca tacccgcagt    105180
     tcaagcgcaa cccggtcgtc cgcgaactgg ttgcggccta cacgccaacc gacgctgagg    105240
     tggccttcgt tgccgagtac acccggcagc ctgcgcaccg cctgacgctg acgatcctgc    105300
     tcaagacctt ccaacggctg gggtatttcc ccgtgctgga cgaagtcccg ccggcggtgg    105360
     tgcgccatat ccgcagcgcg ctgaaactgc gcgtgcaggt caagccagcg aatcttgcca    105420
     acgcctcgcg ctatcgctac taccgtcgga tccgtcaatt cctgcaggtc cgggcctaca    105480
     gcgacggcgg gctgaagatt gcggcgcgag cggtatacga agccgctgcg gtgatggata    105540
     acccggcgga cctgatcaat gtagccatcg aacagctcgt gcgtgatcgc gtcgagctgc    105600
     cggcgttctc cacactggat cgcctgaccc ggcgcatccg ctcgctggtc aacgggcact    105660
     atttcgccca gatcgaggct cgactgacca tcgacgaaaa acagcgcctg gaaggcctcc    105720
     tgcatgtcga acaggggcgt cagaagagcc cgttgcacgc gatcaagcgc ctacccaagc    105780
     gctcttcgct gcagcatttc caggagttga tcgaccatat cgccgaactg ggcgaattgg    105840
     tcggcagcga ggtgcacctg gcgggcatcc gggaggtcaa gcgcaagcac ttcgccgccg    105900
     aggcgcgggc attggatgct tccgagctgc gcaagtttcg gcccggcaag cgctacgcgg    105960
     tactggtgtg cttgatccac cgggcccggg tccagacgcg cgacgatctc gcggagatgt    106020
     tcatcaaacg catggggaac atccacaacc ggggccgaga ggaactggag cggctgaggg    106080
     cgcgctatcg cgagaagacc gaagcgatcg tggcgacgat gtcggatgtg gtccgcgtcc    106140
     tcgaccatca tcgcggcgac accgaggcgg ggcgtgaaat ccgccgcctg gtcaacgccc    106200
     atggtggcgt gcagacgttg caggccgact gcaacgccat tgcggcgcat agtggcgaca    106260
     atcacttgcc gctgctgtgg ccgttctata aaagtcaccg ctccaccatc ctgcggatgg    106320
     tgcgtaggct ggacttggcc tcgaccacgg aggaccgctc gctgatcgac gcgatcgagc    106380
     tgatcctgac gcaggaacga agccgcagcc attggttgga cgaagcggtc gatctggcat    106440
     tcaccaccca gctctggcgc aagaccatcg tccatcgcac cgaagtgggc ggcgaggagc    106500
     gcatccaccg gcgcctgttc gaggtctgcg tgttctcgtc gctggccaac gaactgaaat    106560
     cgggcgacgt ggctgtgcgc ggatcggaaa cctacgccga ctaccgcgaa cagttgctgc    106620
     cgtgggagca gtgcgagcct ctgttggagg attactgcaa gcaggtgggg ctgccggcca    106680
     cggccgtggg ctttgtcaat gccttgcaat cgcgcctgac gcaagtcgcc gagctgaccg    106740
     atcagggcta tctggagaac ggccaagtgg tcatcggcga ggatggcatt ccggtactca    106800
     agcgcagcaa ggccaaagag atgagctgcg gggcccgtgc cctggaaacc gccgtcctcg    106860
     accgcatgcg cgaacgcagc gtcatcgaga tcctgtgcga tgtggcccac tggacgcgct    106920
     ggccccgtca cttcggtcct ctgtccggct cggacgccaa gatcgagcaa ccgaccgagc    106980
     gctacgtcct caccgccttc acctatggtt gcaacctcgg accggcccag gctgcccgac    107040
     acctgcgtgg cgccgtctcg gcgcacatgc tgtcgttcgt caaccgccgg catgtggatg    107100
     ccaacaaact ggcggcggcc tgtcgggaca tcatcaacag ctacgccggc ctgcagctcc    107160
     ccaaatgctg gggcgatggc aagagcgcag ccgccgacgg caccaagtac gacctctacg    107220
     accagaatct gctcgcttcg taccacatcc gctatggcgg ctacggcggc atcgcctatc    107280
     accacgtgtc cgatacgtac gtcgcgctgt tcagccactt cattccgtgc ggtgtctggg    107340
     aggcggtcta catcattgat ggcctgctga agaacacctc cgacatccag cctgacaccg    107400
     tccacgccga cacgcagggg cagtcgctgc cggtgttcgg cctttcgcat ctgctgggca    107460
     tccagctgat gccgcgcatc cgcaactggt gcgaatacaa gttcttccgc cccgatgagg    107520
     acattcgtta cgaatacatc gatgcactgt tccgggacac tgtcgactgg gatctgatcg    107580
     agacccactg gaaggacctg atgcaggtcg tgctctcgat caagaccggc aagatcgcgg    107640
     cctcgacgct gatgcgcaag ctgggcaact acagccgcaa gaaccggctg taccaggcct    107700
     tcaaggcgct cggttcggcc gtgcgcaccc tgttcctgct gcagtacatc tccaaccgcg    107760
     aactgcgcga gcagatcacc gcctcgacga acaaggtgga ggcctacaac ggcttcgcga    107820
     agtatttctt cttcggcggg gaaggggtga tcgccgacaa cgaccccgtc gagcaggaga    107880
     aggccgtcca atacaacgac ctggtgtcca atgccgtcat cttctacaac gtggtcgaac    107940
     agacccgaat catgaagtct ctgatgcggc aggggtggaa gatcacgcgg gaagacgtgg    108000
     cgttcctcag cccgtacgtg accagccatg tgaagcgctt cggggattac ctgattgatg    108060
     tggaggaggt cccggaaccg tatgagactg aactggcatt ggcagggtag ttttggtgcg    108120
     ccaaaatatc cgctaactca ctgatgcaat ggatgaaatc cgatcttgtg agctattttt    108180
     acacgtatgt cggctgaacc cctatatagg caaaaactaa aggcaataac ctatcggttt    108240
     agggggggtc cgattctgcg tggcaaaggg gtccgattct gcgtgctttt cggtgtggga    108300
     ggggtccgat tctgcgtgac taggggggtc taattctgcg tggataactt gctgtatcca    108360
     ccgacttacc cacaatcgaa tcgagggggg tccgattctg cgtggcaaca gccaagggct    108420
     gtcgccagcg ctgcggagtg ctatgagcct ttgtagggta tcggcggggg cgaagccatc    108480
     agcatgattc cgcctgtcac ctgcttgacc ttcgcatcgg ggtagacggc aagcacgcgt    108540
     cggagtgagg gcaggaattt cttcttgaag tccttgtcgg cttccttgcc ctgatactcc    108600
     tgcccgaact gatcacgcaa atttgtccaa tacagcacga ccggccggcc ctcgatgcga    108660
     tgcaggcgct gggcaagcca cgcgtacacg tcaagatcga gcgccgagcc tttcagctcc    108720
     atgaaggcgc gcaggtcgag tggtacggcg tggtctttga gcgtcaggta gtagtcttgc    108780
     gaaaacgtca cggaaccggg ccaaagagcg cgctgcttct cttccagatt gatccatgct    108840
     tcgaagtgtt tgatgggctt gccctcgtaa gtgtgggcgc ggccgttcgc gttgaagccc    108900
     aaggtcatac ggcaggcgga caaggcttgt acctgcttgc ggaaattggt gaaggtgccc    108960
     cgttcgccgc ctgtgatgtt cttttgaccg agcatccgca gaaattcact cgcgctgtcg    109020
     cctaccggaa tctctggcga gttgaaccga acggcatagg tgttcatcca cgccaacatc    109080
     aggcgcggca tggccccgta ggggattggt tgttgcacga actgcttgcc gtcccataat    109140
     ttgccagctt caacaagtag cgctgcgccg cccgaatgcc gctcaaacga tgtgccgtcc    109200
     accttggatc gtggcaagcc gacttggcac atgatcgagt gcatataggc gcggtcgtcg    109260
     tcatccggac gttcgccggc aatctctgcg gccgttttga ttagacgttc ttcgcgcgcg    109320
     gtagctgtcg tagttttggg cttccgctca agcgcggccg gttctacgcg cttaagtttt    109380
     gccgccttag tgggctttgc cttgtctggc cgggagtctt ttagcggggg gactttggca    109440
     tccgtggctt gttctcccgg tgcggtcggc ggttcgacct ggaatagggg gcgcgtcgcg    109500
     gctaggtcgg tagggtagag gtcggcccga tagctaacct tggctgccaa atctgcggca    109560
     gattctggtg ggataccctt tgattcaagg tggtgccggt atccgtcacg ccattggagc    109620
     atttcggccg atgttggctg ggcggttagt tcgctgattt tcttcatttc aaacgtcctt    109680
     cctcgtctct gttcttacaa ccgcacggct gctacaattc cgaccgttaa gcccctcttg    109740
     atgaggggtt gaacattgga atttaatccc ggctccggcc gggatttttt attgggcgct    109800
     tgcggttgcg tttcgcagac gtggccacac ccctttgcta gaatgctttc agccctacgg    109860
     atgtgccaca tggtctgttt ccttgtacaa gttcgcacgg gttaggcggg gttgtagggc    109920
     ggctccttca acctcgccgc ttacatctat ctcttgccaa aatccttggg ttcgatgccc    109980
     ttggatgccg gcccttgaat ctcttttgct ccccattcct tcacgatgcc gacccggttg    110040
     tacgggtagc gaatctcgac gttagtgccg gcgttcagca gctcgcggcg gtcgctgttc    110100
     agtacaagtc gttcgtgctg gatgtgcagc tcgcggccgg cttccctgac tgactggatg    110160
     acgtgcttgt cgtcggccga cacaatcggg ccttggtagg tcttgccggt ctcgggtgcg    110220
     cgcagctctg gttgctgccg gccgtagtcc tggcgctcgt actcggccgg cttatgctcc    110280
     gggtattgct gccctccgta ttggcgcgct acgtcgcgca cgcgttcgat ctcgcgttcg    110340
     tcggctcggc gtgcggtcat catcgcaagg atcgttgccc attcggcctc ttgttgtcgg    110400
     cgttcctcgg gcgtaggcgg gcgctcgcgc tcggcctcga tggcggtctt tgctgccggc    110460
     tgccgtttcc attcgttgcc ctgcagctcg ttgtcgtaca gcacgttgcc cttacggtcg    110520
     tagacctgca cgcggtcagc cagtttgttg tgctcgatgt attcgagcgt cgccggcatc    110580
     cctttgtagg cgtcgtcatg agcctgcaca ttcgaccagc ggccgaagcc cttggccgcc    110640
     ttctgttctt catagcggcg gtggatgccg gccatgctgt cgcgttcgtt ggccgcgatt    110700
     acgcgggcga cgacgtaata gccggcttct ttgaggcgtc gcatcgtctc ggtgatagga    110760
     ccggcttcgc gcatcgtgcc ttcaaacacg acgttgcgac gtgtctcgat ggtgcggtcg    110820
     aatagctgct tggtccacgg ccgggcgtgc gggtcggtca gctcggcaaa ccggcgctcg    110880
     tcggccttct gaatgtctcg gtattgaggg tggtagtagc gcagctcgtc gccgttgatc    110940
     gtgacaacgt tgcgatctgc aaagccctgt ttgctggctt cgagcaaccc gcttttgcct    111000
     gcgccgggct ggccgcccaa gatgattgcc tgcggttggt cggccggcgc agtgtccttg    111060
     aagtgatgcc gctcgatttt ctcgtaagcg gccgtgtgct tgcgtgtgct cagttggaag    111120
     cgtttttcgt ccatgccgcg tcacccgtgc atcggtttga gcaggggtgc gtagacatac    111180
     aaggcccggt taatcaggct gagattgtcg ggcgtaatgg cgcggcgctc gtcaaccacg    111240
     atttctagct cgtgctctag cgcctcgatg cgaccagcgt tcggctcggc cttgtcctgc    111300
     tcggcgtcga tctcgctgtt caggtagccg atgtactcgg ccagtgtctc cgttgcggcc    111360
     tccaagcggg ctgttttagc aatcggtgaa aggggagtgt tcatggtctt tatcctcggt    111420
     gatgcacgtt agctgcgtgt ccaatcttcc acggtcaaac caacaacacg actaaatgcg    111480
     gcgtcattgg taacgaggac agaatccgtt tccagtgcat gtgctgcgat aagcatgtcg    111540
     agcgacccaa gcgctttacc ttgcttttct aggtccgctc ttacgcttcc gtaacgctcc    111600
     attaccgcgc catcccaagg cagcacatcc acgcgccgca ggagttccat gacggcttgc    111660
     tgaaggcgtt tggcgtctgg caccttagcc aagccgaaca tcagctcccc accggtaatt    111720
     gcggacatac atagcgcagt cataggcact tcaatgaccc gtcgagagac agccggatgg    111780
     ctcttgacga gatggctcac ggtgttggta tcaagcatgt accgcttcat tcgcgccatc    111840
     ccgcaaaagg atcacggtcc tgcgtgccct gattgcgctc ggcggcatct agaaaattag    111900
     caggcacatc tgcgctcttg agtgcgataa agaagtcctc ccacgttgca ggcttccgag    111960
     acaggatgac gtcaccggtc tccgggtctt ggcgaatgaa aacctctttc tcggtaaagc    112020
     gataggcggc aggcaagcgg actgcctggc tgcggccatt gatgaacagc ttggcaactt    112080
     ggctcacgat ttcctctctg ggtgaaggtt gggatatacc gtaggatatg ccaatgtttg    112140
     gtatatatca aggcgtatgc ctgtccgaca aacgatcatt aggcggtcat gccggacaat    112200
     gtccggcaat gcgcttgttt aatgggttgt cggacattat gatgggcgga cggaaagacg    112260
     gacaaaaggg gcggtaatgg tactgatcgg ctatgcgcgg gtatcgacgg cggaacagga    112320
     caccgctttg cagacggatg cgctacgcaa ggcaggctgc gcgcgcgttt ttgaggacac    112380
     ggcttctggg gccaaggccg acaggcccgg cttggctgat gcgctggcct acctgcgcgc    112440
     cggcgacgtg ctggccgtct ggcgtctgga tcggctcggg cgctcgatgc aacacctcat    112500
     cgagacaatc gccgcgctgg aagcgcgtgg cgtcggcttc cggtcgctga ccgaaagcat    112560
     cgacaccacc acgccgggcg gacggctcat cttccacgtc ttcggcgcac tgggccagtt    112620
     cgagcgcgac ttgatccgcg agcgcaccaa ggccgggctg accgctgccg ccgcacgcgg    112680
     gcggaagggc gggcgaaagc cggttgtcac ggccgacaag ttgcagcgag cgcgggagca    112740
     catcgccaac gggcttaatg cccgagaggc cgctacacgg ctcaaggtga gcaagacggc    112800
     tctatacgcc gcgctgcaat ccacaagtgc agccgactcc tgacattccg tgcagctgtc    112860
     ctctgagaat gacatcacgg gaattgactg ctggagcagg acttgccgag aagtaaggca    112920
     ggatcgccag ttggggatgg cgcagggtcc gccgtgaact caccagtgag ggtcggcagg    112980
     gattcgttta aaaaacagcc aaaagtgagc taactggctc tcagcaaagg tcttttacac    113040
     gaatccctgc cgaccctcca gaagggcgta aggacgtcgg tccgccgcta cgattgtggc    113100
     ggatacttct tctcttacgc ttctcctgca tttgtaacat gtaaaagctt ggaggaaata    113160
     aaaatactta tcccctctat gatttcttca accctaaaat ccaacaaact catttcacgg    113220
     atatgacttc ctgcttcatc tttatcgtaa gtgcaaagtg aaacaccttg acgcaacgat    113280
     cggctaatct cattagcgat aaattccctt tcttgtatgg tcaccgctga aaccctttca    113340
     agcgttgact tgctgtcaag tgcggtttgt gggccaagcc atgatagttg gcgctcgata    113400
     aaatcggcga ccattttact cttgtgccca tcatcatcta tctcttgtgc tatcgacaac    113460
     atctccaaat taaattcaat cagggtagcg accgccaagg cacgagattc accaactgct    113520
     atagctttag catcccacag ttcaagcttg gtgcaatatt cattatgccg caaagcactg    113580
     gcaggttttc ttgattgcaa tagcatctgg tgttcagcca attcttcaat agagtgaaca    113640
     aagtcggtgg agattctatc tggatcatgc cttataaagg gagtaagatt cctttcaatt    113700
     aaccccaact tttcggcatg gctaagcgac ccacatattt tttcgtagtc ggaattaaat    113760
     gcgttattgg atttgaaaga gtgcacgtcg ccgaaaccat ttcgagacgt tagatagtct    113820
     gattcactac ggcggctgct ttggccatat acgactgaag gaagacctct gtatttttgt    113880
     ttatccttcg cccttgggac ttcagatatc aggttcatcc gcacttcctt ttttacaagg    113940
     gaggcgggcg tcatgacaat gtcatgcagc gtggatttat tgcaaatcgt atcaacctct    114000
     cttttggctg gcgtttttcc ttccgcccca agcttactag tcacctcttg ggggtttgaa    114060
     aatcttagag atcgaatcat taaaggattt ccttctccat actcttcagc aatctttgga    114120
     tttcttttta ttagcaattc cttgactgaa aatccatcaa ttagctcttc gagttcgact    114180
     ctaccattta tcttagccaa ccctctctgc aactgcgcta aattctgaac taataccttc    114240
     ttttgatgaa ctcgctctaa cgatgaggtg tgcaaagcag ctatattttc ttttattact    114300
     ctttttctag gtgctttttt caaggcttgt gaatcgagcg atggcgccac cagtccagat    114360
     ttcgtataac tatcttgctg agtggcgacc tcctcttcac tgggtgttga atctattatt    114420
     tttgaagaga aattaacttt catgtcggac attagttcga tatttatatt aattgatatt    114480
     tatcgagaaa gccgccagcg catcgagcac aagtccgtca tagccgaaaa tgtacttgcg    114540
     atttatgcat tgtggtcgag ccattcggac cataacaatg gctggccctt tggattttgc    114600
     ttggcgtact cgtagaatag aggaaggaac tctgaccgtt cattacgaaa ttctgagcgc    114660
     cccttgtcag aaacgtcttt attattatcc aagcttcgcc ctggattaaa tttacgttgc    114720
     cgttcgatga tatcatcaaa cgataacatt gcagcatttc ttagtatgtc atgcatgaca    114780
     ataaatattg tcgtacggcc taggcccata ccacaatgta catgcagtct ctcatcatgg    114840
     gccatctccc gctccattgc aataaacgca tcaatatcgt ccgcccgtgg tgaaagatga    114900
     tctgtcactg tcaaacgtac atatttggcg cccgcagctc tcacaagctc ttcttcgcta    114960
     aaaatcagtg gcttacttaa cgtcgccccg cgtgggttgc gggcttcgct cttgacatct    115020
     ttgcgatgga agatatgtac cgtctcttgc gatttaagcg cttgaatcct ctgttgctcg    115080
     tctgccaagg cttcgtcacg tgatttgcca gcattgcccc agttgtttgg tgtacgccaa    115140
     gtacccggat aaccgccgac aatggcatgc gactcttcgc gagcatccag aacgaccact    115200
     gggcgctcct tggacggcct caacctagta atctgtccaa tggacgctat actgccgcta    115260
     cctgaaacgt gcaagttttt ccaaccagtc ggattgagac tttcggggag gtcaaattca    115320
     tccgaagagc gaaaattatc ggatgatcct agatccctgt cgtaagctag aacaggatgt    115380
     gacgtgggtg gtggcgggag aggcaaaggg tctctgaatt tctggattac ctgataaagt    115440
     gctgtttttg accgaggtgg ttgccggctt ggtagatcgg cgagttctgc gggaaccgct    115500
     tgatgaacgt gttttgatac aacttcctct ttaatattct cagcgcagtc ggcactcttc    115560
     atcgcgtcgc tgctggccga tggtgcaatt gagccggaga ttttgttcgg cattttcagg    115620
     cgcctatata tggattagaa ctcctaattt taattgtcgc gctaactagt tttatatcgt    115680
     gatcggaagt tatgtcgtca atcgcgatat cgaagcctgc ctggcgccgg atctgtgaaa    115740
     tgcctgccgt gcagcagatc ggtagtctga tcttggtttc gccacacaca acgcgaacat    115800
     cccggtgttc ggcgatgccg agtggattgg cgtgttcacg gctgccgaga acgggggtgt    115860
     aagccggaac cccagaaaat tccgtccatc atttccaccc gccatcgcat tcgtcccagt    115920
     acaaaccgtt ggcctcgttc ttgacgctga tgtcgtcgac cacgcaattg cgtagatcgg    115980
     ccagatgaca gatctcgtgt aacaacccgt cgagtcgttc tttcagatcg gcatcgttgg    116040
     cgtatcgaat caccaatcgg tattccgcat cgttgagctt ggtgctgtcg tagaaacggg    116100
     tgaccaggct gccgacgtct tcgcgtaccc gcttcttccc tcgggtgaac ttgctcccgt    116160
     tctcgacatg gagccagaga atcacggtta cggagagcga cgctggcgta ctcgccaatg    116220
     cgggcgctct ggtggtacgc ccagcgaacc tgacggcttt gctgatggtg ctgcggctac    116280
     accctaccgt tttctgcacc acgccccacg aacaacttgg ccttgcacac atcaatcccg    116340
     atgccattca tgggtaaact ccgttaggct tgaagaggtc gagagctccc ctgcctgccc    116400
     agccttacgt ctacgcgtgg caacactggc aactgttcgg gcgatacggg ggagaaaccg    116460
     gcgtgggcac ccagctacac gacgatcggt aacgatccag gctctcacgg tggcccacgc    116520
     cggctctcga cgcccagact gccagattcc gaacagataa ggctcaccga agtcatggct    116580
     gggacggtaa tccccccgcc gattagcaga cgccagaagt ggaattttct cgtacccttt    116640
     cccgaggagg ttccatgaag aagtcccgct ttaccgacag ccagatcatc gccgtgctca    116700
     agcaggccca ggccggtgcg cccgtgccgg agctgtgccg cgagcacggc atcagctcgg    116760
     ccacgttcta caagtggcgc ggcaagttcg gcggcatgga cgtgtccatg gtcgcgcgca    116820
     tgaaggagct ggaggaggag aaccgccggc tcaagaagat gtacgccgag gcgcagctca    116880
     gtaccgacct gctgaaggaa gcgctcgcaa aaaaatggtg aggccatctc agcgacgcga    116940
     gatggcccaa tcggcagtca cgagcgggcg cacgaacatc cgccacgcct gccagacctt    117000
     cgcggtgagc gagacctgct tccgttacca ggccaaggcc agcgaggaaa acgcccgcat    117060
     cgccgactgg ctggtccgcc tgacgagcgc ccatcgcgac tggggctttg gcctgtgcta    117120
     cctgtacctg cgcaacgtga aaggctttgg ttggaaccac aagcggatct accggatcta    117180
     ccgcgagttg gagttgaacc tgcggatcaa gccgaagaag cggctggtgc gtgagcggcc    117240
     cgagcctctg gcggtgccgg aggccatcaa ccaggtctgg tcgatggact tcatgcacga    117300
     ccagttggcc gacggccgca gcttccggct gttcaatgtg ctcgacgact tcaatcgcga    117360
     ggggctgggg atcgaggtgg atctgtcgct gccgtcagcc cgggtgatcc gatcgctgga    117420
     gcagatcatc gagtggcgcg gcaagcccgc cgtgatccgc tgcgacaacg gccctgaata    117480
     catcagtggc gcgttgctgt cctgggcgca gcggcatggc atccgggtcg agcacatcca    117540
     gccgggcaag ccacagcaga acgcctacgt tgaacgctac aaccgcacca tccgctacgc    117600
     ctggctcgcc cgaaccctgt tcgacaccat cgaccaggtg caggacaaag ccacccgctg    117660
     gctatggacg tacaaggggt tcggggagca atggaacagg gaagtcagtt aagccttcac    117720
     cagtgccggt ctgtaccttc catgcgggcg tggctctctg agaaacagtg gcggtcatcc    117780
     gcaccgcagg cgatgtcggt tagcaaatcg ttcacggctt catccagctc ttcatccgtg    117840
     tcatagggca ccttcagttc atattccccg ttcggccgcc gcgtggcatc gtattgggca    117900
     agatcaaaaa actcgacatg ctcgatcgag cgcttctttc cgcgcacgaa cttgctattg    117960
     ttctcgatgc gcaaggtcag caggatggtg gcgaccttcg gctggtcagc gtttccgctc    118020
     tcgaccacgg agacgtttat cggcgactgc gccgattgtt tgtacgggcc gatctctacg    118080
     ccgcgatgcc gcaggtagct gtacagcgtg ctcttggaca agtgcagttt ctgcgcaatg    118140
     gcagcgaccg acagcttgcg ctcgcggtat agggtctcgg ccgccagcgc tgtcgcttcg    118200
     gcctgcggcg acaggccctt gggtcgccca ccgaccctgc cacgcgcccg cgcggccgtc    118260
     agcccggcct gggtgcgctc gcgaattagc tcgcgctcga actcggccag cgtggcgaac    118320
     aggttgaaca cgaaccgccc ttgggcgctg gtggtgtcga tggggtcatt caggctgagc    118380
     agcccgacct tgcgttccat caggctaccc accaactcaa ccaggtgctt gagtgagcgt    118440
     cccatgcggt cgagtttcca gatcaccagc acgtcgccgc cacgcaactg gcccagcagt    118500
     tcatcgagcg ctgggcgcgc ggtcttcgcg ccgctcgcaa cgtcctgata aatgcgctcg    118560
     cagccggccg ccttgaggga gtccacctgc aaggctgggt tctgttcgcg cgtggatacg    118620
     cgcgcatagc cgattttcat cgtaatattt tgctttactc gttaagtttt aataatatca    118680
     aactttgatt gtacaaacca ctattacaga ctgcttgttg gcttacggac acctcgcgcc    118740
     gatcgcccca tcagagttca taaaaacgat cgttttattg aaccgttgca aaaaaaaacc    118800
     gcttaaagag tgtataaaca ccgatgtgca taaactctga ttggagagag cttcatgaat    118860
     accgtgcgct ggaacatcgc cgtatcgccg gacgtggatc agtccgtccg catgttcatc    118920
     gccgcgcaag gcggcggtcg caagggcgac ctgtcacgct tcatcgagga tgcggtgcgc    118980
     gcctacctct tcgagcgggc tgtggaacaa gccaaagccg ctacggtggg tatgggtgag    119040
     acagaactga acgacctcat tgatgaggcg gtgcaatggg cgcgtgagca ttaatgcggg    119100
     tcgtcctcga caccaacgta ttgctggccg cgctgatctc gtcgcacagc ccacccgaca    119160
     tcatctatcg cggttggctt gcagcacgct ttgaactggt gacagggacg gcgcagcttg    119220
     atgaactgcg ccgcgtgagc cgttacccga agatcaaggc aatcctgccc gcgcatcgcg    119280
     tcggcacgat gatcaacaac atgcagcgcg ccgttgtgct gcatgtattg ccgcctctgc    119340
     ctgatcgcat cgaggtcaat gatccgaacg atgcgttcct gctggcgatg gcactggcca    119400
     gcgaggccga ttaccttgtg actggcgacc gccgcgctgg gctgctgcaa cgcggtagca    119460
     ttggccgcac gcgcatcgtc acgccagtca ccttctgcgc cgaggcgctt tgacgccatg    119520
     ccggtcagct tcctgtccac cacacaacgg gaacgctacg gccgctatcc agacacgctt    119580
     tccagcgaag agctggcgcg ctatttccac ctggacgacg atgaccgcga gtggatcgcc    119640
     accaagcgac gcgacagcag tcgcctcggt tatgcgctgc aactgaccac ggcgcggttt    119700
     ctcggcacct ttctggaaga ccctaccgcc gtgccaagcc cggtgctgca tacgctgtcg    119760
     tcgcaacttg gcatcgccga cccttccgat tgcgtcattg actaccggac aactcggcag    119820
     cgctggcagc acacgagcga gattcgcacc cgctatggct accgcgagtt cacgggtacc    119880
     ggcgtccagt tccgccttgg ccgctggttg tgcgcgttgt gctggacggg cactgaccgc    119940
     ccgagtgcgc tgttcgacta cgccaacggc tggctggtcg gccacaaggt gctgctaccc    120000
     ggcgtcacct tgctggagcg ctttatcgcc gagatacgct cacgcatgga gtcgcgtctg    120060
     tggcgactac tggtgcacgg cgtgacaccc gagcagcgac aacgcctcga tgacttgctc    120120
     aagcttgtcg aaggcagccg gcagtcttgg ctggatcgat tgcgcaaggg gccggtacgc    120180
     gtcagcgctc cggcgctcgt tgcggccttg ctgcgaatcg aaaccgtgcg tggcttgggc    120240
     attaagctgc caggcaccca tgtgccgccg agccgcatcg cagcgctggc ccgcttcgcc    120300
     agtactgcca aggtatccgc cgtggctcga ttgccggagg tgcgacgcat cgccacgcta    120360
     gtggccttcg tccactgcct ggaagccagc gcgcaagacg atgccatcga tgtgctcgac    120420
     ctgctgctgc gcgagctgtt caccaaggct gagaaagaag atcgtaaggt caggcagcgc    120480
     tccctcaagg atctggatcg ggccgcctcg acgctggccg aggcatgccg gatgctgctc    120540
     gatccggccc tgccggacgg cgaactgcgc gagcgcgtct atgccgccat cggccacgat    120600
     gaactggccc aggcgctcaa tgaagtgcgc ggtctggtgc gcccgcccaa cgatgtgttc    120660
     tacaccgaac tggaagcccg caaggccacc gtctcgcgct tcctgccggc gttgctgcgc    120720
     gtcatccgct ttgacgccaa tccggccgcg caacctttgg cgcaggcgtt gcaatggctg    120780
     catgagaagc ccgaccatga tccgcccacg gccatcgtcg gcaaggcgtg gcaacgccat    120840
     gtcgttcagg atgatggccg catcaatgcc acagcctatt cgttctgcgc gctcgacaag    120900
     ctgcgcagtg cgattcgccg ccgcgacgtg ttcatcagcc cgagttggcg ctacgccgat    120960
     ccacgcgccg ggctgctggc cggagctgaa tgggaggcct cgcggcctat cgtctgccgc    121020
     tcgctgagcc tgtcggcgca gcccgaggcc acgttgtccg agctgacgcg cgagctggac    121080
     gaaacctacc gccgcgtcgc cgcgcgcctg ccccagaacg acgcagtgcg cttcgagaac    121140
     gttggcgaca agacggaact ggtgctcagt ccgcttgaag cattggagga gccgccttca    121200
     ttgatcgcgc tgcgcaacga aatcaaggcg cgcatgccgc gcgtcgatct tccggaaatc    121260
     ctgctggaag tcgccggtcg tactggctgc atggaagcgt tcacgcacct gactgaacgc    121320
     accgcgcgcg cggccgacct gaccaccagc ctgtgcgcgg tgctgatggc cgaagcctgc    121380
     aacaccggcc cggaaccact ggtgcggcca gacactccgg cgctcaagcg cgaccggctg    121440
     atgtgggtcg atcagaacta tgtgcgtgac gacacgctga cagcctgcaa tgccgtgctg    121500
     gtggccgcgc aaagtcgtat cgcactggcg cgaacctggg gaggtggcga tgtggcttcg    121560
     gccgacggca tgcgattcgt ggtgccggtg cgcacgatcc acgctggacc gaacccaaag    121620
     tatttcaatc gcgggcgcgg cgtcacttgg tacaacttgc tttccgatca gcgcaccgga    121680
     ctgaacgcga tcactgtgcc tggcacgctg cgcgacagtt tgattttgct agcggttgtg    121740
     ctggagcagc aaacggagtt gcagccgacc cagatcatga ccgacaccgg cgcgtacagc    121800
     gatttggtgt tcggtttgtt ccgcctctcc aactatcgat tctgcccgcg cctggccgat    121860
     gttggcggta cccgtttctg gcgcgtcgat cccgacgccg actatggcga cctcaatgcg    121920
     ctggcccggc agcgtgtgaa tctcgaccgt atcaccccgc attgggatga tgtgctgcgt    121980
     ctggtcggct cgctcaagct cggtctggtt ccggcgatgg gcatcatgcg caccttacag    122040
     gtcgatgaac ggcccaccag cctggcgcaa gccatcgccg aaatcggccg tatcgacaag    122100
     accatccaca cgttgaattt catcgacgac gaagcccgcc gtcgcgccac gctgctgcaa    122160
     ctgaatctcg gtgaaggccg ccacagcctg gcgcgcgagg ttttccacgg caagcgcggc    122220
     gagctgttcc agcgctaccg cgaagggcag gaagaccagt tgagcgcgct cggcctggtc    122280
     gtgaacatga tcgtgctttg gaacacgctg tacatggatg cggtgctgac gcagttgcgc    122340
     agcgaaggct accccgtgaa gccagaagac gaggcacggc tgtcgccgtt cggccacgag    122400
     cacatcaaca tgctcggacg ctattcgttc tcggtgccgg aagctgtcgc gcgcggcgag    122460
     ctgagaccgt tgaccaaacc gaatgatcct taaaaacctt ggaaattcac catgcaacaa    122520
     atgacgcaac aaccgttgaa cgatgcccag cttgatcggc tgggcgactt tctcgaagga    122580
     gtcggcgcac ctgcaatgaa tctcgaaatg ctcgatgggt tctttgccgc actcatttgt    122640
     ggtccagaaa cggttttgcc cagcgaatac ttgccacaag tattcgggga agaccattgc    122700
     ttcgacagca atgaccaagc cgccgaaatt cttggcttgg tcatgcggca ctggaacacg    122760
     attgcatcag aattgttccg cactctggag aaagacgatg tctaccttcc cgtgctactc    122820
     gaagatgcgg atggggccgt acacggtaac gactgggcac gtggtttcat gcgcggcatt    122880
     caattacggc ccaatagttg gcaagagttg atcggcagcg aagaatttgg cgggcccatg    122940
     ctgccaatca tgatcttgac ccatgaacat gatcctgatc ccgccatgcg cccgccagag    123000
     attgcgccgg acaaacgcga tgagttgctt cagtccctga ttgccggact gacgcacatc    123060
     tatcgctact ttgcctcaca tcgccaattg gcaacccaag ggcctttacg cagacaaggt    123120
     cctaagattg ggagaaatga tcagtgccca tgtggcagtg ggcggaagta caagcattgc    123180
     tgtgctacca gcgctccgac atttcattga taccggctta actgacttcc ctgttccatt    123240
     gctccccgaa ccccgaagcc gccacccgac ccaacaccga acgcgcttac gccgcggcga    123300
     cccgccattt cgagatcgag tggggtggtc atctgccgac gaccgcagag caggtggcgc    123360
     gctacttggc cgcctacgcc gggcaactcg cgctcaacac actcaggcac cggctcgcag    123420
     cactggccca gtggcaccag gcgcacggtt tcgccgaccc cacgcgggcg cccgtcgtac    123480
     gcaaggtgct caagggcatc caaacggtgc atccgagtca ggaaaagcga gccacgccac    123540
     tgcagctcac gcagttaggt caggtcgtgg attggctcga tggcgccgca actgcggccg    123600
     gaacgcgtga cgatgcggca ggtcggctcc ggcacatgcg cgatcgcgcc tttgtactgc    123660
     tgggcttttg gcgcggcttc cgcggcgacg aactggttcg cctccaggtt caggatttgg    123720
     agttggtggc cggcgaaggc atgacctgct tcctgccgca cagcaagagc gatcgccagc    123780
     acgccggcac cacctacaag gtcccggcgc tgtcgcgctg gtgcccggtt gccgccacca    123840
     tggcctgggt cgcggcagcc gccctccacg aggggccact gtttcgcgcg gtcaaccagt    123900
     ggggtgggat tgccgccgcg ccgctccacc ctaacagcct ggtgcgcctg ctacggcgga    123960
     tcttccgcga ggccgggctg agctctccca acgactacag cggccactcg ctgcggcgcg    124020
     gcttcgccgg ctgggccaac gccaacggct gggacgtcaa ggcgctgatg gagtacgtcg    124080
     gctggcgaga cgtgcagtcg gcgatgcgct acatcgacgg ggccgatccg ttcgcccgcc    124140
     agcgcatcga agccagtctg ccggaagcgc ctgcgctgcc aaggcctgca acgacctgag    124200
     gggctggatg gcgtcgatcg aacggaccgc atacccgcag ttcaagcgca acccggtcgt    124260
     ccgcgaactg gttgcggcct acacgccaac cgacgctgag gtggccttcg ttgccgagta    124320
     cacccggcag cctgcgcacc gcctgacgct gacgatcctg ctcaagacct tccaacggct    124380
     ggggtatttc cccgtgttgg acgaagtccc gccggcggtg atgcgccata tccgcagcgc    124440
     gctgaaactg cgcgtgcagg tcaagccagc gaatcttgcc aacgcctcgc gctatcgcta    124500
     ctaccgtcgg atccgtcaat tcctgcaggt ccgggcctac agcgacggcg ggctgaagat    124560
     tgcggcacgc gcggtatacg aagccgctgc ggtgatggat aacccggcgg acctgatcaa    124620
     cgtggccatc gaacagctcg tgcgtgatcg cgtcgagctg ccggcgttct ccacactgga    124680
     tcgcctgacc cggcgcatcc gcacgctggt caacgggcgc tatttcgctc agatcgaggc    124740
     tcgactgacc atcgatgaaa aacagcgcct ggaaggcctc ctgcaggtcg aacaggggcg    124800
     tcagaagagc ccgctgcacg cgatcaagcg cctacccaag cgctcttcgc tacagcattt    124860
     ccaggagttg atcgaccata tcgccgaact ggacgaattg gtcggcagcg agttgcacct    124920
     ggcgggcatc ccggaggtca agctcaagca cttcgctgcc gaggcgcggg cattggatgc    124980
     ttccgagctg cgcaagtttc ggcccgccag gcgctacgcc gtactggtgt gcttgatcca    125040
     ccgggcccgg gtccagacgc gcgacgatct cgcggaaatg ttcatcaagc gcatggggaa    125100
     catccacaac cggggccgag aggaactgga gcggctgagg gcgcgctatc gcgagaagac    125160
     cgaaacgatc gtggcgacga tgtcggatgt ggtccgcgtc ctcgaccatc atcgcggcga    125220
     caccgaggcg gggcgtgaaa tccgccgcct ggtcaacgcc catggtggcg tgcagacgtt    125280
     gcaggccgac tgcaacgcca ttgcggcgca tagtggcgac aatcacttgc cgctgctgtg    125340
     gccgttctac aaaagtcacc gctccaccat cctgcggatg gtgcgtaggc tggacttggc    125400
     ctcgaccacg gaggaccgct cgctgatcga cgcgatcgag ctgatcctga cgcaggaacg    125460
     aacccgcagc gattggttgg acgaagcggt cgatctggcg ttcaccaccc agctttggcg    125520
     caagaccatc gtccatcgca ccgaacgagg cgaggagcgc atccaccggc gtctgttcga    125580
     ggtttgtgtg ttctcatcgc tggccaacga actgaaatcg ggcgacgtgg ctgtgcgcgg    125640
     atcggaaacc tacgccgact accgcgaaca gttgctgccg tgggagcagt gcgagcctct    125700
     gttggaggat tactgcaagc acgtggtgct gccggccacg gccgtgggct tcgtcaatgc    125760
     cttgcaatcg cgcctgacgc aagtcgccga gctgaccgat cagggctatc tggagaacgg    125820
     ccaagtggtc atcggcgagg atggcattcc ggtactcaag cgcagcaagg ccaaggagat    125880
     gagctgcggg gcccgtgccc tggaaaccgc cgtcctcgac cgcatgcccg aacgcagcgt    125940
     catcgagatc ctgtgcgatg tggcccactg gacgcgctgg ccccggcact tcggtcctct    126000
     gtccggctcg gacgccaaga tcgagcaacc gaccgagcgc tacgtcctca ccgccttcac    126060
     ctatggttgc aacctcggac cggcccaggc tgcccgacac ctgcgtggcg ccgtctcggc    126120
     acacatgctg tcgttcgtca accgccggca tgtggatgcc aacaaactgg cggcggcctg    126180
     tcgggacatc atcaacagct acgccggcct gcagctcccc aaatgctggg gcgatggcaa    126240
     gagcgcagcc gccgacggca ccaagtacga cctctacgac cagaatctgc tcgcctcgta    126300
     ccacatccgc tatggcggct acggcggcat cgcctaccac cacgtgtccg atacgtacgt    126360
     cgcgctgttc agccacttca ttccgtgcgg tgtctgggag gcggtctaca tcatcgatgg    126420
     cctgctgaag aacacctccg acatccaacc tgacaccgtc cacgccgaca cgcaggggca    126480
     gtcgctgccg gtgttcggcc tttcgcatct gctgggcatc cagctgatgc cgcgcatccg    126540
     caactggcgc gaatacaagt tcttccgccc cgatgaggac attcgttacg aacacatcga    126600
     tgcgctgttc cgggacactg ttgactggga tctgatcgag acccactgga aagacctgat    126660
     gcaggtcgtg ctctcgatca agaccggcaa gatcgcggcc tcgacgctga tgcgcaagct    126720
     gggcaactac agccgcaaga accggctgta ccaggccttc aaggcgctcg gttcagccct    126780
     gcgcaccttg ttcctgctgc agtacatctc caaccgcgag ttgcgcgaac agatcaccgc    126840
     ctcgaccaac aaggtggagg cctacaacgg cttcgcaaag tatttcttct tcggcgggga    126900
     aggggtgatt gccgacaacg accccgtcga gcaggagaaa gccgtcaagt acaacgacct    126960
     ggtttccaat gccgtcatct tctacaacgt ggtcgaacag acccggatca tgaagtctct    127020
     gatgcggcag gggtggaaga tcacacggga ggacgtggct ttcctcagcc cgtacgtgac    127080
     cagccatgtg aagcgcttcg gggattacct gattgatgtg gaggcagtcc ccgagccgta    127140
     tgagactgaa ctggcattgg tcgtgtagtt ttgttgcgtc aaaatatccg ctaactcact    127200
     gatgcaatgg atgaaatcca atcttgtgag ctatttttac acgtatgtcg gctcaacccc    127260
     attctacggg ctttttcggc ccttgtgcaa tgagattaca ccgcgtatta cgtatcacat    127320
     cacaaaatga gcaacgtcgt acaattacac ttgtcggacg ccattcaggt atgcgagcat    127380
     gacgcatcgc ccggctgtgg ctgtgcgtcg gtgatttaga aggtcggtat gctgggcccg    127440
     cagtccgcgg gtcgccgcgc taggagcaag tcgatgggca cgaacgccgc gatcgagaag    127500
     acacaacagc cgccgttgcg gcaggcgacg gtgctggtgc ccgccgccaa gatgcctgaa    127560
     ttcaccaagc ggcttgaagc actcaataaa aaagcggcca agttcgggct cgatgccctc    127620
     accgtcgaac tggcgcacgt cacgccttat ctgcagcagc gccgggtgca cggcgcaggc    127680
     gaagaagtga cgctggtccc gtggaccacc agcgcgccgc tgccagccga cgcggtgggc    127740
     ctgatcgaca tgcacagcct gctcctgcgc tttccactgg tcaagctggg cgactggcac    127800
     gttgtcgccc agctcgatgc cacgcctgcg gccggcgcgc tggtgtttgc ggtgacggac    127860
     gtggcggacg atcgcaccga ggcggcacgc cgccgtgacc accccatgca ctgtgagcat    127920
     tgccacacgg cccgggcacg caagcagatc tacctgctcc gcaacaccaa caccggggcg    127980
     tatcagcaag tgggcagcac atgcctgcag gacttcactg ggatcgaccc ggcccgggcg    128040
     ctcttcctgg ccaagctggc cgacttccag cgctacgccg atgccctggg cgaccaggcc    128100
     gccgcagggg cggccggggc agttgctacc ttggactatc tggcgcgcgt cgtgttcctg    128160
     tgcgagtcca gcagcttcat ccccgtcagc aaagcacggg aactccgcat tgacgccacc    128220
     tacctgcaag cgaccgagct ctccgacgcg catcgacgca atccggccgc tggccgcgcc    128280
     ttcgccgcgg cgcgggaacg tctgcaggcc gaggctgccg cggtggtcgc ctggtttgcc    128340
     ggacgcgagc ctacggacgc gtttgaagcc aacgtcaaag cggtgctggc cagcgacacc    128400
     atcaaggcag atgcccgcca cctggcgacc gccgccgcgg ccgtgccgac ctaccagcgg    128460
     caccagagcg cggcgcagct gctgctgcgg gcagctcgct cggcgcacgt ggccaccgaa    128520
     ggcgacaagt tggagcggcc cctacgtgtc taccaggtcg cgacgatcga ctcacacttc    128580
     gggccgcagg aacgtgtgag cctggtggat gacgacggca actgcttcac ttggcgcacg    128640
     gctgccgcgc caggggagct cttgaggccc agcaaccgcg agcgccgctt tgatgccggc    128700
     ttcaagatca agaagcacat cacttcccag ggcaccgcaa tcaccgagat ctcccacgtc    128760
     cgcgtcaagc gctggctgcc ctagcaccat ctgtgcgcca atcgggcgac acgcgcaggt    128820
     tgcgtgcgcc cgcgacgatg gtggatggcc accgctacca tagaccgtgt ggctcaacac    128880
     gccggagcat gggttgacag actccaggca agtatcaaga cgacggagca atgcagtgaa    128940
     aatgagcggc gcagagtaca aggcctggca gtcatccgag tggggtagcg cctggtggga    129000
     ggagtacgag atgttgatca acggcgtcgt cgtggatgac atcgcccttg atgaggtcaa    129060
     ggatgccgac aagatcgtca tcaatggagg cgtggtcttt gctgatgaga acgaccgcgc    129120
     tggctgttct gcgacgtcgc acttcaacag atggaagaaa gcccaaacca cgcaattcgt    129180
     cagcgtccag gtcagcaacg atgacgtgca ggcactacaa gaattgctag cgcaattcgg    129240
     tcaaggccgc acgaatttca aggtcacgct cggcagctaa ccgaagtgac ctctgtccag    129300
     gtaccaatct actttgcgag aactacacaa atgcctacag ccggtcttga aaggggcacc    129360
     gagcaccctc aacgagcgag agccaccgaa agcagtccga attccatcac cccaccgctc    129420
     aaaccggtaa cggccatcta catcgacacc gggctcgtct acaggcttgt agaagcagtg    129480
     gtgagcacgc cttttggcat ccatcgtggc gctgatgggc atagctactg tttgtcgcat    129540
     atcgccaccg gttaccggat cggcagcggc ttcgcatcgc tcgatcaagt cctcgctctg    129600
     tgcgaagact tgcgccggat gaagatcacc tgggacttca cggaaaaggc ggtgatcgca    129660
     gggtggtcat actatgcgcg caacaaaatc ctaagcctca tcaccaaaca cggcggaacg    129720
     accgggagca cgacgcgatg acccataatg aggccattac ggcgccagag acatcaccgc    129780
     agctggtgag catcccgccc caggtaattc aggctgcagc gatcgcatcc gccggcggcg    129840
     cagcagagtg gaacctactg agcgccagag ctcaacaaga agcacatgcc gactgcgagg    129900
     tgatcatccg caccgccgtc agcgcactgc ggcaagcagg tgtggcatcg gatggaagcg    129960
     atgcgtctac gatcacgacc atccgcagac tccgcgctgc attggagttg attgctacgc    130020
     aagggccgca cttcggtcac gatggcacgc aagaaacatg gatgcattgg gcagatattg    130080
     cccgaaaagc actgaccgat caggctgccg gttacaaaca cctatccccg cagcccgacc    130140
     aaataccaac catctctcaa caacgagaac cctcatactg gaccgagacc ttgctagcaa    130200
     gcgcggagaa actgcgtgtc cgcattggtg gacagccgga tggcgatgcc gatgatctgg    130260
     agcggctagc tgcagcgatc cgcgcgccga atggctacat cgtgaaggtt gggggtgcgg    130320
     cctatcgcta cgacctgtgc gcttctaccg ccgcctacgc ccgtgaggct gctctggcaa    130380
     cggggctgga accggaagat tttaccgtcg agccattcct ggtgatccac ccatgagcaa    130440
     gctgatcgcg cccctatgac ccccacctcc agcaggatcc aacgcgttcg ccaggccggc    130500
     agcgagcatc aggtggtaac ggtccaaagc ccaaaacagg ccagtgcacg ctactgcaag    130560
     cgcccatgcc ctgattgccc ctggcgggtc gacgcggtag gcaagtggcc agcagaagcg    130620
     tttcgtgcat ctgctgagac ggcgtatgac atggcaacgc acacgttcgc gtgccactct    130680
     gccggcgcca ccaacccgcg gctatgcgca gggttccttc tgcgaggcgc agaccataac    130740
     ttgagcgtcc gccttgagcg catgcacggt cgtgtgggca gcgatgtcga agacggcggg    130800
     cagatccttt acccatccta cgtcgccatg gccgtcgcca atggggtacc gagcaatgat    130860
     ccagcactac aggcatgccg cgaaagctac ttcgaggcac agcaagttga ttcgggtgaa    130920
     caatgaccac tgctcctgag gtctctgatt ttgctgtgaa ccaaccggtg ctcggaaagc    130980
     tcaccgaacg cgccctagcc cgcttccaaa aggctatcga ccgacgaaaa aagcgttatc    131040
     tcgacttcga caagttccgg gatcatgccg cagcgcgtat ccgagcgctt gcctccgaga    131100
     acgaacaaat agcgtacttc ctgtcctatg gattctacgt gctcgaaggc gggaagacag    131160
     ctggctggga tgatagtgtt gttaaagtcc aattcggcag ccgcccctat ctcactgcgt    131220
     atagtgagcc tcagttggtc tatggcgaaa tgtcaaagag cctgcgtgta ttcactgagc    131280
     agggcgcatc actattgtat caacgtggcg acgatggcca tgtcatgtgt ctcctctacc    131340
     ctgcctcatc ggagcgagag ccaaaaacgg tttctatggt ggtgctcaag gtcgttaacg    131400
     atccttccaa tcttctcaac gatcgactgc tccgtagcca cctgaaaacc cttgctgcct    131460
     acatggctgt gaccagctta gatggctctc cgaccatgct gcagaggtgc cggtactggt    131520
     ggctacacct gacaaagcag cgcacgatcg gcggcgtcgt acgaccacgt cagatacagg    131580
     tgattgctgg caaactgctg ctctgggtag caaccgtcgc cttcagcggt atcgctcttt    131640
     ttttgattca gcgcaggtgg cctgaaaagg atgccgtcac cccagccgtc ctgcaggcca    131700
     gccaggcagc gcagcgcagc gcaagagtga agcgcagctc cgagtgctgg aacagatccg    131760
     agacacaatg gcggcatctg ctccaacccg ggcgacgcca tcggcgccag tgaaagtacc    131820
     ctctccggcc gcgccagctc aaaatggaaa ataaattctc cgcttaccct accctgtccc    131880
     cgggggaaag cgtggcgacg cgctacaagc aggttgagcc aagtgcactc tgagtttgac    131940
     ccttggcacc ctagctccgc ggcaatagcg cgggtgaaaa acgccctaac cgcgccaacg    132000
     cgccacgatt gcggcggcat cgtggagatc cgcagccatc gcgaagtctt tgggcgcaac    132060
     tacggcaatt ggccatgggt ctatttctgc acgcactgcc gggcccgcgt tgggatgcac    132120
     ccgttcaccg acatcccgct cggcacgctg gccgatgagc cgacacgcaa tgcgcgcacg    132180
     gcagcgaaaa cgctgttcga gcagctctgg aggcgtgccg acagtccact gagtcggtct    132240
     gcggcttatg cctggctggc caaccagctc agcctcccga tgagtgcatg tcactttggc    132300
     ctgttcgaca tcgctacttg cgaacgagca cgtctagctt gccggcagta tcttgagccc    132360
     tgatatcggg aattcattgc ttctatgaca cgcccccccg cccctcggcc gacaaacgaa    132420
     cacactaagc gtgttcgagc aaggtctccc tatctggtca caccgcaggc gagagagctg    132480
     cagaacgcac tacaggcgct cgctgcccct ccagaaggtc cactcgtcct ggcggacatc    132540
     ccggtcgtcg tcctgggcgt gcgtttcgat ctgagcccag aacagatcga gcgcgccacg    132600
     gcagtcctgc aggaccttta caaacacgac atcaagccgt acgcagacaa cagccgaaag    132660
     gcgatccgat cagactggcg acactgggtg gcgttctgcg ctcaaggcga tcgcgtctgc    132720
     atgcccgtgc agctcgatga cctggtcgag ttcttgaaca gcctgatcgc ggcaggctac    132780
     aagcgcgcga cgctggagca tttgctcttc acgctcaagc tggccagccg cctgtggagt    132840
     tgcacctgtc ccactgaaac actgcaattc cgttggtatt ggcaacaaca atgccgcgaa    132900
     cagctcacgg ctcgaaatca ccaggcgccc gcactgaatg ttgagaccgt cgacaatatc    132960
     gttgaagctc cgaccagggc gtcaggactt gccgggctgc tcgaacttcg cgacatggtc    133020
     tatgtatcaa tgtcctacga tctgctcggg cgcgcatccg aaatggtgcg cttgcggtgg    133080
     agcgatgttc gcttcgatgc ggatgtcgac ggcggagcca catgcaccat cgcccgctca    133140
     aagacagatc agcaaggcgc tggcgtcgcg ctttacctat cgccgcgttc ggcccacctc    133200
     ttggacacgt ggcagacgca gcggttgctg gcggcggact atctatggcc agctgcgcgc    133260
     cttgagtact tgcacaatcc ctacgtcttt catcggctgc ctcgacacaa acttttcaag    133320
     cctggtccga ctgcagacgc caagcggctg cgctgggatg cgcatctgaa cgtgcgtgaa    133380
     gctgatcgaa tcatcaaacg tgctgccggc gatcagttct cagctcactc ggcgcgcgtc    133440
     ggggctgcac aggatatgac gcgagccggt atggaccttc cagccatcat gcagcaggga    133500
     cggtggaaca cgccaaccat gcccgcgcgc tacgcagaga acgagctcgc tacccgcgcc    133560
     gggaaaaatc gccaaaccgc gctggcaaaa ctcaagaaca gctgagcacc atatcctgct    133620
     cgtgcggctc tcaagagatg caaatcgctg aaacatattt ccaggagcaa agatgctgac    133680
     caacgaaggc acacaccagc tagtcgagga gtcggggctc tttgacgcac gtaccgcgct    133740
     caacacgctc acccggcttg aatacaatgg acttccggtc cttgcgagct acgacctcac    133800
     gactacaaag ttgcgagtga cctggaacgt acctgcacag tgccggatcc aggttcccga    133860
     gcccatggta ggtgagacct tggccgcgct tcgttatctg agcggcatag cactccgtag    133920
     gtcatttacg aaagggatct ggagaaccac cgtcgttatt gccagctggc aattgacgga    133980
     tgtggacgag gacgacgaca ctgagcaaga cctaagccag acgcaagcga cgttgcacct    134040
     ggcacttcct ttcggttccc agatttgagg cacgacggtg actcatcggc gccacgcgat    134100
     aaaggagcat gcggatgggc ggaaatgcat tgaagacggt tgcaactcac cgattatcgg    134160
     ccgcgagcta ccgtcagctg gctgcgcagg tcatggacac gctgcaaagc gaaagcggct    134220
     tccgcgttga gctcgtgcgc agcttcggcg ccaaagccga tttcggtgat atggatgtga    134280
     tcgccgatcg cagcacgctg ccggcggacg tggcagcgct gatgcgccac ctattcaatc    134340
     cacacgaggt ggtgagcaac ggcaatgtcc tgagcttcga tgtagccgcg ttccaggttg    134400
     atctggtgtg tgtgcccgcc agcgaatacg acaccgcccg cgactacttc gcgttcaacg    134460
     atctgggcaa cctcatgggc cgtaccgctc acagaatggg attcacgtat ggccataacg    134520
     ggctgcgcta caaggtccgg gacggcgact acctcgtggc cgatcttaca gttacatccg    134580
     agatgccagc agctttcgcg ttcctcggct atgactatcg ccgcttcgat caaggcttcc    134640
     ataccctgga agaggtattc gccttcgctg ccagctctgc ccacttcaat cctgccgcct    134700
     atccactgga atcccgtggg caccgcgacc gcgttcgtga ccaaaagcgg cagaactatc    134760
     gcctctttct tgaatggcta cagacggctg gtgtagccgc aggagcatca gcagacctgc    134820
     agcgcgaaca ccacctacag cgggcactga agcaattccc tgctttcgcg gaggcacttt    134880
     cgcaatccca ggaagcgctt gccggagcac gtcgtcgcaa gcaactattc aatggccaga    134940
     tcgtggcgga gctcaccggc cttgagggcc gagagctcgg gcagctcatg cgtgagctac    135000
     acgatgcata tccgggtggc cgtgcggcat ttgtgtcctg gcttgatcag ttgcaagatc    135060
     acgatctaac gccgctacat gcgtacatcg agcaggttgc cgctgatctc gacctgcaag    135120
     aatcaaagtg tcatccgtag gccaaaacgc cactctgtaa cgtgtgcact gaaaaaccgg    135180
     gtcaagcgca tgtgcaaagt ttggcaattt caaatcaatt gacaccacct gagcgaggaa    135240
     cattatgtcg accgaaccac gcccgcttga tcccgaaaaa ctactcgatg tactcaagtc    135300
     gattgatcga tcactcttcc aacttgcggc cgctgcccgg cttccacatg tctacactga    135360
     tacacagaca gattccctta aagaagaact tggcagattg aagtatgccg ataaaaccgc    135420
     ctatgaggac ctcacagagg ctagtaacga ggtatctaaa gacggtctta cttacgacca    135480
     gcgcgtgagt aagttgggag agcctgaggc ggagcggatc tacgcaccgg tgagacgagc    135540
     gagtcaagtg agaagggaca gttctgtggc attggccaag ttccgtgaag aacacccgtt    135600
     aatttccgct ttggtggatg gcactaaatc gtaatcaatg acgccgttac cgcagaccat    135660
     tgtccaatca cacatgctcg atatcttctg tcccttggca gaagatatcg ggaaccttgc    135720
     cgactgggcc gcggtagcag tcgctttgtt cggtgcgatc gcagtctttc aattgagcag    135780
     ggctgcgaac gctacggctc gtggtgtcaa gagggtcgca gagcgagaag cacgcgatcg    135840
     ccgtgcggca gctgcacgcg agggacggct gcttctgatc tatctcgaaa atgaattccg    135900
     gcaagccctc acggcattcg gtacgctggc tacgggtctt gatgtggttg accatgacag    135960
     cttcatcgac agcggttacg cacgcgcaca gttcctatca gaagccgatg gcatttcgct    136020
     aaagctcagc cgcgagatgt ttcaccgctt gcacgtgctc gtcgataaag atgcacatga    136080
     cattgcgcga gtcgtaagtg gcttgtcagt gttacagcag gcagcagcgg aagcggctag    136140
     catcgatctg tcagagacca tgcctggagt agatggcgcg agctggaatg agtttaggcg    136200
     agagaccttg tccgagcggt ttgtgttgct tcgcaaagga gcggcagaga tgcaggtgat    136260
     cctaattcga ctcatccagg aggcggttgc tgccaaagtc gtcgcaggag cgcaacatca    136320
     cacgcttgag aacaacgcac gaggcccttc gaccgcgggc taaccagcga taaaacacga    136380
     cagattgtgg cgcagcgctc gaacccgcta tcgaggcagc gaacctgctt gggcaccaag    136440
     tcggatatgc gccaaccagc gattccctag atcgaggagg ggacgctcaa caaacctgta    136500
     cgtcagcagc gccaccacgc agcatgcgat gaacgatgac gcaagaaaca aagcattcat    136560
     cgtgatggtc ccggtaggag ccaccgctat ccaaagccga ccgctgagcg agagcacgaa    136620
     cacatgtgtt aggtacagcg agtaggacgc gtcacccaac gctgcggccc aacggctcac    136680
     tggccaccaa cccgcgagct ccaagcgcgc agctgctgcc agcgtcaacg cgcatggaat    136740
     cgcaaacgcc agtgttcgca caccatgcgt ctgtccgaaa tcagagcgat ttagcaaggt    136800
     ccacgcagcc agaagcgcca gcgcaaccgc tgcgcaaagc acaacaacac cttgtctggg    136860
     gctcaggctc ttccagagaa tcgccgctgc ggcgcccgct atgaactcaa acgccaacgg    136920
     actagtgacc aactgcgccc aaggtccttg gacaggcacc cactgcagta atgccagcgc    136980
     caccgcccaa ccgcacaaca tgaacgggat gttgcgctca gagccgaagg caagcgccat    137040
     cgcagtcatg aggtaaaaga acagctcaaa ggtgagagtc caacccacta caagtagcgg    137100
     tccgccctcc tgaggaagca gaaataacga gcggattaag cttcgatcga gcagagctgg    137160
     atccagcaga ccaggcctga cagacagcac gagggcgatg gcgccggtgc acaaccagta    137220
     gagagggaag atgcgaatga agcgcttcgc caagaagtct aacgcccccc tccgatcgcc    137280
     gaacttgccg gagctcacca tcaccatgat gaagccggag atggcgaaaa acatgtccac    137340
     acccgcaaat ccaagatggg caagcccgcc caggatttgt aaccctccac cgtacacaac    137400
     ctcagcgttg atcaggtggt agacgacgac cgctgctgcg gcaagagcgc gcagagcttg    137460
     aagcgattgc agcggacgcg gtttgcttac ttccatgcac agttgtctta gtcagcgtag    137520
     tggcaaatta tccctgaatc caccgccgag ttggaacgcc acagtcactt ttgtgtggaa    137580
     cgcagctgtg gatgttgctt cgcaaacgtg ttggacaacc cgtggaccgg tgtggacggc    137640
     ctaagcccga ccacgcccgg cccaccggtt gcccacactc acccacagca gggcaacaga    137700
     gcaccgccac gttgctctga agaggtctgt acaaggcaat cagcaagata gcgagcggcg    137760
     caccatggag gtacgcgcct agacggtctt acaatcagac cggtgcagcc gccaacggca    137820
     atccaacctg tgcgcggtgg ctgcacactt gcacttgcat ttccgcacga atgcgagcag    137880
     caacttcttc gcgatgaacc ggcaccgcac gcggcgccac gatgtccagc tttacctggc    137940
     catcagagat tccatgcaca gtgatggtca catgttctct gaccattaag tgcgcgccca    138000
     ctcggaggtc gtatgtgccg ggctcatgcg cgccgaggcc agcgatggta agcgtcgctc    138060
     ggcctcgacg gatcttcatg acggtcacgg aaatagtatc cgcgatcaca atggattcgc    138120
     gttctttccg agttaggatc agcatcgaca gcctcttgga tgcggcattg ttggccgcca    138180
     catatggcag cttatagcct gtgtttttat cctaacgaat gtggccgcaa tacggcaaga    138240
     gtcagaccca acccatcttg ggctgcgtca cgtttcggct cccttgtgca cgctcgatac    138300
     cagaatgcag tcgtgctcgc tcgcctgcct cgtagcctgc gccaacatcg cctaccgcag    138360
     tctctatctc taggagtccg cgcggctcta cgcgggggcg agcgtccaca actgctagcc    138420
     aggcctgcag ctttctgagc gcgtcatcct tgttcattcg agccgattgc cgttcttgga    138480
     gtcgagaaag cggcgcttca actcatcagc ggcggtgaac tgcacagcca cgcgttcgcc    138540
     tacttggacc gtctcgcccg tcttaggatt ccgggcctgt cgtggtggtt tgtgctggag    138600
     ccggaagcgc ccgaaccggt tgatgttcac acggccatgc tccagcagca tgagcgctac    138660
     cacttctgtc actgtatcta cgatggaact ggcttctgcc tgggtcatcg cgtgacggtg    138720
     cgcgatcgcg gatgcaagag cgcttttgtt catatatccg gactcctggt tacaccccct    138780
     gtggccccgt tatatgccgc aagtgcccgt tatgcaagct gaaaagacct ttccagccat    138840
     gatcaatgga ccttttttaa aaagatttcc taacgtttgt tgcggcacct gtgattatcg    138900
     cgtattgtcc gctccgtcca ccaccaccat cggagaacgc aatgccccgc aagtctgaat    138960
     gtcgggtcga ctgcatgggt ttcgtcgcca acgagccgca gctgcgccag gccaacggca    139020
     cgccggtagt caacctggtc gtcatcgaga acgagtactg gaaggatgcc gaaggcacgc    139080
     gcaaggagcg ttcccacgca cactccatcg cgttctgggg tccgtacgcc gagaccgtca    139140
     gcaagctcgt acagaagggc tcctacgtcc gcgtgaaggg caacctgcgc tacaagccga    139200
     tcgaaggcca gcagtacgac aaggccgccg aaatccgcgg tgatgatttc tccctgctgg    139260
     acgatccgcg cgagcgcgac gaatcccccg actgatcgtt ccccccttct gcccctctcc    139320
     gcatcccccg gagacgcagt gcgcccggcg ggcatcccca ctcgccgggc gctttttttt    139380
     tgaggtcgtg atggtcactg cgctgaatgc tctccccgtt gcgcttgtgg actctgaagc    139440
     ccatgcgatc tgggtgcata tccgggggcg cgcggcggta aagaaatccg gccagggcgc    139500
     cgcattccgc cgcgtggtgc gcgccgacta tgcaggccgc ctgcgcctcc attccaacag    139560
     cccttggcgt ccattctgtc ccgccgcagg cgatgaccag gccattgaag taagcctgat    139620
     ccgcgtcgga aggattctcg ataagaccga gttcgacggg ccagagtggg atcggctgca    139680
     gaagcatgga ctggatgcgt tcctgatcga ggcgatcgcc acccggtcct tccgcggcgc    139740
     catgcggcgc atctttggaa gcacctgaca tggcccgtcc gcgcgccaag cacctcaagc    139800
     agggtcaggt atgggtagcc aagaccgcca ccggccgttc aaggatgcgc cgcgtcgttg    139860
     cgctggtgga tgacagggtt tgttactcga ctggctcgga catcgtccat tggtgcaacc    139920
     gtcgcgcctt ccagctctgg atcgccacgc atggggcaat tcgatcccgg tctgtcgcaa    139980
     atcgcaaact catcttggac ccaggccccc gaacatgagc cgagaagccc tgctgtccca    140040
     atacatgacc cctgactggg cggccgccct ctgcttggag cggtttctgc cagatctggg    140100
     tccagatgac ctggtcttcg agcccacctg cggccgtggg gcctttctgc gcgcggtacc    140160
     actccacgtg ccggcggtgg gcatggaagt tgacccaacg cttgctgcct atgcagctgc    140220
     aaccaccggc cgcgcggtac tggtgggtga cgtgttacgg gatccactgc ccagcggaat    140280
     caccgcaata gttggcaatc cgccattccg cgtcagcttc gtcaaccagc tgctggcaag    140340
     agcccatggg ctcctgcctg aacatggccg tgtgggcatg ctgctgccct acttcatctt    140400
     ccagaccgcg tcgaatctcg aagcgatcgc gcgtgactgg tcaattgaac agaccatgct    140460
     gccgcgcaac ctgtacccgc gccttcgtca tccgctctgc ttcgctgtcc tgaccaagga    140520
     ccaccacaag cgcctcgtgg gcttcgcact gtttcatgaa ctggctgccg tcaaccggct    140580
     gcagcggcgc tacaagcagc tgctgcagga gggcgtcggc tctgtctgga ccgccgtagt    140640
     gcaggccgcc ttggagcagc tgggaggcac agccacgctg gccgagatct acagggaagt    140700
     cgagggccac cgcccgacaa cgaatgcctg gtggcaggcg aaggtccgcc aagtcctcca    140760
     gcgctctttc agacgtgtcg ccccgggtac gtgggccatt ccaacacctc atcacgcggc    140820
     agttgccgca taacaaggag ctgcatccat gcgcgatatt ctgcttgcca cctgcctcat    140880
     tctcggtgcc gcagcggcac cagcacatgc aagcgagaac atctcgctgc atgtaaaggt    140940
     cacaaacggc agcaaggtgc ttgtcgatac caacttgctc accacgcccg gcgcgccggc    141000
     gcaggcgcgc gtgggcagcg acatcaggta cgtgagctcg acaacggtct acagccgcgg    141060
     caaacgcagt tccctgggcg gcaagaaagg aacgccggtg gaccggccgc cggccgagcg    141120
     tacctacgcc acactgttcg acggcgtcga catcaccgtg tacccggagc cgctggccga    141180
     agctgtcggt tcgcctgaca aggtgctcct gcgcacgcgc gtgtccctca gccgcctcaa    141240
     tggaatggag cacaccggcg aaggcgatgc gcgtattgac ctgccttccg tgcagaattt    141300
     ccgcacgcaa tccaacactg tcgtcgcctg gggctccccc caggtcatct cctacaagtc    141360
     tgcaggcgat gaagcggccg atgactaccg catcgaagtg actcccagca ccgccaaggc    141420
     ccgctgacgg agagcacacc atggctgata ccggcgccca actcgacctg tttcagatgg    141480
     accacgtgct gcaggcctac gaaggcggca gcgtggtgga caacaatgag ctctacgagc    141540
     acgtacgggc tgcggccggc gtcagccaac aggtaatgga ggcgcgtcaa ccgatcggcg    141600
     ccagcgggca gcatcacagc gttgcaaagc gacgcgtacg ctggatgcag cagaccgctc    141660
     ggcgcctcgg gcttcttgag cgggttccgg agcgccgcgg cgcctggcgg ctgactgaag    141720
     agggcaagcg ccgcactggc aaggcggcgc ccggcgttgc cttgctcgcg ttctcgaccg    141780
     accttggcct tgcgatatgg ggtagctggg aatcggtatt ccctcgcctc gacgagaaga    141840
     tagttctctg cctaacgagc ccgccatatc cgctacgaaa accgcgggcg tatggcaatc    141900
     cgccaatcca tctctacgtt gacttcatcg tcaaggcgct agagccgatc gtccgaaatc    141960
     tggccgacgg cggctccatc gcgctcaatc tgtccaacga catcttcgag gccggacttc    142020
     cctcgcgtga gctgtacctg gaacggctga cgctcgcgct atgcgatacc taccgcctcc    142080
     acaagatgga caccctgatt tggtcgaacc cgagcaagcc gcccggcccg gtgcgctggg    142140
     ccagcatgac gcgtcagcag ttgaacgtgt cctgggaacc gatcctctgg ttgacgaaca    142200
     atccgcgtaa ctgcgtcagc gacaaccgtc gaatccttga gccgcacagc gatcggcacc    142260
     aacgtctcat ggcacgcgga ggtgagcatc gcgaggccgt caactccgac ggcgcctatc    142320
     ggattcacca gggcagttat ggcaggccaa ccgatgggcg tatcgcgcgc aacgtgctca    142380
     tgcacgggca ccgctgcgcg gaggctcagg cctgtaacca cttcgcggcc gagcagggtc    142440
     tcgcgcccca cggcgcccca atgccgctgg cgctggccga caaactcgtg cgctttctta    142500
     gccgccccga tgacctggtc gccgatccgt tcggcggccg cctcaccaca gggaaggcgg    142560
     ccgaacagaa cggtcgcagg tggatctgca ccgagctgat cgccgaccac ctgcattcag    142620
     cccttccacg ctttccgcag gcagtgcctg gcccctcttt ctaactcgga ccaacttcaa    142680
     tggcattctt ccgcaatctc acgctcttcc gctttcctac cgcgaccgat ttcagcgaag    142740
     tcgaccagct cctaccggcc gtggtcctca agccggtcgg accactggag atgaattcgc    142800
     gcgggttcat gtctcccttc ggtcgcgagc aacaggtaac tctgtcccat aggttgggtg    142860
     atttcctgtg gctcaccgtt gggggcgaag acaagatcct gccggctgcc gtcgtgaacg    142920
     atgcgctggc ccgcaagatc tcagaaatcg aagcgaaaga aggccgcaag ccgggtgggc    142980
     gtgagcgcaa gcgcatcaaa gacgacctga tccacgaact gctgccgcgt gcctttgtga    143040
     aatcgtctcg taccgatgcg gtcctggacc tgcgcaatgg gtatatcgcc gttgacacct    143100
     ccagtcgcaa gactgcagaa agcgtgatgt cccagatccg tggcttgctg ggttcgttcc    143160
     cagcgatgcc gctgaacgcg gaagtggcgc cgcgcggcgt gctgaccgga tggatcgccg    143220
     gcgaaccgct ccctgaggga ctgagcctgg gcgaggaatg cgagatgaag gatccggtcg    143280
     agggtggcgc gacggtccgc tgcagcgcgc aggagctgcg cagcgacgag atcgaccggc    143340
     acctggacgc cggcaagcag gtaaccaaac tcgccatggt gctggacgac catctttcgt    143400
     tcgtggctgg cgacgacctg gtcatccgca agctgaagtt tctggatggc gccctcgacc    143460
     agctggaaga ggcagaccag gaaggcctga gagcggagtt cgacgcccgc tttgccctga    143520
     tgagcggtga gctccgccgg ctgttctcgt tgctcgaaac cgccttcaag ctcagcgcgg    143580
     cggaggcatg agatgagcgc tctcgcacgg ctcttggata tcccacgcgc ggcgccgccg    143640
     cacgacttgg aacacacgct cgcactactc gacgatatgc gccggcagat cgacgcactg    143700
     ggcgatatca gccgcaacta cggccagctc aaccacaagc tcaagcaacg caagctccag    143760
     gacatccacc tcaaactacg tgacatgcgt gacgacctcg cgcagcgcgt tgtgccctct    143820
     atcaaggaga cctgatatgc gtatcgccgt atggcccacc ggtgactggt gtgaggtcaa    143880
     ggagtctgcg gagttcagcc aacagaacgc attgggtgac gacttcgctg tctacacggc    143940
     tgcaaccgtt gccaccgctg aacgcattgc agccaacgtc gaagctggcc gccctcccct    144000
     cgctgcatag ggcaaccatg aatcgcctcg cacttcccct tcttctcacc ctctcgctgg    144060
     ccgcctgcgg cgacgactcg acgccgaacg cgagctctgg ccttgatttg gcgcaagcag    144120
     ctgtcagcaa gcttgcgccg cacgcgaagg tgaccggcgt cgaacgcgca gcagtgcccg    144180
     gcctgctgca ggtcacggtc gacggatccc aggtcatcta catctcggag aacgggcaac    144240
     acctgctggc cgggcagatc attgaattgg cttcgaaaga caacctgacc gagcgcgcga    144300
     caagcgcctt gcacagaaag atgctggccg agctgccgcc ggagcgcaag atcgtttacg    144360
     cggccgagga tcccaagcac accgtgaccg tgttcacgga cgttgactgc ggatactgcc    144420
     ggatgctcca cgagcacatc cccgactaca acaaggccgg catcagcatc gagtacgtgc    144480
     tgtatccacg cagcggcctg caatcaccga cgtatgcaac ctccgtcagc gtctggtgcg    144540
     cgcaggatcg caagcaggcc ctcatcgcgg tctcaaccgg gggcgaactt acgccagcgc    144600
     aatgcaccaa tcccgtggcc gaggactatg cccttggaca acgcttgggt gtgacggcga    144660
     cgccggccat cttcgccgag gacggccgtc aggtcggcgg cctcttgccg ccggcgcagc    144720
     tgctggccgt actcgacggc cgggcccagc gaggtccgac acagccatga tgcgcaagac    144780
     gtggcggctg ctccgattgg cggcaacccg gcagatcagc tggtacagct ttcggtgcgg    144840
     cttgcggccg acgcaaatcg ccgttgcgct ggtgggcggc ggtatggtgt tttgcgaccc    144900
     cgccgtggag gcactgttct tcgaggtgga tgacagccat gacgcatagt ccacggtccg    144960
     ccgaagaaga ccgactgacc acgatcgcgc cggccatagt gatcgcgctc tcgattggag    145020
     ctggcagcct cttgggcatt ggcttcggcc cccgccttct tgccgccatc gcggtgtaca    145080
     cggccatggc cgctctctct gcattgaccg gcacctggat gatcgttgag cggcctcgtg    145140
     acagcgccca gcctccgggc gaatagatgg cgctggtgcc aaaacatggc gccccaccat    145200
     tggggcgcct ccgaagtttc agctcatcct ttgccgtgcg ctgtcgagaa ctccagccat    145260
     gcgcgttcca atgcttccaa cacgtgatca ccatgcctgg ccaagtagcg ctcaatttct    145320
     tggcggctgc ttgcgccgac ggggaatgtc ttgtcagcgc gcacatccac cgccaggtcc    145380
     gacacaatgt catcacgatc cacctgggcc agtagccagc gatggaacgc tgatcgtgat    145440
     tgctgatagg ccaagttgag ggccacggcc tttgctgcca gcaaattggg ggcatcctct    145500
     ggtcggcggt accggctccg ccacactgtg ccgcgctcgc tccagcgctc gatcgactct    145560
     aggtatcgca tctcgtggga ctgccctcga tgcaaggcgt cattctcgaa atgatcaggg    145620
     aggcagaacg aatcacatcg cgcgcagtaa taggtggagg gatcctcctc gtcctggtcg    145680
     ccatgcaggt agtaacggat ggccgctcgc cttatagctt ctttggtggc cagctctggt    145740
     cgaccaccag gcgcgacgca tgccttcgac aatagcgacc agtttgcgaa cccatgcgca    145800
     gtagcagacc tgtctagggc ctctgcgtgc gtaatagatg tttcgcgcac aagcttctta    145860
     gcttgacgct tgatgcgggt gatctgtgcc ggagaaagac tgttggccat gactcaatct    145920
     cagcggtcgc tgcaaggtcg atgcgtccac acaccaagcc agcggcgacc tctggaggtc    145980
     aaggcgggtc ttgtaagagc cacacgctgt cgattcgact tcgccttgtg gacgggcggg    146040
     cccgcgctag ggccgcagcc agcttacatc gggtcagcct cctgtgccaa cgccgcaaca    146100
     gcgtcaccag cctgttccaa taaatggaat gtcagcgact aaatggaact cccctggact    146160
     tacgatcctc tgccgacctt cgcaactggc tctacaccat agtttgtccg cacatgcacc    146220
     actatggtgt tcgccctact atggtagtcg ccccatcatc ttattgattc atatacaatt    146280
     gtcccgtaga aggccagatg ccaaaaaaca ggacaattgc atgaaattca atatgatagt    146340
     cgatgagggc cttcggctgg cggccaacat ggagacccgc tacgacgcct ggctgcaggc    146400
     ctcccgcgcc attgcagatg gccgtctgca gtggaagacc tccggcgggc atgactacct    146460
     ataccgaatc atcgatagca agggcaatgg tacctcgctg ggaccgcgaa gccctgccac    146520
     cgaagcaatg atggagtcgt tccagaacgc caagctaacg gttcagaaca cgtgggccac    146580
     cttggagcga gagggcaaga tgtaccgctc cctgcgcctc cctcgcattg catcctatgg    146640
     cgcccaggtt ctgcgagagc tggacatcag cggcttgctc ggtgactcgg tactggtcgt    146700
     tggcacaaat gctctttgtg cgtacgctct cgaagctggc cagctgctga gctccacgct    146760
     cgatgcgaca gaggacttcg acctgacctg ggtacgcgac gtaagcaacg cgccgccggc    146820
     attgcaggcc ccttcggtat ttggcgtgct gaagagcgtc gacagcacct acaccatcaa    146880
     taccgagcgc ccgttccagg cacgcaactc ccacggcaac gaagtggagc tgcttatcgc    146940
     tgaatctctg gcgggcctgc cgacctacga gcggctccgg ccgattccgc tgccagagca    147000
     gaactggctc ttgccgggta cgcgtatcag ccacatcacg tgcggcatgg acggcctgcc    147060
     ggcgcgagtt gtcgcgcctg atccacgctg gtttgcgctc cacaagctgt ggctcgccga    147120
     caaggagtcg cgcaacgtgc tcaagaaggg gaaggaccgg gagcagggtg acactgtgtt    147180
     gcacctggtc aatgaccata tgccgcactt ccctctcgat gacgcgtttg aggactcgct    147240
     gccggacgag ctccgcccgt actttgaaga ctggaagcag gagaacgggc taacgccgcc    147300
     aggcatgcgc tagcacgacc tagcggcgcc gctgtcaaag ctgccgttgc gccgccagct    147360
     ccaccacttc aacgccgtta tcccgccagc tgttgattgc agcacgcacc tctccgagca    147420
     cgcgccggac atctgcatcc gtagcagaat ttcggccaca gaagaactcg cgaaactcca    147480
     ctaatgtcat ccaagcggat acgatgatgc ggcctgcctc atcctcgcta atgcaatgca    147540
     tatcggcttc ccattgcgca cgccacgcac tatccatggc ggccgtcaga agcgctcggg    147600
     cgtcagcgcc tgacaggtgc aaagcgtcga ccgcatcaac cccttgcagc atgccgtcgc    147660
     cgctcaggcg gtactgcatc ggccacaacc ggcagcctgc atcagcatcc atatcgtcaa    147720
     agctcgccat ccctatgcca ccttcgcata ctggagaatt gccgcgtact ccgggtctcg    147780
     ctccgaaatt tcggaggcat cttccggatc attggatggg gcgtccatgt tcaaaatggc    147840
     ggttgttgga tcctcaagca gatcattttc gatcgccgcc ttatgctgga tcagtgccat    147900
     cgcttgctca tcaattgtgc cggcgaacag gggcaccagc accgtgacga ctcgcttctg    147960
     tccgtagcgc catgcgcgat cttccgcctg ctttttgagc gcattcgtcc acggcagcga    148020
     ggcaaagcaa acgatgtttg ccgcggtcaa cgtgtggcca acgccggcag ccttcgtggt    148080
     gccgatgaag caccgaaccg taggctcgct ctggaatcga tcaatcgcct gctgcttacg    148140
     ggccttggaa tgcttgccaa ggaacgtcac cacctcaatg cctgctttgg cgaactcctc    148200
     ggccaggtac tccaccgtgt cttggaactc gcacatgatc agcgccttgt cggaaggctc    148260
     aaatccggcg attgtctcga tcagccaatc agctttctga cgttccaggt actgccgcag    148320
     ccgcccaatc ttggctagcg cggtgaggct ggggtctgcc gccatacggc ggtattcaac    148380
     gccctgcgca ccggaaagct ccaggtaccg aggctcctgc accttcgcat ccagaccgag    148440
     gacacttttg ggacggcgca gcatccattc cgatacccgt tgcgcgagta gcactcgggc    148500
     ctcttgactg ccggcgaact cctttgcgaa gtcgccgcgc tccatgtcgc cgagcgggtg    148560
     ccccgacaga cgcagcagcg tgtgcagttc cacaatccgg ttcaggatcg gcgtagccgt    148620
     cagcagatat cggcgcggca ccttctgagc gaccaggaag gcattgagcg tgcgcgatgc    148680
     cgtaggttgg atgatgctgt gggcttcatc gaaaaccacg gcccgaggcg caatgacgcc    148740
     atcggtgatg gcctggacga tgacgccaag cttctcgtaa gacgcaatca gccagtccgg    148800
     ctccgcatgg atgccctctt tgtccaggat ggcaatctgc gcgttcggat ccacggccag    148860
     gatctcgcgc gaccagttga tcaacaggct ggccggcgcg accaacaggc ggcagccggt    148920
     accaggcatc aggtgcagcg cggccgccga ctgccgcgac ttgccgaggc ctggttcgtc    148980
     cccaagcagt gcgctattcg cggccagcag atgcaggatg ccggccggct ggtgatccag    149040
     tagcgacatc gaggcggtcg cttcagcgaa ccactgcgga tcaacattct gtcgctgcag    149100
     cggctgcagg acgatcgcca ggcggccttc ctcgccctcc tcatcgccgc cctgcccccg    149160
     cttcacctca gcaccggaca cgttgatggt ggggcgctct tccgcctcgt agccaccact    149220
     ggtgcgatcg atgcgaatct cgccttcatg gatgaagacg tggccgcgaa gcacgcctgc    149280
     tttggcggca aggtcgccta acagctgttc caggctccgc tggacgtacc agccctcctt    149340
     gctgctcaga agccggccgc ccagggcgcg tagacaggac acgaccaggg agtcgtacct    149400
     cgtgtcgacc acatacccgc cgtcagcagc gaccggatag atcttgacat cgaggtccgg    149460
     cgcgaacgca tcgacttccg gcgacagcag cgctgcagcg agctgcgcct gcgctgcaga    149520
     gcgatcgtac gcgagccgca aaccaccctt gtgcccgagc tcgtccagca ggggcccaat    149580
     attgtcgtcc gccggcagta cccacgtccg cgagctggcc gaccagctgg ctccgcgctc    149640
     tttaagcgtg gctacgatat ccgggtgaaa gccggtcgag agacccacgc ggaatccatc    149700
     ggatcggatc ccggcaagca acgggcgggc ctgcctccgg atcttggcca gggcacccat    149760
     cgctataccc ccggccgcgg cgagtcttcg acttcctcgc cgccagccac gcacaccagt    149820
     tcgtgcgcgg ctggcggcgt gagctccgcc agcctcaggg tccagtacgc atccacggcg    149880
     ccggcgccgt ggtcaaagtt gacctggcca tactggctcg tgatgccggg cagatccaaa    149940
     tagtcttcga gacactctcg caggggcctg gccagcgcca tcaaggcggc atcggtagtg    150000
     ccctcgccgg cgctgccaag gcgccacttg cggacagcct cccgtgcggt ctgcagcgcg    150060
     tactcaccgt actgctgacc aatgaacggc gccatggaat agagctccaa agcaaatgcg    150120
     agccgcgagc ccacgtcacg ggcagaaagt ccccgagacg ccgcctcaat gctcacctcc    150180
     tgcagcagct gctgggcccc ttcataggct gccgctgctt tgaggtgggc atcaggcgtg    150240
     tggctgtcgg cctcgccatt gtcgtgtagg tcgtgtaggt cctcggcgcg ggagagcgca    150300
     tatggcagta cgctggccaa cgcagcgcta agcgcgtaca cgcgcgcctg atgccggtca    150360
     acggggtcgg tgttcggagt cattgcttca ttcccattga tgccgcgtcg gccgccgcgg    150420
     gcattgtttc ccgagccacc aactgcaggt cttcgcgcgt aaggttgtgc cgcgcgcaga    150480
     agtgatcaac cgaccaagcg atcctgcttg caaggcggcg tcctaccacg gcttcaccgt    150540
     cttcgttgcg gaggtccacc aggtcatcct caatcgaggt gctcgcagga tcgaagtcga    150600
     agccgcgctc tcggagcgcg accaaccacg cctcaggctt gagatcaaac gcaggtatcg    150660
     cccagggctg cgggtccaca ttcagcgcct cgtagaagct gcgactcagc ggcggctccc    150720
     cctgagcccc tcccatcacc cacggccgaa gcgtcaagcc gaattcacgg accgtgatca    150780
     gctgctcata cagaaagtcg aacatcttgg cgtcttcgcg atcaaccagg ttcaccatca    150840
     gtgagctaac tgcctgcggt agaagctctc tcacctgcca gaacgccgtg gacgaactcg    150900
     actccagttc gtccacgcac aacccctggc gcggccgcgc caggggctgc tgcgtgagcg    150960
     cgccttctgc attcaccgtt acggggacgg ctcgattgca ccgcagccaa gcccgggcac    151020
     aatcttcgat cgtttgaatt gccatcaccc gctgatcagg gtccacgctg cgcgctgttg    151080
     cacgcatgag agctttctct gcgcggtgga ggctgtcaca caattcaccg acgagctccg    151140
     cagagcggta gtcgagcaca tcgatgtcca cgtcataggc agaatccgca ccacctgacg    151200
     tcagtaagac cgtgtaatag gcagcatgac cttgctcagg cgcggatggg tccacctcgc    151260
     tcaccaggtc cgacctccag agatcccggt agcagacgtc ccggaaagga atgacctggt    151320
     ttccctcgcc caagaggacc acggggagga tcacatttcc ctcatacggc aagccacgaa    151380
     tcatcatggc gacatcctcg gcacgtgctc gcgccactcg tcgtcgctca tctgctccag    151440
     ccccgttgcg gtttccttca ttggaagcgc aacgagcgac tcgccatcca tgtcgaacga    151500
     cagctccatc actacgccgt tctgatcgcg cgcgtagacc gtaccgttcg tgtccaggag    151560
     gaactggaac tgatcgtcgt cgatggatgc accgacgatc tctacttcat ccagcgaggc    151620
     cccttcggat gcgacggtaa attcctgaat catcggcgag gcttcagtgt ccgcaggcga    151680
     aactgcatct ctgtggtgat tcgatgcgta ggcgaacgcc gcgttgacat agccgtccac    151740
     caaatcctct ctctcctcaa gccactgttt cacccccggt ggcacctcgt gcccgttccg    151800
     ctcgccttcg ttcaaccacc ctgtatcgcg gacacagaag aaggtaccgc ttgtgccgtt    151860
     cggtccacag accattgccg gcgtaccagc gcccgggtcg tcaggatgcc cctcggtgta    151920
     atcaagttcg accgtatagc gtggatcctt tgtataggtc agtgtttgct tcttcatggg    151980
     tctgctcctt atgtactgct cagaatctga agccgcggtc agcctcatct atatcggctt    152040
     ccggtgtgct accgactcga cttttcagat gtaccgccaa gctctcgccg atggcggctg    152100
     cgtgtccaaa taggatcgat tgaccaaggg cctcatgcgc gagcgtggtg ctcgctccga    152160
     caaccaactt ctctgggatg cctttcacgc gcgcatgctc caccgggctc aacaatcgct    152220
     gcaatccgtc ctcacgaatt agaaacgctt ccgtacttcg agctttggcg tagccgcgcc    152280
     caatcgtccc aacctccgtc gcatcggggg taaccagctg gcgcttgaat cctttgcctg    152340
     ccgccgcgtc gcgggcgttt ttttcggcca aatactcgta cgcccgccat cggctttcat    152400
     cactgtgtgc gctggcgtcc aaggcatcgc cgagcgtctc gtacagtcgt ggttgggctg    152460
     ggaggttcgc catggagtag ctttcggcga ggcccttgct gatcgcgcag aaccaccagc    152520
     gcttgcgatt ctcgatcgtt cccgcaacct tgacatcgag aaccacgtcc gacatcacat    152580
     atccctgtgc atcaaggtat gcacgcacaa gatcgtagct ggcgctatcg cgcgcctgct    152640
     cgacgttctc cgagacgacg atggacggat tgaccacctc caggatccgc agcagtccat    152700
     agaccgccag cccatcggtg ggatgctgct cggcgttgtc caacttccgc ttcgcctttc    152760
     ccgacaggct gtggcccgtg cacggcaacg agacctgcaa cacgtcaacg tgtgaaagcg    152820
     cctgcgcatc gatctcctcc agcgatgctt catagagccg ggtgtcggag ccgatcgcgt    152880
     cgttgttctg cgatgccagt tcgaggtacg cgccctcgcg atctacaatc cagtccacgc    152940
     gtgtacgcag accctcgcgc tccagacctt ccttcagcgc caacgtcgag acacccgccc    153000
     ccgcgcacag cgtcgcttcg gtcaggtacc catcgcggac gtgctcccgc gtgctcttct    153060
     cgcgttgttc gagggcgagg tcggcagggt ggagatcgaa aacgatctgc cctgccgcta    153120
     gcgtggcgcg tacgcgcgcg ccctcgccca ggacgtcgga aagcgcgcca cccgtgacgt    153180
     ctacaatcgg cgtctgcctg atctccccgc ctacaactgc cttttcccgc ttcgatacgg    153240
     tgcgatcacc tgctgcatct actttgagtc gaacctggcg gttgacaaga tcaagttcca    153300
     cccggaactt tgatcccggc aaaaacccgc acttgcccag gcgaagacct tccagccaca    153360
     gccgtggttg gccccggctg tgtccgagct ttgtgtagct cacctgcacg tgagccggga    153420
     atccggcttg accattgcgc ggtaaagcgc tggcgacctg tgttgccgcc gccagcgcgg    153480
     tttgagccgg aagcttcctc agcatgctcg cacctcaggc tgcatctggc agacctcacc    153540
     agcgccgcgg ccccgaggct ggctcgcgac cacggaccag tagcagtcga tgccaaaacc    153600
     gaacacagtt tcaaagttcc gcgtcggctc ctgcagcccg tgccgacgga gcaactcggc    153660
     gcactcataa attgcctcgt gagcgccctc gcccgccatc tgctgccggt agtacaccag    153720
     ccagcacccg acctcaaaat gatcctgagc ggcccggaac tccttatacg cgtcccgagg    153780
     ttcgaggatc ttgctggccc gcgcggccgt ctcaacgacc gcttgggtcg tattgcaatt    153840
     cctgcgcaga tcatcccgcg tcgaggcgga tatgggcgcc cgcaccatac gtcggacgct    153900
     catggcttga aagccccttc atactcatcc tctggctctg ccgccgccga agcctgcagt    153960
     gtggccacgt gttgattgat ggccatgctg ctcgcaataa gcgtttttgc caccaagagg    154020
     gtttcggcat acgacttccc gctggtatgc gctgccccgt cagcaaatac ggagcggtgc    154080
     tgcccttcaa ccatcgggcc ggtgccaagg aagatggtgg ctcgcggctc gtccaggaac    154140
     acgcgtactt cgccgtggga ttggtctgcg cgcttcccgt gcatgttcag cggctccagg    154200
     aacgcactga cgctgttgcc aggccccccc atgtaccagg tcagctcgtg gcgttcgtac    154260
     agcttccact gatggccagc gggcgccggc agatcggcca tcatctcttt gaggtgcccc    154320
     accaccaact cggccacgcc gcgacggtcg gtctcccatt gcgtgccttc ggacgccggc    154380
     agctgcgagt ggcgcgatcg cgcccacagc ggactctcgg caagtgatcc acccagcagg    154440
     ccggccgcgg tgccgtgcaa cttgagccgg tcgcccaggt cgacggcttc agcctttggg    154500
     gcggccgact gaagccgaac cagggctgca gctgctgcat ccagctgcgt ggtcaatgac    154560
     accgccagct cgtggttacc agcatcaacg gcacggtcac gcgtgacctg gcccgttcgc    154620
     gcaaaatcac tcaacgccgc cgccataacc tggcgctcgg cttcggagac gtacagcggc    154680
     tgaaggttgt tgtccatatg cgcctcagcc cgccatcgcc ggacgggatt caaccgtcaa    154740
     ggcatcttgg agcgcggtct cgggctgatc cccgctgccg atggcctcca gcaactccgg    154800
     cagcttgtcg tacatctcga tatcgcggtg ctgatggccc tccagcttca gcatctggtg    154860
     acgtccgcca ccccagtcaa tctccagctc tgccctggcc gtatgctgct ccggctccct    154920
     cggggtccag ccgctgtcgt ggtagtcccg atagccttcg ctggccgggc agtacgacgt    154980
     cgtgcgttca cacccatcta cgctcaccag cgtgtagtgg atcgacggct ttttcacaac    155040
     gttcatggtg gcaaaatcct gtcaggctgc ggctagatgc ccaccccggc gtgccgcgca    155100
     cggcaatttt gcgccacttt cattggtaaa tctacggctt ttttatgtcg ccatatgtgc    155160
     gcgctgccgc cctccagcga cttcggtggc agaacagtcc gtggaccggt tcacgacaac    155220
     tcgccacctc ggcacctccc gcacgtcgcg atgaggcgag cgcccgctga gctcccattc    155280
     gcaatcggta cgccacgcgc gtgctccatg tccaataatc acgcactgat ccaacatttc    155340
     aatcaccccg cacatcactt gcgctcacta ccgccggtct cgcccccata gctggggaga    155400
     tttgccatca agtaccgcct tgcgccggcg caatagcgaa tgttatccgt gagccagccc    155460
     ctagcatgcg aacctacgta tccagctggc gcgctgcacc agactcatcc tgacgacgct    155520
     cttccgcatc cgaccccgaa gtgagcaacc cgtcatcacc gcagctcgcc gccatccagt    155580
     gcccttatcc gacacccaca agaggcccca gcgctccgac acttcgtcga cattgatgag    155640
     accttccggg cacatgaaat agcgccattt gccggcacct agcgcgggtt taattcgatg    155700
     ctctttgcgc gcgtcggcca aaaaatcggc gcgtgacacc ttgacttcga tcagcacgct    155760
     accgtcctgg aagcccgcgt gccgccatcc gataccatct ggctgttccc ccccgccagc    155820
     cgggatagca ttccgtctgc gccaccgaac agccgtgtcc gccagcagaa ttgtgctttc    155880
     tcagccaccg aacggcgact gcgcacaacg cattgtgcgt cgcggcgggc gagcgccctt    155940
     ctttgcgatc cgattcgcct tcttccgtca cccgaatctc tcctgcgccg acgagtcggc    156000
     tagtcttttg acaccatcac catcacatca gcttttcact gacacccgag tgtctctccg    156060
     ggtgtccaac gaagccggag cagtggtccg aatcggtgta cttgcgagct ccccaagcag    156120
     aaatccctgg ccgtagcgga ttcccatgtc gatgcacgct tgccgcttct cttcggtatc    156180
     gatgttctcc gcgacaacaa tgaacccctg cccttccgcc agcgctaaca cgcgggagat    156240
     gtcccggctg tactcactac gacgcccgag catcacgccg gcaagcttca cgatgtccgg    156300
     gttgaaccga acaatgtctt cgaatgagaa gcagccatcc ccgaagtcgt caaaggccac    156360
     tttggcgccc gcagctctca cgcctgcgat gaaagaatgc accaccctgg gattcgtgac    156420
     cgcaatcgac tcggtgatct ccacgaccaa ccgatcagcc tcctgaagat gcatgaacac    156480
     tgccgccacc agaggaccgc agttgcgctc aattgtgctc accgatgcgt tcacacctat    156540
     ccggataccc ggcgagcgag cgaggaattc agtcgcctgg tcgagcatgg cgagatcgac    156600
     cagctcaatg aagccatagg tctcggcgaa gctgagcagc tcgccgtgac tacgcttgct    156660
     ggtgcttcgc gcgagcgcct cgaaatagag cgcttccccg ttcaggagat cgataaccgg    156720
     ctggaacacc ggaactacag ccagcgccat actcggctgc cgcttcattc gcgtgcccct    156780
     ggtcgaacac ccaatcgggc gcgcatggcc tcgaatgcct cccggcgacc gaagttacgg    156840
     gcatgcgcga gcattgctcc gagcagctcg ccaagctcgt gcgcgccagc acctgcagcg    156900
     accgatgcca cgacatggca ttggtcatcc attatttcca cacgttgacc gcgacacgaa    156960
     agcttcaacc ccagttctga aagtgggacg ctgtcaagca gctgctgaat cagcgggcgc    157020
     cgtgtgtttg cataccggga agttgctgca gccatagaaa ggtcctcgtg acgaatttcg    157080
     caactgcatc gttcccttgg cgcacttctc gcagggtgcg ccgctcccgc cgttcgcctt    157140
     cttgccgccc tttgacgcag tcttccgctt ccccgctgtc ttcgtggggg gcacacgacg    157200
     tgggcccagg tcgggaagca cgatccgcag ctgacggatc tctgccaaca tcgcgttgat    157260
     ctgcctagcc tggaacgcca tgaactgttc caaggtgatt tccccggctt caatcttcgc    157320
     aaaggccatg tcccacacgg cagtggcatc tggaaccgtc agcgacctgg gaagcgcttc    157380
     gtagagtgca agaccagcag ccgttggcgc gaagaacttc gccttcttct tgccggcgat    157440
     gtgctccacc acgccaatct ctatcagctt gggcgcgaag gtatgtcgcg tggcaggcgt    157500
     gccgattccg cagccttggg cctggtcatc agccccggcc tcgctcttct tcagcattgc    157560
     cacaaagtgc gccttcacct gcggtgtggt cacgtatttg tgaatgttga ccatggcttc    157620
     gagcaaggta tcgtcagtga accgcgaagg cggctcggtc ttcttgttct cccggtcgag    157680
     cccctcgcac cgcgctgctt cgtcctgccg catagcgggc agattcacat cgtcgccctt    157740
     gtcctgcggc gcagcatcgt catcagcagc ctgctccgcc ttcccataca actccttcca    157800
     ccctggcttc aacgtcgtgc gaccactggc aatgaagtca tgattcgcga cttcagcacg    157860
     cacgctgact tttcggtacg tgtgtggagg catgaactgc gccaggtacc ggcgggcaat    157920
     atcctcatag atgagccgct cttcgcggga aagtgcctct aaattcgctg ctttgggcgt    157980
     cggcacgatt ccgtggtgcg ctgtgaccct tttgtcgtca aacgccctgc tcttgcgacc    158040
     gatatccaac tggcttagct gcgccggcag gtcagttccg cggaagcctt cgcgcactgc    158100
     ctggacaatc tcagctgcct ccgcatgctg gctcatgggg agataagcgc aatctgtacg    158160
     cgggtacgtg accagcttgg aatcgtagag cccctggaca acctttaggg tttgctccag    158220
     acccatgcca tagcggcgcg acgctaggcg ttgcagttcg tcaagcgaga atggaagcgg    158280
     tgcattttcg ttcttctgct cgtcacggta ttcggcaatc cgtccggtct tgcctgcaac    158340
     ttgctggtgc accatagcgg caactgcagc gtcaagcagc cgcccgttct catcgatacc    158400
     cggttgcccg ttgcgcgggc gccacttggc gcggaactta cctgcctgca cagcgatcat    158460
     ggcagtgagc accaggtagt ccacgggctt gaagttacgg atttccagct cccgcgacgc    158520
     aatcagcccc agcacaggcg tctgaacacg tcctatagat acatgcccgg tcgagcccgc    158580
     ctcacgtgcc tgaagcgtca cgcatcggct gtagttcatc cctaccagcc agtccgcgcg    158640
     gcctcttgca atggctgcat cgcgcatccg cgcgaagtca cgattgtccc tctcatctgc    158700
     aagaacgcgc tggacggaca catcatcaat ggccttcggc aaaacccgct tcactggtac    158760
     ccggcagcgg agatcctcca ggacttcgtc aaccaagagt tggccttcgc ggtcgatatc    158820
     gcccgcgtgc acgaccaccg ttgcacgtgt caggagctta cgtacggcgt cgatcatctc    158880
     cgccttgtcg ctcaccggta caagccgcca ctcgtcgttg gctgggagca gcggcaggtg    158940
     gtcaaagagc caggggaagc gcccattagc cccacgtttg gcctccggat aggtgcgctc    159000
     gatgtagtag tccggctccg ccagctggta cacgtgccca cgcagccagc acaccgccca    159060
     gttggaacct tcgatgtggc ttcccgatct accgaccgcc ggcgcgctct tcgcgaggtg    159120
     gccagccagc gctttgccaa ccgagggctt ctcggcaacg tacagtttga actcaggcac    159180
     aggggtctcc accactttcg ttaccaaatc ctgcaggacg aagcgcgaaa gggttttgta    159240
     gaatcacggt gttggggaac ggtccctgta gccgaggact cgaacgatga cgacgacagg    159300
     ccgcaccaag gccaagccgg tcaagagcgc cgctgtccga aagggctctg cgacgacaac    159360
     gactgcccgt aagagcgcgc ccgcgaaagc gagcacgcca gcgaagacgc caccaccggc    159420
     gcaggaagtc gcaggcaaat cggtcgtgag ccctcgcagc gctgagatga aggaagctcg    159480
     gcgcttcgcg cttacccata attttggtct cagcagccgc atccgcgatt tgctggactc    159540
     caaacgcccc gtgctgcaga tcttcatcga cgagaacctg cccctcgcca aggttcagga    159600
     gttcatccag cgcaaatacg gcccgaagat cccggccaaa gcgcttagca cttacctgga    159660
     agcgaacttc aaagcgaaga agtgagcacc tgggcatgcg gcctcaccgg atcaaccgga    159720
     acgaagatgc ctgcatcagc gccgcggcca acgaggcagc aatccgccgc acgctttcag    159780
     actcgaccgg ctcgccactt tccgcctgca aagtgacgct cagaagcggg agcgttcgct    159840
     gctgaccggc aaccaggcgc cactcgctgt ggctcacctg gatcgtcgct ggcgatgccg    159900
     gatccgcctc ctgatattcg agcgtcagat cttcgccttc accgccgtcg tcggccacat    159960
     gggagaaccg cacgtagggg cactcggtgc cgaactcctc cggcaccggc aaggcttcac    160020
     agatttgcgc ccagatactc atttcggctc ctatcctgcc agggagaacg cgggatggcc    160080
     cgcgtcacaa tcgttagtat atccatattt gccgaggatg aaatcgttaa tggcggcgcg    160140
     gacctcagaa ggtccataca ttgatacacc aatggaagtg aggatcctga ggacttcagg    160200
     cagcttgtcc ggggaaaacc gggccaccat gtaggcgcgg gttccggcga actccccagt    160260
     gagctcacac aacggctcgc tgctgaagta cttcccgccc caggccttcg tgcctggcac    160320
     cgtcattttc aacagtgggc catcccgctc gatggccgcg tgccggtcga gctcatactc    160380
     cccctggctg ttcgtcgaca gttggatatc cggatgctcc tggatcaacc atgaagctac    160440
     cgaaggggtc tcgatacgca cacgcagcga attgatatgg tcgggcctga tgccggcgtt    160500
     gagcatcacg ccgcgatgcc gcgcgccatg ctgatcggtg tacatgacgc agctgccgat    160560
     cttattggcc gctgccatct gagccgcctt gaacagattg ccatccagga cgcaccgcgt    160620
     ccgggttatc agccctgcag gggccgcgtc gaaagcctcc caaagaccag acgcgggcga    160680
     gccgaccggg cgcgtcgaga atgcggggtc ttccataagc gcatacaagc tgcgctccac    160740
     cagctgggac tgaccaggca cggcaatgag gaccgtgtat tgcccggggt tatgcatctt    160800
     cttctcgttg ttcggcaacg tgatgtccac catcacgcct tccgttctgg cgttttcggc    160860
     cccggagaac gtcgtcagcg cgccaggcgc acatcgcggc agtgttcgcg caatgaagtc    160920
     aatgcgatcg cggaggcgct ttactgcatt aacttctgtg gcggccaata gctcgtctac    160980
     gctctccttg cggccttgag cgccctcctg cagcagcttg ggcgccaatc gctccagaga    161040
     gcccgccatg cgggtcagga cgcgcgccag cgggtgtcca taagctgagt caaagcgcgc    161100
     ctccgtgcga tcgcaacggg ccttgacatc catcggacgc agcggcagca cttcttcggt    161160
     gtagctgatg gttttgagga agacaggttg ctcaaacacc gaaccggact gagcgttacc    161220
     accctcaaaa acgattcgag aatcctcggt ggcgcgaaga tccagatcct ttgatttgaa    161280
     cgggttcaag cccttctcat ccagttcctt gatgatccgg gtgtactcgc tggtgatctc    161340
     ctcgtagatc gcctcctgct cggcattacg aagcatcacc agcctgctgg tgagcttggt    161400
     gatgaaatag gcctcttgct ggaaccccga atcgtcgcct tcgatatcaa gatcaatgtc    161460
     gagtcgatgc gcgatcaacg gattgctttc gagataccgt cttgccacct ggtcgccgac    161520
     cacgttgatg aagtcgggca cgtttctgtc cagcgcggcc gaatcctgat tggccgtggt    161580
     gttggccgag agctttcgca tcttcgcgtt ctgcatcgcg atggggcgtg cctcgccaat    161640
     tagccccgag gagagcgtct caacttcggg gctgctgacc tggcctttgc ggttcacccg    161700
     tccgaagaac tggacccgca cattcacatc ggcagccgac tgcagctcga tcaacacccg    161760
     ttgcctctgg tcgtcgaact tctcgctggc gtgcaatgag atgccggtcg agccagcccg    161820
     cgtgagcagg agcgcgtcgg tttctcccat gttgaactcg cgcacgatcc gtgccttggg    161880
     gcgctcaggc ctgacagtgg ccacggactt agcttcgccg gtaacaccat ctgtgcgtcg    161940
     ctctatgcgc aaactgcgcc cactaagctc gtccgcggca taccctgcct cttcaagacg    162000
     cgttcggatt tgatccaacg gcgaggcggg aagatcggga aactctccga tcaagctctc    162060
     gatgctggcg atgagcttaa gcgtttcctt gctggttacg tcccgccgaa ctacctcgcc    162120
     atagccagtt gtttcactgt agtagcgcaa cttgtccaac atcctccgga gcacatcggc    162180
     aaacacgatg tcttggccaa ggtctacccc ggccgcaaga tcctgctcgg cgttgacagc    162240
     ggcggcggcg ttcgccagct cttggtccag gtcctcgaag ccatcggccc ggctgttggt    162300
     gattacgtcc ctgagcaggg actccatggt gttctccaat acgattactg gtttcttgcc    162360
     agcctcaagg gccgcaatcg cgcggtcaat cgccagctcc gtcttgatcg ccatctggaa    162420
     ctgccggtag atcgagaaca ggcgggatcc gaagttcatc gatatcgcgc ccatgcgcgc    162480
     gcccttgcgc tcttgctcag gaatcagctc acgcagcttt tcgatttctt tgttgcgctc    162540
     gctgaccatc acattgatgt caccggaaac gaagttcatc agctcaagga tttcggccaa    162600
     cttgtccgat agttcgatgt tgcgctccag gcgggtgctg tcagccaccg tatcgaacgt    162660
     aagcgcgctc aggtcatgct ctcggcggat gaatactccg tcgcgggcca tcattcctga    162720
     cagcacctcc tggagaactt caccgcctgt ttgcaaggtc tccgggagac cggcaacatc    162780
     aacagattgc gggaagagcg cgctatagat cagcacgttc tttgctccct tcatcgaggt    162840
     cgcagagcta taggtcaccg agcggcttgc ctcgatcgcg gccgcgatat ttcgcccggt    162900
     gttcgagtcg cccgccgcat tgtgagcctc atccagcagc agctgcgagt cacgtgctgc    162960
     accggaaatc catctggcct ttgccgatgt gttggcattc cgattgaact ggctgtaggt    163020
     ggccaacacc aggttgaact ccgatggaat cgcatcttcc gcaagtgccc gctggagggt    163080
     agacctcggt gtcgccggca ccagcgtctc gcccgacttc gggtcgtaca caggaacgcc    163140
     gtcattgacg atcatcggtt tgaacaggtc ggcagatcca atatcctgca cgtctcgcca    163200
     gaaatcggtg aacaatgtcg gcgtctcggt gaggaagacc gtctgcctgc cgcggagaac    163260
     tgcatagcga gccatggcag ccatgacacg ccccttgccg aggccggtct ggtcgccctc    163320
     caggcagcct cgcccatact gctctgcgta gatacaaagc gcgaccgcgt caacctgctc    163380
     gggcgacagg tactcgcgct cacgcatctc gtctactcgc caatgcagat tcttcgccac    163440
     gaactcgtcg atgtcgccat gttcgtcaac gatgcgctcc agggccgaac gggtggcagt    163500
     ttggagattc cgtggaatca tcgccgacgc ctcgccgacg cgtgactggg cgatgtatgg    163560
     cgattgatag ctgttctcgt cgacagctga tacgttcgcc gcactgtcct cctcgccgcc    163620
     cggcggcagt ggattggcat ggtcggtgga tgcctgcgcg gtatgtacag cagcttctat    163680
     gctgtctgcc ggcagatcca gatccatcgc gtcgaacata ggctcaggcg ttgcctcgct    163740
     cagcactatc cggttggacg acacatccag gtgtgaggcg tcgaacgccg gggtcgactc    163800
     aacagctacc tgcttcagca gcagcgccgg ggccggtgcc tgcgcgtaac gcgcccgcat    163860
     gtttcgcgcc cacgcgatga cggactcgtg gtcctgcagg acgtccaacc tttcagggat    163920
     cgggctggcg cttgcaccct tggcgccaat gacaaccagc cgcacgggga agccggcgcc    163980
     ttgctttgcg tacagtccgc catcgacctc caccacatcg acctggtagt gatcggccaa    164040
     ccagttgaac aagtagcgcg accctcccct gacctcgccc gccttactgt cgagtgcgtt    164100
     gtcgccgcca acgatgtaaa cagctagccc atcatctcgt cgcaggcgca gcgagttgac    164160
     cagaaccaga tgatcgagcc ttcccacctt cagcctgtcg accatgacag gtcgcgcaag    164220
     cccgccgaaa ggtggattgc acagcacggt gtcgaattta ccatcggttg ccggcgacgg    164280
     cggcggatcc gccaggaagt cgccgacaga taccacgatg tcgggacggt cgcgacggac    164340
     cgatgctacg cgagcgggat cgatgtcgac cgaatgaatg gtcgcgtcac ggatcagcga    164400
     caccagcgac gcgttgccga tagtgggctc cagcaggagc ttccctcgct ggtcacccgc    164460
     aatgtgttgg acggccactg ccaacggcaa cgtcgtggag tactgctgat ttacgatcga    164520
     gctggtggtt cttgccttga aggggggctg accttcttcg agtctcctgg cgagctcgaa    164580
     agccggcaca tcggccgcgc catgggcgcc aagcgtgcgc accaaggcgg cctcgacggc    164640
     ttcctgccaa acccggagca acggggatgt ctccacctgc tcctcggcag cgtcgttgac    164700
     cacggctgcc catcgccgta ggtctgcgta ccgcattggc ttgccccgcc gcatttcgac    164760
     cacgaaccca tcagcgcagc ccgcaagttc aaccgcatcc ggcgcccgca gaaagcgcga    164820
     ggcgccggta gcacctgcaa gctcgctctc tctgcccacc acctcgtggt cgcggcgtgc    164880
     aaatctccca agctcgctct cgaaaacggt ttccccagcc gagttgcagc caagctccct    164940
     gatggcgccg atgatgttgt tggcctgcag gtcaccactg ttgaccgggt cgccggcgtt    165000
     cgctctgcgc ggtagcgccc tgactacacg gccaaccgga acctccacag gctcggcgcc    165060
     agggaacgcg cggcgaagtt cgccgagcgt gaacttaagc tcgtcgcgca gcaccaatcc    165120
     acgtggagat tggtagaagc cgagctgcgc cagagcgctg agcgtagacg gggcgacttg    165180
     gtcgccgccg aggagcacaa gcttgcgcgt gccggacggg aactgggcac ctaccagacg    165240
     cacccgggga ttggccgggt ccaagcgcac ccagcgaacg agcgtatttg catccatcga    165300
     agatctcatg aggttctgga gctcaatacg actcagccgc ccggaggcgg ctgagtcggc    165360
     tactgcaacg agcgattacg gagccgggct gtcggccggc tcatcttccg gttccggcgc    165420
     cactgccgcc tgggccttgg catcgatgtg cgccgtggcg atttcgtgcg cggcatggcg    165480
     gccgggccga tcggcgatca cgttgatcgg cgagaagccg gcaatggtgt cattacgcgc    165540
     cacgcccggc aggacaacac tcgcaaagcg gtttggttcc ttgccgaagg cgatctcgta    165600
     gcgggtcacc ttgttcgcct tcagatccga gacgagcttg taggccgcgt tgtcgtcctt    165660
     gagcgggtta cccgcatagc tcagacggta acccgggatc gagtcgatct tgagcgtacc    165720
     gtcggccagg ccagccagca ggtcggtgtt ggcgatgtcg cggaacacat tgtttttgaa    165780
     cagctcttcg agggttgctg ccgggtcggg caggtactcg tcaccttcac gcttgtactg    165840
     gccatacacc aggcgatcga tgacttcctc gccatcggtg acgcgcagca gcgccagggc    165900
     gcgcgtgcca cggcccagtt gctcggtcag cgcggcacgc agctcttctt cgctggtcac    165960
     cagcttggca ttgtttggct cgacggtgtc gatgaagacg gacggcttgg cgtccttcga    166020
     cagcttgttc agtcgctcga tgccccatgc gcggtcgaac tcgcgcgaga acgtgccgtg    166080
     ctcggtttgc acgcgtgcgg tgaacttctc ctgcgagacc ggaatcgtga tggtgcgcgg    166140
     ttcttcattg ccctcgcggt agttcgggtt ctcgaagctg acgcgcggcg aagtggccat    166200
     cacgccttcc aggaagctgc ggtccgagtg cgtggcctcg ttgaccttct gcagcgtgtt    166260
     gacccagcgc gaactgacga ccatgcggtc gtcgtcggac atctggtcgg tcaggtagca    166320
     ggattcaagg gtcaagaccg agccggctgc attctccggc ttgtcaaaga tctttcggct    166380
     accgccatgg cccttcacga aattgctcac cgcgcgttcc gcgtcgtcgc cgcggaactc    166440
     cactgccaca ggcaggtcgc ggcctgcacc gggcacttcg ttgagcacga tgccggtcag    166500
     tttgaggctt tccttgtcgc cgaccttttc gaccacagcg gtggacacct gcaggacggc    166560
     ggcgaaggta ttgggggtgc ggccaccgcc cttcggggcg gcggactcac gcagggagcg    166620
     aagtgcggac attgcgatct ccagataatg tcgaaaggag gaccgcactg cgtacttgcg    166680
     gcccgagacc cgtttgggct cgggatcaat ctaccacttt cgttggcata taagaacgct    166740
     tttattgcca tcgagtgtgg ttatttcgcg tatcttcgcg tatttccgcg tatcttttgt    166800
     aatctaccgg atcaggaacg cttctacctt ggctactgcc aagacgcggc aagctgctta    166860
     tgctcttcga cagtcgtcaa gccagccagt tcagccacca agtttcgcag caccagcggc    166920
     gccgtgtgcg cagcagctgg tgagggcgca acctcatcgg ctagcctcaa cgcaaagcca    166980
     atgtctcggg tccgcatcgg atccgcccgg agcctttcga gcgcttcacg cacactcgtc    167040
     tgtccaccga atgccggcgc agcgtgggcc caaaccgcac ttgcgaggtc cttcgcctcc    167100
     gctgctgcgc caacgggcac gccgagttgc accgtgcaac tttggccgtg cgccggcatc    167160
     acccgtagga tccagttcga cgtggcgcga tgtcacgacc gagcagaatg acattctgcg    167220
     atccagccac ctcgatgtcg tcagctgcag cctggctacc cgtgtcaggc tcgtagcgct    167280
     cgcgcaccca ccccagcaga tcttcagggg tcagattgaa ctgccgtgcg gccagcgcta    167340
     ggtcacccca gtccatcgca cccatgctct gttcgaaggc ctggtcgaac tctttgactg    167400
     tcatatcgcg ggcgagcacc tggcgccaat gcgaagcttg gatctgcatc gtgtgatgcc    167460
     ggttgtcgtc gcgccacatc gtccccttgg ccacatccgg ggtcacccgg accttgcgga    167520
     agaagggttg cgtgacggac acgaccacgc ggcactgccc gccaccgatc atgtactgat    167580
     ccgtgcgcgc caggccgctc cgcccgcgaa cagccttcgg tggatggacc tgcgtgatcg    167640
     cagagttggc gcccagcagc cgtgagagca gctccaccgc cgccaacgca tcctccacct    167700
     tggtgaacgc accaagcttc acgcgccaaa aatggaccct ctgggagtcc aaacgccatg    167760
     cgccggcgtc cagtcggagg ccaagcatac ccatcagctc gacgatggta ttcacgcgaa    167820
     ggccgcgaat attgccaccc agccaggagg ctacgttggc gcgtgggata ttcgcggccc    167880
     gagagagcgt atagatgtcg tatcccaaca gttgcgccag cagatgagcc agtccgctca    167940
     ccgagatttt cgttttcgac atcgaatgct cctagtcttt tgaccccatc accatcacat    168000
     cagctctttt ccgccgcccg cttaggctgt cgcgatcaat tgccggctct cgtgttcacg    168060
     tattgcctcg tctcgccgac caatgcccac ctctgcaacg ccgcaggaat ccatcaggcc    168120
     acgcaccatc ttttctgcca cggccacatc ttgtgtcagc cagattcgct ggacggcttc    168180
     cgaaactgcc ctgtcgctgt cgaccaggat cctgtcgacg ccgagcaact tggcgacacc    168240
     ggaggcgacc tcaccggtcg cacgcagcat ggccacagca cctccatccg cgatcaacag    168300
     gaaaaatgac tcccgacaac cggcagtggt aacgacgccg accgaatatc gacccatgac    168360
     atcaagaagc actctcaagc cgcccatcag atggtcctca gcgcccaagt cccacctgtg    168420
     cagggacctg gtcagcgtca gatcccaatg gaggcccagc gcgaaaagca ccgcgcgcaa    168480
     tttgacatcg gaaatgttcc gccggccgcc atgactgcgg atgaaggacg acaggttgct    168540
     cctgtgcgtc tccgcttcca cggcaacctt ctgcagcgaa accccctgcc atcgctgggt    168600
     ccccaccaca aagcccaacg ctgcagccat acggctacgc attgcggatt cggcttcgtc    168660
     gttagccact ttcgttgtca tttacaggcc tttgatctaa caataatagt gcactttcgc    168720
     gaacaccgaa gcaagccatg accgtgcccg ctcagccacg cctcagcatc gaactgatcc    168780
     cttccagctg ctggtacaag aacgtccgca gcaatgtacg tgtgaccacc tggtcccgcc    168840
     tccagtctct gatctctacc gcctctggcg gccgatgcga gatctgcggc ggtcaaggac    168900
     accagcatcc ggtggaatgc cacgaggtgt ggacgttcga cgaacgcctg ctgctgcagc    168960
     gcctcgatcg actcgtctcc ttgtgcccgg cgtgccacgg ggtcaaacac ctcggccgat    169020
     ggctggcccg aggtcaggtt cagcgtccac tcgcttggta ttgccatgtg aaccacacca    169080
     cacctgcgga agccgccgcc gcggttcgag ccgcgctcga actgaatgcc caacgctccc    169140
     gttgccggta ccagctcgat gtttcgtggc ttcagcgagt cggcgtggac cttgcggcgc    169200
     atggcgtgga ggttggtcat acatccgtcg ccatggacta ctagcgccac gcctgcacca    169260
     gcgcccgcat cctggcagcg tgctcagcgt caacacgctg cgcgttcttc ttgacttggt    169320
     cgtaccgggt gcgcatacgc tcggtgtatt cgtcgttggt ctcgttgggc aggaacgcca    169380
     gctcagcggc gatttggtcc tgcaaaggag aaactaccgt cagaacgctg gccgccggcg    169440
     gagatatcgg cgcgtattcg gtaaccggcg ccctagaggc ggcctgcgtc ggcgtactgg    169500
     cggcagcggc cggctccaac tggggtgggg tcagccggtt aacaacctgt gcctgtgcgg    169560
     cgccaaaaac gccagccata ttgatcaatg cgagcatcca cagacgagtt ctgttatgca    169620
     cggcggtcac cttgggccac tgccccctgc agacgagcag cgtcatattt gcccttgatc    169680
     tcgcggatga gttcattgat cacgccatct tccttttcgc tatccaccat aacgccgctg    169740
     ttctgcagcg cgagcttgcg gcgctcgatc tccggcaaca atgtgcccgc cggataaagc    169800
     gcagcgagca gcctccgtgt ttcttgtccg ccgatctgtg aataaaggac atcgcgcacg    169860
     taggagtcct cgtttgacgt cgaaaaagcc caaagcctga taccgcccat cttcaggttg    169920
     agcagctggg tgaccggccc gcttctcgtc ttgaagatca ccaccatcgt cgagccatcc    169980
     ttcgcggttg gagggcggat atgcttctta gccgcgtgga gcactgtcgg ggatgcctgc    170040
     cacttgtccc gcatcagctc agcggaatcg tcatccgttg gcgaaagaac aaagtttcct    170100
     gtcgagaacg agagcacggc ctctgggaag tcctgcggcc gatgcgaaat aagcgtcagc    170160
     atgacgcccc acttaccacc ctctcgtgca tccagctcaa gctgattctg tacagcggca    170220
     gcctttgacg tgcgatgtac ctcgtcgaac accaggtgtt tacggttctg ccggatctca    170280
     cgaattcgct gttcgtggtg tcccttgtac tcgggcggga aggaatcgat gtgctcctcg    170340
     cgcaggtaga agttgcgggc agcagcatgc ctggcaagca tgtagcaaac gttggtctgg    170400
     tgatcagcca ccgcactacc ctgctttgcc acctcatcca agtcgatcga cacgatcctt    170460
     gcatcgccca cgtcaaatgc cgttggacgc gacaggatcg ggtagcgacg aatggcctcc    170520
     gatagcattc gcgcgaatgc ctgtagcagc ggctcgcccg agttggtcag cttttcgccg    170580
     tacaggtcag aaaactgccg ttcgcggctg acagccgcca gatccgtcag cgttggaacg    170640
     gcgtagcgct gcgctagcga cgcagcgtgt atgtcgccgc gagaaaacaa ctggtccaca    170700
     atctcccacc aggtggtgtt gcgatcgaca tggagcccat gcgcgacaat ggcacgatcg    170760
     accagttcag cgccctccgt ttgcgggctg taccggcgcg gctgcgcatt gtcggcgaag    170820
     tgcttgtacg cataatcgat gacaccagcg caaagcccag ccatgccgtc agctggatgc    170880
     ggctctcccg gaggcgtcat aagcagcgtg gtgaaattga cggctagcgc ctcctcgtgc    170940
     gggagcgggc gccggcagcc aagctgtgtg tcgaatgggt tcacggagtc ctcgggacgc    171000
     atccgcatcc ggaactgcac gacttggtgc ttagactgct ccgtcgccgc ctcccggata    171060
     agcgaggtga agcccgagct ggagcgaccg atgtcaatga tcgcgatata cggcaggtcg    171120
     gtcagacctg gagacagggt gaatgccaga ttcatcgcgt tcaccagcac cgacttaccc    171180
     gcgcggggct cggcgataac tgtgttgatc cagttcgact gaacggagga cgatggctgg    171240
     aacggaaaaa gcttgccgtc cggcgaattg aacatcaacg cgccgaaatc ccaaggtgac    171300
     gccggtcggt agaagctcag catctgcgtg acatccgcca gtgccgcgca ggcaaccgtc    171360
     gccgggctgt tcagactcaa ccctggcgtg gtcgccacca aggcctgcac cggatcgcct    171420
     gacagctctc tgacgtccgt accaccccac gcctgcaccg cacgggcgag cttggatgta    171480
     cggtcttcca gcagcttcgc gttgcctgcc ggcgcccaag aggtgagatc aacccgcagc    171540
     ttcacgtcga gctcgttctg ctcacgtacc aggtactcga tgcgatcagc tgcggcacgc    171600
     atgagcccgt tctccgggtt ggtgaacccg atgatcgcgg taataagacg cttaaagccc    171660
     agggaggtta gccctcccga ctcgatctgg aacttgatcc gccaaggcgc acgggtgtcc    171720
     ctcactcggc ggaacagcgc ctgaaacggc accgtctcgc tccctgattg gtgcatgaag    171780
     atgtacatcg gcttgtaggc gatcgaccct acagtgcagg aggtggagct ctcttcccgg    171840
     atgttgcggg gcgccagctg gcggtcaagc cgtggccaca gcgcgccaga catatccgcc    171900
     ggatttcgcc gctgctcgcg cacagggatc ttgtcgccgg ggaggcttgg gcgccactct    171960
     gctgccgtga actctcggtc aatcgacatg cgcatgtccc ggcaagcgtc gtgcacctcc    172020
     agctgcacca gggaaatctc ggccgctgcc atctcctgca tgaaggagga gacgaaggaa    172080
     tcatgtctgc tcttgagccc agcgatcacc cgaaacagat tgggtgcatc ttccatcgtg    172140
     ggaatgggat tgtctttcag cagctccatg cgcgccgcaa catcgcgctt caactcggta    172200
     gcggtaaatg ccgatgggcg agtatagaga gcgacccagc agcgctcagc gctgcaggac    172260
     tccctcagca tcgcgacatc ttcctcaaag agatcttcga ggttcagacc aatccggaca    172320
     gcagtgtccc gcatcggttt ctgcgcttca cgcacctcgc gctcgacgag gtccggatca    172380
     gattcgaaga tgcacgacag cgcatgacca ccaccacgca tgaatgcctt gagtgaattt    172440
     gtcaggcgtc catcaatctc acgaaactca tcaacaccaa tcatgcgtct ggaaccattg    172500
     actcgaagaa gcgtcatgcg agagccatcc ttgagcacga aggtggtctc gtcttcggtg    172560
     tattcgatgt ccaggtagtc agcaacgctc tgcttaactg aactactgaa gtacgcgagg    172620
     gcgccctcag caatatctgc gatttgctcg acgatcttca ttgcgctcct taggtgctcg    172680
     aaacagagct gaactgcttg cgcacgctgc tggcgtgttc ggtgaaaacg gctgtcgcag    172740
     cgtcgcgcaa gcttgccggg actctctctt gtatgaacga cctgaccact tccaagtcgc    172800
     gaatcgtggt ttgaagctca tcctgggttc ttggcataac gctcagacgc ccaagggcca    172860
     taatcacgcc catgttgcgc gcgtcccgca ggaccacctc cagcgcgtgc agcgtctgcg    172920
     gctcaaccga catcctggag atcctcctgc acgtcgatgt cctcactcat cgtggtcgga    172980
     gcaagcattc ccgccgaaac agcaacctcg taggcatccc gatagttgta tttgggcact    173040
     cgtgccacta cgactcctgc accgtagtag cagaccgtga aacccgcctg gtgcaggctc    173100
     agcgcattgg tgaacatctg gaaccgatct accgacgtca gccacgcggc acgtggcgag    173160
     gttcgccgtt cgctgctctt ccctggttcc aatcgatatg gattctctcg acacaggcca    173220
     atccagtgat tcgttgccag gatctgcgtg ttgggcgtca tcgcctgcag gtccgtgatg    173280
     tcgtctggga gcagacattg cgaaggcatc tgccggtact ccgaaaacac ataggccgat    173340
     tcgatctcga ccctggcaaa attcgacagc agaaggatct ccggctgcgt cagccagttc    173400
     cggttcgtcc ctgccctgcc cccgttgccg taggagatga gattggcgaa gtcagggtgc    173460
     acatctgcta ccgagacacg cgcaagcact gggcgtggat cgttgaggac ccagtccaag    173520
     cgcttcccga acggagggag actttgctgg tccagatact cgacctgatc cgaaggaatg    173580
     atggtctgcg tcatctcgcg ggcataagcc actgcaggct tggagaagca cacgtcgacg    173640
     tagtcttcag tccggtggtg gggcgtcatg caggtgttgt agtagagatg ggattcaccg    173700
     atcgcgccat cggcttcggg ccccaagctc gggtcagcca ccggcaggag ccgtgaccga    173760
     atctcgtcgg ccagtgtgtc gtacggaaac acctcgcgct gactcaggtc cacgttgtag    173820
     cggcgtgcag cgacgcgcat cacctgcgcg aagatcgcac tcagcgcctc ggcgatcgtc    173880
     ttctcggtgt atcggcgccg caccagcccc catgactcgc agaacgcgtc ctgtccatcg    173940
     ccgcgacgcc acgagtgcat ataggtagtg cgcttgacgt tcggaagtcg gtgaatgttc    174000
     gccttccaca tgctgtcaaa tgacaagttc gtccaccaca cggtagaact gtccaggctg    174060
     ctggcgttgg ctattcggaa tgcctcgccg ccctcaactg aagcccagcc gccggcgttc    174120
     gggtcgtcga tgtcgaaccg aaccgagccg aagtacttag cccccatttg caactccggc    174180
     agctgcagcg atctcgcgcc agctcgccag gtccagattc ttgaatccgc ttccgtcaac    174240
     tagccaggac ttggccagct ccacgatcgg atcgagcggc gccaggtagc gcacaccggc    174300
     caggagctga ccgcggtcgg cgtaatcggc atcactcatc gactgcagaa ctctcgccat    174360
     cacgacaggt gaggacagtt gatggcgctg cgattcgccg ttcttggtgc cctccacctg    174420
     tgccgcacgc gctgtgagcc gcgcgtagac cacgtgggga tagatgtcat gacctgcttg    174480
     ctctgcgacc gtcaccactt caccaggctt catttctgcg gatcccaccg caatggtgta    174540
     ggcgatcgct tggagcagcg agctcaattc cgcttgggtc aactcaggaa gatagatgag    174600
     cgctcccggg ctatccgccc atcgccgact tgcaaggtcc aggtggtgcg gcatgtggca    174660
     caggacacaa gccaaggtca ggttgtcagc tgtgttgttg gcatggtcac cgtctaagtg    174720
     gtggacttcg cattcgtctg ctaccccacc gaacttgaag tcacagaaag cacagcggcg    174780
     caggaaacgc gcttggccca gcagcgcctc tctggagccc gcgtgctcct tgtccttacg    174840
     cccaccgtgc ccagcggctg ggatcagccg ctgggaggcg cgtgctacgg agagcaggat    174900
     gtcccgcatc gtcaggatac ttactgcggg gtgatgttga tgcgctgcgg acgaccggcc    174960
     tggtcgccaa acaccgtctt gccgagcgtc ccaacggtca gcggcagcat caccatgagc    175020
     acacccacga tgcagccaac gaaggacgtg gcaatcgacg cctgtccctg acccttctcc    175080
     ttgttcacgc ggtagaagcc atacacgccg atgcacacga tgatgaaccc gaccaggcac    175140
     accaaagact ggatgagcgt gaagacgccg ttggctgttt cggttccatt ctgagcgatc    175200
     gttttgacgt ccggcgcgcc ggacatctga tcctgtgcga atgcgccgaa cggggtgaga    175260
     agggaaaggc acaccagcag cagggttgcc attgcgagcc aggttcgttt gttacggatc    175320
     atcactatct ccttgggact tggttgaagg gtgttgcgga ttaaaaaact ctgccgaagc    175380
     caagaagctt cgcgagagtg ttcacggtga gcacgatgtt gagtagtgcc gcgccaccga    175440
     gaatgcggaa catggtcgag cggaacgtaa cctctccgcc tgatcggttg tcattgagtt    175500
     tgcgtacttg cacccagccc gtcacggtga agaacagccc gtagacctgc agcaacagca    175560
     cgatgacctt catcaccatc gcggcctgcg tcggcatcga atcggttggc ttataggcaa    175620
     ccaggtgctg caccgatgca cccgaattcc cgtatagcaa gccgaatgcg gcgtccgttg    175680
     acagtgcgag gttcaccaga gctacgccgg ataccagata gaggaatgcg gttccgaggt    175740
     gtgcttcacc gcgctcggtg tgctgcttga acttgtagag accttggaca gtgaaaagaa    175800
     ctcccatcag gctagcgatg gtttgaatca gtgcgctgac atacggagcg accccttcca    175860
     ggttggccag catctgagaa acgtcgttca tggcctgccc ttatcgcagc gaggtaccgt    175920
     tgttgaggcg cacctcgttc cgttccacat ccactgcgga cacggtaccc gcccccggaa    175980
     tggtgtcgcc cggtgctacc gacacagtct ccccgttctt gagctgcagc caggcccgtc    176040
     cctcaaggac cgctttcagt tggataccgc ttgcgggcac cggttcgggc tttgcggcgg    176100
     ccgtgaccga ggaaggcgcc ggccttgttg cgctatctcg cgatttcgga cgcgcaggcg    176160
     ctgcgtttcg ccgtgccggc tgtgttcgcg gcgcggtggc aaccgcgcgt cccgaggcgg    176220
     tcattgttgc gacgcgcttt tcgagctcca tcaccctcgc cctcagtgcc tccagctccg    176280
     tttcagcaac tgcagactgg tcacttgcgg gagttgcctg cggcgtcgca gaagactggc    176340
     tagttgcaac cgcgaccggg ggctgctgag cagcagattg cggctgggcg atttgctgct    176400
     cagcctgcac ccctgctgca tggtcgttct gctgcgcagg cgcgctttcg ccgccgccag    176460
     gcgtcccctg gtcagcggtc aatgacaccg gggcgtccgc cgcggcactg gccgcgattt    176520
     gcccatttgc cgtttctccg ggtaccccgt acgggttaac cgcggtcgca ggtgcgcccg    176580
     tcatcgggac agctgcctgc tcttggacag ggatggacag cgtgtcagta gcggccccgc    176640
     cacggttcat cagcttgtag ccgaaccatc caacgaaggc cacgatgagg acgacaaagc    176700
     cgatgagcat gtacttggcc atgttggcct tcccacctgt ctccgccgca ggattgctct    176760
     gggattcagt agtgaacacc gactggtcgt cgctgtattc gcccgcgggc agtgcatcgt    176820
     cgtgattgaa gttgttgttc atggggagcc tttatttgcc gaatgcggat gcagggacgt    176880
     cgctcagaaa gagcacgccg atctcggttt tctggccgat actcgccgtg ggcttcctgt    176940
     tgatggtggg ctgcaacatc tgggttgcat tcgttccgac tttgccgagt ccgacaagcg    177000
     ccagctgccg atcattgaag gcgtctttct gcacaacaac ggtttgtccg gtggtcacaa    177060
     cgttctcttg ctgaccgcca gcgatcagac cctcgcttac cccactcaac accgacgaga    177120
     agaacaacga agccatccgc gacgcggtat gcctgttgac gtcaccgacg ctagcgcgcg    177180
     atgtcgtggg atcgattgcg actgcatcga tctcaactgc gtcgcgcttt tgtgccccgc    177240
     taggaggagt aagactggtg aagtgaataa acccgccggg cgcgaactcg ctggtctcga    177300
     tcgtcccgcg catgacgctt cccttgcccg gcccattgag gattcgagcg cgtaccagcg    177360
     gcagtcgatc gtcggtcgtg gcgtccccca aggtgatccc aaggtacgtg tcattcgctc    177420
     gcagcaaggc gccgctggtg gtctccgcca tgtcgtcgga ggccgtactt gcgaccgacg    177480
     ctgagcccac ttgggcatcc tctgcttcgc ctgcctttcg ttcctgattt acagccacgc    177540
     ttacgggcgt ttgcacactg atccagcggc caaccaggtt gtcgtactgc ttggacatga    177600
     tcgcgtaccg tgcctggacc tgctgttcgt gctgctgcag cctggcggta gcttcggcgc    177660
     tttgcgcctg cgctgtggtg gcggcagcgg ccgccggctc tggcacagca ttcatgttca    177720
     cgccggtgcc atcgatggtg acctcgccct tggcttccgc tgcggcttgg ccgggccgtg    177780
     gcattggcat tgccgtgcca ccggtctgct gcgcctgttt cagcgcttgg atgtcactct    177840
     gttgcgccaa ggcctcgtac gccttggtgt tggtcagcgt ctggccgctc ggtgcgacgg    177900
     tcggctcggg cacactttca agcacaacct cgccattgtt ggcgggcttg ccgcctccca    177960
     tgaagctaaa ggccagcacc accacgacca gactcaggac aattccaccg atgaagatga    178020
     ggcgggttgg tccgtgtttg agcgcgctgg cgatgttgcc agcgcgtagt ttgatatcgc    178080
     tttcctgctg agccatcacg gcgcctctat cttgacgtgc ttgggacttc cgctaatcga    178140
     caccaccaca atcggggtcg gtgggatttc gtagtagctg gtgccgtccg gactcttgcc    178200
     tggattgcgg taagcgggcg acagaagtgt cagtggcgtc tttacgtagt aggccccgtt    178260
     gtaggcccaa gcctgcacat cggggctatc gctcttcagc gcgacagcac cctgcgggat    178320
     ggcaccggta ataaactcca gcatcgtggt ggtcacagcg ctgccggcgc ttccactacc    178380
     tgcgagcttc tgggcaatgt tcccgccgat gacccgaaca tccacccggt agtcgacttc    178440
     ccgttgaccc gtgatcaaca tcagcgggac gggggccgaa acacctttca aggagacgga    178500
     gatgttcccg gtcgcatagg gctgtgtggg aaatagcttg agaacattgc tgttctcggc    178560
     caccgggaag gcgtcgaacc ctcctttcat gagatcgggc gacgtgatcg gtagcgcatt    178620
     gccgatcccg tccacgaaca gcacatttgt taccgcgcca taggccaagc gcaccaccgc    178680
     cggttctgcg ccgggggcca gatttgcgac gacggaggtt gatacaggcc tgggcgtgcc    178740
     acgcgctgct atcgacgcgg cacgttccgc gtcgtctaca aggcgacgga gatctcggat    178800
     ctgctctggt gtgagcggcg cagcgttggc tttgacgcga tcgaaagcga cctcattgac    178860
     ctcgggaagg atcggcaggc cgggcgccgg cacagtggta ccggcaggcg gcgcggccgg    178920
     tgcttgctgc aggggtacgg cagcggcccc tgcagctgcg gcagctggtg cctgcgccat    178980
     ggccgccgcc gacgccagca atgccgcgct cgccagaaac atgcgtccca ggatcattgc    179040
     cggcgttcct cggccgtgta cgcgctgatg ccaatgccat actggttctc gtactcgggg    179100
     acgcgttgca cggtggctgt aatgagcagg ttctgtgtcg ccagacctcg accgccctca    179160
     ccgccctgga agctgacgcg aatcggcatc tgcacggtgt aggtcaagac gccaccgatc    179220
     tgctgctctc cgataatgac cggcacgccc gtggcgactg cttgagtcac aaggcgctgg    179280
     cggcggaccg ccttcaaggt tccgacgcgt tccagttcct gcgcaaatgc gttccaaccg    179340
     ccatccgtaa agcaggtgga gatggattgg aagctttgct ggaagttgac gaagtcgtag    179400
     gtgttggcgc cctgaacaca ctcctggaca cgagtgagca tcgcgggttt ggccaggtac    179460
     ggctcgttca gcggcacgag gcggaccata cggcccgtct tgaaatcgac gccaaagtac    179520
     tcgcgccgta cctcccggcg ctctttgaac atgttccagc ccacctgggc acattgcgca    179580
     aacgacaaaa tcaagattgc cgcaaccaac ttcccgaaat ggcgcccata gaaggccagc    179640
     tttgctacat caattgccag cggcggatag ccacctagcg ggctcactgc gtcaggctta    179700
     gccttggagc tggcaggcgg tttcggagaa tcgtccattc gtcgcgccac aactgtttgg    179760
     aaatcgttca cgaggatacg acaccataac aggcgggtca acgatatatg ccaacgaatg    179820
     tggcctttgg ccgtgggaag aacggcatag ttggacaccg attgcacgaa ctctgccggt    179880
     cactcggccg ggcgccttta tgcggtcaca accggcgcac atcagcagct gctggacgtc    179940
     cattccacga tgtagcgccg gcgctactta tcgcgcgagt gctacagcgg tcatcacttc    180000
     actgacttac cgcaccaagt gatatggacg tcggcaagca ccgcgcaaaa tcactagaaa    180060
     tcagctgttc ggcggcctgt gtccaaccta tgccggagag ctgtggctat aaaggatttg    180120
     gtaaccgtat gatgggcgaa ttttcacaaa ctatgccgat cgagggagca ccaactaggc    180180
     cgttctctcc agccatcccc ctttctgggg ggccaccggg gactacagct ctttcagatt    180240
     caccaagtgc gcttcatcgg cgagcgcgtc gcaggcaacc agcctcattt cagcctgcaa    180300
     atccaaggcc tcgctgtggc tcatgaccga cagcacatcg aagccagcgg aacgaaggta    180360
     ccccgagagc gccgaggcgt cagcagccgt accgaatcct gccattgcgg tagcctctga    180420
     gacacggccg ccgccgacat atttgccaac gaaagtgaac acgttggacg attgacgccg    180480
     ctgacctggc tctaccggaa acaagtcgag gtactcttca gcccccactt ctgcgctgca    180540
     tgacgcaatt gcgtccagga tctcaacgct ctgacgaacg tccgccaggc ttgcgataga    180600
     tgtgacctcg aaatcccaat cacgaaatcg tgcgaccagc tcctctggag aggtggcaat    180660
     gacgtacgcg cccttctggt ctccgagccc ggcgacgcgg ccggcgacgg tgaacacgtg    180720
     gttgtctggg tggaccggct gcatcggtgc acgccttatc ggggtcgggg ggcgctaggc    180780
     gcgttgggga gatcccggta gtcaagcttc tcttggcggg tcgcggccgc agcagagaca    180840
     gcgccaatac cacagggaac accggccttc aacggcacag cgaagaccgg gagctggatc    180900
     tgattcatgg gaacacctcg aaagcggtag gtccgcgttg gccggactat accgccctcg    180960
     gaaatttatg ccaacaaaag tggtgcggcg actcgccggc agctgacggc tgggcttagc    181020
     accgagatgc agggtcctcc ttccggagag ttactcccgg tcagtcgttc gcggccacat    181080
     gctggattag cagcttccga tacaaggggc cagagaattc gtgtttccgt agggagtcat    181140
     agatcagttt gttatcggct gccagttgct gccggaagct ctcttccagc ttggctcgct    181200
     gctcggaatc gagtgcgtct aatcgagctt ctgcggtatg aaggcgcgcc tgtagctgca    181260
     gcctacgctc ggcttccgca gattcagccg caagcgtagc ctcgtccttg ggcttctcgc    181320
     ttgctggttt gcgtgcttcc aaggtcaatg tggtctgctt ctgcgacagg ctttcaggcg    181380
     tggcattttc ggccacacga aggaagtacg gtgccagctt gtgcttctgt accttgccct    181440
     cctgaaagcg cgctaccacg tagtctcgca ccgcgcgtag tcgttcatcg gagtgctgct    181500
     cgaacaactt gactacagat ccatacccaa gggtcatctc ttcctgcagg cgcgtcacca    181560
     aatcggtatc gcggccatgg aacggatcgg cctgctctcg cattttgtcc gagccgccat    181620
     cgccaaggat cttgatcgcg aatgcaacgc tcactacctt gcgggcgctt ctattgagaa    181680
     tgggctcaag ttggatcggc gccacgcgat ttacttcgcg acaagctggg ttcaacacct    181740
     tgtctttgaa cttgccgaag tcgtcatacg tggagttgcc ggcaaccccc agcaatccct    181800
     tcaggtctgg cagagcaaaa gccggtgtca cgccctcttc cgcgtacacc atgcagttct    181860
     cgtacagcgc caatgcagga ctgctcttca tcaggcgcgt aacgcttgcg ctaagcactc    181920
     cgctgacttc gggatcgtag aggcgcttgc gcagctccgg actgaaggag tagtagacaa    181980
     ccccatcttc gatgcgcgca gaggcgagtg tggcgctcac tgcccaggca gcgcgcccgt    182040
     cggagcgcag aatgttccac tgcacggggg atgtaaccag ccccgtgagt gactctttca    182100
     ggtaaggcgt gttcttgctg ttgaaaccag cgaggtagga cagcacgcca atagggattt    182160
     ggtgggaaat gatgctgaag ttcggcagct cgtcatagcc gttgaggagc agagcggcga    182220
     aaaccttgcg ttgtagcagg gtcagactat taaagatctg gatggcaccc acatgcttcc    182280
     gcacgatcat gttcgccggt gctttatcgc attcgttgcg gtcctggtgc gactgctttg    182340
     aatgggaggc tggtttggcg agtgcggtca tacgggattc ctctttgggc cgcggtccga    182400
     acgaaggatc agcagatgta tcccaacgaa agtggttgca ttgaagcaca gaacgccgat    182460
     cggcgtctca gttgactgct tggaagtccc tgcggggtgc tggcagggtg tggtccagtc    182520
     gactgtccca tgttgggctt tggctgtcgc ttcggctgcc ttgttgtgtg tc            182572
//

If you have problems or comments...

PBIL Back to PBIL home page