(data stored in SCRATCH zone)

EMBL: AM039952

ID   AM039952; SV 1; circular; genomic DNA; STD; PRO; 5178466 BP.
XX
AC   AM039952;
XX
PR   Project:PRJNA13649;
XX
DT   20-OCT-2005 (Rel. 85, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Xanthomonas campestris pv. vesicatoria complete genome
XX
KW   complete genome.
XX
OS   Xanthomonas euvesicatoria
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Xanthomonas.
XX
RN   [1]
RP   1-5178466
RA   Thieme F.;
RT   ;
RL   Submitted (16-JUN-2005) to the INSDC.
RL   Thieme F., Institut fuer genetik, Martin-Luther-Universitaet, Weinbergweg
RL   10, 06120 Halle/Saale, GERMANY.
XX
RN   [2]
RX   DOI; 10.1128/JB.187.21.7254-7266.2005.
RX   PUBMED; 16237009.
RA   Thieme F., Koebnik R., Bekel T., Berger C., Boch J., Buettner D.,
RA   Caldana C., Gaigalat L., Goesmann A., Kay S., Kirchner O., Lanz C.,
RA   Linke B., McHardy A.C., Meyer F., Mittenhuber G., Nies D.H.,
RA   Niesbach-Kloesgen U., Patschkowski T., Rueckert C., Rupp O., Schneicker S.,
RA   Schuster S.C., Vorhoelter F.J., Weber E., Puehler A., Bonas U., Bartels D.,
RA   Kaiser O.;
RT   "Insights into genome plasticity and pathogenicity of the plant pathogenic
RT   bacterium Xanthomonas campestris pv. vesicatoria revealed by the complete
RT   genome sequence";
RL   J. Bacteriol. 187(21):7254-7266(2005).
XX
DR   MD5; 349da57285b28fc92af5b8779169fe04.
DR   BioSample; SAMEA3138194.
DR   EnsemblGenomes-Gn; EBG00000036295.
DR   EnsemblGenomes-Gn; EBG00000036296.
DR   EnsemblGenomes-Gn; EBG00000036297.
DR   EnsemblGenomes-Gn; EBG00000036298.
DR   EnsemblGenomes-Gn; EBG00001206925.
DR   EnsemblGenomes-Gn; EBG00001206926.
DR   EnsemblGenomes-Gn; EBG00001206927.
DR   EnsemblGenomes-Gn; EBG00001206928.
DR   EnsemblGenomes-Gn; EBG00001206929.
DR   EnsemblGenomes-Gn; EBG00001206930.
DR   EnsemblGenomes-Gn; EBG00001206931.
DR   EnsemblGenomes-Gn; EBG00001206932.
DR   EnsemblGenomes-Gn; EBG00001206933.
DR   EnsemblGenomes-Gn; EBG00001206934.
DR   EnsemblGenomes-Gn; EBG00001206935.
DR   EnsemblGenomes-Gn; EBG00001206936.
DR   EnsemblGenomes-Gn; EBG00001206937.
DR   EnsemblGenomes-Gn; EBG00001206938.
DR   EnsemblGenomes-Gn; EBG00001206939.
DR   EnsemblGenomes-Gn; EBG00001206940.
DR   EnsemblGenomes-Gn; EBG00001206941.
DR   EnsemblGenomes-Gn; EBG00001206942.
DR   EnsemblGenomes-Gn; EBG00001206943.
DR   EnsemblGenomes-Gn; EBG00001206944.
DR   EnsemblGenomes-Gn; EBG00001206945.
DR   EnsemblGenomes-Gn; EBG00001206946.
DR   EnsemblGenomes-Gn; EBG00001206947.
DR   EnsemblGenomes-Gn; EBG00001206948.
DR   EnsemblGenomes-Gn; EBG00001206949.
DR   EnsemblGenomes-Gn; EBG00001206950.
DR   EnsemblGenomes-Gn; EBG00001206951.
DR   EnsemblGenomes-Gn; EBG00001206952.
DR   EnsemblGenomes-Gn; EBG00001206953.
DR   EnsemblGenomes-Gn; EBG00001206954.
DR   EnsemblGenomes-Gn; EBG00001206955.
DR   EnsemblGenomes-Gn; EBG00001206956.
DR   EnsemblGenomes-Gn; EBG00001206957.
DR   EnsemblGenomes-Gn; EBG00001206958.
DR   EnsemblGenomes-Gn; EBG00001206959.
DR   EnsemblGenomes-Gn; EBG00001206960.
DR   EnsemblGenomes-Gn; EBG00001206961.
DR   EnsemblGenomes-Gn; EBG00001206962.
DR   EnsemblGenomes-Gn; EBG00001206963.
DR   EnsemblGenomes-Gn; EBG00001206964.
DR   EnsemblGenomes-Gn; EBG00001206965.
DR   EnsemblGenomes-Gn; EBG00001206966.
DR   EnsemblGenomes-Gn; EBG00001206967.
DR   EnsemblGenomes-Gn; EBG00001206968.
DR   EnsemblGenomes-Gn; EBG00001206969.
DR   EnsemblGenomes-Gn; EBG00001206970.
DR   EnsemblGenomes-Gn; EBG00001206971.
DR   EnsemblGenomes-Gn; EBG00001206972.
DR   EnsemblGenomes-Gn; EBG00001206973.
DR   EnsemblGenomes-Gn; EBG00001206974.
DR   EnsemblGenomes-Gn; EBG00001206975.
DR   EnsemblGenomes-Gn; EBG00001206976.
DR   EnsemblGenomes-Gn; EBG00001206977.
DR   EnsemblGenomes-Gn; EBG00001206978.
DR   EnsemblGenomes-Gn; EBG00001206979.
DR   EnsemblGenomes-Gn; EBG00001206980.
DR   EnsemblGenomes-Gn; EBG00001206981.
DR   EnsemblGenomes-Gn; EBG00001206982.
DR   EnsemblGenomes-Gn; EBG00001206983.
DR   EnsemblGenomes-Gn; EBG00001206984.
DR   EnsemblGenomes-Gn; EBG00001206985.
DR   EnsemblGenomes-Gn; EBG00001206986.
DR   EnsemblGenomes-Gn; EBG00001206987.
DR   EnsemblGenomes-Gn; EBG00001206988.
DR   EnsemblGenomes-Gn; EBG00001206989.
DR   EnsemblGenomes-Gn; EBG00001206990.
DR   EnsemblGenomes-Gn; EBG00001206991.
DR   EnsemblGenomes-Gn; EBG00001206992.
DR   EnsemblGenomes-Gn; EBG00001206993.
DR   EnsemblGenomes-Gn; EBG00001206994.
DR   EnsemblGenomes-Gn; EBG00001206995.
DR   EnsemblGenomes-Gn; EBG00001206996.
DR   EnsemblGenomes-Gn; EBG00001206997.
DR   EnsemblGenomes-Gn; EBG00001206998.
DR   EnsemblGenomes-Gn; EBG00001206999.
DR   EnsemblGenomes-Gn; EBG00001207000.
DR   EnsemblGenomes-Gn; EBG00001207001.
DR   EnsemblGenomes-Gn; EBG00001207002.
DR   EnsemblGenomes-Gn; EBG00001207003.
DR   EnsemblGenomes-Gn; EBG00001207004.
DR   EnsemblGenomes-Gn; EBG00001207005.
DR   EnsemblGenomes-Gn; EBG00001207006.
DR   EnsemblGenomes-Gn; EBG00001207007.
DR   EnsemblGenomes-Gn; EBG00001207008.
DR   EnsemblGenomes-Gn; EBG00001207009.
DR   EnsemblGenomes-Gn; EBG00001207010.
DR   EnsemblGenomes-Gn; EBG00001207011.
DR   EnsemblGenomes-Gn; EBG00001207012.
DR   EnsemblGenomes-Gn; EBG00001207013.
DR   EnsemblGenomes-Gn; EBG00001207014.
DR   EnsemblGenomes-Gn; EBG00001207015.
DR   EnsemblGenomes-Gn; EBG00001207016.
DR   EnsemblGenomes-Gn; EBG00001207017.
DR   EnsemblGenomes-Gn; EBG00001207018.
DR   EnsemblGenomes-Gn; EBG00001207019.
DR   EnsemblGenomes-Gn; EBG00001207020.
DR   EnsemblGenomes-Gn; EBG00001207021.
DR   EnsemblGenomes-Gn; EBG00001207022.
DR   EnsemblGenomes-Gn; EBG00001207023.
DR   EnsemblGenomes-Gn; EBG00001207024.
DR   EnsemblGenomes-Gn; EBG00001207025.
DR   EnsemblGenomes-Gn; EBG00001207026.
DR   EnsemblGenomes-Gn; EBG00001207027.
DR   EnsemblGenomes-Gn; EBG00001207028.
DR   EnsemblGenomes-Gn; EBG00001207029.
DR   EnsemblGenomes-Gn; EBG00001207030.
DR   EnsemblGenomes-Gn; EBG00001207031.
DR   EnsemblGenomes-Gn; EBG00001207032.
DR   EnsemblGenomes-Gn; EBG00001207033.
DR   EnsemblGenomes-Gn; EBG00001207034.
DR   EnsemblGenomes-Gn; EBG00001207035.
DR   EnsemblGenomes-Gn; EBG00001207036.
DR   EnsemblGenomes-Gn; EBG00001207037.
DR   EnsemblGenomes-Gn; EBG00001207038.
DR   EnsemblGenomes-Gn; EBG00001207039.
DR   EnsemblGenomes-Gn; EBG00001207040.
DR   EnsemblGenomes-Gn; EBG00001207041.
DR   EnsemblGenomes-Gn; EBG00001207042.
DR   EnsemblGenomes-Gn; EBG00001207043.
DR   EnsemblGenomes-Gn; EBG00001207044.
DR   EnsemblGenomes-Gn; EBG00001207045.
DR   EnsemblGenomes-Gn; EBG00001207046.
DR   EnsemblGenomes-Gn; EBG00001207047.
DR   EnsemblGenomes-Gn; EBG00001207048.
DR   EnsemblGenomes-Gn; EBG00001207049.
DR   EnsemblGenomes-Gn; EBG00001207050.
DR   EnsemblGenomes-Gn; EBG00001207051.
DR   EnsemblGenomes-Gn; EBG00001207052.
DR   EnsemblGenomes-Gn; EBG00001207053.
DR   EnsemblGenomes-Gn; EBG00001207054.
DR   EnsemblGenomes-Gn; XCV_tRNA01.
DR   EnsemblGenomes-Gn; XCV_tRNA02.
DR   EnsemblGenomes-Gn; XCV_tRNA03.
DR   EnsemblGenomes-Gn; XCV_tRNA04.
DR   EnsemblGenomes-Gn; XCV_tRNA05.
DR   EnsemblGenomes-Gn; XCV_tRNA06.
DR   EnsemblGenomes-Gn; XCV_tRNA07.
DR   EnsemblGenomes-Gn; XCV_tRNA08.
DR   EnsemblGenomes-Gn; XCV_tRNA09.
DR   EnsemblGenomes-Gn; XCV_tRNA10.
DR   EnsemblGenomes-Gn; XCV_tRNA11.
DR   EnsemblGenomes-Gn; XCV_tRNA12.
DR   EnsemblGenomes-Gn; XCV_tRNA13.
DR   EnsemblGenomes-Gn; XCV_tRNA14.
DR   EnsemblGenomes-Gn; XCV_tRNA15.
DR   EnsemblGenomes-Gn; XCV_tRNA16.
DR   EnsemblGenomes-Gn; XCV_tRNA17.
DR   EnsemblGenomes-Gn; XCV_tRNA18.
DR   EnsemblGenomes-Gn; XCV_tRNA19.
DR   EnsemblGenomes-Gn; XCV_tRNA20.
DR   EnsemblGenomes-Gn; XCV_tRNA21.
DR   EnsemblGenomes-Gn; XCV_tRNA22.
DR   EnsemblGenomes-Gn; XCV_tRNA23.
DR   EnsemblGenomes-Gn; XCV_tRNA24.
DR   EnsemblGenomes-Gn; XCV_tRNA25.
DR   EnsemblGenomes-Gn; XCV_tRNA26.
DR   EnsemblGenomes-Gn; XCV_tRNA27.
DR   EnsemblGenomes-Gn; XCV_tRNA28.
DR   EnsemblGenomes-Gn; XCV_tRNA29.
DR   EnsemblGenomes-Gn; XCV_tRNA30.
DR   EnsemblGenomes-Gn; XCV_tRNA31.
DR   EnsemblGenomes-Gn; XCV_tRNA32.
DR   EnsemblGenomes-Gn; XCV_tRNA33.
DR   EnsemblGenomes-Gn; XCV_tRNA34.
DR   EnsemblGenomes-Gn; XCV_tRNA35.
DR   EnsemblGenomes-Gn; XCV_tRNA36.
DR   EnsemblGenomes-Gn; XCV_tRNA37.
DR   EnsemblGenomes-Gn; XCV_tRNA38.
DR   EnsemblGenomes-Gn; XCV_tRNA39.
DR   EnsemblGenomes-Gn; XCV_tRNA40.
DR   EnsemblGenomes-Gn; XCV_tRNA41.
DR   EnsemblGenomes-Gn; XCV_tRNA42.
DR   EnsemblGenomes-Gn; XCV_tRNA43.
DR   EnsemblGenomes-Gn; XCV_tRNA44.
DR   EnsemblGenomes-Gn; XCV_tRNA45.
DR   EnsemblGenomes-Gn; XCV_tRNA46.
DR   EnsemblGenomes-Gn; XCV_tRNA47.
DR   EnsemblGenomes-Gn; XCV_tRNA48.
DR   EnsemblGenomes-Gn; XCV_tRNA49.
DR   EnsemblGenomes-Gn; XCV_tRNA50.
DR   EnsemblGenomes-Gn; XCV_tRNA51.
DR   EnsemblGenomes-Gn; XCV_tRNA52.
DR   EnsemblGenomes-Gn; XCV_tRNA53.
DR   EnsemblGenomes-Gn; XCV_tRNA54.
DR   EnsemblGenomes-Tr; EBG00000036295-1.
DR   EnsemblGenomes-Tr; EBG00000036296-1.
DR   EnsemblGenomes-Tr; EBG00000036297-1.
DR   EnsemblGenomes-Tr; EBG00000036298-1.
DR   EnsemblGenomes-Tr; EBT00001776577.
DR   EnsemblGenomes-Tr; EBT00001776578.
DR   EnsemblGenomes-Tr; EBT00001776579.
DR   EnsemblGenomes-Tr; EBT00001776580.
DR   EnsemblGenomes-Tr; EBT00001776581.
DR   EnsemblGenomes-Tr; EBT00001776582.
DR   EnsemblGenomes-Tr; EBT00001776583.
DR   EnsemblGenomes-Tr; EBT00001776584.
DR   EnsemblGenomes-Tr; EBT00001776585.
DR   EnsemblGenomes-Tr; EBT00001776586.
DR   EnsemblGenomes-Tr; EBT00001776587.
DR   EnsemblGenomes-Tr; EBT00001776588.
DR   EnsemblGenomes-Tr; EBT00001776589.
DR   EnsemblGenomes-Tr; EBT00001776590.
DR   EnsemblGenomes-Tr; EBT00001776591.
DR   EnsemblGenomes-Tr; EBT00001776592.
DR   EnsemblGenomes-Tr; EBT00001776593.
DR   EnsemblGenomes-Tr; EBT00001776594.
DR   EnsemblGenomes-Tr; EBT00001776595.
DR   EnsemblGenomes-Tr; EBT00001776596.
DR   EnsemblGenomes-Tr; EBT00001776597.
DR   EnsemblGenomes-Tr; EBT00001776598.
DR   EnsemblGenomes-Tr; EBT00001776599.
DR   EnsemblGenomes-Tr; EBT00001776600.
DR   EnsemblGenomes-Tr; EBT00001776601.
DR   EnsemblGenomes-Tr; EBT00001776602.
DR   EnsemblGenomes-Tr; EBT00001776603.
DR   EnsemblGenomes-Tr; EBT00001776604.
DR   EnsemblGenomes-Tr; EBT00001776605.
DR   EnsemblGenomes-Tr; EBT00001776606.
DR   EnsemblGenomes-Tr; EBT00001776607.
DR   EnsemblGenomes-Tr; EBT00001776608.
DR   EnsemblGenomes-Tr; EBT00001776609.
DR   EnsemblGenomes-Tr; EBT00001776610.
DR   EnsemblGenomes-Tr; EBT00001776611.
DR   EnsemblGenomes-Tr; EBT00001776612.
DR   EnsemblGenomes-Tr; EBT00001776613.
DR   EnsemblGenomes-Tr; EBT00001776614.
DR   EnsemblGenomes-Tr; EBT00001776615.
DR   EnsemblGenomes-Tr; EBT00001776616.
DR   EnsemblGenomes-Tr; EBT00001776617.
DR   EnsemblGenomes-Tr; EBT00001776618.
DR   EnsemblGenomes-Tr; EBT00001776619.
DR   EnsemblGenomes-Tr; EBT00001776620.
DR   EnsemblGenomes-Tr; EBT00001776621.
DR   EnsemblGenomes-Tr; EBT00001776622.
DR   EnsemblGenomes-Tr; EBT00001776623.
DR   EnsemblGenomes-Tr; EBT00001776624.
DR   EnsemblGenomes-Tr; EBT00001776625.
DR   EnsemblGenomes-Tr; EBT00001776626.
DR   EnsemblGenomes-Tr; EBT00001776627.
DR   EnsemblGenomes-Tr; EBT00001776628.
DR   EnsemblGenomes-Tr; EBT00001776629.
DR   EnsemblGenomes-Tr; EBT00001776630.
DR   EnsemblGenomes-Tr; EBT00001776631.
DR   EnsemblGenomes-Tr; EBT00001776632.
DR   EnsemblGenomes-Tr; EBT00001776633.
DR   EnsemblGenomes-Tr; EBT00001776634.
DR   EnsemblGenomes-Tr; EBT00001776635.
DR   EnsemblGenomes-Tr; EBT00001776636.
DR   EnsemblGenomes-Tr; EBT00001776637.
DR   EnsemblGenomes-Tr; EBT00001776638.
DR   EnsemblGenomes-Tr; EBT00001776639.
DR   EnsemblGenomes-Tr; EBT00001776640.
DR   EnsemblGenomes-Tr; EBT00001776641.
DR   EnsemblGenomes-Tr; EBT00001776642.
DR   EnsemblGenomes-Tr; EBT00001776643.
DR   EnsemblGenomes-Tr; EBT00001776644.
DR   EnsemblGenomes-Tr; EBT00001776645.
DR   EnsemblGenomes-Tr; EBT00001776646.
DR   EnsemblGenomes-Tr; EBT00001776647.
DR   EnsemblGenomes-Tr; EBT00001776648.
DR   EnsemblGenomes-Tr; EBT00001776649.
DR   EnsemblGenomes-Tr; EBT00001776650.
DR   EnsemblGenomes-Tr; EBT00001776651.
DR   EnsemblGenomes-Tr; EBT00001776652.
DR   EnsemblGenomes-Tr; EBT00001776653.
DR   EnsemblGenomes-Tr; EBT00001776654.
DR   EnsemblGenomes-Tr; EBT00001776655.
DR   EnsemblGenomes-Tr; EBT00001776656.
DR   EnsemblGenomes-Tr; EBT00001776657.
DR   EnsemblGenomes-Tr; EBT00001776658.
DR   EnsemblGenomes-Tr; EBT00001776659.
DR   EnsemblGenomes-Tr; EBT00001776660.
DR   EnsemblGenomes-Tr; EBT00001776661.
DR   EnsemblGenomes-Tr; EBT00001776662.
DR   EnsemblGenomes-Tr; EBT00001776663.
DR   EnsemblGenomes-Tr; EBT00001776664.
DR   EnsemblGenomes-Tr; EBT00001776665.
DR   EnsemblGenomes-Tr; EBT00001776666.
DR   EnsemblGenomes-Tr; EBT00001776667.
DR   EnsemblGenomes-Tr; EBT00001776668.
DR   EnsemblGenomes-Tr; EBT00001776669.
DR   EnsemblGenomes-Tr; EBT00001776670.
DR   EnsemblGenomes-Tr; EBT00001776671.
DR   EnsemblGenomes-Tr; EBT00001776672.
DR   EnsemblGenomes-Tr; EBT00001776673.
DR   EnsemblGenomes-Tr; EBT00001776674.
DR   EnsemblGenomes-Tr; EBT00001776675.
DR   EnsemblGenomes-Tr; EBT00001776676.
DR   EnsemblGenomes-Tr; EBT00001776677.
DR   EnsemblGenomes-Tr; EBT00001776678.
DR   EnsemblGenomes-Tr; EBT00001776679.
DR   EnsemblGenomes-Tr; EBT00001776680.
DR   EnsemblGenomes-Tr; EBT00001776681.
DR   EnsemblGenomes-Tr; EBT00001776682.
DR   EnsemblGenomes-Tr; EBT00001776683.
DR   EnsemblGenomes-Tr; EBT00001776684.
DR   EnsemblGenomes-Tr; EBT00001776685.
DR   EnsemblGenomes-Tr; EBT00001776686.
DR   EnsemblGenomes-Tr; EBT00001776687.
DR   EnsemblGenomes-Tr; EBT00001776688.
DR   EnsemblGenomes-Tr; EBT00001776689.
DR   EnsemblGenomes-Tr; EBT00001776690.
DR   EnsemblGenomes-Tr; EBT00001776691.
DR   EnsemblGenomes-Tr; EBT00001776692.
DR   EnsemblGenomes-Tr; EBT00001776693.
DR   EnsemblGenomes-Tr; EBT00001776694.
DR   EnsemblGenomes-Tr; EBT00001776695.
DR   EnsemblGenomes-Tr; EBT00001776696.
DR   EnsemblGenomes-Tr; EBT00001776697.
DR   EnsemblGenomes-Tr; EBT00001776698.
DR   EnsemblGenomes-Tr; EBT00001776699.
DR   EnsemblGenomes-Tr; EBT00001776700.
DR   EnsemblGenomes-Tr; EBT00001776701.
DR   EnsemblGenomes-Tr; EBT00001776702.
DR   EnsemblGenomes-Tr; EBT00001776703.
DR   EnsemblGenomes-Tr; EBT00001776704.
DR   EnsemblGenomes-Tr; EBT00001776705.
DR   EnsemblGenomes-Tr; EBT00001776706.
DR   EnsemblGenomes-Tr; XCV_tRNA01-1.
DR   EnsemblGenomes-Tr; XCV_tRNA02-1.
DR   EnsemblGenomes-Tr; XCV_tRNA03-1.
DR   EnsemblGenomes-Tr; XCV_tRNA04-1.
DR   EnsemblGenomes-Tr; XCV_tRNA05-1.
DR   EnsemblGenomes-Tr; XCV_tRNA06-1.
DR   EnsemblGenomes-Tr; XCV_tRNA07-1.
DR   EnsemblGenomes-Tr; XCV_tRNA08-1.
DR   EnsemblGenomes-Tr; XCV_tRNA09-1.
DR   EnsemblGenomes-Tr; XCV_tRNA10-1.
DR   EnsemblGenomes-Tr; XCV_tRNA11-1.
DR   EnsemblGenomes-Tr; XCV_tRNA12-1.
DR   EnsemblGenomes-Tr; XCV_tRNA13-1.
DR   EnsemblGenomes-Tr; XCV_tRNA14-1.
DR   EnsemblGenomes-Tr; XCV_tRNA15-1.
DR   EnsemblGenomes-Tr; XCV_tRNA16-1.
DR   EnsemblGenomes-Tr; XCV_tRNA17-1.
DR   EnsemblGenomes-Tr; XCV_tRNA18-1.
DR   EnsemblGenomes-Tr; XCV_tRNA19-1.
DR   EnsemblGenomes-Tr; XCV_tRNA20-1.
DR   EnsemblGenomes-Tr; XCV_tRNA21-1.
DR   EnsemblGenomes-Tr; XCV_tRNA22-1.
DR   EnsemblGenomes-Tr; XCV_tRNA23-1.
DR   EnsemblGenomes-Tr; XCV_tRNA24-1.
DR   EnsemblGenomes-Tr; XCV_tRNA25-1.
DR   EnsemblGenomes-Tr; XCV_tRNA26-1.
DR   EnsemblGenomes-Tr; XCV_tRNA27-1.
DR   EnsemblGenomes-Tr; XCV_tRNA28-1.
DR   EnsemblGenomes-Tr; XCV_tRNA29-1.
DR   EnsemblGenomes-Tr; XCV_tRNA30-1.
DR   EnsemblGenomes-Tr; XCV_tRNA31-1.
DR   EnsemblGenomes-Tr; XCV_tRNA32-1.
DR   EnsemblGenomes-Tr; XCV_tRNA33-1.
DR   EnsemblGenomes-Tr; XCV_tRNA34-1.
DR   EnsemblGenomes-Tr; XCV_tRNA35-1.
DR   EnsemblGenomes-Tr; XCV_tRNA36-1.
DR   EnsemblGenomes-Tr; XCV_tRNA37-1.
DR   EnsemblGenomes-Tr; XCV_tRNA38-1.
DR   EnsemblGenomes-Tr; XCV_tRNA39-1.
DR   EnsemblGenomes-Tr; XCV_tRNA40-1.
DR   EnsemblGenomes-Tr; XCV_tRNA41-1.
DR   EnsemblGenomes-Tr; XCV_tRNA42-1.
DR   EnsemblGenomes-Tr; XCV_tRNA43-1.
DR   EnsemblGenomes-Tr; XCV_tRNA44-1.
DR   EnsemblGenomes-Tr; XCV_tRNA45-1.
DR   EnsemblGenomes-Tr; XCV_tRNA46-1.
DR   EnsemblGenomes-Tr; XCV_tRNA47-1.
DR   EnsemblGenomes-Tr; XCV_tRNA48-1.
DR   EnsemblGenomes-Tr; XCV_tRNA49-1.
DR   EnsemblGenomes-Tr; XCV_tRNA50-1.
DR   EnsemblGenomes-Tr; XCV_tRNA51-1.
DR   EnsemblGenomes-Tr; XCV_tRNA52-1.
DR   EnsemblGenomes-Tr; XCV_tRNA53-1.
DR   EnsemblGenomes-Tr; XCV_tRNA54-1.
DR   EuropePMC; PMC1272972; 16237009.
DR   EuropePMC; PMC1489615; 16751505.
DR   EuropePMC; PMC2246292; 17927820.
DR   EuropePMC; PMC2493286; 18502858.
DR   EuropePMC; PMC2772435; 19749062.
DR   EuropePMC; PMC3060682; 21193578.
DR   EuropePMC; PMC3131649; 21515727.
DR   EuropePMC; PMC3264282; 22123704.
DR   EuropePMC; PMC3321045; 22493725.
DR   EuropePMC; PMC3364877; 22404966.
DR   EuropePMC; PMC3591321; 23505513.
DR   EuropePMC; PMC3838355; 24278159.
DR   EuropePMC; PMC4907191; 27107122.
DR   EuropePMC; PMC5117858; 27904456.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01811; PtaRNA1.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02222; sX2.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02224; sX5.
DR   RFAM; RF02225; sX6.
DR   RFAM; RF02226; sX7.
DR   RFAM; RF02227; sX8.
DR   RFAM; RF02228; sX9.
DR   RFAM; RF02230; sX11.
DR   RFAM; RF02231; sX12.
DR   RFAM; RF02232; sX13.
DR   RFAM; RF02233; sX14.
DR   RFAM; RF02235; asX1.
DR   RFAM; RF02236; asX2.
DR   RFAM; RF02237; asX3.
DR   RFAM; RF02238; asX4.
DR   RFAM; RF02240; Xoo1.
DR   RFAM; RF02241; Xoo2.
DR   RFAM; RF02242; Xoo5.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; AM039952.
DR   SILVA-SSU; AM039952.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5178466
FT                   /organism="Xanthomonas euvesicatoria"
FT                   /strain="85-10"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:456327"
FT   CDS_pept        1..1329
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="XCV0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21632"
FT                   /db_xref="GOA:Q3BZT1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21632.1"
FT                   /translation="MDAWPRCLERLEAEFPPEDVHTWLKPLQAEDRGDSIVLYAPNAFI
FT                   VDQVRERYLPRIRELLAYFAGNGEVALAVGSRPRAPEPAPAAAAVPSAPQAAPMVPFAG
FT                   NLDSHYTFANFVEGRSNQLGLAAAIQAAQRPGDRAHNPLLLYGSTGLGKTHLMFAAGNA
FT                   LRQANPAAKVMYLRSEQFFSAMIRALQDKAMDQFKRQFQQIDALLIDDIQFFAGKDRTQ
FT                   EEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIV
FT                   LAKARERGAEIPDDVAFLIAKKMRSNVRDLEGALNTLVARANFTGRSITVEFAQETLRD
FT                   LLRAQQQAIGIPNIQKTVADYYGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPE
FT                   IGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKLSE"
FT   CDS_pept        1606..2706
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="XCV0002"
FT                   /product="DNA polymerase III beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21633"
FT                   /db_xref="GOA:Q3BZT0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21633.1"
FT                   /translation="MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLT
FT                   GTDLEVEMISRTLVEDAQDGETTIPARKLFDILRALPDGSRVTISQTGDKVTVQAGRSR
FT                   FTLATLPSNDFPSVDEVEATERVVVPEAGLKELIERTAFAMAQQDVRYYLNGLLFDLRD
FT                   GLLRCVATDGHRLALCEMELEKAGGAKRQIIVPRKGVTELQRLLEGADREVELEVGRSH
FT                   IRVKRGDVTFTSKLIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGV
FT                   RVEVSPGQLKISAHNPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALRDEHVVIQL
FT                   RDANSSALVREASSEKSRHVVMPLRL"
FT   CDS_pept        3750..4856
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="XCV0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21634"
FT                   /db_xref="GOA:Q3BZS9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21634.1"
FT                   /translation="MHVVRLSIHRLRRFHTVELHPSSTLNLLTGDNGAGKTSVLEALHL
FT                   MAYGRSFRGRVRDGLIQQGANDLEVFVEWKEGNGAAGERTRRAGLRHRGQEWTGRLDGE
FT                   DVAQLGALCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHVEPDFLTMWRRYARALK
FT                   QRNALLKQGAQPRMLDAWDHELAESGESLTSRRTRYLERLQERLVPVADAIAPALGLSA
FT                   LTFAPGWKRHEVSLADALLLARERDRQNGYTSQGPHRADWVPSFQALPGRDALSRGQAK
FT                   LTALACLLAQAEDFAYERGEWPVIALDDLGSELDRHHQGRVLQRLASAPAQVLITATET
FT                   PPGLADAGALLQQFHVEHGHITRQAAAH"
FT   CDS_pept        4917..7415
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="XCV0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21635"
FT                   /db_xref="GOA:Q3BZS8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21635.1"
FT                   /translation="MRSGYRRLRPCCGANGTRMTDEQNIPPTPNGTYDSSKITVLRGLE
FT                   AVRKRPGMYIGDVHDGTGLHHMVFEVVDNSVDEALAGHADDIVVKILADGSVAVSDNGR
FT                   GVPVDIHKEEGVSAAEVILTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEHLWLDIW
FT                   RDGFHYQQEYALGEPQYPLKQLEASTKRGTTLRFKPSVAIFSDVEFHYDILARRLRELS
FT                   FLNSGVKITLIDERGEGRRDDFHYEGGIRSFVEHLAQLKSPLHPNVISVTGEHNGIMVD
FT                   VALQWTDAYQETMYCFTNNIPQKDGGTHLAGFRAALTRVLSTYIEQNGIAKQAKVALTG
FT                   DDMREGMIAVLSVKVPDPSFSSQTKEKLVSSDVRPAVENAFGARLQEFLQENPNEAKAI
FT                   TGKIVDAARAREAARKARDLTRRKGALDIAGLPGKLADCQEKDPALSELFIVEGDSAGG
FT                   SAKQGRNRKNQAVLPLRGKILNVERARFDRMLASDQVGTLITALGTGIGRDEYNPDKLR
FT                   YHRIILMTDADVDGSHIRTLLLTFFYRQMPELIERGYIYIGLPPLYKLKQGKSELYLKD
FT                   DAALNAYLASNAVEGAALIPATDEPPITGEALEKLLMLFTSANEAIARNAHRYDPALLT
FT                   ALIDLPPLDVEKLQAEGDQHPTLDALQAVLNRGTLGTARYQLRFDPGSENAPATLVAIR
FT                   RHMGEEFTQVLPMGAFESGELRPLREVSLALHDLVREGAQIVRGNKSHPITSFAQAHAW
FT                   LLDEAKKGRQVQRFKGLGEMNAEQLWETTVNPDTRRLLQVRIEDAVAADQIFSTLMGDV
FT                   VEPRRDFIEDNALKVSNLDI"
FT   CDS_pept        7484..8320
FT                   /transl_table=11
FT                   /locus_tag="XCV0005"
FT                   /product="putative membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21636"
FT                   /db_xref="GOA:Q3BZS7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21636.1"
FT                   /translation="MRTDLPPPPAPRTVAGKPPLLPVLVGFWVDVLIAAGLLLTLSVAG
FT                   FALWGAVRGFGHVQAAKAQGLTPSPTEVMAAIGQPGVMVQLLTALVSTATPALLLYYWR
FT                   RRATAAEQTASRAAARRASTWGWTALVAAAVFLLSNLVSVAASALGIKPVPTNLPLMED
FT                   ALQQWPLALTLFAVVIAPAYEELLFRRVLFGRLLAAGRPWLGIVLSGAIFALVHEVPGI
FT                   SGNGPAAIAQLWLVYGSMGAAFAWLYWRTGTLWAPIAAHGINNATALAALYFFGLG"
FT   CDS_pept        8504..9271
FT                   /transl_table=11
FT                   /locus_tag="XCV0006"
FT                   /product="putative peptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21637"
FT                   /db_xref="GOA:Q3BZS6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21637.1"
FT                   /translation="MKARLLIVVAVLALTACATTTSPTGRRQVVGGVSQQQLDQLGAQS
FT                   FAQTKAKEKVSTDGKQNAYVQCVVNALVAQLQPQWRETKWETALFVDNEANAFALPGGK
FT                   VGVNTGIFTVAKTQDQLAAVLGHEIGHVISRHHEERITRQLGAQTGLGIIGALAGAAYG
FT                   DGAASAVNQVGGMTAQTVFLLPGSRTQESEADVVGQRLMAQAGFDPAQAVTLWQNMMAA
FT                   SGNRQPQWLSTHPDPANRIRELQADVAQLEPVY"
FT   sig_peptide     8504..8557
FT                   /locus_tag="XCV0006"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        9588..10781
FT                   /transl_table=11
FT                   /locus_tag="XCV0007"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21638"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21638.1"
FT                   /translation="MKLLNRKQALLSLFIAASLGGAVVTDAVAQSDRSSERASRKSKSG
FT                   KAEELYPQSTRQAPTIKPSSKLSSKLQKLIETFNKGEDYQGVRTQADEILANSAANDAD
FT                   KALAAQLAAQAAYNLGDTAAAKKYLQQAIGLNALDNNGQFQSMLMLAQLQMQDDQQAEG
FT                   LATLDKYLEESKSQRPEDLILKGQALYQTERYKEAIPVLKQAIAASPEPKDSWNQLLMA
FT                   SYAEAGQTGEAVAAAEALAAKTPNDKKAQLNLANMYMQADQMDKAAGVMDKLRASGQLT
FT                   EEKEYKQLYSIYANTENKEKDVIAVINEGMQKGILKPDYQTYLALAQSYYYSDDVPKAI
FT                   ENWQKAAPLSKDGETYLNLAKVLHSEGRIPEAKQAAQQAIAKGVKKPEDAKKIINLK"
FT   sig_peptide     9588..9674
FT                   /locus_tag="XCV0007"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        10935..11606
FT                   /transl_table=11
FT                   /gene="tonB1"
FT                   /locus_tag="XCV0008"
FT                   /product="energy transducer TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21639"
FT                   /db_xref="GOA:Q3BZS4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21639.1"
FT                   /translation="MTEQLVIHRHDYDAGNQGLSWARIIGIAFVIALHLTALMMLLIPA
FT                   VAPKAPAEKERTTMVTLVDAPPPPPPPPPPPPPEDKPPPPVKNLSPPKPSPVPPPPEAP
FT                   VVDVPEPRPSDIVTPPSPPSPPAPPSDIGASVDISSKNMNPPKYPPAAFRAGVQGEVIL
FT                   IVDVDASGNVTNVSVEKSSRNRDLDRAAMDAARKWKFNASTVNGQKAAGRVRVPVNFAL
FT                   N"
FT   CDS_pept        11692..12453
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /locus_tag="XCV0009"
FT                   /product="biopolymer transport ExbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21640"
FT                   /db_xref="GOA:Q3BZS3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21640.1"
FT                   /translation="MLQEFFIAAAAGGSNPSAALSQMGFEHLITEMTSSPGDFAVSWVV
FT                   LITLIAMSAASWYWTVINIFRATRLKSAADRVTTAFWDAPNAQDAIRAMEEQPASEPFS
FT                   KIALDAAQAAAHHQRAEGSTGGLGESLSRSEFVDRALRQAVTRESTKLQSGMTLLATVG
FT                   ATAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAVFAFN
FT                   FFSKVNSSVIAKFDTFAHDLHDFFATGSRVR"
FT   CDS_pept        12500..12922
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /locus_tag="XCV0010"
FT                   /product="biopolymer transport ExbD protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21641"
FT                   /db_xref="GOA:Q3BZS2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21641.1"
FT                   /translation="MAFSSGNSGGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKVE
FT                   LPEANLIQKEDAEKRAAPITLAVKEDGSLYWNDEPISKEALESRLSTAAQQTPQPPLNL
FT                   RGDRTTKMRTINEITKIAQGQGMLDVGFVATKVKGQ"
FT   CDS_pept        12926..13339
FT                   /transl_table=11
FT                   /gene="exbD2"
FT                   /locus_tag="XCV0011"
FT                   /product="biopolymer transport ExbD protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21642"
FT                   /db_xref="GOA:Q3BZS1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21642.1"
FT                   /translation="MAFSTGGSRGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVD
FT                   LPQRVLNPPPQTTEPPPPIELRIDASNQVFWNNSPTPVDVLQQKMEEVVQADPTNQPEL
FT                   RIDANPDAEYEVMAKVLAAAKNSQMKKIGFMQQ"
FT   CDS_pept        13586..13993
FT                   /transl_table=11
FT                   /gene="exbD3"
FT                   /locus_tag="XCV0012"
FT                   /product="biopolymer transport ExbD protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21643"
FT                   /db_xref="GOA:Q3BZS0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21643.1"
FT                   /translation="MAFSTTGNRGPLAEINVTPLVDVMLVLLIIFIVTAPMVTRTIAVD
FT                   LPQHSSQVTTRPEPAAPIALRVDADAQLFWNANPVTLQQLQSRLIEQMQATAGHQPELR
FT                   IAASGDAEYAGVASVLAAAKNAQVQRIAFVQ"
FT   CDS_pept        complement(14248..15015)
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="XCV0013"
FT                   /product="pyridoxal phosphate biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21644"
FT                   /db_xref="GOA:Q3BZR9"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21644.1"
FT                   /translation="MTTQLSVNVNKIAVLRNSRGGADPDVVQAARACIAAGAHGITVHP
FT                   RPDQRHIRADDVLALSALTRAQAVEFNIEGNPFAPPRAGYPGLLELCRATRPQQITLVP
FT                   DGDGQLTSDHGFDFAQDTTQLAELITAFKQLGSRVSLFVDAGNPDIARAAALGADRIEL
FT                   YTGPYAHAHASGQADATLALFADAAQRASAAGLGINAGHDLSQANLGDFLAAVPGVLEV
FT                   SIGHALISEALYQGLDASVRAYVDILRGSHVSA"
FT   CDS_pept        complement(15023..15292)
FT                   /transl_table=11
FT                   /locus_tag="XCV0014"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21645"
FT                   /db_xref="GOA:Q3BZR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21645.1"
FT                   /translation="MHWLFLLMALGALVLAFSTPHVWLLVVSLLVALVLLLLWTRGWFA
FT                   SRMGDTQRDTSSMIDPAELRRLRELAEARKSAALAAARDSEPQA"
FT   CDS_pept        complement(15368..16828)
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="XCV0015"
FT                   /product="cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21646"
FT                   /db_xref="GOA:Q3BZR7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21646.1"
FT                   /translation="MLALAQGAWEWLATIPHLEALLLAAYVLYLLWIAGWIVLQKREPV
FT                   ATLSWVLSLAALPYLGLLIYYWLGPQKVKRQRLRRGRSRSGMESYSSVCPPDADCTELA
FT                   KIAQSTTGLAPSSATEVHWLVDGAATYAAIIEAIRGARDHIHLEYYIFQPDHSGTAICA
FT                   ALMERARAGVKVRLLMDAIGSSAMTRRALRTLREAGVETAWFHPSQLLKPFKRPWLNLR
FT                   THRKVIVIDGRVGFTGGINVTDDENEQVRKQAYRDLHVRLQGHVVRSLQLVFLEDWLYA
FT                   TGQGRAAFHGQQLWPDDVPTRAQGTVDAQVLVSGPDSSWEAIHRLMVAAIHEAKHRVWL
FT                   VTPYFVPGEAARMALTSAALGGLDVRLLVPRVSDSRLVTYAARSYFDELLEAGVRIYEY
FT                   GPRMLHTKALLADDDVCIVGSANFDSRSFRLNFELSMLFRDQAVAAEMAGLIGTDLQQA
FT                   QEVQFARHRPLWRSRLPEAFARLLSPLL"
FT   CDS_pept        17004..17930
FT                   /transl_table=11
FT                   /locus_tag="XCV0016"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21647"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21647.1"
FT                   /translation="MKAVTLVQQGIETELLMMKMIAIFSSLVLLGFVGKATANDIHFCD
FT                   SCTQTQRGVLATQLTSGLGQVYIGDRTTGVPYLYTVNTVNGPVSVAPPGIQEQPVSQAD
FT                   ADQFAIYSSVYRSYGNIGTLNVKIDLANGTVAPSSVSRMVEVASDESSAFASAFDVRRE
FT                   GATRQQVIQWLEKNDWQVPNTGENFIFFIQQVLSNAYKWRSSEDYSIRIDTTFNDKSRA
FT                   IFAYDSAKRAIVYVEAYDSAGNLIGTSSSEPINVDYSSYESPGAASRPDYQRGIDWLTS
FT                   SGAATISGGTVTVGSGTVLVGDVVQVK"
FT   CDS_pept        17930..18520
FT                   /transl_table=11
FT                   /locus_tag="XCV0017"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21648"
FT                   /db_xref="GOA:Q3BZR5"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21648.1"
FT                   /translation="MRTIRIRERRLSLRFRETVLLAGTLACSVLFVATQSQIGLLCYAV
FT                   APILLLAFFVLQADLVWRGHKAAGAAFIMAVAAWLTFSALATYAFSGLVHAHIFLGTWL
FT                   KALLGAGFFAALFSLSVLLARKRSMSLYCYLAGSLAVVIAVAAVHPENSGDITVHCERG
FT                   SCAAGIIAFWPGAFQAADGNRPISVVLPQSGGD"
FT   CDS_pept        complement(18729..19856)
FT                   /transl_table=11
FT                   /locus_tag="XCV0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21649"
FT                   /db_xref="GOA:Q3BZR4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21649.1"
FT                   /translation="MQKNSFPGTSAAAERDVRSSRTVIKGRGTTAYVPGRFAVTTAVEI
FT                   DDGWGALDADGEAAMRPKTVVAEEIARSIISRNNSPDIGFSQSVNPYRGCEHGCVYCFA
FT                   RPSHAYLDLSPGLDFETRIFAKPNAAALLRAEIARPSYQCSPIALGINTDAYQPTERRL
FT                   HISRQCLQVLAQARHPVSFVTKAALIERDIDVLAEMAQHNLVSVYFSVTTLDNRLAAKM
FT                   EPRAAAPHARLRAMQALHAAGVPVGVLVAPVIPMINDKELERILEAAAAHGARSAGYVL
FT                   LRLPHELTQLWREWLELHYPDRAKHVMSLIQQMRGGKDYDSRFGKRMVGEGPFAELIAQ
FT                   RFSIAYRRLGFGRLPRLDTTQFRPPRPDTPQLNLF"
FT   CDS_pept        complement(20064..20777)
FT                   /transl_table=11
FT                   /locus_tag="XCV0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21650"
FT                   /db_xref="GOA:Q3BZR3"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21650.1"
FT                   /translation="MVRRMSQPDFIQITDNAIAREECVAIVQRMRQSQQLHPGRIGGGV
FT                   FPDLKHSRDLRISGMAEWAEVENRLQQAVFDGVLTYLRQYPQALISPLMLQVTMADGTA
FT                   HRLVAEDIVQMSDQALGDLARTCLRPGAINLQWYTADQGGYPYWHCELYPRDANADTLH
FT                   RHLLWTLYLNEEFEQGETEFLFQQRKARPRTGSLLIAPTAFTHTHRGNRPVGGDKFIAT
FT                   SWILFQSAQALYGGD"
FT   CDS_pept        complement(21039..22379)
FT                   /transl_table=11
FT                   /gene="fadL"
FT                   /locus_tag="XCV0020"
FT                   /product="FadL family outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21651"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21651.1"
FT                   /translation="MSTASTLSRATLLAVGIAGVLAVGQAHGAAFQLKENSAKGLGRAF
FT                   AGSGSAPDDASIIANNPAGMRQLDGRLFQADVSAISFSAKFQPDTAAYANGAPVSGGNG
FT                   GDAGMIAPVPAMYFHVPFGENDNMHLGTSLTVPFGFKTEYDRDWVGRYHGTKTELQAID
FT                   FNVAFSYDVNPYVSFGASVFAERLDIDLANAVDFGSVLAARRVPGFAPGSADGYSRIKG
FT                   DSTEVGFTLGGLFSIDENTHIGFSYRSQVEHKITDGTADFTVPGSAAAVLGVAAPGTFV
FT                   DTKGRATVKLPASATASFTHNVNEQWSIMADVTRTAWSKFDQVTVDFASNQPDSVLDFS
FT                   YRDTTFASIGADYRMSDTVTLRGGLAYDQTPTTAEHRDVRVPDASRKWVSLGMSWRPSA
FT                   QTEYNFGYTHLFTSDPTSDTRSATGDRLAGSYDVKGDVLAASINYKF"
FT   sig_peptide     complement(22296..22379)
FT                   /gene="fadL"
FT                   /locus_tag="XCV0020"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        22597..23289
FT                   /transl_table=11
FT                   /locus_tag="XCV0021"
FT                   /product="putative rhomboid family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21652"
FT                   /db_xref="GOA:Q3BZR1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21652.1"
FT                   /translation="MFVSLPSRKKPTPRWAVPLLFATVWLAYLWSISRPGEARNTLWLD
FT                   WGALSSGVSNLGDWWATLRDGSVLRLFTALFLHADWSHLLGNLVFLLIFGLPAERILGP
FT                   WRLLLLFLVGGAASNLAAIFAIGTPDRVIIGASGAVSALIGTYLALFPGAKLGVVLPLG
FT                   VFLEFIRVPAPLLIGAWALLQVVFAYIGPAFGMVAWSAHIAGFVFGIVYGLYVRAAIAR
FT                   RLRKRHGF"
FT   CDS_pept        23353..23718
FT                   /transl_table=11
FT                   /locus_tag="XCV0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21653"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21653.1"
FT                   /translation="MLRTSLSRRAPIIVCMSKSLYKVTFLNHGKVYELYAREVTGSHLW
FT                   GFNQIGELVFDVHDGLVVDPTEERLREEFGNTKTLHLPMQSIVRIEEVEKKGQSVIRDA
FT                   TTGDKVVTPFPSPIKPR"
FT   CDS_pept        23718..24710
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="XCV0023"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21654"
FT                   /db_xref="GOA:Q3BZQ9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21654.1"
FT                   /translation="MRIVVPDDYQGAVAQLPCLQQMQGHPVQVLGALGAELDARAASLA
FT                   DADALVLIRERTRVDAALLQRLPRLKLISQTGRVGAHVDVAACTASGVAVAEGVGSPVA
FT                   PAELTWALILSASRRLTDYQHALQQGRWQALGDPGLGRVLHGRTLGIWSYGRIGQRVAS
FT                   FGRAFGMQVLVWGGPASCAQAARDGFAVAGSREELFERSDVLSLHRRLTAQTRHDITAQ
FT                   DLARMRADALLVNTSRAELIAPGALLAALDAGRPAQAALDVFEHEPVLDPRDPLLRHAR
FT                   VLATPHLGYVERDSYALYFAAAFDNVLAFAAGTPRNLVNPEVLATTQRV"
FT   CDS_pept        complement(24877..26406)
FT                   /transl_table=11
FT                   /gene="ctp"
FT                   /locus_tag="XCV0024"
FT                   /product="periplasmic carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21655"
FT                   /db_xref="GOA:Q3BZQ8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21655.1"
FT                   /translation="MRVAVLSVALSLALFASPGWAQKAGPAAAQASADDPEANEAAVSK
FT                   VPLDEIRRFVAVYNAVKQAYVDPVEDKKLMHSAVRGLLSDLDPHSTYFDKEDAEAFDEQ
FT                   ATGAYDGIGVELLQQQDNTLKVIAPIDDTPAARAGIRAGDVIVAIDGKPIDASKAMEPL
FT                   RGESGSKVVLTIMRDKTPKPFDVTLQRETIRVASVRSKLLEPGYGYIRISTFQADTGAD
FT                   FQKNLKQLQAGGKLRGLVLDLRSNPGGLLTSAVQVADDLLDKGNIVSTRGRISISDAKF
FT                   DATPGDLLSGAPVVVLVDAGSASASEVLAGALRDNKRARIIGSRTFGKGSVQTVLPLDN
FT                   GDSVKLTTARYYTPSGKSIQASGIMPDVLLTPEPQPGDADVPASLTDYSEATLPGHLRG
FT                   DDEGEEGYSAGDVLPGDGPIAEALAELKQPGSVAKAQAARKAKAQAAQKAKPAKTGADP
FT                   KPAAARPATTDKPTSAEPAGKAKPATAPAAPAEPVQPAPPKDTPASTEPAN"
FT   sig_peptide     complement(26344..26406)
FT                   /gene="ctp"
FT                   /locus_tag="XCV0024"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(26511..27746)
FT                   /transl_table=11
FT                   /locus_tag="XCV0025"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21656"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21656.1"
FT                   /translation="MWLAAGVLACTLLGSVGASAQSQRETERKLQQLRDELKTISADRR
FT                   ELEGKRGTAAQQLRQADEKVAKTARALSETEAAMRAQEQHLSTLQQERAQLQRGLQSQR
FT                   TQLAALLRAADQVGRNAPLKVLLSQDTVGDATRMLADHRYVQNARAQRIHALTTQLDTL
FT                   AKVEQDIATRRQALDAARAQQKAQAATLQKDRSQQAATVAQLDDRYKQRAEREKAIGQD
FT                   AKALEQLLANLRAAAAKAEAERRAAAKRAAAEAAAQAKRSKTERSDRPGKTPPKVVANA
FT                   PAPKVGGLSWPVAGNLLARFNATLPDGHTSKGVLIGAPKGTTVTAVADGTVVFSDWMTG
FT                   YGMILIVDHGNGYMSLYAHNDTLLRDAGASIKRGDAVAKVGSSGGQGVPALYFELRRNG
FT                   QPVDPSSWLQRR"
FT   sig_peptide     complement(27687..27746)
FT                   /locus_tag="XCV0025"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        27907..28563
FT                   /transl_table=11
FT                   /locus_tag="XCV0026"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21657"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21657.1"
FT                   /translation="MKPQILLLALSLVCTSAWADEDVSKVNGKISADAGKTYGALETVN
FT                   GSIEIGAGAQTKNVETVNGGIRIGDNARTGGVETVNGSITLGQKVTVSGGLETVNGSIL
FT                   AERGSQISGGVETVNGSIGLVGTELGKGIETVNGDITVGVGSHVRGGIEVSKPSFGFSF
FT                   QPSRKPRVVIGPDAVVDGPLHFEREVNLYVHRSAKIGAVSGATARSFDSDVAPKD"
FT   sig_peptide     27907..27963
FT                   /locus_tag="XCV0026"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        28725..30521
FT                   /transl_table=11
FT                   /locus_tag="XCV0027"
FT                   /product="putative peptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21658"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21658.1"
FT                   /translation="MPRKILLCLAATLALAGCKREPAAAPGAPAAQTPTERAPTAPVSR
FT                   HTFSPEMTTGDFAELVKTLASDDFEGRGPGTPGEEKTVTYIRDQMQRIGLQPGNGDSWF
FT                   QEVPMVETTADASTAPSLRSGEQTRTLAFGTDIVVGTRTGQAEVKLDNSELVFVGYGVD
FT                   APEQQWNDYAGQEWKGKTVVMFVNDPGFHTDDAKLFDGKRMTYYGRWTYKFEEAARKGA
FT                   AAALIVHDTPGASYGWDVVKNSWSGPQYDLPAKDDPDPRLPVQGWISAETAKQLFANAG
FT                   LDLAQAYKDASKRGFKPVPLKASWSVDLKSTIAAKTSRNVVGVLPGTSHADEAVLYMAH
FT                   WDHLGKHPGERGDNIYNGAVDNATGVAGILEIADAFAHQDPKPARSVVFLAVTLEESGL
FT                   LGSKYYVANPSFPLDKIAAVINLDAMSVAGRARDVTVVGMGSSELEDILKPIAAMQGRT
FT                   LHAEATPQSGSYFRSDHFNFAKAGVPALYADGGEDLREGGTAAGRAAAEDYGRHRYHAP
FT                   GDEYDASTWKLDGTIEDLQVVYGVGKEVAAGERWPNWYPGNPFKAARDRMMAGKPGASA
FT                   ATAQPADADSAATQTHKAQSPR"
FT   sig_peptide     28725..28814
FT                   /locus_tag="XCV0027"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(30846..31289)
FT                   /transl_table=11
FT                   /locus_tag="XCV0028"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21659"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21659.1"
FT                   /translation="MTQRLMKTALIGALALLSQGALAQAADKPAKALTSGEVTSMLTAK
FT                   GYTKVHDVKFEHGVWTADARSGDGKDVDVHIDPVTGRVYGDQTTSKLSEADVRASLSTG
FT                   GYADVHDLKFKDGLWKADAKRNGQKVELHVDPEDGHVVSVEND"
FT   sig_peptide     complement(31221..31289)
FT                   /locus_tag="XCV0028"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(31584..32717)
FT                   /transl_table=11
FT                   /gene="egl1"
FT                   /locus_tag="XCV0029"
FT                   /product="cellulase precursor"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21660"
FT                   /db_xref="GOA:Q3BZQ3"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21660.1"
FT                   /translation="MSAVCFSLRALLRSTLLFIVFGSLSLAHAQTRALTYAGVNLSGAE
FT                   YASSKKPGVLNKDYMYPATNDYTYFAGVGMNTIRLPILWERLQPTANGELDPAQLALLQ
FT                   QAVARAKAAGMYLLIDIHNYAKYYGYKIGGPEVPVATFTDLWRRLALAFNSDNAVMFGL
FT                   MNEPNNISASEWAGAAQAAIDAIRRTGANNLILVPGALWTGAHSWYSPTNDGYSNATAL
FT                   TAIYDPLNRYAFEVHQYLDADSSGTSSTCVSSTIGAERLRNFTQWLRTNRKRGFLGEFG
FT                   TANNAVCNQALQGMLAHMETNADVWLGWTWWAAGSWWNLSYAYNVHPNKDGTDKPQMAI
FT                   LSPQAALATRAPVATAVARSSAASTSATSTSAARTTR"
FT   sig_peptide     complement(32631..32717)
FT                   /gene="egl1"
FT                   /locus_tag="XCV0029"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(32993..33280)
FT                   /transl_table=11
FT                   /locus_tag="XCV0030"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21661.1"
FT                   /translation="MCPRKRLRRPPDARAQVLSLLFATTAPVQARAGAAGNRHHTSLFH
FT                   PVASALSTGLSIAAIGHFSWSFRGKIEAAYACNLGGTSMRHGVMDMTSCH"
FT   sig_peptide     complement(33191..33280)
FT                   /locus_tag="XCV0030"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(33347..34399)
FT                   /transl_table=11
FT                   /gene="egl2"
FT                   /locus_tag="XCV0031"
FT                   /product="cellulase precursor"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21662"
FT                   /db_xref="GOA:Q3BZQ1"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21662.1"
FT                   /translation="MKSLTTRTRRPRCRALSLLLLALMPLAQAQSTSGLKYAGINLSGA
FT                   EIKSSQKPGVLNIGYHYPAADEYAYFAGKHMNTVRLPILWERLQPKAGGELDPAQLALI
FT                   RQAVANAKAANMYVIVDVHNYAKYYGHTIGSTKVPISTFNDLWRRLAIAFKSDNAVIFG
FT                   LMNEPYDIDPQAWARAAQASIDTIRKTGANNLILVPGALWTGAHSWYSTVAGQSNAVAM
FT                   ASIRDPLNRYAIEAHQYLDADSSGTSGGCVSATIGVERLRSFTEWLRLNKKRGFLAEFG
FT                   TGNTATCNLALNGMLGYMESNSDVWMGWSWWAAGAWWSRAYPFNVQPDAQGRDKPQMSI
FT                   LGPRARRITD"
FT   sig_peptide     complement(34313..34399)
FT                   /gene="egl2"
FT                   /locus_tag="XCV0031"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(34633..34866)
FT                   /transl_table=11
FT                   /locus_tag="XCV0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21663.1"
FT                   /translation="MDDARAISSNPRYRVDVRTKPAHCLPLWLALPGDSIANQATHRDG
FT                   QIGAAAQRHCTNAAAFARDVQHAIAQAMRATV"
FT   CDS_pept        complement(35167..36240)
FT                   /transl_table=11
FT                   /gene="egl3"
FT                   /locus_tag="XCV0033"
FT                   /product="cellulase precursor"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21664"
FT                   /db_xref="GOA:Q3BZP9"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21664.1"
FT                   /translation="MFRTPPHFPRLRIAALALTLLAATPLVQAKEPPGPKKDTAGLKYV
FT                   GVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGQLD
FT                   QAQLGLIKKSLEAAKANKQYLILDLHNYATYNGKRIGTSDVPAGALADLWRRLALEFKD
FT                   DKAVIFGLMNEPNGISAPDWANAAQGTINAIRKTGAKNLILVPGTAYTGAHSWRSTSYG
FT                   VSNAKALEILKDSGNNLAFEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQK
FT                   GFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFNVQPGKDGS
FT                   DKPQMAILSKYARRAGK"
FT   sig_peptide     complement(36154..36240)
FT                   /gene="egl3"
FT                   /locus_tag="XCV0033"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        36551..37609
FT                   /transl_table=11
FT                   /locus_tag="XCV0034"
FT                   /product="Zinc-containing alcohol dehydrogenase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21665"
FT                   /db_xref="GOA:Q3BZP8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21665.1"
FT                   /translation="MSTAHAYAAQAADQPLAPFVFERRAPGPHDVQIDIAYCGVCHSDL
FT                   HTARNEWHNTLYPSVPGHEIVGRVTAVGNAVTGFKVGDLAGVGCMVDSCRSCASCQEGE
FT                   EQYCEQGFTGTYNGPMFGGGENTYGGYSDHIVVDQKYVLRITHSDNLAAVAPLLCAGIT
FT                   TYSPLAHWKVGPGQKVGVVGLGGLGHMAVKIAKAMGATVVLFTTSESKRADAMRLGASE
FT                   VVISKDEAQMAAQYNTLDFILNTVAAPHNLDPFLNALKRDGAMVLVGVPEQSHPSPAVF
FT                   NLVMKRRTLAGSLIGGIRQTQEMLDFCAKHNIVSDIETIRADQINEAYERMLKSDVKYR
FT                   FVIDMATLDKAA"
FT   CDS_pept        complement(38332..38772)
FT                   /transl_table=11
FT                   /locus_tag="XCV0035"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21666"
FT                   /db_xref="GOA:Q3BZP7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21666.1"
FT                   /translation="MLRAMANSTTNLDKASKRVAWCCALVTAACTAIAVDWSFFATTGQ
FT                   VLIALLLFGVTALLGVTPYAIYSFFLPISNAGPAQKLFVLCTLIALSLVPNAWWIATTA
FT                   RTDGWNFFIVPVLQIFYLLIIVPFIIVLTHALWRRLDRRRYN"
FT   CDS_pept        complement(38809..40290)
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="XCV0036"
FT                   /product="glutamate synthase, beta subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21667"
FT                   /db_xref="GOA:Q3BZP6"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21667.1"
FT                   /translation="MSRKQAFQFLDLPRTMPTRIPVELRTSGDWGELYGKFDKADAQYQ
FT                   AGRCLDCGNPYCSWKCPVHNAIPQWLQLVQENRIEEAAALCHSTNPLPEVCGRVCPQDR
FT                   LCEGSCTLEEFGAVTIGAVEKYIVDTAFKMGWRPDLGNVQPTGHRVAVIGAGPAGLACA
FT                   DRLARAGIEAVVYDRYEQIGGLLQFGIPSFKLDKSVIGKRREILEGMGVQFRLGVEIGK
FT                   DVSIEQLLGEYDAVFLGTGAYRYTDGGLPGQDLKNVLPALPFLVQNSRIVSGNDPHGRP
FT                   IAGWEDQLALPDLSGKRVVVLGGGDTGMDCVRSAIRLGAAKVTCAYRRDEASMPGSARE
FT                   VANAREEGVRFLFNRQPLSIESGADDEAIGVTVVETRLGEPDASGRRNAVPVEGSESLL
FT                   EADVVIIAFGFSPTLPDWLASQGVEAGSNGRIVAPADCNGRLPYQTSNPRLFAGGDCVR
FT                   GADLVVTAVAEGRDAAGSIVQLLGVNAQVKEPAAA"
FT   CDS_pept        complement(40419..44891)
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="XCV0037"
FT                   /product="glutamate synthase, alpha subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21668"
FT                   /db_xref="GOA:Q3BZP5"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21668.1"
FT                   /translation="MAPRTRQGLNDYGLYNSVRDERDACGFGMVAQLDDQPSRALVDTA
FT                   IAALSRMTHRGGVAADGLTGDGCGLLIRKPDAFLRGLARDAGIPLGTRYAAGVVFLPLD
FT                   ESEAARCRAELEAQLQAAGVQLRGWRVVPTDDSVCGQLARDTLPRIEQLFVDAGAEQTE
FT                   DGFTLALFLARRRAEQQLQGVPDFYVTTLSPNGISYKGMVLPDKLSTFYPDLQRSDLSS
FT                   SAIVFHQRFSTNTLPRWPLAHPFRLLAHNGEINTIEGNRRWAQARSKVWQTPRFDIAEF
FT                   DPVISMHGSDSQSLDNMLELLIAGGMDLLQALRILVPPATQSLEFKDADLAAFYEFYGL
FT                   NTEPWDGPAGIVACDSRYAACMLDRNGLRPARWMLTSDRHFLVASEAGVWELPAERITR
FT                   KGKLGPGEMMAIDLKRGDLLDSDAIDRINRARAPYKQWLQQGVTYLQTELIDPSLVEEP
FT                   FSEQTLRSYHKLFQLSTEEVEQVLRPLAETEQEATGSMGDDTPMAVLSRQTRPLYDYFR
FT                   QAFAQVTNPPIDPLREGIAMSLTTQLGRETNIFHAGAETVNHVILNSPVLSQRKLRQLL
FT                   KMEQYVERNRLIDLSYSLEEGLKAGLERICQEVEAAARDGAVMLLLSDRYPVPDRPMAH
FT                   ALLATGAVHHHLCKVGLRCDVNLIIETGTARDPHHMACLLGVGATAVYPYLAYQTLFDL
FT                   GRRGILQLSKGGEQSQIGRRYRKGIYKGLSKIISKMGICTIASYRGAQLFEIVGLDPDV
FT                   VDLCFADTPARIGGVDLARLDTEARELTVRAWNDQLKPEVGGLLKYVHGGEYHMYNPDV
FT                   VMTLQRATRTGDAGDWQKYVDAVHARPASTLRDLVQLKRADTPTPLDQVAPAEDVLRRF
FT                   DSAAISLGALSPEAHEALAIAMNRLGGRSNSGEGGEDPARYGTEKRSKIKQVASGRFGV
FT                   TPEYLVNAEVLQIKVAQGAKPGEGGQLPGHKVNELIARLRYAKPGIGLISPPPHHDIYS
FT                   IEDLAQLIYDLKQVNPTALVSVKLVAHAGVGTIAAGVVKAGADLITVSGHDGGTGASPV
FT                   SSIRYAGVPWELGVAESHQALVANDLRERTILQTDGGLKTGLDVVKAALLGADSFGFGT
FT                   APMIVLGCKYLRICHLNNCATGVATQDERLRAGYFTGLPERVEHFFRLLAEEVRQWLSY
FT                   LGVRSLDEIVGRTDLLEQLEVSPRPGVKVDLSRLLTHARYDGSHCAAQRLYESPDSLAT
FT                   QMDGLLADAIANKRGGDHRFLIHNTDRSIGARLSGAIARVHGNHGMSDAPLNLRFRGTA
FT                   GQSFGAFNAGGLQLELEGEANDYVGKGMAGGRLVVRPPRGARFEARNTPIVGNTCLYGA
FT                   TGGELFAAGRAGERFAVRNSGALAVVEGAGDHCCEYMTDGIVLVLGKVGLNFGAGFTGG
FT                   LAYVLDIERDFVDRYNHELIDIHRVSAEGFENHRQHLHTLISRHRELTGSIWAQQILDE
FT                   FRDYIGKFWLVKPKAASIESLTESLRRAA"
FT   CDS_pept        complement(45094..45474)
FT                   /transl_table=11
FT                   /locus_tag="XCV0038"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21669"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21669.1"
FT                   /translation="MRAVLPVARLTCTLVMLAALTACNKPQPDEQEAVTAKAQHAAEQA
FT                   AAPAPDAAPEAPPIGTCDATQVQSLVGQPLTDAVGEQARSDAGAKSVRVLKPGQMTTME
FT                   FNGERLNLEVDAKNVITSVRCG"
FT   CDS_pept        45531..46808
FT                   /transl_table=11
FT                   /locus_tag="XCV0039"
FT                   /product="putative DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21670"
FT                   /db_xref="GOA:Q3BZP3"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21670.1"
FT                   /translation="MACAQGVVVALTQPSLAAANNRGQSLDLCAMKAKRVVRNAAVAVS
FT                   TAGKLAAVATGAAVATAAVASAAAVAQAKATARAAGLTYVNDQQPGISRRKAGKSFSYR
FT                   DADGQRIADADTLQRIRSLAIPPAYTDVWICAKPNGHLQATGRDARRRKQYRYHADWAQ
FT                   VRGEGKFERVIAFGTALPKLRRRLRRDLVLPGFPREKVLAIVVALLADTLVRVGNAEYA
FT                   RSNRSYGLTTLRNRHMEFLKGGRARLKFRGKSGQDHDIEVDDKQLVELIRQCQQLPGQS
FT                   LFQYRDDDGQLQPVDSGEVNDYLREAMGEDFTAKDFRTWGGTLAALQRLARLPLPERSS
FT                   ERALKQVQNDVIREVADALGNTPSVCRKAYIDPCVFEGWRAGQLQAMATGVRGERQWEA
FT                   ATLKFLSASRSRLKTQSTSAARRKSA"
FT   CDS_pept        complement(47025..47369)
FT                   /transl_table=11
FT                   /locus_tag="XCV0040"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21671"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21671.1"
FT                   /translation="MIRVLAPLAAAALLSACASNQVAQVQPIDGAISGQCHSDKVRGAV
FT                   GLAAAAQTIERARVDSDSQRVIVRRGERATGGTTASGLADPAQGASESGGDQLTIETGP
FT                   NNSITAIYCG"
FT   sig_peptide     complement(47301..47369)
FT                   /locus_tag="XCV0040"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        47618..48985
FT                   /transl_table=11
FT                   /locus_tag="XCV0041"
FT                   /product="putative penicillin amidase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21672"
FT                   /db_xref="GOA:Q3BZP1"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21672.1"
FT                   /translation="MTIKPLLLALVACAALPPSVARAAPAPSQATMTVAGLQRPAQIRV
FT                   DRWGLAHIYAQTDDDAFFVQGFNVARDRLFQLDLLRRKGLGHLSDAFGPTYVEQDRAAR
FT                   LFLYRGDMAQEWSSYGPTARRDVGRFVAGINAYIAWLDSHPQALPYEFDKLGYRPERWA
FT                   PEDVLRIRTTGLSRNVKSEVARANVACKASLAVDAIRLRLQPAWTTTLPDGLDPCLPKD
FT                   VLKVYELATQSPKLSASTQLAAIAPTLSAIDDDASAEGSNNWVIASQKSATGHAVLADD
FT                   PHRAYNVPSLRYFVHLNSPGLDIIGAGEPTAPGIAIGHNRTSAFGLTIFNIDQEDLYVY
FT                   RLRPDDNAAYWYQGKWEPLRSEHEQIAVRGAAPVTTELQFTRHGPVIYVDVEKHVAYAL
FT                   RSVWSQPGAAPYLGSLRYLRSNAFVQFKAALAHWERRRSTRSMQMSAEPSAGPPPA"
FT   sig_peptide     47618..47686
FT                   /locus_tag="XCV0041"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        48913..50016
FT                   /transl_table=11
FT                   /locus_tag="XCV0042"
FT                   /product="putative penicillin amidase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21673"
FT                   /db_xref="GOA:Q3BZP0"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21673.1"
FT                   /translation="MGAPSVNQVYADVGGTIGWATAGMTPRRDHGDGLLPVPGDGHYEW
FT                   NGFWDGTVLPWSKNPKAGFITTSNEMNLPAGYPVAQRKLGFEWANEARHARITQVLSQL
FT                   PKVTLEDSQKLQNDQVSLPAQRLAALLRPLRSQDPDISAALTLLRPWNGEVSATSPAAA
FT                   LEEVWFSRYLGNAYKALRLQPSEADSFGAPDAAAMLDALEHPGAAFGAAPAARRDQLLL
FT                   QSLRSAYQALVSLQGPDASQWQWGKLHTNKISHAMSAVAGADRALLDVGPFAKGGSPYT
FT                   PNQSSYDPADFRQTIGPSARLIIDLGNWDNSRAMNYPGQSGDPASPHYRDLAPLWLKGR
FT                   YFPLLYTRAAVDAATEQIFDLVPAQAH"
FT   CDS_pept        complement(50096..50965)
FT                   /transl_table=11
FT                   /locus_tag="XCV0043"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21674"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21674.1"
FT                   /translation="MSILVTGATGTVGSLVTQGLADAGAQVKALVRQQGKRSFPAGVTE
FT                   VVADLTDVASMRAALASVRTLFLLNAVTPDEVTQALIALNLAKEAGIERIVYLSVIHAD
FT                   TYTNVPHFTGKHTVERMIESLEIPATILRPAYFMQNEGMVQQTITKYGLYPMPIGAQGI
FT                   AMIDARDIADIAVVELLRRDRADGPLPPVTLDLVGPQALTGVDAAKVWSAALGREIAYA
FT                   GDDVAAFEAQLATYGPSWLAYDMRLMMAGIQRLGMHAAEGTVAQLQALLGRPLRTYEAF
FT                   VREATAPA"
FT   CDS_pept        51118..52005
FT                   /transl_table=11
FT                   /locus_tag="XCV0044"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21675"
FT                   /db_xref="GOA:Q3BZN8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21675.1"
FT                   /translation="MWNSMDLNALIDFSLVAANQGLGKASRASGRSKATLSRRITELEE
FT                   QLGVRLVERSARGLKLTEAGQQLMERTQVPLSEVAEAMTAAREGLSSPRGRLRVASPVL
FT                   FSQLAMGHIGADFCAAYPEITLEVVAEDRTVDLMEEQFDVAIRINPSPDSRLVGRCFAK
FT                   DRLVVVAAPSIAMPSGDAVHPVPGVVMSSFEPTTWTLDGGRLVLEPIPRMRFSSFLMVR
FT                   DAVIAGGGVALIPQSIAWQQLARGQLLQWGTISGVAPALWVLHTSRRLAAPKVRAFVDF
FT                   ICARYPDASLVLKG"
FT   CDS_pept        52209..52595
FT                   /transl_table=11
FT                   /locus_tag="XCV0045"
FT                   /product="putative penicillinase repressor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21676"
FT                   /db_xref="GOA:Q3BZN7"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21676.1"
FT                   /translation="MRGKTIGDQELALLQYIEEQRHASVGEVAGAFGEPRGLARSTVLT
FT                   MMERLRAKGFLRRKQVEGVYRYSATAGQDDVVRGAVGQFVEKTLQGSVSPFVAWMSQRA
FT                   EVSDTELAELEALVAKLQSQRKED"
FT   CDS_pept        52599..54338
FT                   /transl_table=11
FT                   /locus_tag="XCV0046"
FT                   /product="BlaR1 peptidase M56 family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21677"
FT                   /db_xref="GOA:Q3BZN6"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21677.1"
FT                   /translation="MSPLIEAVLWKLGATSVQTAVLVLVVWALCRGVRRLPAATQTWLW
FT                   WLVGVQAVVGLVWSNPVQLPVLPAHSVTTALGSADSLAPLANATAAASTAAHAGATAQD
FT                   MQVGAWSTWPVALLALWAAGVLVLAAGTARAYLRSRALVRAAQPCNDRALVQALQMAAE
FT                   AHGLSRPPALRLSAQIDSPQLIGPWQPVLLLPAARLPHMADDDLDMALTHELIHLRRGD
FT                   LWWGLLPALAQHLFFFHPLVHLAAREYAIAREAACDAAVVAGHRHCRHDYGRLLLQLGV
FT                   APRPRGGVASASPSFISLKRRLSMLQDTHAFPRLAAAMILAAVAVCGVLPLRLVAMPVP
FT                   APVTSAGMQPVVVTAPAAPRAQVSSTAEPADAAAPMRALPALPAAPAQVAAPATHGVIA
FT                   DVLGAEPLHDEDADPIDSGWNLDLDRIRRDASRDAQAAVHDALAADNHDLELQQDRMQA
FT                   AQDALQDAREQLASLGPELAQAKQEAQQQARQAEQQIREMTQQHRQAQYAYAAAVRQAD
FT                   ALSRHQVEMAKQAALQGRAEAERGQREAAQAQREAAQAQVEAEKAQAEADQAQAEAERA
FT                   KNN"
FT   CDS_pept        55019..56068
FT                   /transl_table=11
FT                   /locus_tag="XCV0047"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21678"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21678.1"
FT                   /translation="MIQTTSPVLCLRSALLLALAAVAGSAAIAHASAVPAVAGVRSSPA
FT                   APVFAGSAASATTQLASIADVLPVGGIATVAPVTPESTVARIAPVVAAPRAPAIAALAP
FT                   AALMTPALAVAGARTAPAVPAANAAPAAPAAPAISPAPPVAPAAPTAAAVPARPRVGMP
FT                   TSCGHAIANTQSQGDAYVLVHGDREVMHGTPDDLQTARRYAGDGRRVLWFRADGKQYLV
FT                   RDPTLLHQLAVAHLRSRQLADAQAGLAARQQALSERQATLAAQLSAHAAPRLLQASTRT
FT                   ASATTSTSAQPPATPDALQALSRQQQALAQRQAELASKQVGASRLATQQALKVLREALR
FT                   SGRATRIDG"
FT   sig_peptide     55019..55111
FT                   /locus_tag="XCV0047"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        56156..57286
FT                   /transl_table=11
FT                   /locus_tag="XCV0048"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21679"
FT                   /db_xref="GOA:Q3BZN4"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21679.1"
FT                   /translation="MTYRVAVLGGFGHFGARIVRALAATAQIHVIAAGRHPGDVATKWP
FT                   GAAPGRISTCRLDIDASDFPAQLAATGADAVVHTAGPFQGQQYAVARCCLQAGMHYIDL
FT                   ADGRAFVRDFPAAMDAAARQAQRVAISGASTLPALSSAVIDALLPRFSALHEIGIVIAP
FT                   AQGTPLGLATVRAVLSYCGTPFHWWQAGRWQQVVGWARPTRVHFAQLAPRLASPCDVPD
FT                   HDLLPQRYPGVQTVQFRAALEVPFLQRCLAGVAWLRRRGVPLPMQRLADVFANAGRWFD
FT                   RFGTDLGGMRVELRGTCDGTDGASRPLVLHWDLTAAMLHGPEIPCFAAVLLIRKLAAGH
FT                   RLPIGAHACMGLLTLAEFEQECAAWQMTTAVTQAHR"
FT   CDS_pept        complement(57425..58210)
FT                   /transl_table=11
FT                   /locus_tag="XCV0049"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21680"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR012390"
FT                   /db_xref="InterPro:IPR015069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21680.1"
FT                   /translation="MSSFLDTRISRRRLMAAAGTSLLATSLATPTMTPPPSDVGRKFLR
FT                   SRRPMPFAGNTFVGHLEQQGDGYDSFDRVLNIYRQFPEQRFAHKFAVLPPSSYHVTLLG
FT                   GVNEIDRARGPWPSDLPRDHALADINAAYLARLKERAAPPLGACRFLVNPTAARTGNND
FT                   NLLIPLKPADTQTAQRLEAARQALMQLTRLQRPDYTNFQFHISLAYLCDTLDAAEQTAY
FT                   RSAVRGWLTQLAAAGPITVPRFHFCTFNDMDAFRTVQEV"
FT   sig_peptide     complement(58127..58210)
FT                   /locus_tag="XCV0049"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(58221..60878)
FT                   /transl_table=11
FT                   /locus_tag="XCV0050"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21681"
FT                   /db_xref="GOA:Q3BZN2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21681.1"
FT                   /translation="MRLLHSPSRPHCAAPSCPPPPHALSLALGLALIGWLPSHATAADM
FT                   SGGGDALTMDAVQVRNPFQSQNTRAIATKQAAPTIVDSVAADSIGQLPDFNVGDALRRV
FT                   TGVSTVEYQGEPRYVTVRGLNGNYNSMLIDGFAFASNDIGSRQALMDVLPANFVDRIDV
FT                   VKSLLPENDGGAIGGVTNLVTATGFARPDGLLTASAKGGANLVGSRYGGRTPVGEGELK
FT                   WGKRFGRDGQFAFLGAASVWRREISVPQQENGGALNWYNADGTRASSAYGGTGAAVPSE
FT                   RRWYNYDNTRERRGVTARVDWQPDGPLSGHVSGYTFDQHESSDRNAQVAQVQNSARLTR
FT                   SGPQSGTLDNLNQLVELGQLRWKRGLSGINGELLAELPDQWRGALRASTSRATVDNPQT
FT                   WDRFQQNGLAYGFDWNGTLPAFTALDPALAEDPTRYANLNHQQERTTYAERVSDLQLEL
FT                   RRNMDEDSQGLGLAFGLRQVRTHMQTAFQRTTWSGLPYSLADVLGNATCALGCNAPMLI
FT                   IDPDLADARWDAVSGQARGVADITAQNSGTYSVDEQVRAGFAQAQWRGERWRLAGGVRL
FT                   EQTRFGSSGQQLSGTVWAPVSAQRTYRNWLPSLAGQLQTSANGTLRFGASRSIGRPRLD
FT                   QMALNGGVLTLGSNPPTLNQGNPDLQPRRSQNLDLGHDWTFDDGGSLLSIALFHKTIDN
FT                   EIFRYGQLQSIDGEQVLVTQPRNTDRPVRMRGAELGAIKELGPWLPALAGLSVGANVTF
FT                   LDVDYPVVLGDGSRTTLSVLPQQPKQLWNLTLNYARGPLRSTLAWSRTGELWDDRYPNY
FT                   SNQQEFYRNRYQQPLDRLDLKLAWDVSPAVAVSLDVLNLTGQGYEYRIGRHQEYVQSAW
FT                   KMAPTVMLGVNVKL"
FT   CDS_pept        60846..62138
FT                   /transl_table=11
FT                   /locus_tag="XCV0051"
FT                   /product="putative transcriptional regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21682"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21682.1"
FT                   /translation="MGAGRGMQQAHGTISTSVAPTQGRGRIKLSCLIKAIMTTTNVSPC
FT                   MPSLFANAAIRSHYRRRSDGQAAGSSERLLLDLIRRAGQFERADLPRASGLSVPGIKGI
FT                   VDPLVAHGLLQLRPSLRRGRGQPNAQVSLVPGYAYSVGVSVMVDGFAVVLIDFAGQVRG
FT                   MRQLTAFPLTLAVVRAQLPALVEALLTAAGVDRQHVFGVGLSMTGPRIGDGTRVNPPLS
FT                   LAAEWMQVELDRFVADCLQLPVWMDNDAHCAALAEAVYGIGRQSPDLVYLSISDGFAAG
FT                   VIAAGNVRRGAHGNGGELGRISAITGMARPTLESLRQALAADGHALPDLHTMLQHYDAA
FT                   WPQIDAWLDAVEPTVTLAVAAIIALIDPRVIVFGARLPTDLAQRLIARIAFEPAPRRGV
FT                   ALPYPTLQVGQVTAHATVLGAAMLPFKETLF"
FT   CDS_pept        62327..64471
FT                   /transl_table=11
FT                   /gene="avrBs2"
FT                   /locus_tag="XCV0052"
FT                   /product="avirulence protein AvrBs2"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21683"
FT                   /db_xref="GOA:Q3BZN0"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZN0"
FT                   /protein_id="CAJ21683.1"
FT                   /translation="MRIGPLQPSIAHTAAPALPTHTSAISPTQVPHMPGNTPPLRERPR
FT                   RRAGNMPPLVPLNDSAMTGKPALVALDSEFSEQRLAEVQARQITVQTLQGKLATHLAQA
FT                   GTALKPDSIAARFAAGTLEPVYLDTAAFNAMSRGLPARARAAAGPVLIDAQQGRIIFNL
FT                   QRAFAPGDTFSDAALAALGKQLNLSGHGLATPNWLQPAAGTPGRRKLQQAARYHGHEVP
FT                   ARDGGAGFFKANDHRLLEGKQVLLRNHQKSLVHNHYFEAPSTRAFGKDVMVHRGLFDNH
FT                   AGIPENSLASIDHAYEQGYRNLELDVEVSSDGVPVLMHDFSIGRMAGDPQNRLVSQVPF
FT                   AELREMPLVIRNPSDGNYVKTDQTIAGVEQMLEHVLKKPEPMSVALDCKENTGEAVAML
FT                   LMRRPDLRKAAAIKVYAKYYTGGFDQFLSNLYKHYQINPLHSQDAPRRAALDRLLAKIN
FT                   VVPVLSQGMLNDERLRGFFRSNEQGAAGLADTAMQWLDSWTKMRPVIVEAVATDDSDAG
FT                   KAMEMARTRMRQPDSAYAKAAYSVSYRYEDFSVPRANHDKDYYVYRNFGELQKLTNEAF
FT                   GVKRTTAGAFRDDGESLLTDQPEAELLAILENRALARGHTGNELDVPPETPIDINRDAE
FT                   IVKQRTQQFQASSIPADPNHISAVREGKQHDHTADMVNDPAATRALDKRAKALGLLTDK
FT                   YRGAPVTHYLNEQARQTETD"
FT   CDS_pept        64604..64843
FT                   /transl_table=11
FT                   /locus_tag="XCV0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21684"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21684.1"
FT                   /translation="MGRPISRVAVPCVQVPRRAPPRYLHTHPPLPPIDSSVEATAWPDR
FT                   NDPQTPAVRHHGVACRPPQASTHGWRATRLNTPQ"
FT   CDS_pept        complement(64955..66418)
FT                   /transl_table=11
FT                   /locus_tag="XCV0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21685"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21685.1"
FT                   /translation="MNVSADRLRLLRRQAGQADVPAPAKADDGDGDALHDAPAVDAQAA
FT                   DAAPVDEAAQPASGVHTQGTTPAPGHAPGVSAERLRLLRRQVGGLTPAARKDDAIMPTR
FT                   AQRAAVSGAALPTAGLPLRENAAARHGAVAARPNEARDASTRTRRALQAPMPAPPAREA
FT                   SVFAWVEHDVRHKPALPSNVDVDAIIAVEADSARPWPTARSTATTSPASMSPPPPVQRR
FT                   TDIAGLRKMIGLRERAVSAHAPIRAPSTDRSLPGNEIAPGLHLIQAFLPQAIPTEALSL
FT                   AFAKRDDAVDPMDLLFFDTETTGLAGGTGTRAFMIGVADWVVDAVQGNGLRVRQLMMST
FT                   MAAESAMLDLFRTWLTPRTVLSSYNGRCYDAPLLKTRYRLARRGDPISALDHVDLLFPT
FT                   RRRYRGTWENCKLSTIERQLLRVVREDDLPGSEAPAAWLSYLRGGSARNLRRVAEHNHQ
FT                   DVVTLSLLMQRLVAVDAQERNALTLARTP"
FT   CDS_pept        complement(66415..68910)
FT                   /transl_table=11
FT                   /locus_tag="XCV0055"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21686"
FT                   /db_xref="GOA:Q3BZM7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21686.1"
FT                   /translation="MPPFALAPRTETAERALATTDGRPSRDGALLTQRLERRYHDRITG
FT                   SFTIPGRAGCYAPIPDDVPSALADALQARGISQLYSHQADAWAATQRGEHVAIVTPTAS
FT                   GKSLCYTLPVVSAAMTSGAKALYLFPTKALAQDQVAELLELNRAGELGVKAFTFDGDTP
FT                   GDARQAIRLHGDIVVSNPDMLHQAILPHHTKWAQFFENLRYVVIDEIHTYRGVFGSHVT
FT                   NVLRRLKRICAFYGATPQFILCSATIGNPHAHAQALIEEQVHAITESGAPTGDKHVLLW
FT                   NPPVVNADLGLRASARSQSNRIARIAIKSGLKTLVFAQTRLMVEVLTKYLKDIFDHDLR
FT                   KPARIRAYRGGYLPTERREVERAMRAGTIDGIISTSALELGVDIGALDVVILNGYPGSV
FT                   AATWQRFGRAGRRQQPALGVLVASSQPLDQYVVRHPDFFADASPEHARIAPDQPLILFD
FT                   HIRCAAFELPFIADEPFGPIDPLVFLEALAESEVIHQEGDRWEWIADSYPANAVSLRSV
FT                   ADGNFVVVDKSDGKQQIIAEVDYSAAALTLYEGAIHMVQSTPYQVERLDWEGRKAYVTR
FT                   THVDYYTDSIDYTKLKVLDRFDGGVAGRGDCHHGEVHVVRRVSGYKKIRYYTHENIGYG
FT                   PVNLPDQELHTTAVWWQLPQATLGKAFASKQDALDGFLGAAYALHVVATVAVMADARDL
FT                   QKAVGNGDGAWFAVADQTGRGQLRGVEEGDAATVELQQAFVPTVYLYDNFPGGVGLSEP
FT                   LWLRQAELLQRADELVRRCDCSAGCPACVGPVLAAHEAAKGESPKSLALTVLALLFDAD
FT                   APLRHATQVDEDLALDVLA"
FT   CDS_pept        69088..69750
FT                   /transl_table=11
FT                   /locus_tag="XCV0056"
FT                   /product="hemolysin-III family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21687"
FT                   /db_xref="GOA:Q3BZM6"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21687.1"
FT                   /translation="MPVPANVTAPHYKSVSARRADIAVHAAGLLLAIVGGAWMVVRAHA
FT                   NQTMLLATCIYALGLLVMFACSAAYNFAPPQRQPMLRKFDHAGIFVMIAGSYTPFFLVA
FT                   LDGTWRWVMILSVWCVALFGVFAKLCLPGIAKGFWVAIYLLLGWAGIVVINQMIAGLDS
FT                   AVLWLIVAGGAFYTVGVAFYVRKSMVYNRAIWHAHVLGGALSHWCAIWLCLRPLGEG"
FT   CDS_pept        69816..70073
FT                   /transl_table=11
FT                   /locus_tag="XCV0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21688"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21688.1"
FT                   /translation="MRTELVTTLKRQATEPLAAAERDKEPILITQHGLPRAYVVDVASD
FT                   ERMQQRIALLEGIARGEMAVAQGRTLRHEQAQQHMARWLK"
FT   CDS_pept        70082..70363
FT                   /transl_table=11
FT                   /locus_tag="XCV0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21689"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21689.1"
FT                   /translation="MPALADLDAIADYIAIDNAPAAAAALVKWVLPQVEQLIEHPDSGS
FT                   RPQELKRSRYRQIVEPPCRVFYRVDGQHIVLVHVMRWERALRRNRLSR"
FT   CDS_pept        complement(70546..71445)
FT                   /transl_table=11
FT                   /locus_tag="XCV0059"
FT                   /product="short chain oxidoreductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21690"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21690.1"
FT                   /translation="MRKRILVTGASSGFGRLAAQALAAAGHTVYASMRDTAGRNAGVAQ
FT                   AMADLADKQQLALHTVELDVQSQASADAAVASIVAQAGGLDVVVHNAGHMVFGPAEAFT
FT                   AEQLAQVYDINVLGTQRVNRAALPHLRAQQQGLLVWVSSSSSAGGTPPYLGPYFAAKAA
FT                   MDALAVQYARELARWGVETSIIVPGAFTRGTNHFAHAGTPDDTARAAAYEAGPYAGFGE
FT                   QVQQAFARLVPEDADVAEVAQAIVQVVNAPFGKRPFRVHIDPAGDGADVGFAVLDRLRA
FT                   EMLHRVGLDDLLAPRVVE"
FT   sig_peptide     complement(71377..71445)
FT                   /locus_tag="XCV0059"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(71505..72242)
FT                   /transl_table=11
FT                   /locus_tag="XCV0060"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21691"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21691.1"
FT                   /translation="MTQQHTVAVITGASRGIGAAIAQRLAGDGFAVVLNYAGHADEADQ
FT                   LVRSIEAAGGRAISVQADVSDPVAVERLFAAAETAFGGVDVLVNNAGIMQLATLADSDD
FT                   ALFDKHIAINLKGTFNTLRQAARRLRDGGRIVNLSTSVVGLKLETYGVYAATKAAVETL
FT                   TAILSKELRGRAITVNAVAPGPTGTALFLDGKSPELIERLSKANPLERLGCPDDIAAAV
FT                   AFLVGPDGGWINGQVLRANGGMV"
FT   CDS_pept        72385..72729
FT                   /transl_table=11
FT                   /locus_tag="XCV0061"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21692"
FT                   /db_xref="GOA:Q3BZM1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21692.1"
FT                   /translation="MRLFVRIVERRSFTAAANDMEIPRSTATKVIAEMEARLGVRLGTQ
FT                   ARSWADIRHVALRTSPDSRHRQRTGGLAASAVSCCNQTCAVNLIGLAPPRRHVDGEGGH
FT                   AHGYQRENRT"
FT   CDS_pept        73438..75003
FT                   /transl_table=11
FT                   /locus_tag="XCV0062"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21693"
FT                   /db_xref="GOA:Q3BZM0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21693.1"
FT                   /translation="MAYRESQADKGLRAWFISDNTKALLRGIKLIKGSIRGINSLDIEF
FT                   HYPIAAFAGVNGAGKSTILALASCAFHNNPGGYKLKKRQTTYYTFKDFFVQHSDEIAPD
FT                   GIEIRYEIAHNNWKKTDAVPSGVGVAAQSRVKKKGGKWNDYDKRIKRDVVFLGIERIVP
FT                   HSERSQSKSYSRSFKDAPLKGWEAKVKEAVGTILNKKYDDFRYLEHSKYNLPLVKCGPL
FT                   IYSGFNMGAGENALFEIFSIIYSCNKGALLVMDEAELGLHAKAQRLFIKKLKDVCVEMN
FT                   LQVICTTHSREIFDCLPEDARFFVEAVGGKTRITSGVSSEFAFSKLSGAKNGELDIFVE
FT                   DPVAHCLILSSLPATLRSRVSVQIIGSATAISRQLAAHYVRKDARPVLAIFDGDQRSKY
FT                   AENLKHARNMAENPKADFDEWFTSRCAFLPGETWPEAWVIQKCLDTSVLEKVSESLLLD
FT                   ADEVTDILEYGLQAGKHDEFHEVASHIGLNSSQCMSKLCDTVTHSFSSDFEEIKKAILI
FT                   LLSK"
FT   CDS_pept        complement(75934..76689)
FT                   /transl_table=11
FT                   /locus_tag="XCV0063"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21694"
FT                   /db_xref="GOA:Q3BZL9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21694.1"
FT                   /translation="MSIDHSNYRIVPTRVIGKGGFGIVQAVDLFNNANHKCGEYAIKTF
FT                   SPPDQDHDEELLSRFSREVRYQASCAHENIAQIYMYNDKIQEPWFLMDLATCDLQYEIS
FT                   NNSLSDSEKIRIMKMTLQGIHYMHSRNLLHRDIKPRNILKFDSPLGPVYKISDFGLAKN
FT                   TDPAGESNLLTKIVLGWGTEKYMAPETQSAWDFSVKSDIFSMGVVFEDLNPSETPALRK
FT                   IIDKCTHRRPNLRYDSAQAIYEDLVAIAV"
FT   CDS_pept        complement(76728..77177)
FT                   /transl_table=11
FT                   /locus_tag="XCV0064"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21695"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21695.1"
FT                   /translation="MDRITTIARCLVLATSVLCGAAYVQPAHAQGMRSATGTATSKYIA
FT                   PTQQPYNSMAHDTTPFNCEQYRTHPHPGMVRYCQGVENMMLRNEAQRQGRPAPSDSVIT
FT                   LPGLGTAEAKQLGYACVGGQAMKRLRNGWEQVAAPAGGWQRCLGG"
FT   sig_peptide     complement(77091..77177)
FT                   /locus_tag="XCV0064"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    77342..78567
FT                   /locus_tag="IS_1477_1"
FT                   /note="IS element 1477"
FT   CDS_pept        77406..77672
FT                   /transl_table=11
FT                   /locus_tag="XCV0065"
FT                   /product="IS1477 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21696"
FT                   /db_xref="GOA:Q3BZL7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21696.1"
FT                   /translation="MKKSRFSTEQIIGFIKQADAGMAVAELCRRHGFSPASFYQWRAKY
FT                   GGMEADEAKRLKELEVQNTRLKKLLAEAHLDIEALKVGFGVKR"
FT   CDS_pept        77705..78538
FT                   /transl_table=11
FT                   /locus_tag="XCV0066"
FT                   /product="IS1477 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21697"
FT                   /db_xref="GOA:Q3BZL6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21697.1"
FT                   /translation="MLEHTPLSERRACRLAGLSRDAFRHAPVPTPATQALSARLVELAQ
FT                   THRRFGYRRLHDLLRPEFPSVNHKKIYRLYEEAELKVRKRRKAKRPVGERQKLLASSMP
FT                   NDTWSMDFVFDALANARRIKCLTVVDDFTRESVDIAVDHGISGAYVVRLLDQAACFRGY
FT                   PRAVRTDNGPEFTSRAFIAWTQQHGIEHILIEPGAPTQNAYIESFNGKFRDECLNEHWF
FT                   TSLAQARDVIADWRRHYNQIRPHSSCGRIPPAQFAANYRTQQANNAVPFNPGLYQ"
FT   CDS_pept        complement(78565..78753)
FT                   /transl_table=11
FT                   /locus_tag="XCV0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21698"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21698.1"
FT                   /translation="MHDEPGYWMSEGTQYHLLRVRDQLRLLATLATPRTREEGAMGMPA
FT                   IPLQQWAHCLQHLAEQV"
FT   CDS_pept        complement(79153..81039)
FT                   /transl_table=11
FT                   /locus_tag="XCV0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21699"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21699.1"
FT                   /translation="MATPSPQLEAALASFAASGASQDQVAQLRGALVADPKLMQQFDQE
FT                   AIAGHLRGFALQAANSSTPNLTGTYNIQSGVVTLPAIGIQSTGTVANSDLRASLQVQQM
FT                   SIAFARSAYQDAARTSHPVTQDMVDNLQSTINGSPFLADEVKKAATTIDQSDGQRPKRA
FT                   QLEAFGFLGPGMAAGGTYDGGNKIMNLPPLGLQSSSATNLHGRFNDRDMTFVLGHEIQH
FT                   SFNHASKAQATQKFLSDVEAQSKVRGPIHDYTDELRAYIQAGREDEAKAEIAGWNALLS
FT                   QQQRINPHAGLKAMQATQIDRVNDFVTTNPLTGVAAGKQGLTFNQDGSLSQTSGNIAAM
FT                   GHHYFDRPSPLYSQPGQRPVGIGEHRNAMGALQPTADYPNYYGTWGIEQILQAEDRANV
FT                   MYQGARPQVTIDMAALGLKEHLIENEGLDRGVNKSPFPYQDTSTRPPTLHHFDHTQDGS
FT                   VNPAHDHTYVPVVPSAPAATGSLGPDDPAHPDHRMLEQIRSGVRKIDESVGKPYDDMSE
FT                   RVSRSLLAVCKDNREAYPAAGDRSLADNALSRVDHVVMGKTGNVFAVEGRLDDPAHRRV
FT                   HVEIDQAIRTPVEQSDQKLLAANQAIAQERALTQQQELARGMNEPNQGSLSR"
FT   CDS_pept        complement(81056..81703)
FT                   /transl_table=11
FT                   /locus_tag="XCV0069"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21700"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21700.1"
FT                   /translation="MRLSKVAMFSVGILCITSLCACAHTPGNPISPLPKEPRAMTTPNT
FT                   STVNPTLSAVEIGERFLKLLGGLDSRKDLTIDRVREVTGISLKKVSFPSEGLESYIHGQ
FT                   ALSNGWSYLLELTPESRALKQGIGLSFVNEDEGSSSLQGNCVDFEKYRDSLIEMGFLDS
FT                   PVHGEIGQLQSWRFAKLANDGSGNDIVISLVPQNEAPGSPGRLCVKSIGTLN"
FT   sig_peptide     complement(81635..81703)
FT                   /locus_tag="XCV0069"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(82229..82411)
FT                   /transl_table=11
FT                   /locus_tag="XCV0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21701"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21701.1"
FT                   /translation="MAIALPAPGLWGLLTDGSAWRDGCETEGNHLITRGRSFAASRQLL
FT                   RSAARGNASRTNAAA"
FT   CDS_pept        complement(82639..82827)
FT                   /transl_table=11
FT                   /locus_tag="XCV0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21702"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21702.1"
FT                   /translation="MDKNRIDGAAKQVKGSVKEAIGRVTGDKSTELEGAAEKNVGKVQR
FT                   KAGEVADDVRDAVKSNK"
FT   CDS_pept        complement(83064..84233)
FT                   /transl_table=11
FT                   /locus_tag="XCV0072"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21703"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21703.1"
FT                   /translation="MMLVTVLLLAAGLLGAVVLAGGLWWLLARRRDAKADDIATPSASN
FT                   ASTAHASPSPIAPAPSPAAPLQQPVPPPAAQTLQIEPPPMRPLLRRMYAAVMATPSLAE
FT                   GTLPGDPAQAEVLAAVAAALEQVDLRPQLLPRRPHLLPQLMRAVNDPDASGRGIAAIIA
FT                   QDPALAANLLRIANSALYRPQGGPLESLERAVVHIGTEGVRQIVAAAVMQPVLSLDGGL
FT                   YSRLPAAVWDYALRTATAAAAYLRERGGDTLSGQLAGLLQGLGAIVILRVLRDTYADRR
FT                   GVPYNLEVAAALVERHTAAVAKTIATAWDLPPQLGTALDEQRPEHDTSLLATPLGLALR
FT                   YGRLAAALAMLARHGAEHEDHALGILATLQPDSDANAALWQRLVAASVE"
FT   sig_peptide     complement(84174..84233)
FT                   /locus_tag="XCV0072"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        84393..84977
FT                   /transl_table=11
FT                   /locus_tag="XCV0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21704"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21704.1"
FT                   /translation="MQQAAAHTPPSRRRPGVILAHAGHGLPMMCNGRFMASMQRRSLPK
FT                   RVPMSTVTLHRVIRASPERNYRAFLQADAVAKWLPPNGFTCTVEHLHAHVGGTFRMAFT
FT                   NFANGQRHAFGGTYRELQPNVLLRYDDAFDDPSLPGTMVTTVQLHTLPCGTDLHVVQEG
FT                   IPEQIPLHACYLGWQDSLMLLAHLVEAHPEN"
FT   CDS_pept        complement(85278..85589)
FT                   /transl_table=11
FT                   /locus_tag="XCV0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21705"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21705.1"
FT                   /translation="MSPQRPPVETGVTLRLAREGGVAAFPAMRRERQLAMDALDDAQRV
FT                   RLRSVLDQCMAHALPAPQAGGGDRRYFSIVWDGASEPLRIPEEHAPAEIVQLWKQGTL"
FT   CDS_pept        complement(85586..86650)
FT                   /transl_table=11
FT                   /locus_tag="XCV0075"
FT                   /product="Zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21706"
FT                   /db_xref="GOA:Q3BZK7"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21706.1"
FT                   /translation="MSAFVSARRAGILPPYLLEHVAQAAPAHARQCALLSRQITAQLRQ
FT                   QRALGLLARADAPAADAKAQQTAPAVQRRIYDAQRGTALPGTLVRDEGAAATQDVAVTE
FT                   AYDYLGATHDFFQTVYGRNSIDAAGMPLIGSVHYERGYDNAFWNGEQMVFGDGEVFNRF
FT                   TIALDVVGHELTHGVTERTANLIYQGQSGALNESISDVFGVLIKQYTLRQSADQADWII
FT                   GAGLLMPGIKGVGLRSMQAPGSAYDDPALGKDPQPATMAGYVDTQEDDGGVHYNSGIPN
FT                   HAFYRAAVAIGGAAWEKTGRIWYRALTGGELAAGADFATFAALTVEVASAEYGANSSET
FT                   AAVQQAWRDVGVLA"
FT   CDS_pept        complement(86760..87416)
FT                   /transl_table=11
FT                   /locus_tag="XCV0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21707"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21707.1"
FT                   /translation="MSRILVIGGHGKVARLLTPLLVQGGHQVTALFRNPAHEDDVMADG
FT                   ATPVVFDIEHAQTDAIAAQLAGHDAVVWSAGAGGGDAARTYAVDRDAAIRSMHAAEQAR
FT                   VRRYVMVSYLGAGLEHGIGPDDAFFAYAQAKAAADAHLRSTTLDWTVLGPGRLTLDPPS
FT                   GRITRDPGSDAEGGVSRANVAQVIAAALATPGSIGKTIGFIDGQTPIAQALSQLE"
FT   CDS_pept        87674..88126
FT                   /transl_table=11
FT                   /locus_tag="XCV0077"
FT                   /product="putative NUDIX hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21708"
FT                   /db_xref="GOA:Q3BZK5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21708.1"
FT                   /translation="MPMSSELRPRVGCGAFIQRADGRLLLVLRGRAPEQGHWGLPGGKV
FT                   DWMETVEATVVREVLEETGLQVHPQRVLCVVSHFEPDMDPPQHWVAPVYLASIQGPEQA
FT                   VLREPQVLLELGWFALDALPTPLTRSAMQAVQQVQQVQAKRAAARA"
FT   CDS_pept        88167..92132
FT                   /transl_table=11
FT                   /locus_tag="XCV0078"
FT                   /product="putative membrane-associated peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21709"
FT                   /db_xref="GOA:Q3BZK4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21709.1"
FT                   /translation="MLRRAGHMDFVAALGYFLRCRGEGTARPADRIVRPGCRTTAWRPA
FT                   THQGTRMESLYPQGPAVVPEQLTAPSSNYRRNAWLAMLGLGGFIAVYLGLLVWFGWTAY
FT                   RLVAGLLQGSGGEQAFWLWVVAAGAAFLAVFMAKALVFNKRAERDTRALELTPAEQPAL
FT                   FAFLYRLADDAGAPRPHKVYLSAQVNAGVFYDLSLINLLLPSRKNLDIGLGLVNVLNLG
FT                   ELKAVLGHEFGHFAQRTMAVGRWVYIAQQIAAHIVGKRDALDRILATLSRIDLRVAWIG
FT                   WGLSLIVWSIRSLVEIAFRGVVLAQRALSREMEYQADLVAASLTGSDALVHALHKLEAA
FT                   DDGFQRALRFAAREFAQDRPVKDLFAIQSRIIEHMRVVLNDPGHGAVPAVPTETAPMHR
FT                   LFHGEIAQPSQMWATHPPSAAREENLKRRYIACPIDARPAMELLHDAQALRERVSLGMF
FT                   NGQAPTCVDTAVSLEQLERDFAALSLSRRYQGLYLGRSCTRTARTLDELYATPLPSGDL
FT                   LQALDGLYLPDDGQAIEQLRERERQRATLQGLMDGGLRAAGGVVTWKGTTLSRTQLPAV
FT                   IAELDDELRVLRARVSGHDQRCRSVHLAAANRIGGGWPALLRGYLAVLHYTDHTIADLE
FT                   DANLLYLQTFQSVIADGRVSSKELRKLVAACNQVQRALGQVYAQAGQVQMNAPLAQALG
FT                   KPQWSQCLPEFGLVEADENNINAWMKAAGSWVQVTLDALGTLRDASLEELLRAENAVAE
FT                   RLRSGDTSPTDATPPAAPTDYPIRLPGEMRQRDLRQNLWQRFLAADGVFPSVARVAVAA
FT                   SIVAGVLWAGGAVGMAEVVAYNGLQQTVTVAIDGQSATIPANERHVFRLSERSTHHVET
FT                   RTANGAAIERFDAPSGGHGGQFAYNVAGAALLLNWRASYGSASEDTTRSLSTTRWERTQ
FT                   AQDIFSEPPQKVSGKGGQYRDVLTAVSGRSPHELLGELGPERDLALITAHARWDAADSA
FT                   YLEQWMEQLRSAAPQALPAILTERLQRNRQDVVALRMQQDIATPEQRAQVCGQQTAAAQ
FT                   AHPDAPALQYAAIRCRSDTPERDQAFVTAQARWPNDPWLQRAAAAVQVGQLHLPQAQAL
FT                   YEQAARAPALADDVLPLLARLQRYRGLAMDLPGMAQQSPSLASIVALEGGERTQGTPYH
FT                   SYYALAHGQLDMAVTEAAADADVQARIVRLAAASHGASAALLQQARVLPESAGLDPITA
FT                   PSAWALAAREGWQTDALRAATLQGTGEDGAYIARFFDAVQAGGSQQQAEAALGGVSLVG
FT                   RGLAYTMAAVLLGQRCPDAWRRGAQQLLFASERPYLG"
FT   CDS_pept        92516..92914
FT                   /transl_table=11
FT                   /locus_tag="XCV0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21710"
FT                   /db_xref="InterPro:IPR041374"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21710.1"
FT                   /translation="MSLQIPQGALVVVADGGEARWFTNTGNESKVVLRQHARTDVQNVD
FT                   DDGPAGKAPQDLTETDLDEMTFAKQLSHALNDGALKHEYTHLVLVADPTTLGRVRPLLH
FT                   KETQQRLVGDLAKDLTNLPLEDIQRALS"
FT   CDS_pept        92935..93264
FT                   /transl_table=11
FT                   /locus_tag="XCV0080"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21711"
FT                   /db_xref="GOA:Q3BZK2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21711.1"
FT                   /translation="MGFVRQYATQAPERSAVEAQTGLQVLEFGTDWCGHCIAAQPLLQK
FT                   LLGGYEAIDYRKIEDGKGRPLGRSFRVKLWPTIILLRDGQELARAVRPQTREDLQDLLS
FT                   LLDAA"
FT   CDS_pept        93797..95287
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="XCV0081"
FT                   /product="metabolite:H+ symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21712"
FT                   /db_xref="GOA:Q3BZK1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21712.1"
FT                   /translation="MHDARAMRSHFGWFKRRRQLQLDDVTVVDRSMLRKAVGAAALGNA
FT                   MEWFDFGVYGYLAVTLGQVFFPASNPTAQLIATFATFTVAFLVRPIGGMVFGPLGDRYG
FT                   RQKVLAATMILMALGTFSIGLIPAYERIGLWAPALLLLARLLQGFSTGGEYGGAATFIA
FT                   EYATDRNRGLMGSWLEFGTLGGYIAGAATVTALHMSVTPAQMLDWGWRVPFLIAGPLGL
FT                   LGLYMRMKLEETPAFRAYTEQSEQRERQTAAQGLTTLLRLHWPQLLKCVGLVLVFNVTD
FT                   YMLLTYMPSYLSVTMGYAESKGLLLIILVMLVMMPLNIVGGMFSDKLGRRPMIIGACIT
FT                   LFALAIPCLLLVGSGNDGLIFAGLMLLGLALVCFTSSMPSTLPALFYTPVRYSALSIAF
FT                   NVSVSLFGGTTPLVTAWLVERTGDPLVPAYYLMGAAAIGLLTMLFVRETAGLPLRGSPP
FT                   AVASDAEARALLQADSPVTVDAQLPVTTTASMGQPRTA"
FT   CDS_pept        complement(95631..96104)
FT                   /transl_table=11
FT                   /locus_tag="XCV0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21713"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21713.1"
FT                   /translation="MNCEIRHSIVIAAAPEVVCAALSEPRQLARWWTREVSLADDLVRL
FT                   DWSRQGWRVELSIDEGADHQLVCWRCHDSNMLDTDAWKGTVMRFELRSISQGTQVDFVQ
FT                   SGYRDSPCKEACARGWRFFLGSSLKRYVETGEGAPSADMRMPVLPEHNPYTAR"
FT   CDS_pept        96251..97069
FT                   /transl_table=11
FT                   /locus_tag="XCV0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21714"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21714.1"
FT                   /translation="MTTLPIPVMDAAAQRDLARAHALLENPGVAAQLANALGAPIESLI
FT                   TKRLPKVVTRSIDGVTRRALQVAMKSALLSLRGKADAQQPASTTRHTLAVAVSGGAGGF
FT                   FGLPGLMVELPVTTTVMLRSIADIARAEGESLHDPDTALACLEVLAHGGRSASDDGAES
FT                   GYFAVRAAMAQQLSAAASYVAAHGFASKGAPALVSLVSRIAAKFSVNVGEKLAVQAVPL
FT                   VGAVSGATLNTVFMRHFQAMARGHFIVRRLERRFGEDAVRRAYEALPPPR"
FT   CDS_pept        97266..97916
FT                   /transl_table=11
FT                   /locus_tag="XCV0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21715"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21715.1"
FT                   /translation="MMPKPFSPASARNRDPILEVLRTHFADRQQVLEIGAGTGQHAVHF
FT                   AAAMPWLQWQASDHLDHLAGMRQWLDEAALPNTPPPIALQAVPTPTPGLAPPPSLPVLR
FT                   GGQRGFDAIYSANTLHIMGWPQVQALFAGLPAVMAPDAVLAIYGPFNRDGQFTSDSNRA
FT                   FDTSLRERDPASGIRDAEAVDALAASVGLQLIDDVALPANNHCRVWRRLTAAS"
FT   CDS_pept        complement(98176..99957)
FT                   /transl_table=11
FT                   /locus_tag="XCV0085"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21716"
FT                   /db_xref="GOA:Q3BZJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21716.1"
FT                   /translation="MTPSLPWLVGAALLLIAVIGCVRLLRAHHRQPYARTRLWLLFAAQ
FT                   PLLAALLYPVLLPPPRAGTGGELHVATAGTAAGQISTGDLARWVALPEAPALPGVMRVP
FT                   DLATALRRAPGTTALVVHGSGLPARDREGLNIPLRLKLSPAPRGVVAVSPPPPLAPGDT
FT                   IAVSAQVQGLPDARVELLDPAGQVVDSAVADRAGRVRLRGLARAPGQVLFAVRARDAAD
FT                   AERSRVEVPVLIAAMPPMRVLLLAGAPQPELKYLRRWASDAGLDVRSQIAVGAGVQLGE
FT                   GAALDAASLDRLDLLIVDPRRLVALGAAQRQTLRAAIQRGLGVLVRTDGPLDAGTRAAL
FT                   AALGLGVSGGSTSSPVPAPQRLSPPAAPADPAGGPGDAPTLAPLQRRDLQPQATDALVA
FT                   ARADDGSALGWWRAQGRGRIGIGLVEDSFALVLAGRSDLHAALWAQLSGAVARPGGALP
FT                   TPVQEGWSQHRMPLCDLHADALVTDPDRARHPLLPERNGDGPRCAGYWPTTPGWHRLES
FT                   GNTQRWLHVRAPNEAPALYAQQSRLATIALAAGAASAPIAHPATQPGARWPWLLVWLGA
FT                   AAALWWFERKRPSQRVP"
FT   CDS_pept        complement(99954..102374)
FT                   /transl_table=11
FT                   /locus_tag="XCV0086"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21717"
FT                   /db_xref="GOA:Q3BZJ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21717.1"
FT                   /translation="MSTPALQRAWQAARRRQAAGVLLFGLPWAALPAALAWRAGAQVAV
FT                   VVLLLLGLLALGGAALLAARRLDQAWLIRRLDRDADLEDSSDLLFAPIAQLGPLQTLQR
FT                   QRLEQRLRSTPRDLRPAWPWRRAWPWSVLGVLACGALLLWPQPATQRTPPTDRVAAARA
FT                   SSGAPTLRQAQLRSSPPAYTGLPAARLPGLDAKVPAGTRLDWQLQVSPAPRSVALRLTD
FT                   GRTVALAREGSSETWQGHWVAERATLYRILIDGAPADRQLHRLDVLPDRPPQVRVLAPE
FT                   QSLVLWSPANRSWTLRFEASDDYAVAASAELRLTLAQGSGENITFSTQRRTLTGSGPAR
FT                   QRGFATTVQPQALGMAAGDDLIAQLIVHDTRQPGPQEGRSASVILRWPPPEQTMAAGLE
FT                   ASVKQTLPAYFRSQRQIIIDAQALLKEKPRLDAASFLKRSDAIGVDQRLLRLRYGQFLG
FT                   EESEGAPQGPPTADAPPTSDAPADDLPTADMPTADAPSAPAAASDTHAAHDHDAHASEP
FT                   GAAALDDHDHDHGGSDGRPERSSFGQAENVLAEFGHTHDHAEAATLLDPQTRALLRAAL
FT                   DQMWQSEGELRQGHPERALPYANKALGFIKQVQQAERIYLARVGTQLPPIDPSRRLSGD
FT                   RAGLGDRAAGLDTRPAPDPSALQLWDALGEAAPVPDATLARYAQWLQTQHDRLHDPLGL
FT                   AAAVETLRAEPDCARCRTQLRLQVWRTLLAPSGSTASPRRARRSGPALPGCAAAGDAAV
FT                   SPALIRLLPVHRSIGPRWSLDLAAGGPPSWARTASPRLYGGRFQDALRPEHQP"
FT   CDS_pept        complement(102371..103570)
FT                   /transl_table=11
FT                   /locus_tag="XCV0087"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21718"
FT                   /db_xref="GOA:Q3BZJ5"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21718.1"
FT                   /translation="MNLLLLFPTGLAALAALLLPLLIHLARRSEHRPTDFAALRWLRAL
FT                   PRPRHRVRLDEWPLLLARLLLLVAVALLLAEPAVRDHDDARPRIALSPGVDVAAARQLR
FT                   HAANAQWVWLAPGFPPVDADADADTHKTLARPAGATQPVSSLLRELDASLPADAALSVI
FT                   VPAQWGPLDAQRLQLSHQVRWQVVPGQSPLAAPAAAAPLRLQAIADDSAAPALRYLRGV
FT                   HAAWALPGSLPISTPANAQPSRWGPGTVVAWLSRSAPPAPVMAWVAAGGQLLVDAQTPV
FT                   PPNLAALLQPVQQTASGAPWLDAAAFGRGRMLRWAAPLQPQQLPALLDAGFPTRLHDAL
FT                   QPAPTPQRALAQTQHPQRGAAARLTTTPRPLAPWLIGLVLLLFALERWLATALRRATPA
FT                   "
FT   sig_peptide     complement(103526..103570)
FT                   /locus_tag="XCV0087"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(103614..104513)
FT                   /transl_table=11
FT                   /locus_tag="XCV0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21719"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21719.1"
FT                   /translation="MSVDVPALIPSDVRSRLRGLQLRARHAQGAHGIGQHASRSRGAGL
FT                   EFAQYRAYEPGDALRQIDWKLYARSDRFFVREAERESPLTLWLLLDATASAGQADHARP
FT                   GSTRLQTMAMLAACAAEIALQQGDQVGLFAVHGGGLVAVPAGGGPRQRDRLWLALHGLR
FT                   AGGRWPGMAAVRPLWERIATHALVLSIGDGFDEDLNAALEKLAAARRQVMQLQVLTCDE
FT                   RDFSFSGGHRFRDPETGEQLLGDGAAMRADYLQRFGAAQRAQQARWQAAGITHAVQYLD
FT                   AAPDAVLRRLFGSEGAQR"
FT   CDS_pept        complement(104527..105519)
FT                   /transl_table=11
FT                   /locus_tag="XCV0089"
FT                   /product="MoxR-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21720"
FT                   /db_xref="GOA:Q3BZJ3"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21720.1"
FT                   /translation="MTSPNDDILTAQLAQLGTLRAALARAVVGQDAVVEQLLIGLLAGG
FT                   HCLLEGAPGLGKTLLVRSLGQALELQFRRVQFTPDLMPSDILGTELLEEDHGTGHRHFR
FT                   FQQGPIFTNLLLADELNRTPPKTQAALLEAMSERTVSYAGTTYALPAPFFVLATQNPIE
FT                   QAGTYPLPEAQLDRFLLHVRVDYPSEQEERDILTQTTGSTSAQVPKVMDAASVQALQQH
FT                   VRQVHVGAELLTWINRLVRASRPGPQASDEVRQWIKWGAGPRAGQSLVLASKARALLHG
FT                   RFAATREDVVALAAPVMRHRLLLSFAAEAEQRTADDVVAALLRAVPFPT"
FT   CDS_pept        complement(105632..106450)
FT                   /transl_table=11
FT                   /locus_tag="XCV0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21721"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21721.1"
FT                   /translation="MSRSRESGVGIREWESTAGSLHPDTFPAPSVSGLRHLAAPATRRH
FT                   FLGLLLGSVAALALPQRVRAAGNYDFWFTRLRYDSGDWDVDARMPSNLITSLIDYTQLR
FT                   VDPQEHVLDLADPRMLQAPFCYLSGHKLVEFNPAERRNFERYVRNGGFVFVDDCNHDID
FT                   GLFATSFEAQMTSIFGKTALQKLPKNHRLYSAFFTFPDGPPATGFELNGWGDDLVHDYL
FT                   KGISIDGRLGVLYSNKDYGCEWDYDWRNKRFLAEDNTKFGVNIVMYALTN"
FT   CDS_pept        complement(106447..107781)
FT                   /transl_table=11
FT                   /locus_tag="XCV0091"
FT                   /product="putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21722"
FT                   /db_xref="GOA:Q3BZJ1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21722.1"
FT                   /translation="MSILTEAQAKAILDKVIKLSKADECTATLTGSIDGNIRFALNNVS
FT                   TSGIVDNTDLQVQVAFGKRVGVATINAFDDASLERVVRRAEDLARLAPENPEFMPAVDK
FT                   QTYRPSPTFSESTAAVDPAFRAQVAADSIAPCKGKGLIAAGFLEDGQSFTAFANSKGNF
FT                   GYQRGARFDYTCTVRTEDGRGSGWVGRNLKDAADFKAEQDIRIAMRKASDSAEAKALEP
FT                   GKYTVILEPAAAAGLISFMMNFFDARMADEGRSFLSKKGGGNKLGEQVYDPRVNITADP
FT                   WDPRAAVMPWDEEGLPREKMSIVENGKIANLQYSRFWAQKNGKRAVGEPGNLLMAGGDK
FT                   NIAELVRGTEKGILVTRTWYIRMVDPQTVLLTGLTRDGTFYIENGQIKYPVKNFRFNES
FT                   PVIMLNNIDELGKPVRVAGDESNFVMMIPPMRLRDFTFTSLSDAV"
FT   CDS_pept        complement(107796..109430)
FT                   /transl_table=11
FT                   /locus_tag="XCV0092"
FT                   /product="putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21723"
FT                   /db_xref="GOA:Q3BZJ0"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21723.1"
FT                   /translation="MQRRDFLALTGLTMGGLIVPAYFGKAIAAEQLLTPFDVGRKKRLA
FT                   DAGLNAARQAGASYCDVRIGRYLRQFVITREDKVQNVVNTESIGAGIRVIVGGAWGFAA
FT                   TNELTEQGVAKAAAQAAAIAKANAKVQGTPVQLAPTPGVGEVSWKTPIKKNAMEVPIKD
FT                   KVDLLLGVNAAATAAGANFVNSMLFVVNEQKYFASTDGSYIDQDVHRIWAPMSVTAIDK
FT                   ASGKFRTRDGLSAPMGLGYEYLDGAASGKFVSPNGVVNYGLSYDMKEDAIAAAKQAQEK
FT                   LKAPSVKPGKYDLVLDPSHTWLTIHESIGHPLELDRVLGYEANYAGTSFATLDKLKAGF
FT                   QYGSDKVHILADKTQPGSLGAVGYDDEGVKTKQWDLIRDGKLVDYQAIRDQAHILGKTA
FT                   SDGCCYADSWSSVQFQRMANVSLAAGKTPLSVSDLIKNVENGIYIIGDGSFSIDQQRYN
FT                   AQFGGQLFYEIKNGAITRMLEDVAYQIRTPEFWNACSAVADQRDYRLGGSFFDGKGQPS
FT                   QVSAVSHGSSTARFDGINVISTARSLG"
FT   sig_peptide     complement(109347..109430)
FT                   /locus_tag="XCV0092"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(110149..111777)
FT                   /transl_table=11
FT                   /locus_tag="XCV0093"
FT                   /product="putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21724"
FT                   /db_xref="GOA:Q3BZI9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21724.1"
FT                   /translation="MDRRTFLTLSGIGAAGLLLPNTRLIAAEQLLAPVDAARNRRLSDA
FT                   ALTTAKAAGASYCDVRVGRYLRQFVITREAQVENVVNAESIGVGVRVLADGAWGFAATN
FT                   TLTSDGVATATRQALAIAKANARLGGTPVQLAPVTPAGQVSWKTPIRKNAMEVPLQDKV
FT                   ALLMDVNAAALNAGATFVASRMFAINEQKYFASSDGSYIDQDVHRLWLPFTVTAVDKAS
FT                   GKFRTRDGLSSPMGMGYEYLDGDAGQKHQLPGGLIGYGHSYDAREDAIAAARQARAKLT
FT                   APSVKAGKYDLVIDPSNLFLTIHESVGHPLELDRVLGYEANYAGTSFATLDKRDAGYRW
FT                   GSDAVTFVADKTQPGSLGAVGYDDEGVKTKQWELVKDGILVDYQCTRDQAHLLGKTASD
FT                   GCSYADSWSNVQFQRMPNVSLAPGRTPLAVADMIRNVEHGLYIHGRGSYSIDQQRYNAQ
FT                   FGGQLFYEIENGQVTRLVEDGAYQIRTPEFWNACSAVCDQRDFRLGGSFFDGKGQPSQV
FT                   SAVSHGASTARFDGINVINTARSLG"
FT   sig_peptide     complement(111700..111777)
FT                   /locus_tag="XCV0093"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(112149..112538)
FT                   /transl_table=11
FT                   /locus_tag="XCV0094"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21725"
FT                   /db_xref="GOA:Q3BZI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21725.1"
FT                   /translation="MTLASARFLLVIAGVVLPYAARLPFGLGWLRQYTDVGLGGWLLLG
FT                   GFNAIAWGALLCISFLYRRPIALLVPCLLGFGVLAWAHATLDLRADAQSALALIFIPIY
FT                   ALLPITLGGVLGYVLDRKLRRSGTP"
FT   CDS_pept        complement(112604..112828)
FT                   /transl_table=11
FT                   /locus_tag="XCV0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21726"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21726.1"
FT                   /translation="MGGITRKIQLYFTEELKQQIGRFDAEFLLDFFTEEVGAYFYNRGI
FT                   CDAQAIVAKKLDDLGESIFQLERPTDFIR"
FT   CDS_pept        complement(112976..113362)
FT                   /transl_table=11
FT                   /locus_tag="XCV0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21727"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21727.1"
FT                   /translation="MRHLLPIDIPATLRRSTSVEQFLGKSPVDAAYVRHVELRPASDCI
FT                   EVWMYDVEDVGSEDSSDLHDFAYFEPDGPCAPAAIFADAAAAVTYASTFLAADPTRWTK
FT                   IGIAESEYLDYIRAGRPSRWPVAI"
FT   CDS_pept        complement(113443..113934)
FT                   /transl_table=11
FT                   /locus_tag="XCV0097"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21728"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21728.1"
FT                   /translation="MKTARVALVAAVLLQATPAFSASTTPSPLVGTWLLDTSSLPMPEA
FT                   VRPKRVVLQFKQVPGNKWATTADIVEHDDTKLQAQSTLLLDGTPGQASGTYLVDRAAVK
FT                   MPEPGVLVMQLMYQGVPASTRTYTVSADGKVMTEIEAYFKDGNPMMRTAYFKRAASQSK
FT                   "
FT   sig_peptide     complement(113872..113934)
FT                   /locus_tag="XCV0097"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(114233..115288)
FT                   /transl_table=11
FT                   /gene="cbbFC"
FT                   /locus_tag="XCV0098"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21729"
FT                   /db_xref="GOA:Q3BZI4"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21729.1"
FT                   /translation="MATMAAHFLHRLPVPMSRPSLTRFLIEEQHAGRIDAELRQLITIV
FT                   SRACKRISIAVSKGTLGGVLGDAGTGNVQGEAQKKLDVLSNDILLEANAWGGHLAACAS
FT                   EEMDHSQPVPDQYPSGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPKGTEKPGDEHFL
FT                   QPGTQQVAAGYCIYGPSTMLVLTLGHGTHAFTLEREEGSFLLTQANMRVPEDTAEYAIN
FT                   MSNQRHWEPAMQAYVGDLLAGKDGARGKDFNMRWIASMVADVHRILTRGGIFIYPWDKK
FT                   DPSKPGKLRLMYEANPMSMLVEQAGGAATTGRERILDIQPTQLHQRVPVFLGSKNEVAE
FT                   ATRYHLDADKA"
FT   CDS_pept        complement(115817..116803)
FT                   /transl_table=11
FT                   /locus_tag="XCV0099"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21730"
FT                   /db_xref="GOA:Q3BZI3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21730.1"
FT                   /translation="MKLSRKSAGIWWSLLFLFLAIVALIIFLFRDLEIFPAEQQSRQPS
FT                   NQVIDVHSELKSDSAFAGAAPASNVPARMSLSDLEMRSRRGDAAAACHVAAIYEQCLLL
FT                   LRQYDDVLAMIETKNLGAAGYFEALRPRAEYCAGISINARDAIDKWKDAAKKGNLNAMR
FT                   GYVSGSAFLGISDAAKYRTAFHAYSQLAEGFAWKLADQGDVNAMLALAHAYESGPTPAG
FT                   PLLSQVVNKDPTKALAIFYYLDDVPSRTPTRSIAENRVRELALTSIKAMESSLSAASIR
FT                   ASALIAGDLRRRWTKPLTYEKLFMSTLEDGSLRSAQAEDCDDQENRP"
FT   sig_peptide     complement(116687..116803)
FT                   /locus_tag="XCV0099"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(116808..117650)
FT                   /transl_table=11
FT                   /locus_tag="XCV0100"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21731.1"
FT                   /translation="MRPSLSLLLPCLFIAPTAMAVTKTCDGCTEAEMSSMVSHILIFES
FT                   GAYRNARQPAYVANPQSRSVMKGIYSWNYEADGETIVQHVSMSNVESQIFGFVNTLADA
FT                   YGERMLTSNAVGLADFNRPTSIYDVIDNPSREQQVVSAIENSKADFFQRAAEAAKIVNP
FT                   FPGFNPGGVNLTIKFIFDDKSTATYTFDSQTKSWVRVKDSQRDSSGNIVPITKSDFSGG
FT                   EGGTRTYDFSNSQADIDKFYAWANRSGIKFNQPTGSGTRTGITCVSTKDGVICHIVAY"
FT   sig_peptide     complement(117591..117650)
FT                   /locus_tag="XCV0100"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(117769..118971)
FT                   /transl_table=11
FT                   /locus_tag="XCV0101"
FT                   /product="aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21732"
FT                   /db_xref="GOA:Q3BZI1"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21732.1"
FT                   /translation="MSFFANVEQVPGDPILGLTEAYNADSRPNKVNLGVGIYYDENGRI
FT                   PLLRAVHKIEQQLAQDAKPRGYLPIDGLAAYDKATQELLFGADSALVTCGRVATSQTVG
FT                   GSGALRVGADLLKKLLPTATIAISNPSWENHRAVFGAAGFEVVDYTYFDAAIHGLNFDG
FT                   MLADLAKLEPGTVVLLHACCHNPTGADLSKEQWKQVAGLLKERNLFPFVDIAYQGFDKG
FT                   IEADAYAVRLLAAEGIDSYVVASSYSKSFSLYGERVGALSVVSATAAEAKAVQSQVKRI
FT                   IRTIYSSPSTHGAALVAGVLTSPELRDLWEQELTDMRERIHSLRAGLVEKLATLGAPEF
FT                   DFIQRQAGMFSYSGLTKTQVDRLRDEFAIYAVGTGRICVAALSQRNLDYVAQAVATVSR
FT                   V"
FT   CDS_pept        119128..121266
FT                   /transl_table=11
FT                   /locus_tag="XCV0102"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21733"
FT                   /db_xref="GOA:Q3BZI0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21733.1"
FT                   /translation="MSRLTLLAAACGLFATGATSPVLAADPAPPASTPIQRLPAVQVDA
FT                   ARVRGVDDFDLPASFTVVAADDDNRRGAQVSELLDGIPGLVARDRQNYAQDTQLSIRGF
FT                   GARSTFGVRGVRLLVDGIPASMPDGQGQLSHFNVLGAQRVEVLRGPFSALYGNSSGGVL
FT                   QLWSADGQPDDPWRLRATYGSNATVNVGAQLLGQQGAVHYNVAANRFDTDGFRAHSRAR
FT                   RDSVNAKLGFDLAEGRRLDLVLNYLDAPDAQDPLGLTRAQFTADPAQATSVATQFDTRK
FT                   SVRQSQAGAIFTQQLDNQTLRLMAYGGQRSVEQFLAIPVAVQRNPLHSGGVIDLDSNYE
FT                   GADARWAWQSEALGRPLQLTVGTNVDRQRQHRTGYENFVGDTLGIKGALRRNQRDEVQN
FT                   VDQFAQLWWQWSERWSALLGVRHSDVRFESDDHYIVGRNPDDSGKRAYSATTPVAGIVF
FT                   RADEDLRFYASVGRGFETPTFNELGYRSDGGAGLALDLGAATSRNYEVGSKWRAQSGAA
FT                   LEFAVFHADTDDELAVASNTNGRSTYRNIGATRRQGAELSWQQPIGAAQQLQLAYTFVD
FT                   ATVRDGYLTCASSGCATPTALVASGSRLPGVPRQQLFARWQWQPAQWQLAAESVASGAT
FT                   VVNDLATERAPGYALVNLEASRRWTTTQGALRAFARIDNVLDRQYVGSVIVNDGNGRYY
FT                   EPGPDRTYTVGLQWDFGG"
FT   sig_peptide     119128..119199
FT                   /locus_tag="XCV0102"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        121248..121673
FT                   /transl_table=11
FT                   /locus_tag="XCV0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21734.1"
FT                   /translation="MGFWRLRNIPRTAHHHAPWPRRSAPGRDEPVPIRPFPTLYRTSMI
FT                   VIDHAPADWFLLSEGDRSWLDINCTISAAGFSILLLLDATERAAVLAGQHAACATLAAH
FT                   VQARPHDYAARDSSATDGKRVLAAVRQWRARGSTAAG"
FT   CDS_pept        121868..122386
FT                   /transl_table=11
FT                   /locus_tag="XCV0104"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21735"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21735.1"
FT                   /translation="MMVCKRTVNLAAMAAGLLVCNAAWADHVDMRIVRDYPAGTPAIAQ
FT                   IHAWLQQQSRLGTQPRQTPPPADAAALGAVRISTAIFDRPLNTRADDISNAAPLPARGQ
FT                   PRDEITIDACTAGQRHRWVYSWEQSGRSAAWQLRSYRLQTATDCQVPPEQSMAIGTAAE
FT                   HGVTVTGKP"
FT   sig_peptide     121868..121942
FT                   /locus_tag="XCV0104"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        122773..124302
FT                   /transl_table=11
FT                   /locus_tag="XCV0105"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21736"
FT                   /db_xref="GOA:Q3BZH7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21736.1"
FT                   /translation="MNAQPATKPLNTDPQSIFKPRYDNFIGGKWVAPKDGQYFDNTTPI
FT                   NGKVFTSIARSTAPDIEAALDAAHAAKEAWGKTSTTERSNVLLKIADRIEQNLELLAYA
FT                   ETWDNGKPVRETLNADVPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQ
FT                   IIPWNFPLLMACWKLAPALAAGNCVVMKPAEQTPASILVLMELIGDLLPPGVLNVVNGF
FT                   GLEAGKPLASNPRIAKIAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAE
FT                   DDDFLDKAVEGFVLFAFNQGEVCTCPSRALIQESIYDRFMEKALARVAAIKQGNPLDPN
FT                   TMVGAQASSEQLEKILSYIDIGKQEGAQVLIGGERNTLEGDLAGGFYVKPTVFKGHNKM
FT                   RVFQEEIFGPVVSVTTFKDEADALAIANDTLYGLGAGLWSRDASRLYRMGRAIQAGRVW
FT                   TNCYHAYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLVSYSPKALGLF"
FT   CDS_pept        124479..124874
FT                   /transl_table=11
FT                   /locus_tag="XCV0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21737"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21737.1"
FT                   /translation="MQDSTTRTELPAQVTATLAALQLIDKLRAQHGDVLFHQSGGCCDG
FT                   SSPMCFAVGEFIVGDRDVLLGEIGGAPFYISAPQFEYWKHTQLIIDVVPGRGGMFSLEN
FT                   GEGVRFLVRSRLFDDDEFARLQQAGRA"
FT   CDS_pept        complement(124977..125156)
FT                   /transl_table=11
FT                   /locus_tag="XCV0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21738"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21738.1"
FT                   /translation="MSRDPLRDQPTQPGEQHGKRDAEHYEDRGAGDAPGRLIPADDQTP
FT                   AKKPGSAPSTGTDD"
FT   CDS_pept        125307..125705
FT                   /transl_table=11
FT                   /locus_tag="XCV0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21739"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21739.1"
FT                   /translation="MRPQDRRPDRRLFSAHVEPAPPRRAPRKSRMPDTAGVAQDFHCYS
FT                   LADYQRRRRRGGPTWRDLLPAYAFARITHAADWPRGADIDCEQALAAQWDSMRGASRLD
FT                   WPHVRDIVEDAWLALDHIPEAAIHGAAH"
FT   CDS_pept        125705..126664
FT                   /transl_table=11
FT                   /locus_tag="XCV0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21740"
FT                   /db_xref="GOA:Q3BZH3"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21740.1"
FT                   /translation="MARPIWTGTLSFGLLNVPVSLMSGERKVDLHFRMLDSRDKKPIRF
FT                   ERVNADTGDEVPWKEIVKAFEYDKGSYVIVEEQDIRSAAPESHETVEVETFVDAADIDP
FT                   RYFEKPYILVPGKKAEKGYVLLRETLRDTGKVGIAKVVIRTREYLAAVMPQGDALILLL
FT                   LRYQQEVVDPQDFKLPAGAVGEYRITPKEQEMAKQLIESMSGTWQPEDYHDEFRGKLEK
FT                   ILRKRIQEKGGTTTVDVEPPQHEDATTNVVDFMSLLQKSLQANTRTPAKKSSTAETASA
FT                   PAKKAATKKAPKKAVRKTAGKAAKKTAAKTAAPRRKAG"
FT   CDS_pept        complement(126802..127968)
FT                   /transl_table=11
FT                   /gene="lctD"
FT                   /locus_tag="XCV0110"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21741"
FT                   /db_xref="GOA:Q3BZH2"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21741.1"
FT                   /translation="MIISAASDYRAAAQARLPPFLFHYIDGGAYAEHTLRRNVSDLADV
FT                   ALRQRVLRNMSDLRLSTELFGETLAMPVALAPVGLTGMYARRGEVQAARAAAARGIPFT
FT                   LSTVSVCPIEEVAPAIERPMWFQLYVLKDRGFMRNALERAKAAGVTTLVFTVDMPTPGA
FT                   RYRDAHSGMSGPNASLRRMLQAVTHPRWAWDVGLLGRPHDLGNISAYRGSPTGLQDYIG
FT                   WLGANFDPSIAWKDLEWIREFWTGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLD
FT                   GVLSSARALPAIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYALAAAG
FT                   QAGVENLLTLIEKEMRVAMTLTGTHSIAEISADALSRVTRERAETISP"
FT   CDS_pept        complement(128108..129622)
FT                   /transl_table=11
FT                   /locus_tag="XCV0111"
FT                   /product="putative lignostilbene-alpha,beta-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21742"
FT                   /db_xref="GOA:Q3BZH1"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21742.1"
FT                   /translation="MHRRRFLQSLLAAGGSAALGSWMLRSLPAHAAEAAAFHTQLQRTP
FT                   WLLGWRSVTSPTFGPTTTAVQGKLPEGLAGSLYRNGPAWTERAGFRYEHWFDGDGMVHR
FT                   WQLGGTQVQHVGRMVATHKFTQEQQAGRFLYRAAGTSVPDMQPVRNNDDVNTANTSVAM
FT                   LNGRLFALWEAGSAIELDPDALRTLGPVTWRDDLAAMPFSAHPLIDRDGSAWNFGSINA
FT                   AGASGVVLWHLGADATLRHVQLLHTDAPGYMHSFAMTDRHLILVMAPYRRLDGEGAFFE
FT                   RLRFTPEAPSRIAVVPKDALDQPRWFEADFAVAYHFADAYAHRDRIVVRAIVYDDPEQA
FT                   RSPMRAAMHGDPAAAPSQVQLRSLHLDLSNGRAHWQPHPVDNLELPLYDRRTPTTTGAR
FT                   LYAPCIDGPDNSPFLNAVAGYDLERDRRQVHRYGPDVLAEEHVFVPRPGSDRPDDGWLV
FT                   GTVLDTRRGRTGLMVLDARHIDAGPVAQAWLPYALPLGFHGHFAPA"
FT   sig_peptide     complement(129530..129622)
FT                   /locus_tag="XCV0111"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(129649..130329)
FT                   /transl_table=11
FT                   /locus_tag="XCV0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21743"
FT                   /db_xref="InterPro:IPR018673"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21743.1"
FT                   /translation="MRSRAGACCRWCGDGADSSGVAHGCQAVLRLLAPRFGPHDMQPGV
FT                   LLQVWATPHGPICDGRQRSKVDTLRTIGLTASHPYRCRESCMLARPYPVVALAWLLGSA
FT                   GVHAADLNVDVSGLRSQQGKLRIAVIASAAQLDSAQPPVQAQTLPITSSTPHIQFKNLP
FT                   PGRYAVMINHDENANGKLDTNLIGMPVEGYGFSNNPTGMRKPGFDEIVFDLPASGKRIS
FT                   VQMR"
FT   CDS_pept        complement(130289..130936)
FT                   /transl_table=11
FT                   /locus_tag="XCV0113"
FT                   /product="putative protein-S isoprenylcysteine
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21744"
FT                   /db_xref="GOA:Q3BZG9"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21744.1"
FT                   /translation="MTCGPWYGCSARADWPHPLTALPRSHTMSASSLFIALNLVWGGYE
FT                   LLLSRRRRAGDGGAHDQGTLKYLWRVLSAAVAVAVMLAYSGLAHWPQGWAGSLQWTGCA
FT                   LIGSGLALRVWAIQVLARWFTVDVTIQPDHQLVRRGPYRWLRHPSYTGALLAFYGLALG
FT                   MGNALSVMAIVVPVTWVFLHRIRIEEAALQRAFPVAYPAYAKQSRRLLPLVW"
FT   CDS_pept        130886..132115
FT                   /transl_table=11
FT                   /locus_tag="XCV0114"
FT                   /product="two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21745"
FT                   /db_xref="GOA:Q3BZG8"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21745.1"
FT                   /translation="MRPVCARTAPIPGAAGHRSHLPEVTFCLRTIAERLHGGQHRRMNY
FT                   SFRHLLHPLRLAAAFTIAAVALSFMPDASAYGAWRWGALAGFTALFVVHTVLPQTHALR
FT                   TVATLLQAALALLLVWMEPHAGTAPVLLVMLVAQAGMTWPPLRVLLLALVLNAGMYAVL
FT                   VHAGFDRALLIVSIYAGFQAFAALTAHYARSAERARDTLAYVNADLLATRALLADSARD
FT                   AERLRLARELHDVAGHKLTAMRINLRLLSADPALAQRNEVAVVEQLSAELLSDIRNVVQ
FT                   SLRDDQGLDLQTALRALAAPFPRPTLRLQIDADVRVTDARVAELLLRLVQEALTNAVRH
FT                   ADADEVAVHLHCVGAQLHVDICDDGRRAERIREGNGITGMRERLAALHGQLDLGRTPTG
FT                   GMHLIARLPV"
FT   CDS_pept        132112..132744
FT                   /transl_table=11
FT                   /locus_tag="XCV0115"
FT                   /product="two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21746"
FT                   /db_xref="GOA:Q3BZG7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21746.1"
FT                   /translation="MSSRRIALADDQILVRAGLRALLQQQGVEVVCEADDGQGLLDALT
FT                   IHTVDVVLSDIRMPGLDGIQALEQLRARGDRTPVLLLTTFDDSDLLLRASEAGAQGFLL
FT                   KDAAPEDLREAIERVAAGDTLLQPVSTDPVRARYQFRDQQAPRETFNEREVAILRLLAG
FT                   GYSNKEIARTLFLAEGTVKNYVSTILEKLGTRDRTRAVLKAITLRVI"
FT   CDS_pept        133344..133742
FT                   /transl_table=11
FT                   /locus_tag="XCV0116"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21747"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21747.1"
FT                   /translation="MRLVRSWFVLIVVLFTSAWGASTQAELPVSWPRAALPIQTVAERD
FT                   MRVVVGCASAVQGTAAHACDRLIRRFDGEGCRQGLASRPRQVGQTDDPECAGIGTGTAG
FT                   TWSSRGQIKPAFSNGTERDERLRRLADI"
FT   sig_peptide     133344..133403
FT                   /locus_tag="XCV0116"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        133981..134580
FT                   /transl_table=11
FT                   /locus_tag="XCV0117"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21748"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21748.1"
FT                   /translation="MGRYRIGCAVLAIACLLMAATGCAKQPRLSSRLIVTLDAPILEQG
FT                   GAVIVSARPIADHQWRLLEGARSTKAGYEKEFQVTVASPASIIELHYPESGTYSFKLQP
FT                   AARAKTRPLQSRRVLIGQADLTDPQTKRQVHWPSMSVVHVSGSTYPEGWARTLASTFDV
FT                   PFESDAPDNYVISSFPAGRVIALTPKAIDTYVRDTN"
FT   sig_peptide     133981..134052
FT                   /locus_tag="XCV0117"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(134715..135113)
FT                   /transl_table=11
FT                   /locus_tag="XCV0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21749"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21749.1"
FT                   /translation="MTDPKIIPITLTVAHVEFGGNTGRGAYFYSFSPDLLICGKGEQGV
FT                   TLRYAFCKSVPHRFKIISLLNSDSTGQIGPAEIASDGSWVQVVNANKDRTLIFFSVVVK
FT                   DTHTGTHFSCDPQVGNDPEISPTEFGRH"
FT   CDS_pept        complement(135110..138457)
FT                   /transl_table=11
FT                   /locus_tag="XCV0119"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21750"
FT                   /db_xref="GOA:Q3BZG3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21750.1"
FT                   /translation="MSLRSERVTQLGSVPRFRLGPLLVEPERLTLIDDGQTITLEPRMM
FT                   EVLIALAERAGEVISAEQLLIEVWHGSFYGDNPVHKTIAQLRRKLGDDSRQPRFIETIR
FT                   KRGYRLLPKVVFPDDYRGAVIGPQAWGHGNPYMGLQAFDPAHADVFFGRSHAIAQVLGA
FT                   LRAQLHSQRGLVLVSGASGCGKTSLLRAGVVPLLCQPGGLDGLEATAVAYCNLAQCRGG
FT                   DVLDTLARALSEWAPGGRAVLSPAQTARLPEWLQQPAPLHAAIDEAMRQTGPARENVHT
FT                   RRHLLLVIDHAEAMVATPGITAADRAALAAALHALCASAHVAVLMLTRSDFYPRLIDAL
FT                   PDIVELKRGDGHVDLLPPRDGEIGQIIRVPAAMAGLRFEEDHSGAGRLDDVLRDATTRQ
FT                   PDALPLLQHLLHALHAQRSDDGLLTFAAYRALGGLEGALAHHAEQTFRALPSNAQAALG
FT                   EVLTLLSVIHPDSDAVTARRALWSALPASGTARVLVDAFVHARLFVSELVAGEPGFAVA
FT                   HEALLRQWPRAAEWIHENRRLLQARKRLQLAAQRWAAEGRRSDHLLNSGRPLSEAREAA
FT                   RRMPQDLDALDHAFLRACERSQRQRRSVYAAAAALLAVLASASLLLGWQARQAQQVAEQ
FT                   RRDQAQQLVGYMLGDLAEQLRTVGNLKLLDSVGSRALRYLEDLPESGMATGDLINHARA
FT                   LRTTGEVLMNQGKLEEAQAAFTRAASTAEQARTQAPDAVEAHAEIGQTAYWLGNMAYRS
FT                   KQFPLARTHWSQYLAASEWLVRTAPDDPHWQLELSYALNNLGTLARSEGQANTAIGLFA
FT                   RSIALKRQVLARTPDNASVRYELVDSLSWLSLAQETQGLLAPAEQGYREQIETLRLLVQ
FT                   HDPDANAWRRRMATSLVRTSNLALARGHLAQAQADAQASVGMLEPLVAQQPDNRTWRRD
FT                   LAHAYAQAGWVAALDGHAAAATRQLTQARQTLAGVLAHQPLPEWEWLDAIIALRLNRVQ
FT                   GLHGDRQTASLAAIVARLDALHQAKPADLIGVSALATALVWYGEQLDASGDHVGARAAW
FT                   QRAVAVLGADIGNSRDKTLLDPWIRAQIHLGRRAAVTQQLGWLYQAGYRHPGFVSLYAP
FT                   LFKESPTS"
FT   CDS_pept        138737..139945
FT                   /transl_table=11
FT                   /locus_tag="XCV0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21751"
FT                   /db_xref="GOA:Q3BZG2"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21751.1"
FT                   /translation="MIIHPKVRGFICTTTHPLGCERNVLEQIAATRARGVRTDGPRKVL
FT                   VIGASSGYGLASRITAAFGFGADTLGVFFEKPGTASKAGTAGWYNLAAFDKHAKAAGLY
FT                   SKSINGDAFSDAARAQVIELIKTEMGGQVDLVVYSLASPVRKLPGSGEVKRSALKPIGQ
FT                   TYTATAIDTNKDTIIQASIEPASAQEIEDTVTVMGGQDWELWIDALEGAGVLADGARSV
FT                   AFSYIGTEITWPIYWHGALGKAKVDLDHTAQRLNARLAKRGGGANVAVLKSVVTQASAA
FT                   IPVMPLYISMVYKIMKEKGLHEGTIEQLDRLFRERLYREDGQPAQVDDANRLRLDDWEL
FT                   RDDVQGACKALWPQVTTENLFELTDYAGYKHEFLKLFGFERTDVDYDADVETDVKFDCI
FT                   ELA"
FT   CDS_pept        140112..140399
FT                   /transl_table=11
FT                   /locus_tag="XCV0121"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21752"
FT                   /db_xref="GOA:Q3BZG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21752.1"
FT                   /translation="MDKLIAHLVLALLVSGVCAVLLRFIRMHGALKALINLLITTTVVC
FT                   AVVMQDGSAPPWQNALLIASFFSIPASVCVVLVSTAMAWIINKRRARRPA"
FT   CDS_pept        complement(140582..141604)
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="XCV0122"
FT                   /product="2-keto-3-deoxygluconate kinase"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21753"
FT                   /db_xref="GOA:Q3BZG0"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21753.1"
FT                   /translation="MSRARILCFGELLLRLGAPGHELLLQQPRLDVHCGGAEANVGVSL
FT                   AHFGHEVAMVSTVADNPLGAAVLGELRRHDVDTRHVRRVDGRMGLYFLTTGAIHRPSEV
FT                   IYDRADSAFALAPADAYDWPRLLEGAQWLHLSGVSPALGAEVAQATLAAARAARAAGVK
FT                   VSFDGNYRPKLWQRWQGDARGVLHQLFACADVVFADYRDIGVVLGGEFAQDTLEARVEA
FT                   AAQQAFAAFPQLQLMACTQRVAHNVDHHSLGAMLLPRDGAVARAPSEELTPIIDRIGGG
FT                   DAFAAGVLHGLIEGWSLEDTARFGLAAGCLKHSIPGDFNPLSVADVQACVGDARFDVKR
FT                   "
FT   CDS_pept        141891..144671
FT                   /transl_table=11
FT                   /locus_tag="XCV0123"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21754"
FT                   /db_xref="GOA:Q3BZF9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21754.1"
FT                   /translation="MQFRTTSRKTPVTLLALSIGLALSGQAAAQDAAQSPAEPAVDLDT
FT                   VTVTGYRASVEKALDIKRGEAGVVDAIVAEDIGKFPDLNLAESLQRIPGVVITRDAGEG
FT                   RAITVRGLGPEFTRVRINGMEALTTVGAGDQSGGTNRGRGFDFNVFASDLFSQLIARKT
FT                   ASADVEEGSLGATVDLRTARPFDYSGFTFAASGQAAYNAMAEKANPRVAALIANTWADN
FT                   TFGALLSVAYTERQVLEEGSNTGRWANGTSNGNFSAASPFAAARSADVYHPRFPRYVQM
FT                   EHDQQRLGVTGSLQWKPTDRTTISLDALYSKIDATRDEHYIEAISFSRGRDSGTPRRAD
FT                   RDGKPATIVRNGEIRNNALVYGEFDNVDIRSENRHDEWNTEFKQVSLDLEHRFSDAFSV
FT                   SGRVGTSRSAHENPVQTTIIMDKYDVDGYSYDYRGNNRAPVLNYGIDPTNPAGWELAEI
FT                   RLRPQTVDNDFDTAQIDFNWNISPGFRLKGGVLAKDYTFSTVELRRASEVSVPTFANGT
FT                   RIVPTDLTEQAGLKGINGSPSNWVVPNLDAVANQLGIYSNTGTYAVAPRANNTRSVEEK
FT                   DRGVWLMGEFSTDLGSIPLSGNFGVRYVRTEQESTGYALINNAPALNTVGRKYNNTLPS
FT                   FNLVAELAPDLLLRLGAAKVMSRPGLGSLTPGVTVAVAGGARTVSGGNPDLDPIEATNV
FT                   DLGLEWYFNEGAMLGVGVFYKDIESFIQTAREVRPYSSSGLPASLLDGTGASINDDFTF
FT                   SIPLNTPGGELKGVEANYVQPFTFLPGKWANLGVQLNYTWVDSQIQYLSSTGAPVMKND
FT                   LTGLSRSSWNATLFYEGESFAGRISATNRDDYLTQAPGTEAGFNVDGVHGMTGTTMIDA
FT                   SLRYKISKQLELSLEGINLTNEASDEWVWSPQTGELPLQYTETGRQYLLGLRYKF"
FT   sig_peptide     141891..141977
FT                   /locus_tag="XCV0123"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        145036..148902
FT                   /transl_table=11
FT                   /locus_tag="XCV0124"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21755"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21755.1"
FT                   /translation="MSVQKWWTSVLLLIALPMRAAAADAPELLFRVSADQSLQADVARG
FT                   DGVPNFRDKIALVPTGKRGNAIEWADDGVLSWNAPGNLYTQRGTLSFFWRSRYPVGEAP
FT                   FVIFRVGYADHTSWDMAWLRIDWNGHGFDAFVTDANLARTRVSFKLDRNPAASDWTHIA
FT                   FAWDETRGVRLYVDGKEAARAHCGAPCANGGSLDYDAALDQFGLAGRVMSPHQVQSRYN
FT                   FLRGSDFDEIRIYDRMLDAGGAAALARLQEPTTAPAIAADAQYAAFLHRYGWDNGHAPP
FT                   ALTAPVTRIRKVEFTDARDLKQWMWKATDGIAETTWPGVYNRSRLPGRNDYFQLPDWNT
FT                   YVEGGKALDLTLPDEPFNRIELRGAAYGQATYAAPNAQPQPLFARQQGVVRSVDQFPER
FT                   RGGTLRFANTAQETPIQEIWAYDVQPGEVPKGSAQLSYTVRSDIQPDYDNLAELRAVIA
FT                   GRYPPSERQTVIALPTKAPARKRPSDKTATTNQHPIVHILVPSSLGDPPPDQPLMRSWS
FT                   YGWENMHDGLDGIAITLPALNLPATHNGSIPLNIRIKDPIWPARDMIDVSVAVVPGQAR
FT                   TLWLDLRDRILSNDSLMLSIAAAAPGFDAQALDGTQLQLVFKPRAEAIKEHVADRFNQV
FT                   KDNWGFLVEEHTTSKRQLLYKRLDADITDLLRVDPDNALGREYWNDISYANQSELPVEM
FT                   PAVPKGVPAWAFWQLQDLKATRRYIRWWIEQRQVAYGDFGGGISDDSDLVQQWPGVALM
FT                   GVDPDMLNASMLALSDANYRNGMFTNGLSTIETDELHSYEEGINLNSALLYLNWGDPRT
FT                   VERLMQTVKAFDSIIQVNPQGHLLFASNWFGGRKVYREPNWQWQKPYSFPIVHPAILLG
FT                   GYNADPNSRRIVTGLADGYLAHAYTNAKGNWALPNEINWQTGKTRGGELFEGSGGADTL
FT                   HTFWAAYRFTGEDRYLKPINYRVANSGPNGLSLLNENFLDVMGKRNDWASKLIDAANKD
FT                   DGSAPDFPHHVAWEQTGNLDYLAAIYRSEAREKLQNFYMNTEGHWWSDRVESPTVNLQR
FT                   ARLGGVALKRNQTYPGHTVSWRFADPEAATQVAIAIPAPKQDRFTVIAYNTSNKTQRAS
FT                   MTGWNVAPGQWRITQGVDSDGDGKIDGTGTTREVAFEKSAAIDIDFPAGRTTILQLERI
FT                   AATTPVELRPDLGIGNGDVRVTADAIEVTVHSLGHADAPAGFVVLEDARGRELARAPFP
FT                   SLAAPRDLQPITTQVRLPLTNAANLKTVQLRVMTEGNVPEITGLNNSLALPTPAKPATT
FT                   ENRQ"
FT   sig_peptide     145036..145101
FT                   /locus_tag="XCV0124"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    complement(149488..150713)
FT                   /locus_tag="IS_1477_2"
FT                   /note="IS element 1477"
FT   CDS_pept        complement(149517..150350)
FT                   /transl_table=11
FT                   /locus_tag="XCV0125"
FT                   /product="IS1477 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21756"
FT                   /db_xref="GOA:Q3BZL6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21756.1"
FT                   /translation="MLEHTPLSERRACRLAGLSRDAFRHAPVPTPATQALSARLVELAQ
FT                   THRRFGYRRLHDLLRPEFPSVNHKKIYRLYEEAELKVRKRRKAKRPVGERQKLLASSMP
FT                   NDTWSMDFVFDALANARRIKCLTVVDDFTRESVDIAVDHGISGAYVVRLLDQAACFRGY
FT                   PRAVRTDNGPEFTSRAFIAWTQQHGIEHILIEPGAPTQNAYIESFNGKFRDECLNEHWF
FT                   TSLAQARDVIADWRRHYNQIRPHSSCGRIPPAQFAANYRTQQANNAVPFNPGLYQ"
FT   CDS_pept        complement(150383..150649)
FT                   /transl_table=11
FT                   /locus_tag="XCV0126"
FT                   /product="IS1477 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21757"
FT                   /db_xref="GOA:Q3BZL7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21757.1"
FT                   /translation="MKKSRFSTEQIIGFIKQADAGMAVAELCRRHGFSPASFYQWRAKY
FT                   GGMEADEAKRLKELEVQNTRLKKLLAEAHLDIEALKVGFGVKR"
FT   CDS_pept        150798..151349
FT                   /transl_table=11
FT                   /locus_tag="XCV0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21758"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21758.1"
FT                   /translation="MAAFLIGPLMNQAQKAGVDLFYIPLLTDLIPSDQERESYSSMEDI
FT                   VMIGYPNGIWDAKNNLPVIRKGITATHAGVSWNGNCEFLTDIASFPGSSGSPVFIANLG
FT                   GYMDNKGNAYMGTSRIRLLGIHYAGAMHTASGEIRIVTAPTSNLPVPITQIPNNIGVAI
FT                   NSKEILGLEKEVARFIGANT"
FT   CDS_pept        151912..152613
FT                   /transl_table=11
FT                   /locus_tag="XCV0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21759"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21759.1"
FT                   /translation="MLYSENGIPDPEGRIAKPLSQDQVPAAAVPGDVVLLHTMKHLQHV
FT                   NAIASDQSIMMAPSGVTVIYGDNGSGKSGYSRVLKRACRARDQSEPIHPNANLPASQGG
FT                   VAQATFEISVNGTNQEIVWRLDAAPPAGLSSIAVFDARCAKSYLEQENDFSYVPYGLDV
FT                   FGSLARLSQRLKLKVDQQILAGAVDLGVFAHLRGETAVGKQIAALTAKSKPEAIESLAT
FT                   LRDGLINGVGG"
FT   misc_feature    152584..153741
FT                   /locus_tag="IS_1479_1"
FT                   /note="IS element 1479"
FT   CDS_pept        complement(152698..153678)
FT                   /transl_table=11
FT                   /locus_tag="XCV0129"
FT                   /product="IS1479 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21760"
FT                   /db_xref="GOA:Q3C078"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C078"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21760.1"
FT                   /translation="MQLTFGDAEGLGKRKQTRREIFLAEMEQVVPWQQLLGLVAPHYPV
FT                   SGRPGRQPYALATMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPDETTI
FT                   LNFRRLLETHGLAARMLEAVNAHLARKGQSLRSGTIVDATLIAAPSSTKNADHARDPEM
FT                   HQTKKGNQWYFGMKAHIGVDEFSGLVHHVHCTAANVADVTVTHALLHGKEDSVFGDSGY
FT                   TGADNREELQTCKAAFFIAARRSVLQAIGNKRERAREQRWEHFKASVRAKVEHPFRVIK
FT                   RQFGYTKVRYRGLAKNTAQVLTLFALSNLWMKRKQLLPAMGSVRL"
FT   CDS_pept        153906..155582
FT                   /transl_table=11
FT                   /locus_tag="XCV0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21761"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21761.1"
FT                   /translation="MVRQAADEYRTAKAAAELAAQLHSEGESLLPGTGGDVWRELYEAA
FT                   KRFSVQVDPGKTIVDLTPEDACLLCQQPLQEGAARMHRFEAFVQAEAEKIHAAKKAALA
FT                   VVYVPMTKHPIAFGLDEALLLALRSEDEGIAEELPTHETALLDRQQSIRKAAESNDWSV
FT                   VLSLATSFSQRLSQLSVQLDLSAKALEEASDEAARKAMQAELGELDARAQLGLVKDAVL
FT                   SAVAKLAHLARLKACLPALRTNGISTKASELAEKVVSQELADALNREFAALKVNALRVS
FT                   TQSRSERGKPLHRLRLELPQSRTPSEILSEGEQRAIAIASFLAEISLNGQTSGIIFDDP
FT                   VCSLDHRRRELVAKRLVQEAAKRQVIVFTHDLYFLKLLADDGKRLGVSVQTQSVSRQQQ
FT                   GFGVTSADLPFEGKTSSQRVGVVKNIQVLAAKAYSQNDQENYEMHTVRAYTLLRLAWER
FT                   SVEEVLLRNVVIRFRKSVDTQRLSGVTVSDGDYARVNDGMTKCSNYAHDRPEIAGVALP
FT                   DPDELLADILAFDSFIKEVNARSVATEVVRKKGPAASVAVA"
FT   CDS_pept        155977..156366
FT                   /transl_table=11
FT                   /locus_tag="XCV0131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21762"
FT                   /db_xref="GOA:Q3BZF1"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21762.1"
FT                   /translation="MRRSTSSPKPARKRATVPLPTEVGWHSLDPSIPPRPYLERTPIPE
FT                   PRPDPSKPRRPGHPRAPQHCTVGYGYYPDSHQRIPTLRLRGRWLEQLGFTIGSKLNISM
FT                   RNGELVVSVADDGEKATDKAANNWR"
FT   CDS_pept        156521..156925
FT                   /transl_table=11
FT                   /locus_tag="XCV0132"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21763"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21763.1"
FT                   /translation="MAAMKQANFFIAVLLAFVVAACSRPVAPFSPAHVDQSVSQQSRYP
FT                   LATEPSLVGTYSGRSKSGGGYFYDHILEYRVWLHPEQGAVPLAGDDDYFAAFAQYESAL
FT                   AFSQAHKGAEPPVVLVRQLESINEPSPGVY"
FT   sig_peptide     156521..156622
FT                   /locus_tag="XCV0132"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        157104..157514
FT                   /transl_table=11
FT                   /locus_tag="XCV0133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21764"
FT                   /db_xref="InterPro:IPR025459"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21764.1"
FT                   /translation="MGALEYSVATLRFFGDDLVPDEISALLSGSPTASRHKGQELKSKN
FT                   GVVGIAKTGSWRLTATRREPEDLEAQIFEILDQLTQDLSMWAQLSSRYQPDLFCGIFMA
FT                   KSNDGLALSAKAMLALGQRGISLGLDIYDPTS"
FT   CDS_pept        158170..158490
FT                   /transl_table=11
FT                   /locus_tag="XCV0134"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21765.1"
FT                   /translation="MKPRSIGATFALAVALGLGLAAPARAQTADPCSVFLCMAAVSGFG
FT                   TPSAECAAPIAAFHAIQIWDPHFDSAATAAARRTYLMTCPGVVPVNQATLEAIIGQWGY
FT                   TP"
FT   sig_peptide     158170..158247
FT                   /locus_tag="XCV0134"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        158840..159316
FT                   /transl_table=11
FT                   /locus_tag="XCV0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21766"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21766.1"
FT                   /translation="MTVIEIFPSAGVGLVKLGMSRAEVHAVMGAPSTSFRKVPTSAYPT
FT                   DAWHHNGFQVFYGGIEPSVEFIELSANCGFEVLCLGQRVFSTPASRLVEKFLAVTPFDS
FT                   FDKELGYSYVFPALELALWRPDMEEPQGEYFSTVDIGCVGYFSRKIPAESTGET"
FT   CDS_pept        complement(159489..159827)
FT                   /transl_table=11
FT                   /locus_tag="XCV0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21767"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21767.1"
FT                   /translation="MAATVLTEEGHAGATYFLTGPETLDMQAATSRLSKIIGRKVRYLD
FT                   LPTPVFRVLMRATGNSPWMAKGLTVQFADVVAGHHDIDPTFEIERLTGKRPHTFDDFVR
FT                   DHRQAFVG"
FT   CDS_pept        complement(159852..160346)
FT                   /transl_table=11
FT                   /locus_tag="XCV0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21768"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21768.1"
FT                   /translation="MILVSGATGGIGGELCKLLQDVATPFRAMCRKQEQVDNLQQKGMD
FT                   AVLGDFDTPETLQGAMQGCHTLFLITPPTPEQVAQETAAIDAAKRAGIGRIVKVSASDC
FT                   NVRSPVPWAKSHALIDHHLRASGIAWTILKPTAYMQNFLWFKDPIAKGVFPMAAGRGSV
FT                   S"
FT   CDS_pept        complement(160354..160842)
FT                   /transl_table=11
FT                   /locus_tag="XCV0138"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21769"
FT                   /db_xref="GOA:Q3BZE4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21769.1"
FT                   /translation="MQTDNEHVRELALAVFAANGRLVSAGNELVAHLGLTSAWWQVLAA
FT                   LRYAPAPLPAASIARNMGLTRQAVQRIVDVLAEQGLVEFQPNPHHLRAKLVVLTRAGIK
FT                   AVSGAEKAVAPVDQAIADKIGIDRIRDAVRTLEEMSAVISEYLGEAPSASSSIVKLQE"
FT   CDS_pept        161708..164824
FT                   /transl_table=11
FT                   /locus_tag="XCV0139"
FT                   /product="putative alpha-amylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21770"
FT                   /db_xref="GOA:Q3BZE3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21770.1"
FT                   /translation="MRICVLNDALKDPTGLEQRCVAAREAGCDYVVMAAPFERDAEGRL
FT                   IEPAAGAPTQMQRLQESVQAARRAGVKLLIDVRLDEVGGASAVVRDNPQWFRARSTAVP
FT                   DPRQPRATPEVAEARFAYAQEGAALVEWWIARLLEWVGQGVGGFRLLQPQQVPVQRWRE
FT                   LIARVHAQAPEVVFAAWTPGLGLEALQELAGAGFDVAFSSLAWWDGRGSWFFDEDSALR
FT                   ALAAQVVAVLDAPDGKRAAAPEQHWQLALALGGAWLLDDAHLAALPSSIRITNGLPTSN
FT                   AGMRLRPLLREATGLTAVAIEPLGGLPSLLLINGDTRHVVPVPASDLLRLLGDAEALVA
FT                   EDGRTLSGATLEALEPGEVRVYRSVPARHVLAVPRMRPRAQTAGTWPRVCIESVTPSVD
FT                   NGRFPVKRTVGDRICVEADAFCDGHDRIAVAVLWRPADAKTWASAPMRALGNDRWRAEF
FT                   PLERIGTYEFRVEAWRDVFATLHADLEKKRAASTVLPVDVQEAIAVVQAAQARSDGALA
FT                   ERLQAVLARIGAQSEPLQQLAIVLEPDTAQAMAQADDKPFRSEYPVTFRVESERRAAHF
FT                   ASWYELFPRSQSGDASRHGTFDDVIKRLPHIRAMNFDVLYMPPIHPIGLNNRKGRNNSV
FT                   TAVEGEPGSPYAIGATDGGHTEVHAELGGLEGFRRLIQAARAQGLEVALDFAIQCAPDH
FT                   PWLKEHKDWFTWRADGSIPYAENPPKKYQDIVNVDFYASGAVPDLWNTLRDAVLFWVNE
FT                   GVTLFRVDNPHTKPFPFWEWLIADVRGRRPDVVFLSEAFTRPKMMYRLAKCGFSQSYTY
FT                   FTWRNHKHELQAYVEELNEGVPRECFRPHFFVNTPDINPLFLQTSGRNGHLIRAALATT
FT                   LSGLWGMYQGFELCEATPLAPGKEEYLDSEKFQLRAWPERAPGDIVEEITRFNQLRRMH
FT                   PELQSHLGTRFYQAHNDQVLYYGKFLDAGYLSRSRSMVLVAINLDPHAGQDADIEIPLW
FT                   ELGLPDHASVAVDDLWDGHRFAWHGKYQHIRLEATRPFALWRIRAGEVA"
FT   CDS_pept        164821..168171
FT                   /transl_table=11
FT                   /locus_tag="XCV0140"
FT                   /product="putative trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21771"
FT                   /db_xref="GOA:Q3BZE2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21771.1"
FT                   /translation="MNAVASLQADAEQSAVVADQRWYKDAIIYQVHVKSFFDSNDDGIG
FT                   DFPGLISKLDYIAELGVDTIWLLPFYPSPRRDDGYDIAEYMAVHPDYGSIEDFEQLVAQ
FT                   AHARGIRIVTELVINHTSDQHPWFQRARNAPAGSPERDFYVWSDTDQEYEGTRIIFCDT
FT                   EKSNWTWDPVAGQYFWHRFYSHQPDLNFDNPAVLEAVLEVMRFWLDRGVDGLRLDAVPY
FT                   LIERPGTSNENLPETHAILRKIRATLDAEYPDRMLLAEANMWPEDTQQYFGQNADECHM
FT                   AFHFPLMPRMYMAIAREDRFPITDIMRQTPEIPESCQWAIFLRNHDELTLEMVTDSERD
FT                   YLWQTYAADRRARINLGIRRRLAPLLERDRRRIELMTSLLLTMPGTPVLYYGDEIGMGD
FT                   NIHLGDRDGVRTPMQWSIDRNGGFSRADPAQLVLPPVMDPLYGFQAVNVEAQMRDQHSL
FT                   LTWTRRVLSVRKRYQAFGRGSLRFLYPGNRRMLAYLRCYQDETVLCVANLSHTLQAVEL
FT                   DLSEFEGRVPVDIIGGGSFPPIGRLTYLLTVPPFGFYAFQLVSEGTLPDWHVPSPVPLP
FT                   DYRTLVLRSDADESAALLPHLPTLEGEILPAWLSARRWFSAKDQALRSVRIARRTPLPG
FT                   DEPMTLLELEVELEDGRHERYMLPVGIVWEREQPSTLAEQLALARVRQGREVGYLTDAF
FT                   ALKPMVRGVIDALRSNAALDFCDGDDASQQGQVCFEATPALATLDIPQDPEIRWLSAEQ
FT                   SNSSLVVADKAVFKLLRHVAVGANPEIEIGRRLTEMGYANAAPLLGSVSRIDAQGTVTT
FT                   IALLQGFIRNQGDAWRWTLDHLARSFDEYATAQTDEARAEAVAGYDAFAAVVGKRLAEL
FT                   HEALSRATDDADFAPQRIDLPTANDVVAGVGRQVEEMWDTVNARLAGSEDSAEREALEA
FT                   VLAERPQLDALLAQAPSVLADSLLTRVHGDFHLGQILVAFDDVVLIDFEGEPAKPLAER
FT                   RAKASPLRDVAGFLRSLDYASEVSARGEEGTAARAGVGVDTHLDEFLVQFRRRSTQAFL
FT                   DAYHAVLDASAHPWIAPAAFNAATLLFLVEKACYEVRYEAANRPGWLMVPIEGLRRILQ
FT                   RARAGAGDT"
FT   CDS_pept        168168..170366
FT                   /transl_table=11
FT                   /gene="glgB1"
FT                   /locus_tag="XCV0141"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21772"
FT                   /db_xref="GOA:Q3BZE1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21772.1"
FT                   /translation="MMSGVMTAVSNRWDPGAVRALAEARHGDAFAVLGAHPSDNGRFLR
FT                   TYLPGADRVSAVLDDGQVVALDAGPEPGLFAGELPAHGGYRLRIGWPGGEQETADPYAF
FT                   GPQLSDFDLHLISEGHHLQLADALGANVVEVDGVRGTRFAVWAPNASRVAVVGDFNSWD
FT                   ARRHPMRLRHQAGVWELFVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTAS
FT                   IVADPTPHQWSDDGWMATRARRQAHDAPMSIYEIHAGSWLREAGLDLDWDGLADRLIPY
FT                   VADMGFTHVELMPVSEHPFGGSWGYQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIV
FT                   DWVPAHFPTDAHGLAHFDGTALYEHADPREGFHRDWNTLIYNHGRREVSGFLIASAMEF
FT                   LQRYHVDGLRVDAVASMLYRDYSRNAGEWIPNIHGGRENYETIAFLRRLNEVVREHTPG
FT                   AVMIAEESTAFPGVTADVAHGGLGFHYKWNMGWMHDTLHYAGLDPIYRRYHHGELTFSM
FT                   VYAYSERFVLPISHDEVVHGKGSLLGRMPGDDWQRFANLRAYLGFMFTHPGRKLLFMGC
FT                   EFGQPTEWNHDAGLPWHLLDDPRHRGVQTLVRDLNRLYVQYPALHAHDDDPSGFAWVVG
FT                   DDAGNSVVAFLRKGKRGDAPVLVVINFTPVVQHGYRIGVPQGGQWREVFNSDAGIYGGS
FT                   NLGNGGSVTAEQQSMHGHAQSLPLLLPPLGAIVLTPYG"
FT   CDS_pept        170559..171053
FT                   /transl_table=11
FT                   /locus_tag="XCV0142"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21773"
FT                   /db_xref="GOA:Q3BZE0"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21773.1"
FT                   /translation="MITRKHDDGETGTGTRIGVISDTHGLLRPEALAALKGCSQIIHAG
FT                   DVGKPQVLEALRALAPLHAIAGNIDDKPWANGLPQTLDLHIAGVRIHVLHDLKTLAPQV
FT                   QADVVISGHSHKPSVRMHDGVLYLNPGSAGPRRFSLPISVAMLWLGDGAPRAHVQPLAL
FT                   G"
FT   CDS_pept        171122..172270
FT                   /transl_table=11
FT                   /locus_tag="XCV0143"
FT                   /product="putative oxidoreductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21774"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21774.1"
FT                   /translation="MNTRRQFLSAAAAGTAALAAAPLMAQSSAPGSVMPTRGKTDAGAL
FT                   PTNPRVQGERYRPRSRLGFGGVAIGNGFAPATDAQSEQTLAAVWESGVRYFDTSPWYGL
FT                   GLSERRTGHHLHNHPADDYVVSTKVGRLLTATDTPPKTMWQQPSPFDYRYDYSASGVRR
FT                   SIEDSLQRLGVSQIDIAYIHDLSPENEKDLGMPWEQRFAEAVKGAMPELTKMRKEGLIK
FT                   AWGFGVNRPEPALRAIEEADPDIFLLACQYSLLDHAQALHDTFPKIAKHGASVVVGAPL
FT                   LAGYLAGRERYLYDGTIPPWAPAKRQKALAICDRHGVDLRTVALQFAAAPQVVSAVIPG
FT                   ARTAEQARANATSMQVAIPPALWEALKREGVMEADAPVPAAR"
FT   sig_peptide     171122..171196
FT                   /locus_tag="XCV0143"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(172316..173794)
FT                   /transl_table=11
FT                   /locus_tag="XCV0144"
FT                   /product="putative carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21775"
FT                   /db_xref="GOA:Q3BZD8"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21775.1"
FT                   /translation="MRGGALRGYRDQGVCVFKGIPYGGDTAPRRFQAPLPETPWHHVRD
FT                   ASGFGAAAPQLKANEPTSEDCLFLNVWTPGLRDGGKRPVLFYIHGGGYTTGSGSDPLYD
FT                   GVRLCKRGDVVVVTVNHRLNLFGYLSLAQLGDAGFADSGNAGQLDLIQALQWVRQHAAE
FT                   FGGDANNVTVFGQSGGGAKIATLMAMPAARGLFHRAWTMSGQQVTVAGPRAATQRAQLL
FT                   LDALKIAPGEIARMRTLPVAQLLAAAHVRDPSRVENTALYFGPVLDARNVPVHPFWPTA
FT                   PVQSARIPMVIGNTRDETRGFLGNDAKNFALSWDELPARLEAQQYVDLLPQVVIAEYRR
FT                   LYPQYTPSQVFFAATTAGRSWRGAVEEAEARARQGAPTWVYQLDWGSPLDGGKFGAFHT
FT                   LDIPLVFDNVRQPGSRTGDGADAQRMAEQMSEALIAFARHGEPNRRGAPHWRPYSLKRR
FT                   ETLVFDTPSRLELDPRGGERVLYQQAPFIQRGTF"
FT   CDS_pept        complement(173935..175011)
FT                   /transl_table=11
FT                   /locus_tag="XCV0145"
FT                   /product="putative esterase/lipase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21776"
FT                   /db_xref="GOA:Q3BZD7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21776.1"
FT                   /translation="MEQTRQTRALTALSRATRHGLALVVLGVLLARPAPAAERPSADTA
FT                   AEQASRIALWPTPLAPGDTALPQPQRIVERSSDPAQPDRYIQQVSTPYLVVYRPKQPNG
FT                   TALLVTPGGGYQRIVLDNEGSALVPGFVDTAGITLFVLRYRLPGEGHPNGADVPLADAQ
FT                   RALRLIRANAARYGIDAQRVGVMGFSAGGHVAASLGTRYAAQMYPPIDAADALSARPDF
FT                   QLLIYPVIDMDSANAHKGSRERLIGSAPSQAQVQAYSPQLHVDAHTPPTFLLHAQDDSV
FT                   VPVRNSLLMHAALLRSGVPSELHVFPQGGHGFGAASGSGLTVSAWPQLAQAWIAHVTKP
FT                   QPPVAKPAPPSPAKEMGR"
FT   sig_peptide     complement(174904..175011)
FT                   /locus_tag="XCV0145"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        175150..175971
FT                   /transl_table=11
FT                   /locus_tag="XCV0146"
FT                   /product="putative 2-keto-4-pentenoate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21777"
FT                   /db_xref="GOA:Q3BZD6"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21777.1"
FT                   /translation="MSNDAATPPPSTSTLSAIAQRFVEARRAGASLPDFPGQIPDDLVT
FT                   AYQVQDIAISQWHDHVVGWKVGYIAAERRDASGDERLLGPIFSQKVWNATGGTTEFPIF
FT                   VGGFGAVEAEYVLVLGADAPAEQTHFTPEQAAQVPATLFIGVEIASSPLATINQLGPRV
FT                   VISDFGNNNGLILGPEVTDWLARDEAALTAQTLIDDQVVGTGGATTLPGGLRAAYAFAL
FT                   SRSAQRGRPLKRGDLIATGNATGIHDIEVGQRALIRFAGIGDISCTAVSAS"
FT   CDS_pept        176009..177007
FT                   /transl_table=11
FT                   /gene="dctP"
FT                   /locus_tag="XCV0147"
FT                   /product="C4-dicarboxylate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21778"
FT                   /db_xref="GOA:Q3BZD5"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21778.1"
FT                   /translation="MITRRHFLGAGLGAAAAAPWLGAGATTPIPGGQLLTATDVHVGDY
FT                   PTVEAVRWFGKQLEERTHGRLKLRQYHSGQLGRESEAIDMARFGAIDITRVYSGALNNT
FT                   FPLTQALCLPYVFDSVPHLRRAIDGHVGDSVLRSFEQRDLVGLAIYDSGARCFYNTKHP
FT                   LHRPEDLKGLKLRVASSDIFLKLMRMLGANPTPMSLGETFSAMETHMIDGAENNMRSFQ
FT                   SSRHFEAAHYWSQSEHSYAPDILVMSRQSFQSLSAADRGLVVELARASVPVMRNLWDAS
FT                   ETVARKQVIDYGVKLNQVDMPAFRAAAAPLLAEYRKQPEIEALYRRIRDFA"
FT   sig_peptide     176009..176083
FT                   /gene="dctP"
FT                   /locus_tag="XCV0147"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        177018..177539
FT                   /transl_table=11
FT                   /gene="dctQ"
FT                   /locus_tag="XCV0148"
FT                   /product="C4-dicarboxylate membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21779"
FT                   /db_xref="GOA:Q3BZD4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21779.1"
FT                   /translation="MTEPETVAVPVAPLQRALDRVSDIAVGVASLALLGLVVVQGWQVF
FT                   TRYVLNDSPSWTEPVTLLLLSTALSLGAAAGVHTNRHFGFYLLGEHVPPLVRKMFEVIR
FT                   PLMIMSIGAVLAWWSAALLLDGLDIKMAGAQMPQSINYLPLSIGGALMVLFAVFKLWRV
FT                   LRPVHAGGVR"
FT   CDS_pept        177539..178822
FT                   /transl_table=11
FT                   /gene="dctM"
FT                   /locus_tag="XCV0149"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21780"
FT                   /db_xref="GOA:Q3BZD3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21780.1"
FT                   /translation="MGIAMLLGTFVVLLLIGVPVAYALGAAALATLLYLDLPTVVLVQQ
FT                   ISAGSGSASLIAIPLFIFAGELMLRGGISERLIALASSLVGRVRGGLGQVSVLSSLFFG
FT                   GVSGSAIADVSAVGGTMIPQMIKRGYDRDYAVNVSMTAALVALLVPPSHNLILFSAAAG
FT                   GGLSIADLFAAGIFPALLMTAAMMVTGYAVARHRGYGTEAFPGWRALALRLIGALPGLG
FT                   LVGLIFIGIRAGIFTAVESAAIAVVYALIVTALLYRQLRWAEFFAAVTHAARTTGVILF
FT                   VIATAAVFGWLLAYLQVPAAAVKFLQAIADSKNMVLLMIVVMLLLLGMFMDLAPKILIC
FT                   TPIFLPVVKAYGIDPIHFGLVMVLAGGIGLITPPIGSVLFIGTSIGQITIAQSMRTIWP
FT                   FWLAALCVLLIVAFFPELSLWLPRALRA"
FT   CDS_pept        179016..180599
FT                   /transl_table=11
FT                   /gene="xylB1"
FT                   /locus_tag="XCV0150"
FT                   /product="xylosidase precursor"
FT                   /EC_number="3.2.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21781"
FT                   /db_xref="GOA:Q3BZD2"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21781.1"
FT                   /translation="MRVRPISSRWRWPMAGGLLLCAGLSAAADWKRGIEHQRIADQGDG
FT                   SFLNPVLAGDHPDPSVLKDGDDYYLTLSSFDAYPGLPIWHSRDLVNWQPLGHAITQNVG
FT                   AIWAPDLIKHGKRYYIYFPARRGDQGERSNFVVWADDIKGPWSAPIDIGLGKYIDPGHA
FT                   VGEDGKRYLFLSGGDYVQLSDDGLKVVGTPKHVYDGWKYPESWDVEGYAQEGPKITRHN
FT                   GWYYMTTAVGGTAGPPTGHMVITARSRSIHGPWQNAPNNPITRTRSAQEPWWSRGHATL
FT                   VEGTDKRWWMLYHGYENGYWTLGRQALLDPIEWTPDGWFVAKGGDLGTPLKKPSGQALP
FT                   HGLALSDDFRASTLGPQWAFFNPAADEAKRLQVGNGVLRLQGKGSAPRDASPLTVIATD
FT                   PAYQFEVQMTVSPGGQGGALLFYSDKLYAGVGSNGQQFVMHRYGEERPATLAPSTNGGT
FT                   LWLRVTNNRHIVTIHSSTDGKAWTKYPVQMEVSGYHHNVAGKFLALKPALYAAGPGQVE
FT                   FRNFRYRALD"
FT   sig_peptide     179016..179096
FT                   /gene="xylB1"
FT                   /locus_tag="XCV0150"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        180741..181799
FT                   /transl_table=11
FT                   /locus_tag="XCV0151"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21782"
FT                   /db_xref="GOA:Q3BZD1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21782.1"
FT                   /translation="MPARKMPEEGMPGLPKGRVATINDIARMSGVSKKTVSRIINNSPL
FT                   VRQDTREKVEALMREVGYAPDPLARGLAFRRSFLIGMVYDNPTAQYIVDMQYGALDALR
FT                   GSSFELVVHPCDSRSPGYIEGVRRFAQAQKLHGVILVPRASEDQALADMLAEIGCRYTR
FT                   IASIALDTTSQTVITHDRDGAAEAADYLLSLGHRDIALVTGPSAYRSSIERTSGFADAL
FT                   TRRGIELPPERIVEAGYTFESGVAAAEKLLLGKKRPTAIFTGNDEMAAGIYKVALRAGI
FT                   SIPRQLSVIGYDDSSLASRLWPPLTSVRRHTRDTGRTAAAMLIQPDNAPQLPTASVRPH
FT                   LIVRDSCQPPED"
FT   CDS_pept        182221..183075
FT                   /transl_table=11
FT                   /gene="kduI"
FT                   /locus_tag="XCV0152"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21783"
FT                   /db_xref="GOA:Q3BZD0"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21783.1"
FT                   /translation="MSLYCKTHYATHPDAIKGASNDALRELYLLDGLFVDDAVTLKYTH
FT                   YERFVLGGAAPLGKTLELPRQTEPASAAGHPFLERRELGVLNVGAGTGTVTVDGTAYTL
FT                   GPKDGLYVAMGSTDVSFASADAANPAKFYLASTPAHARFETKQLSIKDAVALERGALET
FT                   SNERTIYQYIVPATCQSSQLLLGLTVLKPGSVWNTMPPHLHDRRSEVYFYFDLGANDRV
FT                   YHFMGEPDAQRHIVIQNNEAVVSPPWSIHMGAGTSNYAFIWAMGGENLDYTDMHVLDIC
FT                   QLK"
FT   CDS_pept        183258..184013
FT                   /transl_table=11
FT                   /gene="kduD"
FT                   /locus_tag="XCV0153"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21784"
FT                   /db_xref="GOA:Q3BZC9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21784.1"
FT                   /translation="MSNPFSLEGKVALVTGANTGLGQGIALALAEAGADIAAAGIQAPT
FT                   ETEAKVKALGRRFIAIEANLISIEPVQRIIEETIAGLGGLDILVNNAGLIRRTDAVDFS
FT                   EQDWDDVLNVNLKSAFFMAQAAGRHFIAQGRGKIINIASMLSFQGGIRVPSYTASKSGI
FT                   AGITRLLANEWASKGVTTNAIAPGYMATDNTAQLRADEDRNKAILDRIPAARWGVPADL
FT                   GGTAVFLASSASDYVNGAIIPVDGGWLAR"
FT   CDS_pept        184247..184909
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="XCV0154"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21785"
FT                   /db_xref="GOA:Q3BZC8"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21785.1"
FT                   /translation="MKIALMNEFSQAAKNPVILQQLNEVASEQGHSVFNVGMDGDNDHR
FT                   LTYIHLGIVASLLLNSKAVDFVVAGCGTGQGAMMSLNAHPGVFCGYCIEPTDAYLFAQV
FT                   NNGNALSLAFAKGYGWGAEINVRYIFEKAFSGERGMGYPAERRESQQANAGILTQLKQA
FT                   TAKSYLDGLRAIDPELIKQAIGGERFQQCFFDNAQDAEIRNFVAGLLGKTEAAAAAA"
FT   CDS_pept        185132..186244
FT                   /transl_table=11
FT                   /locus_tag="XCV0155"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21786"
FT                   /db_xref="GOA:Q3BZC7"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037459"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21786.1"
FT                   /translation="MRLLLFALLLLFACIAHAAPQRIFIAGDSTAAQYGAERAPQAGWG
FT                   QLLQDWFDPAQWQVRNHAKGGRSTRSFIAEGRLDAIAKELQRGDVLLIQFGHNDAKRED
FT                   PTRYTDPTTDYVQFLRRYVATARDKGATPILITPAARLLYDFGALLDTHGRYTLAMQQL
FT                   AAQEHVGLIDLNASSSDWIRALGEQAAKPYFLFVPEQGKADGTHFSRAGATAIACLVVH
FT                   GWVQLQPALKPQLRRDADCGAAPNTSAQRAAQAHPSLVVHERDLAREQPGPHGGAGPTT
FT                   AYPFFADAPALKFVLRKRVLHKGAGIGLHLHDKDEIYYIVSGRGLYALDGKQYDVAAGD
FT                   ALLTRPGSTHALQQTGEEPLVLLLAYTASK"
FT   sig_peptide     185132..185185
FT                   /locus_tag="XCV0155"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(186471..187115)
FT                   /transl_table=11
FT                   /locus_tag="XCV0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21787"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21787.1"
FT                   /translation="MDLTHLRIRRLELDDTRLLFTLANGIRIDEPIQAHRLLLKASPPQ
FT                   RAQWQITEDGFGVNWPAVAPPTAEGLLNMPELLWRRRAARAQAKLAQLRGRMDALSPGE
FT                   RELIALARLDADMNESGYARYFDRWDAATRSDALRGLAAMGAAQARQAIEGLGAVFERL
FT                   EEDPNLLSIEDILDAMSDTDRQRVDGWEEVYYRRSAELARLGLTHYGVDKA"
FT   CDS_pept        complement(187253..188143)
FT                   /transl_table=11
FT                   /gene="phhA"
FT                   /locus_tag="XCV0157"
FT                   /product="phenylalanine-4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21788"
FT                   /db_xref="GOA:Q3BZC5"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21788.1"
FT                   /translation="MNTAPQRVENQLTDKGYVPVYTTAVVEQPWDSYSADDHATWGTLY
FT                   RRQRELLVGRACDEFLQAQDAMGMGETHIPRFDALNRVLQAATGWTLVGVQGLLPELDF
FT                   FEHLANKRFPVTWWIRRPDQIDYIAEPDLFHDLFGHVPLLMNPLFADFMQAYGRGGVKA
FT                   HGIGPDAQQNLTRLYWYTVEFGLIDTPQGLRIYGAGIVSSKGESLYSLDSPAPNRIGFD
FT                   LQRIMRTRYRIDSFQKTYFVIDSFAQLMEATAPDFTPIYAELAQQPQVPAGDVLPGDRV
FT                   IQRGSGEGWSRDGDV"
FT   CDS_pept        188272..188754
FT                   /transl_table=11
FT                   /locus_tag="XCV0158"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21789"
FT                   /db_xref="GOA:Q3BZC4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21789.1"
FT                   /translation="MDQPIALDRTDLRLLALLQTQGRSSNAELAVQVNLSASACLRRTQ
FT                   RLEAAGIIAGYGARLDARALGLGLQAFVRVQLEQHGQADIEHFAEGVRGWDEVVACWAL
FT                   TGDMDYLLQVQVRDLEHFSRFLLDRLLNATGVSDVNSSFVLRTVKAPEGLPLSHLA"
FT   CDS_pept        189048..191246
FT                   /transl_table=11
FT                   /locus_tag="XCV0159"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21790"
FT                   /db_xref="GOA:Q3BZC3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21790.1"
FT                   /translation="MSAAIAPLGLLPAALLCALSTLAPAAHAAESADATNATTLDQVSV
FT                   NGTVSRAQPATTTRLPLTLQETPQSVSVIGLQRLEEQSLFSIDDVMRNVTGVNVSFYDT
FT                   QRPLYFARGFQITDFQVDGLPTYSGATNQEYDTVFYDRIEVIRGANGLLTGAGIPSATV
FT                   NLLRKRPGKDFDAAFGVSAGTWDFRRMQADVNAPLTEDGRFRSRVVAAWQDRDYYYDRY
FT                   HDSKMSGMAVLEGDLTDSSTLTVGYQRQDNTPVGSTWGTVPFFAADGSFANLSRSTNMA
FT                   PEWTRWQRETSTAFANLEQRFGQDWLLRVNAAHTKGAVQSLRVYGTGYPAADGSGVFLR
FT                   ANAGETQDTRDSVDVYLSGGFALFGRQHDVVIGGSWQDLQSTTYTLAQTYPDDWATCGS
FT                   ERCYFIPNIRHWNGDASEVTYTRTGARRQARTTQRGVYASTRLRLADPLSLIAGARLSS
FT                   WETRTQAFNASGSYTGTSGRYDVSDEVTPYVGLVYDIVPDVSVYASYTEIFNPQNYRDK
FT                   DNNLLAPVEGSNLEAGIKAQLFDGHAMATAAVFEAKQDNYAVRDMTQPEASLPDGSSAY
FT                   IGVDGTKSRGWEVDFNGEVLPGWTINAGYTHVKVTRAPTDAIYANLPEDYLQLSTQWRL
FT                   PGTWDRLSIGGGVSWQSAVRGFNIARPTGDGTGATTPVTVVQNPYALVHFNANYRISDQ
FT                   WTATLAVRNAFDKTYWANLDYQNYGEPRFVSVSLRWRY"
FT   sig_peptide     189048..189131
FT                   /locus_tag="XCV0159"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(191792..192835)
FT                   /transl_table=11
FT                   /locus_tag="XCV0160"
FT                   /product="putative hydrolase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21791"
FT                   /db_xref="GOA:Q3BZC2"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21791.1"
FT                   /translation="MTAFPSKCLLLSLSLSLAGLLSACGGEPRPATPAPVVQAPSAAAP
FT                   KPIKIGVALGGGAAKGFAHIGVIKMLEANGFAPVVVSGTSAGSVVGALYASGMDAFQMQ
FT                   EKAVALDQTSIRDVRLFSGGLVQGQKLQDYVNEQLGGKPIEKLRKPFAAVATRLEDGER
FT                   TVFVRGNAGQAVRASSSIPGVFEPVTIGKYHFVDGGVVSPVPVDAARQLGAEFVVAVDI
FT                   SSKASGKNPGDLLGTVNQSISIMGQRLGEAELKRADVVIRPKVNEIGSADFNQRGAAIL
FT                   EGERAAMAVMPQIRAKIAQLQAARSSAVRTAADQAKAAKQQAYERCLEQRSRWEKLRGT
FT                   DEACVAP"
FT   sig_peptide     complement(192767..192835)
FT                   /locus_tag="XCV0160"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        193010..194383
FT                   /transl_table=11
FT                   /locus_tag="XCV0161"
FT                   /product="putative amidase/aminoacylase/peptidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21792"
FT                   /db_xref="GOA:Q3BZC1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21792.1"
FT                   /translation="MDSAKRTVCSSSIFDHASARCPLRGLALSLLLAASPCHALDAVAV
FT                   KRQVDGILDRDYPRWEALYRTVHQHPELGFEETATAQRLAKEMRALGFHVSAGIGRTGL
FT                   VAMYHNGPGPTIMVRTELDALPMRETTGLAYASDVHLQSSDRDTYVAHTCGHDIHMAAW
FT                   VGTAATLVQLRAQWRGTLMFIAQPAEEKGRGAQAMLDDGLFARFGKPDYGFALHVGPDA
FT                   YGHVFYKAGAVTSNSDALEVVFQGKGGHGAMPAATIDPILIAARFVVDVQSVISREKDP
FT                   AAFGVVSIGAFNAGTAGNVIPDRAQLRGTIRSHDPQVRDKLLDGVRRTALASAQMAGAP
FT                   VPQIALGERGSRAVINDAALAERTGAVFAQAFGVDAERQREPSAASEDYSAFVAAGVPS
FT                   FYFGIGGLDPQWLQQARQTGERIPVNHSPDFAPVPQPSIRTGVEAMTLAVMNVMPPPS"
FT   sig_peptide     193010..193126
FT                   /locus_tag="XCV0161"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(194412..195419)
FT                   /transl_table=11
FT                   /locus_tag="XCV0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21793"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21793.1"
FT                   /translation="MAQWYFHNPGQADRLGPLDDASARAHAQRQPDALAWRDGLDGWTP
FT                   ARQLAELQGSGSAPPPLTGMSGRADEIDYRIVGNDMQFVEVELDPGESAIAEAGALMYK
FT                   DAAVQMDTVFGDGSHAGQSGGGLMGKLLSAGKRVVTGESMFTTVFTHAGSGKAKVAFAA
FT                   PYPGTVLALRLSEHGGQLICQKDSFLAGARGVSLGIAFQRKILTGLFGGEGFIMQKLEG
FT                   DGWVFVHAGGTVVERELGPGERIDVDTGCVVAYHAGVDMDVRRVAGLKSMFFGGEGVFL
FT                   ATLTGPGKVWLQSLPFSRMAGRMLQAAPQAGGQQRGEGSVLGGLGRLLDGDNRF"
FT   CDS_pept        complement(195617..196462)
FT                   /transl_table=11
FT                   /locus_tag="XCV0163"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21794"
FT                   /db_xref="GOA:Q3BZB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21794.1"
FT                   /translation="MTVATEHAADSTVVTNAAQLIELDQASVMRGQVRVLHALSLRIAL
FT                   GQHTAILGPNGCGKSSFIKLITRELYPLARADGLPAVKVMGQTRWQVDRLRSQLGIVTS
FT                   DLSVNLADMPGLDVESAVLSGFFASYVVPPHREISDDMRARAREALALARALPLVDRQF
FT                   AQLSAGETRRVLIARALVNRPQALLLDEPSTGLDLVARQHLLETMRHLARQGITLVLVT
FT                   HHIEEIVPEIERVILLRAGKVVADGTREALLTDASLSAVFDGPVRVQRNGARCWATVGE
FT                   "
FT   CDS_pept        196610..197815
FT                   /transl_table=11
FT                   /locus_tag="XCV0164"
FT                   /product="fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21795"
FT                   /db_xref="GOA:Q3BZB8"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21795.1"
FT                   /translation="MLSDPIIDVLTSGVAGLGVWGMLAVLLVFTQLTIFAVTLYLHRSQ
FT                   AHRGVDFHPAIAHFFRFWTWLTTSMITREWVAIHRKHHAKVETEEDPHSPQTKGIGQVF
FT                   WRGVELYRQARAERADIEQYGKGAPSDWIERHLYTPHANAGPMALLVINSVLFGLPGIA
FT                   LWAIQMAWIPFWAAGVVNGLGHWWGYRNFESADTSTNLTPWALWIGGEELHNNHHAFPS
FT                   SARFSMRRWELDIGWVAIRGLQALGLAKVLRVAPSLDIRPNIAVPDADTLKALLSHRFQ
FT                   AMTDYQRNVLKPALREEAAVTGAKLRELLPRRLRKGLVDDGRWLKPDARAQLQAWVAQR
FT                   PRMRTLVEYRARLTAVLEARSHDASERLRQLQQWCHEAEASGNAALQAYAARLKGYALS
FT                   GA"
FT   CDS_pept        197805..198200
FT                   /transl_table=11
FT                   /locus_tag="XCV0165"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21796"
FT                   /db_xref="GOA:Q3BZB7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21796.1"
FT                   /translation="MVRNPGGRRAVVRVHRARGVIVRALLVVWCACVPAIAAQAQVQDS
FT                   QQYLQRMDTDGDGRVSLDEYLAWMSYAFDQRDTDHDGVLQGDELPGRRGKPITRAAHRA
FT                   TLIARFARQDADGDGYLSARELLAPPR"
FT   sig_peptide     197805..197915
FT                   /locus_tag="XCV0165"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        198249..198986
FT                   /transl_table=11
FT                   /locus_tag="XCV0166"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21797"
FT                   /db_xref="GOA:Q3BZB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21797.1"
FT                   /translation="MFTLDRVSRRYGQAIALDAVSLTFASGITTALIGPSGAGKSTVLR
FT                   MLVGLEWPDSGTVAFDGTPLQRANLQAQRQRIGYVIQEGGLFPHLDARSNVTLLAQTLG
FT                   WTRERIEARLDVLCALCQLPTQLLARYPAELSGGQRQRVGLIRALMLDPPALLLDEPLG
FT                   ALDPIVRYDLQAQMRELFAQLGKTVVLVTHDVAEAAYLADNLVLMRAGRIVQQGRARDL
FT                   LEQPADAFVQRFLTAQRSIGDAA"
FT   CDS_pept        198983..200455
FT                   /transl_table=11
FT                   /locus_tag="XCV0167"
FT                   /product="ABC transporter permease and substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21798"
FT                   /db_xref="GOA:Q3BZB5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="InterPro:IPR041894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21798.1"
FT                   /translation="MMARALIAVVWLICSVSAQAAQVTIGSKNFTEAVILGEIATAAGK
FT                   RDGVDVQHRAQLGGTRILWRALETGQIDAYAEYTGTLAQELLQLPNASQAELRAALDAR
FT                   GLAMTDSLGFQNTYAFGMKRERAQALGIASLSDLARHPSLKIGLSNEFMQRADGWPGVR
FT                   AAYALPQAATGLDHDLAYRALQSGAIEVTDLYSTDAEIPYYQLQVLRDDRHYFPDYQAI
FT                   FVYRKDLAHRSPAMLQALRGLQGRIDEATMQRLNAQVKLERQSEAAVAARWLGVTPASE
FT                   TDSRLTRLLRHTREHLALVGISLGLALLLALPLGVLAARRPRLGQVVLSLTGVLQTLPS
FT                   LAVFVFMIPLFGIGAKPAIAALFLYSLLPIVRNTHAGLTSIPRELRQTAHAIGLPAWTR
FT                   LWRVELPLARRTIVAGIQTAAVINVGTATLGALIGAGGYGQPILTGIRLDDIGLILEGA
FT                   IPAAVLALLVQAVFEGAERWVTPRGLRISQRQ"
FT   CDS_pept        complement(200646..201827)
FT                   /transl_table=11
FT                   /locus_tag="XCV0168"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21799"
FT                   /db_xref="GOA:Q3BZB4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21799.1"
FT                   /translation="MSSPSLSSTLAAPLAWAQRQQAFALPSGVIHLDAASRGPLLRAMQ
FT                   TVAHQAVDAMATPWRLPFDTWLQQIEQVRGLAAALLDGDADAVAMVPSAAHGLATAARN
FT                   LPVQAGDAVLVLEGQFPSNLLIWQRRCAETGAHLVAVPATAGGSLTDAVLQTIADTPAL
FT                   RIASLPHAYWLDGRMLDLDRISAAMQARGAALVLDLSQSLGVLPPDLPRWQPDFVVSVG
FT                   HKWLLGPMGLAWLWVAPQWRTDGLPIEEHWIGRDAGSSWEFPVASAPRYRSGARRFDAG
FT                   GVADPLRVATATVALQQLTAWQPARIAAALGELTAHWDAALQARGVGSWCTPGHAPHLT
FT                   ALQPPAAALDAVATALGASGVICTRRHGRLRIAPHLSVTDHALSQVIAALPDG"
FT   sig_peptide     complement(201777..201827)
FT                   /locus_tag="XCV0168"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        201815..203182
FT                   /transl_table=11
FT                   /locus_tag="XCV0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21800"
FT                   /db_xref="GOA:Q3BZB3"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21800.1"
FT                   /translation="MAMTCPQLTAGCHAAHTARSRALPKHRAMSALSPLLGHLQQQQLM
FT                   LLERYAQTRALSDRLAAPLSAEDAMVQSMPDASPSKWHLAHTTWFFERFVLQADPAYRV
FT                   FDPAWDFLFNSYYQSVGPMHARARRGVLSRPSLQQVRDYRAAVDRQMQQRLREGLLDAQ
FT                   ACTVVQLGIQHEQQHQELLLTDIKHALWSNPLQPAYRDLPTPPAAVASPLRWHARDEQI
FT                   VQIGAAAWPQADIFAYDNESPRHRVLVGAHALASRVVTNAEFQQFIDDGGYRSAGAWLS
FT                   DGWAMVQAQGWQHPLYWDADGREFTLDGWRTRDPHAPVCHLSLFEADAFARWAGARLPT
FT                   EAEWEQAATGVPVQGNFVDTDALHPRGAEAVDTGIQQLFGDVWEWTGSAYLPYPGFTPW
FT                   PGSLGEYNGKFMNAQWVLRGGSCASPASHLRASYRNFFPSDARWQFAGVRLAKDLP"
FT   CDS_pept        203056..204165
FT                   /transl_table=11
FT                   /locus_tag="XCV0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21801"
FT                   /db_xref="GOA:Q3BZB2"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21801.1"
FT                   /translation="MGLAWWQLRQPGQPSACQLPQLFPLRCALAVCRRAPCQGSALNAA
FT                   AHALQRAHAALTDLRPQPDDITADALAGLSQTPKTLPSKYFYDARGSQLFEAITQQPEY
FT                   YLTSTELSLLEASMGSIAQAIGAGVHVVEYGSGSGRKTELLLQGLRDVVAYTPLEISRT
FT                   ALLESTARLAQQFPQIQMLPVCTDFTKPLRLPDAQRPARRHVVFFPGSTLGNFADAAAI
FT                   ELLDAMRQTMGSDGCALIGIDLDKDAGLIEAAYNDAAGVTAEFTLNLLARLNREIGSDF
FT                   DLDGFRHHAVYVRERGRIETFLVSQRAQQVRVGGKDIAFAEGEAMQVEYSCKYTDARFA
FT                   ELAAAAGLKVTHGWNDAKDWFGLRLLRPL"
FT   CDS_pept        204214..204450
FT                   /transl_table=11
FT                   /locus_tag="XCV0171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21802"
FT                   /db_xref="InterPro:IPR021660"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21802.1"
FT                   /translation="MIRHLLAQRRPEQSICPSEVARALSDDAAVWRSLMPQVRTVAAAA
FT                   AGRGLVRITQQGRTVDPATARGPIRLMRGPHFD"
FT   CDS_pept        complement(204561..208304)
FT                   /transl_table=11
FT                   /locus_tag="XCV0172"
FT                   /product="putative ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21803"
FT                   /db_xref="GOA:Q3BZB0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21803.1"
FT                   /translation="MHRGPATLSGHAMTSTAALSSPDSANTPELGRVDADYTLDHKYTR
FT                   TDGRIYLSGVQALVRLPLLQRLRDDAAGLETAGFISGYRGSPLGGLDLELWRARKHLDA
FT                   AKVTFTPGLNEDLAATMVWGTQQTNLFPGANVQGVYGMWYGKGPGVDRSGDVFKHGNAA
FT                   GTSPFGGVLALAADDHACRSSTLPHGSEDEFVSAMMPILNPAGVQDILDMGLLGWAMSR
FT                   YTGRWIGFKTIAETVESSASVDVDPFARTIVLPEDFALPPGGLSIRWPDPPVDQEMRLH
FT                   RYAIAAAQAFARANHIDKVVLDSPNARLGIVTTGKSYLDVLQALEYLGLDAQACAQIGI
FT                   RVYKVGMTWPLEPAGISAFAQGLEDIVVVEEKKAFIERQMKELFYNWPASAGARPSIVG
FT                   KYDEQGAWILPSTGELTPATIAAVIGRRILRLLQSSTINTDSIQQRLRWMDAKEAEMAL
FT                   PRAQFPRVPHYCSGCPHNTSTAVPEGSRALGGIGCHYMVTWMNRATDTFTHMGGEGVTW
FT                   SGQAPFTDTPHVFQNLGDGTYFHSGSLAIRQSVATGVNITYKILYNDAVAMTGGQPVDG
FT                   TLTVPDIAHQLRAEGIHEIAVVSDDIGKWTRRRELFPPEVAFHDRGELDAVQQHLRTVK
FT                   GVSILIFDQTCATEKRRRRKRGKLVDPPKRVMINSLVCEGCGDCGEKSFCVSVLPKETE
FT                   FGRKRQIDQSNCNKDYSCVAGFCPSFVTVHGGAPRKGKRRDASTLLDTLPSPPKRTALE
FT                   RPWNILITGVGGTGVVTIGALLGMAGHLEGKGATVLDQTGLAQKGGAVTTHIRIARQPA
FT                   DIHAVRIAAGEADLVLGCDMVVVNDYWALSKVRDGRTQVVLNTYEAMPGTFTTQPDLQF
FT                   PAAEIIAGVRTALGGQEPLLLDATQLATALLGDAIASNLFVLGYAWQHGLVPLSHAALM
FT                   RAIELNGAAVAMNQQAFAWGRLAAIDLPAVQRAAGLASADAPAHLHGDTPHARGPGSWE
FT                   EHDLSGQSAPRALAQTDGSTLHGEVAAPAAPLDDEQLAHSLDEAIARRVAFLTDYQDAA
FT                   YAQRYRSLVERVRTHELQRVPGSSALTEAVARYAFKLMAYKDEYEVARLYTRGDFQRRL
FT                   QQQFEGDYTLRFHLAPPLLAKKDAHGNLIKREYGPWMFTAFKLLARLKFLRGGKFDVFG
FT                   YSEERRGERRLIADYSATVDMLLERLDADNVGLAAQIASIPEHIRGYGHVKHAHLQEAR
FT                   AREAALLAQWRNPKALHVVQAA"
FT   CDS_pept        208428..209099
FT                   /transl_table=11
FT                   /locus_tag="XCV0173"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21804"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21804.1"
FT                   /translation="MGRGRLLSGENTVKRKYAWAALALLGGVWSLAQAQSLPKPKEFYF
FT                   DEDRGTTKAVVAVQGQGDAVVDRLAAMVQRDARAADPRAQLAALAYAGGRTQLGDELYQ
FT                   GALALVSNGSQQYRAITWNYGWDLLRADQPDKALQQWANLANGRPATPEWLPTTAALAL
FT                   WRAGRKQEAVEWYAAAVRTWPDRWSSTANYASLLPEWREAERASLAEVFAAWQANPPAF
FT                   P"
FT   sig_peptide     208428..208529
FT                   /locus_tag="XCV0173"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        209934..210851
FT                   /transl_table=11
FT                   /locus_tag="XCV0174"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21805"
FT                   /db_xref="GOA:Q3BZA8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21805.1"
FT                   /translation="MAVDAFALILAMLGLGLLFARLRVLPDNSADVLNRIVLYICLPAS
FT                   VLTYVPRLHLDASLGGVIATPWLLTAIIVPLLWGCSRLLRLGRAEYAALLMCVVFTNSS
FT                   FIGFPMVRALIGDHALPYAVVYDQFGTFVLLSTFGLYVLARYSGDTPPTARLIAMRVLQ
FT                   FPPLWALLFALTLMPEQPPAWIGLGLKNLADAMLPLVMLSVGFSLQLRLPADELKPLAV
FT                   GLVFKLLLMPVLALPLSWGLGLHGQMLQTNVLESAMPTMITAAALAISHRLAPRLAAAM
FT                   VGYSILLSLLTLPAWAWLLARLVA"
FT   CDS_pept        211175..211807
FT                   /transl_table=11
FT                   /locus_tag="XCV0175"
FT                   /product="putative ParA family partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21806"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21806.1"
FT                   /translation="MKTVLVAASKGGVGKTTIATNLAAHAALQGQRTVLADADPQGSST
FT                   RWAERRASLESAVLPIDATKRRSWQSAVPDGTDALIVDAPAGAMADDLSGFLDHVDAIV
FT                   VPVLSSALDIEAVVGFLNTLAKVPRVHQRKLPVGLVLNRARPWTQTSQQAADMIGNWPY
FT                   PLVTQLRDTQAYVVMAGLGRSLFDYRSAQVRDHQQDWEPLFKWLKKS"
FT   CDS_pept        211823..212299
FT                   /transl_table=11
FT                   /locus_tag="XCV0176"
FT                   /product="putative phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21807"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21807.1"
FT                   /translation="MRELILLRHAHAEPADTGQADFDRPLSPHGIAEAEAAGRWLREQR
FT                   LVPDRVLCSPARRARETLEAVLELTGYIEQRLDERIYEATPGTLASLVDEHREAERLLL
FT                   VGHNPGLERLAALMHSGQTGDYRGMPTASIALLALPLDATIEPGIARLTAFWWP"
FT   CDS_pept        212360..212875
FT                   /transl_table=11
FT                   /locus_tag="XCV0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21808"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21808.1"
FT                   /translation="MAQQKVQSIDPAQSRFGFEIKTRFGMKIEGFFPRFRGDVVTLADG
FT                   RQQVRFRLDATQVEIPGKDRYTSWMRGEDFFDVAQYPVVEFESLPYVDEVVKQGGDIVG
FT                   NLTIRGITHLETLHVVPAECTRPGYDCDVISRGTVLRGRYGMNAWQMALGDRVTFILRG
FT                   RLQEARRP"
FT   CDS_pept        212872..214890
FT                   /transl_table=11
FT                   /locus_tag="XCV0178"
FT                   /product="phospholipase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21809"
FT                   /db_xref="GOA:Q3BZA4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21809.1"
FT                   /translation="MKCLLRVCVLATLLLGTGCASLSQTERNRAAGVAAAARSTVVNCS
FT                   QADRCAQPSPLRALGGEAMTASTPAAPRHYATIVDHGEESLVARLNLIRSATRSIDLQT
FT                   YIFDKDDSARMVLDALVDAAQRGVKVRILIDQLSAIADLQILGALASSHENLQLRIYNP
FT                   TFGKVKLNYFDYAGSVLCCFRRFNQRMHNKLLVVDDVLGVVGGRNYQDDYYDWDSEYNF
FT                   RDRDVILAGPEVRAMAANFDAFWRARRSVPAERLNDVGRLLLEQGVPTMPPAEFRRPDR
FT                   VARVDREVRDPQFVRDAFVTPAMPVQRVLYVADLPQKHRREHAAKAVSTAPELDGLIAG
FT                   AQQEVLLQTPYLVLSDQAQAIFRTLRKHPQPPRIVVSTNSLAATDNPIVYALSYKFKRR
FT                   NMRELGFNVYEFKPFPLDAPVDYANLVPDPLNPASEVNRDSRNNRLIGGSAAGNAMRGS
FT                   SGPEGNASASAGSVLRGSGGGRAPGGSEVDRRVLRTETRPSFLGTRAVNKPLPVTRAGA
FT                   RMGLHAKSLVVDRRIGVIGTHNFDPRSENYNTEAAVVIDDARFAQALAASIERDVAPEN
FT                   AWTVAPREKPPVLSGLNYSVGKVSEALPVLDFWPWRYATNYEFQPGPDCPFPLKRQDPQ
FT                   FRQCYVAVGDFPEVNVGPKWLLVRMLTAFGAGLVPIL"
FT   sig_peptide     212872..212940
FT                   /locus_tag="XCV0178"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        215180..215608
FT                   /transl_table=11
FT                   /locus_tag="XCV0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21810"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21810.1"
FT                   /translation="MTFREPVDLAALNAASRDTLIEHLGIVFTEAGDDWLRATMPVDAR
FT                   TRQPYGLLHGGASVVLAETLGSSAGNLCVDMSTQICVGLEINANHLRAATQGLVTGTAR
FT                   AVHVGRSTHVWDITIENPAGKRVCVSRLTLAVVARSNG"
FT   CDS_pept        215630..216529
FT                   /transl_table=11
FT                   /locus_tag="XCV0180"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21811"
FT                   /db_xref="GOA:Q3BZA2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21811.1"
FT                   /translation="MEQRHPLPALRGGHAAVTMVALPSPVTGSVRRMSESSLDATRDAG
FT                   GALRWFRYLYRVPLLLLHLCLGLPVTMLCVVVPALAQIRIGHDDTLEERMIRWWQGTLM
FT                   RVFGFRLRRFGTPLPGATLFVANHLSWVDISILHSQRVMGFVAKREIAGWPLVGWLATK
FT                   GQTIFHQRGNTESLGGVLQEMLLRLQSGKPVGVFPEGRTRGGTEVGPFHARIFQAAVEA
FT                   GVPVQPVALRYGLRGNAQAVVAFGERESFFANIVRLLGEPSRLAEVHFLEPIRALDIEG
FT                   RRRMAETSRQRIVAAMES"
FT   CDS_pept        216589..217578
FT                   /transl_table=11
FT                   /locus_tag="XCV0181"
FT                   /product="putative hydrolase of the alpha/beta fold
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21812"
FT                   /db_xref="GOA:Q3BZA1"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21812.1"
FT                   /translation="MNASDYLPPRWLRNPHVQSVLGSSALRRIRSRQLLAASGAVTSEH
FT                   ILDGGDGVRLQGWMSIPPGDAPPRGTVLLLHGWEGSADSNYMRLTAARLLGLGYQVFRL
FT                   NFRDHGGTHHLNVDLFHSDRIEEVVNAAGDLWRRFPAPQLLAAGYSLGGNFALRLALRA
FT                   PAAGLPLARVAAVCPLLDPAATMTQLEKGPQFYDWYFRRKWRESLLRKRKLFPEQHGYD
FT                   DATLALDMRGLMAWLAVKHTGHGSLEAYFDSYSIAGQRLANLQVPVDILMAEDDPVIPF
FT                   ADFAAWQLPAHAKLEIARWGGHCGFLENARGDGFAERWVAERLTTARE"
FT   CDS_pept        217575..217832
FT                   /transl_table=11
FT                   /locus_tag="XCV0182"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21813"
FT                   /db_xref="GOA:Q3BZA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21813.1"
FT                   /translation="MTLRRHPSMDAVIAVLPVIVGCVRVYFSAISLYTRPQTGQILFRS
FT                   RAGSVSVGAHAALWHLGQLMFGALCVACGASVLRRTSASV"
FT   CDS_pept        217982..220054
FT                   /transl_table=11
FT                   /locus_tag="XCV0183"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21814"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21814.1"
FT                   /translation="MQDAILQALRRNAADDAVALAREWVTNAPDHAGAHRWLALALQQQ
FT                   GQPVLALDSIDTALTLTPEDADLHLLRAGALLATRDLSAADAALSRSTALDPNQFNAYV
FT                   MQAHLAVARGDLDEAERLSRTAARLAPEHPQLLAVDGVVEMRRGHSDRALALLTRAAEQ
FT                   LPDDARVLFSLGFAYLQKEHFAFAERAFERVIELNPPGTALRAFIAQLAQRQGRLDDAL
FT                   AAMQGVLEQPGGDLPAMRRLAGEMELQAGRPDQAAAHLRLALAHWPADRRTLHALLTAW
FT                   ERLGAVDDARDTLDAALATSATAHDLWLARLAVEPVGGPQAQAVIERWLLAMPEHLPAL
FT                   EALMRVHDMQGQADEAEMVARQIVAVEPGRISGEQRIVEALLRRDPPAAIACVESLIES
FT                   LPAPQQTVLRPWLGNVQDRAGQPDAAVGTWMQFHREQAQHRLPLPPQAARQPTQWPALG
FT                   SIPDTVTARPLFVWGTPGSHVERLVAVMGAATPLVRGDRYGTTPPSDALQSYRTLEQLA
FT                   SGELAPTALVEGWKAQLPRRGIDDGNVIDWLLWWDNTLLTALRPHLPEGRLAIALRDPR
FT                   DMLLDWLSAGASAPLALQSPQQATDWLLIALEQLATLRERDLYPHRIIRLDGIENDPQG
FT                   ISTALEQAFGLSFPLVEPRGPARLASGRWRDYRGVLGAQFDLLTLIAVRFGYPQD"
FT   CDS_pept        220245..220856
FT                   /transl_table=11
FT                   /locus_tag="XCV0184"
FT                   /product="putative phosphatidylethanolamine-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21815"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21815.1"
FT                   /translation="MRLTSNSIENGNPIAVEFAAGTPEGFAPNRNPHLAWSEVPAGTQS
FT                   FALLCLDPDVPTVPDTVGRDDLRIPVEQPRTDFVHWAMADIPADVHEIAAGSCSDGFVV
FT                   KGKQQPAGPAGARQGLNSYTQWFAGNADMAGHYRGYDGPYPPFNDLRVHRYFFRVFALD
FT                   VAKLSLPDSFTAADVLSAMQGHVLAEAALHGTYTLNPSLR"
FT   CDS_pept        220993..221946
FT                   /transl_table=11
FT                   /locus_tag="XCV0185"
FT                   /product="putative alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21816"
FT                   /db_xref="GOA:Q3BZ97"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21816.1"
FT                   /translation="MPEPVAGPGEVIVAPRLVGLINRDLQILKGTYGGKLAPTRVPVAE
FT                   GVGIVTSVGAGVGQVAPGDRVVSGHFPTWLEGRFDAEMFAHDLGVTHDGWLAEKVSLPA
FT                   SALIKVPASLEDEDVAALASAAVTAWNALVDVARIKAGDLVLCLGTGGVSMAALQLAKL
FT                   HGARVAITSSSDDKLELARRLGADITVNYRTHPDWAEAVVQLSGGGVDVIIETGGQDTL
FT                   GQSIKAAAANATIVVIGVTPGASSPIPDYVALIRKNVTIRGIANGSRAMFVDLLRAIEQ
FT                   HRIKTLHSKTFRFDEAPQALDYFAKAQHVGKVLIRL"
FT   CDS_pept        complement(222002..222817)
FT                   /transl_table=11
FT                   /locus_tag="XCV0186"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21817"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR025485"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21817.1"
FT                   /translation="MRAVFFAPALLAAGVTACGSGASPDPPGSGHAAARAPVTAPPDTD
FT                   NVPLRAALRAQHWHLQQASDAHGTALRSLFVDGVSPVQLDFDDQRIQVSQTCNALGANY
FT                   SVAQAHVQIGRVVSSKRMCADARRMAQERAASDLLSGRFAVVMDNAAAVPGLTLTRSDG
FT                   TVLIFGGTPTADTRYGGPGQTLLIEVAAETVPCVLDPARRCLQVREHEPGAAAATAAAT
FT                   SWQPYDGTIEGFDHEEGIRTLLRVTRYPAVSAPDAKPVYVLDQMIEAGG"
FT   sig_peptide     complement(222752..222817)
FT                   /locus_tag="XCV0186"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(223058..223855)
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="XCV0187"
FT                   /product="putative undecaprenol kinase (bacitracin
FT                   resistance protein)"
FT                   /EC_number="2.7.1.66"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21818"
FT                   /db_xref="GOA:Q3BZ95"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZ95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21818.1"
FT                   /translation="MSDLISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSDFFNIV
FT                   IQAGAILAICLALRQRLWSLATGLGERANRDYVLKVGVAFLVTAVVGLIVRKAGWQLPE
FT                   TLQPVAWALLIGGVWMLVAEHFAGKLPERDVVTWKVAIAVGLAQVVAGVFPGTSRSAST
FT                   IFIAMLLGLSKRSAAADFVFMVGIPTMFAASGYALLEMYKEGGFGTENWTDVAVAFVAA
FT                   TITGFVVVKWLLGYIKKHRFTVFAVYRMLLGAALLLWLPAAAG"
FT   CDS_pept        224077..225486
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="XCV0188"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21819"
FT                   /db_xref="GOA:Q3BZ94"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21819.1"
FT                   /translation="MSVENVEKLIKDNKVEFVDLRFVDMRGVQQHITFPVNIIEPALFE
FT                   EGKMFDGSSIAGWKGINESDMVLLPDAGTAYLDPFFADPTIVLTCDILDPATMQSYERD
FT                   PRGIAKRAEAYLKSSGTADQAFFGPEPEFFIFDSVRFANDMGHTFFQVGSEEAAWNTGE
FT                   KYDGGNSGYRPGVKGGYFPVPPTDSLHDLRAEMIKTLEQVGIETEVHHHEVATAGQCEI
FT                   GTKFSSLVQKADELLTMKYIIKNVAYRNGKTATFMPKPIVGDNGSGMHVHQSLAKGGVN
FT                   LFTGDGYGGLSQLALWYIGGIFKHARAINAFANSGTNSYKRLVPGFEAPVMLAYSARNR
FT                   SASCRIPWVTNPKARRIEMRFPDPLQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYD
FT                   LPPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQEVTKFRAAT
FT                   HPLEYQLYYGN"
FT   CDS_pept        225760..226098
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="XCV0189"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21820"
FT                   /db_xref="GOA:Q3BZ93"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21820.1"
FT                   /translation="MKLITAIIRPFKLDEVREALSAAGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIKIETVVTDDRLDAVVEAIQNAAGTGKIGDGKIFVTAIEQVVRIRT
FT                   GEIGADAL"
FT   CDS_pept        226121..227563
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="XCV0190"
FT                   /product="Ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21821"
FT                   /db_xref="GOA:Q3BZ92"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21821.1"
FT                   /translation="MKTALFAGWKARFYSVCMLMLFSALMVGGMGSAQAQSGAQVTPLP
FT                   TEPVTTEPLPSAQPVAPPVAAAEAAPVVEKGDVAWMLTSTLLVLMMVVPGLALFYGGMV
FT                   RAKNVLSVLIQVATVFSLLTVLWVLYGYSLAFSGEGAWIGNLDKALLKGVTIETLAATF
FT                   TKGVSLPEYVFVAFQATFAGITGALIVGAFAERAKFAAVLLFSVIWFTFGYLPLAHMVW
FT                   ATGGYLFGLGALDFAGGTVVHINAGVAGLVGAYFVGKRAGLGREAIKPHNVTLTFVGAS
FT                   LLWVGWFGFNAGSNLEANAGAALAFLNTLLATAAAILGWSLTEKIIKGKSSALGVASGM
FT                   VAGLVGITPACGTVGPFGAIVIGLAAGVLCVWGVTGLKRLLGADDSLDVFGVHGLGGII
FT                   GAILTGVFSAASLGGQKGGDYDIVHQVGIQALGVGITVGWIGVVSVVGFLVAKLVFGLR
FT                   VSEEAEREGLDITSHGEAAYES"
FT   CDS_pept        227828..228883
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /locus_tag="XCV0191"
FT                   /product="two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21822"
FT                   /db_xref="GOA:Q3BZ91"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21822.1"
FT                   /translation="MVTSSSMPSLDSLGTPVAWADREGHVLGVNPAFARWLGVSARRLV
FT                   EQPLAALEVQGDALARFLLNDERDVLRLHRLALGLPNDAPRFAEGWLSRLDDGGWLLET
FT                   HPVDEFPALDPTHALPNALSAALKGLAHELRNPLAGLKGAAQLLARRAAGRDEDERELI
FT                   ELIGTEIERLNTLLERLLSPTPARPHDRLNIHVVLERVLRLAEAEGGWSVQVQRDYDPS
FT                   IPDILGDGDRLTQAVWNLVRNAFQAGATRVTLRTRVEHGQRIRDRVHAMSLRLEIIDDG
FT                   GGVPEELAEHLFLPLVSGRAEGSGLGLALAQQVSREHHGTLTYRSRPGHTVFTLLLPEL
FT                   AGDHDKEQPHG"
FT   CDS_pept        228876..230303
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="XCV0192"
FT                   /product="two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21823"
FT                   /db_xref="GOA:Q3BZ90"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21823.1"
FT                   /translation="MAEAAAVSHIWVVDDDRSVRFVLSTALRDAGYAVDGFDSAAAALQ
FT                   ALAMRPTPDLLFTDVRMPGEDGLTLLDKLKSKHPHLPVIVMSAYTDVASTAGAFRGGAH
FT                   EFLSKPFDLDDAVALAARALPDADAGVEEIVATRLAEGSASLIGDTPAMQALFRAIGRL
FT                   AQAPLSVLINGETGTGKELVARALHNESPRARKPFVALNTAAIPAELLESELFGHETGA
FT                   FTGATKRHIGRFEQADGGTLFLDEIGDMPLPLQTRLLRVLAENEFFRVGGRELIRVDVR
FT                   VIAATHQDLEALVEQGRFRADLLHRLDVVRLQLPPLRERRGDIAQLAENFLAMAGRKLD
FT                   MLPKRLSSAALEDLRQYDWPGNVRELENVCWRLAALATSDIIDVVDVDAALARGGRRHR
FT                   SGRSDGQWDDMLSSWAAQRLSEGAQGLHAEARERLDRTLLEAALQLTQGRRAEAAARLG
FT                   LGRNTVTRKLGPGRKRR"
FT   CDS_pept        230671..231273
FT                   /transl_table=11
FT                   /gene="sodC1"
FT                   /locus_tag="XCV0193"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21824"
FT                   /db_xref="GOA:Q3BZ89"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21824.1"
FT                   /translation="MRYRSPTIVALTALALAACSSTPPPPKAPPPPAARIVPARPVQQA
FT                   EAALASASGSLVSGRVVLVPALQGIRLTGTIGGLRPGGVSGFHVHERGDCSAADASSAG
FT                   AHFNPGGAPHGRAGGGAHHLGDMDNLRADAEGVVHLDMILSGISLGDGAPTDVVGKSLI
FT                   VHADPDDYRSQPSGNAGARLACGVIRVTQWGTPPSQP"
FT   sig_peptide     230671..230730
FT                   /gene="sodC1"
FT                   /locus_tag="XCV0193"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        231322..231969
FT                   /transl_table=11
FT                   /gene="sodC2"
FT                   /locus_tag="XCV0194"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21825"
FT                   /db_xref="GOA:Q3BZ88"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21825.1"
FT                   /translation="MRIVPTTLFLATALVLTACKREEPAPAERAPAPQASTPAEAAHGG
FT                   EHAASMVTEAAATTTATAELKPTKGNDVKGTVTFKTVDGALRVTGQLSGLKPNTEHGFH
FT                   IHEKGDCSAPDGSSAGGHFNPSQSDHGNVSAEPHHGGDMPNITADAQGNASIDGPVSSN
FT                   VNLGKADQFDIAGHAVIVHADADDYKTQPTGNAGGRLACGVITTDNAQAATK"
FT   sig_peptide     231322..231375
FT                   /gene="sodC2"
FT                   /locus_tag="XCV0194"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(232071..232472)
FT                   /transl_table=11
FT                   /locus_tag="XCV0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21826"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21826.1"
FT                   /translation="MIDQHLRLSRDWRAGCHRFDLLEQRALPSSELFACPIGSGPIGLG
FT                   QTPRLPTHNDRWQADHRVIARGSGRRRLPRSFDNRCAGCARLALTASASCRIQAHAPMC
FT                   APYRDRSEGWTLHLAPTQTPRRCRRGVGV"
FT   CDS_pept        complement(232503..232940)
FT                   /transl_table=11
FT                   /locus_tag="XCV0196"
FT                   /product="putative glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21827"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21827.1"
FT                   /translation="MSQTPAALPPALQGVLETGVYVADLERACAFYARVLGLQPMHRDT
FT                   RMAAYAIAPGQVLLVFLQGSTSATVTLPGGTIPPHEGNGCQHFALAVASDALPGWENHL
FT                   HACGVAIEGRTQWPGGGQSIYFRDPDAHLLELATPGLWANY"
FT   CDS_pept        complement(232937..233839)
FT                   /transl_table=11
FT                   /locus_tag="XCV0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21828"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21828.1"
FT                   /translation="MGQPRIMSKTEHGVTAMGVLALELTGGSAPERGALAPAQAGMLAE
FT                   RIGRDLAQWIPEVRDLELSVALAHFDPSEVLRPGWPLHRRLEELQARAPGRDQGPRVLA
FT                   FGADAQGEIPLPFQADAQLAGGGLRVLPFLLSGDPHTVAGVADAMEEVLLAQGMAQADT
FT                   ALLAQESFGARIEHARYLTANDLAAMMSMQYDNQGLAPLWPLIEAALLAPHTEEWLEQP
FT                   PEPVLRYIDGEVRIALFDPAGWCDYYAHDREDCERLRGVYEHYLARQRQMAAVLEAHGL
FT                   PVLYVHIEPGQDPRQALAA"
FT   CDS_pept        233910..235205
FT                   /transl_table=11
FT                   /locus_tag="XCV0198"
FT                   /product="acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21829"
FT                   /db_xref="GOA:Q3BZ84"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21829.1"
FT                   /translation="MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGAL
FT                   VERFGLHGQQLGEVAMGAVIKHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVI
FT                   TIANKIALGQIDSGIGGGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKL
FT                   AELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDS
FT                   LIAPFRGVSRDNILRADTSLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSE
FT                   AWALAHGHTPMAYLRDAQVAAVDFVHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHE
FT                   AFAAQVLCTLRAWESEDYCRNRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVA
FT                   TAAKQLEERGGGRALISICTAGGMGVVAIVER"
FT   CDS_pept        complement(235428..236693)
FT                   /transl_table=11
FT                   /locus_tag="XCV0199"
FT                   /product="putative porphyrin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21830"
FT                   /db_xref="GOA:Q3BZ83"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21830.1"
FT                   /translation="MKVLRTVLILLIAVALGVLGAQWLSHQNSYDLGNVVVSVGGNDYH
FT                   AAMPQALLILLIALLVLWLLWTLISLPFRVWGKYRRNKGRARLIEGLRAADHGQWQRAE
FT                   RLLVSASEDDEVSGIALASAVRVADARGDEAAATALAKQLAERDPTGYALLQGERHLAR
FT                   QRPVDAINALDSANAQPLPARGLLLRTRALAQIGRADEAYGQLGALRQQAVLAPDAYST
FT                   LEATLAEQTLLQASDANALAERWEALPKTLRTTPAVVGAYAQRAAVLHWDDAAVHSLEQ
FT                   ALDAQWDESLVRLYGVLPLEKYDSRRASAQRWLTQYPDSPGLLLTLARLARHQQQWSQA
FT                   EEFLHRAIASGAGSEAWEELGHGFAASGDLLSAQHCYANTLRAARGEPVRDVMPQQSLR
FT                   GPIVTTYDPAPVDPHAADDRIL"
FT   CDS_pept        complement(236690..237667)
FT                   /transl_table=11
FT                   /locus_tag="XCV0200"
FT                   /product="putative uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21831"
FT                   /db_xref="GOA:Q3BZ82"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21831.1"
FT                   /translation="MTEMPAPARRFPLAWLLLVVAVAAVGVALFLGWRAWQNYQATQLQ
FT                   AAQAQQQRWDGTQQMLETLRRDQRLANERLQDAAATNRVLRDEMLGLSQRSALLEDTVQ
FT                   KLADPNRHGAQALRLDEVELLLRLGQQRLSIAGDADGARRAYALANGALNGIDDPGYLN
FT                   LRQALVQERDALERLGAGPQAEAGKNLDTLAAELQRLPEQTAQASAAAQPWWQKALAPL
FT                   VDIRPSRGDALLTGGDRRAARDAVQIEISLARAAAERGDAAGFAQSLRRVETWTTRLWP
FT                   DSPQRRQLRARLRSLQQAPLRPRLPELGTTLLQLQAMREGRSTQ"
FT   CDS_pept        complement(237771..238550)
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="XCV0201"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21832"
FT                   /db_xref="GOA:Q3BZ81"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21832.1"
FT                   /translation="MTGLAHPDAAWTLISLRPSGEHAPLRRAVARHSGRVLALSPWRLQ
FT                   THDTAQARDALRQALAAPIAIFTSPAAVQAAHRLAPLQRPAPAHWVSVGDGTARALHAC
FT                   GIDSVVRPARMDSEGLLALPLLQAPLQAVGLITAPGGRGMLAPTLQQRGARIVRADVYR
FT                   RVPLRLRASSIQALSLALPRSVLALSSAEALTLVLQQLPAELVAAWQQRPVVASSDRML
FT                   DAAHAAGFVHGMRAAGPLPQQLAAAAGAAIMTPPRPC"
FT   CDS_pept        238607..239563
FT                   /transl_table=11
FT                   /locus_tag="XCV0202"
FT                   /product="putative family 25 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21833"
FT                   /db_xref="GOA:Q3BZ80"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21833.1"
FT                   /translation="MPVRIDGAMPAARAMIRQPDWRPSTRSGTSCNRWESGHDPGRQPC
FT                   WSGEVIKSYLINMQRSGDRLQAMSARFDALGLPFERIAAIDGATLTDEQIAHFVRERPL
FT                   EGSGDAFSAGPRKWTASNIGCFLSHQAAWRIAADSDDAYTAIFEDDMHLSDALPALLGS
FT                   TDWLPGGRSIVRLEPSYNRIKLDAKVADVAGRQLRLVRPSTYQHCWPVCAGALIISRDA
FT                   ARLLLAAKARWHTMADIFLFGWNESPVAHQLSTYQLSPAACIQDKFFHAAAENIVFTST
FT                   IDAPLTHAQKQRSTHWKAKATALLRVAQGYRKVVFAP"
FT   CDS_pept        239816..240358
FT                   /transl_table=11
FT                   /locus_tag="XCV0203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21834"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21834.1"
FT                   /translation="MQVHKTLAEHCGMMPPFAVFQSLPMTPSCTLASALQSLQQQFIAM
FT                   PPVLSMGIAVDGLHDGALRLRAPLQANVNDKANAFGGSLASLMTLASWGWLTLQLQLAG
FT                   HHADVYVADSQLRYVAPVYEDLVANAEPSELGSWEAFLATFRQRGKARIGMRAQIALGS
FT                   GAAAATLSGRFVAFPKR"
FT   CDS_pept        240387..240809
FT                   /transl_table=11
FT                   /locus_tag="XCV0204"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21835"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21835.1"
FT                   /translation="MRAVITTIVLLGLALLSGVANAGSRAQARALETIQAAYTAAVRWN
FT                   DFDAAQGFVEPAYAQAHPLSDLERSRYEQVQISGYREVRVGQDPNGDLRREVELRVINR
FT                   NTQAERLVRSIEIWRWNPEQKRWWLASGLPDLWKGQ"
FT   sig_peptide     240387..240452
FT                   /locus_tag="XCV0204"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        240885..241319
FT                   /transl_table=11
FT                   /locus_tag="XCV0205"
FT                   /product="putative rhodanese-like membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21836"
FT                   /db_xref="GOA:Q3BZ77"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21836.1"
FT                   /translation="MNFEELQAFVGRNPMLSLALVGLTIALIVTEVARLFRGYRALKPA
FT                   ELTRLINSENALVIDLSPTADFEKGHIAGSRNVALAKFDPAGKLLANAKASPVVVVCRS
FT                   GTTSAGAAKTLKKAGFEQVYWLEGGVAAWQMAELPLIKGR"
FT   CDS_pept        241429..241941
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="XCV0206"
FT                   /product="preprotein translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21837"
FT                   /db_xref="GOA:Q3BZ76"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZ76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21837.1"
FT                   /translation="MSDEILNGAAAPADAAAGPAFTIEKIYVKDVSFESPNAPAVFNDA
FT                   NQPELQLNLNQKVQRLNDNAFEVVLAVTLTCTAGGKTAYVAEVQQAGVFGLVGLDPQAI
FT                   DVLLGTQCPNILFPYVRTLVSDLIQAGGFPPFYLQPINFEALYAETLRQRQNEGTSLAD
FT                   SEPAGNA"
FT   CDS_pept        241957..242982
FT                   /transl_table=11
FT                   /locus_tag="XCV0207"
FT                   /product="putative glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21838"
FT                   /db_xref="GOA:Q3BZ75"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZ75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21838.1"
FT                   /translation="MSDWTHKIAVLGAGSWGTALAALLARHGHPTVLWGRDAAMVDTID
FT                   RTHENARYLPGIALPDSLRATTDLQAAVADATWILVVVPSHAFTETIRLIAPLRPAGAG
FT                   VAWATKGFEPGSGRFLHEVARDILGPSVPLAVVTGPSFAKEVTLGLPTAITVHGDDAAF
FT                   AQVVADAMHGPTFRAYTGDDMVGAELGGAMKNVLAVATGVADGMQLGLNARAGLITRGL
FT                   NEMLRLAAVIGARPETLMGLAGLGDLVLTCTGDLSRNRRLGLALGRGQSLDDAIREIGQ
FT                   VVESVQTADEVMRQAEHHGIELPISNAVRAVLHGEITPEAGLKELLARERKPEYPQTLF
FT                   T"
FT   CDS_pept        complement(243447..244043)
FT                   /transl_table=11
FT                   /locus_tag="XCV0208"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21839"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR026364"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21839.1"
FT                   /translation="MKTSLLALGLLAALPFAASAAENLSYNFVEGDYVRTPTEGRDADG
FT                   WGVKASYAIAPNFHVFGDYSKQNADDNNNVFENTDSDFQQWGVGVGFNHEIATSTDFVA
FT                   RVAYRKLDLDTPNINFDGYSVEAGLRNAFGEHFEVYALAGYEDFSKKRGIDIGDNFYGR
FT                   LGAQVKLNQNWGINGDIRMDGDGNKEWSVGPRFSW"
FT   sig_peptide     complement(243984..244043)
FT                   /locus_tag="XCV0208"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        244583..245794
FT                   /transl_table=11
FT                   /locus_tag="XCV0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21840"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21840.1"
FT                   /translation="MEQASSLGSSVTDRPTQDDSPLTEESFLTARFAGGRFDAHAIPFD
FT                   VLPDLAAYRGLIVEVAKMLFKKRNNDRVRVPKGFGDSFQLGLKRVVGGHSAVVTAVRLP
FT                   QLKADVQGDLGFAHYPEFDDAKAYVDALIRKVATSGEVPEDFPQELAGRFNPFGQSLMA
FT                   DEYIELGYDTADPVRYDTFIRKRIVLSREQTYENAVDGLFVLDGGVSSTGTIHVKDANG
FT                   SAFDFRPLSEFEFDKAYSRHTQQVRLVGTGLYDGAERLRRLLDVSVVYSEDEQRQAFDD
FT                   RLDEVAQTEPGWYDPDTPSPSKEAIECMRAFIKKIVLEADIPTPSIYPLPDGGVAAEWT
FT                   VGVWELSANIYLHTSNIELHAVNTSTLKDISKELNIRSSDYAGQFRMVWDVVSSATGST
FT                   DAGI"
FT   CDS_pept        complement(246260..247588)
FT                   /transl_table=11
FT                   /locus_tag="XCV0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21841.1"
FT                   /translation="MGRRSDGDWLYHLRIKQLDALPMITFEPLELEATLRSAIRRLGSS
FT                   FYIDLDGYPLPPDFELDLDDDWLISSDTELTLDFPRTEDGVSLLVKDLIDLSLEVTDSA
FT                   TSFDGLTYHSSRRTIIRMNSTDLRSHAFADRVSAAHSHELKMISEVGGKPGNISIKNDS
FT                   AHFGAIIVARDHFYDKYNPPLTGDELFIEVEHPHGASITDCNALIHAYLFELHTTLGLE
FT                   FFEWPRPLDDEIEYPEDEDIGELVGQAGRLRPLLVGQGLLSVLSEFNSAHGANRSDWSL
FT                   LSYVKCIEYVAATVVREKQYEDLRKRLLTRDALKPNAEFMDGLLLLFEENRTLTKDAEA
FT                   IRLSIERCCDPIPMAGHAPVFLRTLAKIGPSSTLAQRQASLLDLSAALTATRNQLAHAK
FT                   ANYRRTGKECPPEQLSSLVVCARIAAEQCIRWYSSRPEDLRRG"
FT   CDS_pept        complement(247677..248213)
FT                   /transl_table=11
FT                   /locus_tag="XCV0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21842"
FT                   /db_xref="GOA:Q3BZ71"
FT                   /db_xref="InterPro:IPR033390"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21842.1"
FT                   /translation="MPSTASSFTYLFLDTEWADAEGLELVSIALVSEDGASTFYAERDP
FT                   LPLAPTEFVKTRVYPLLQRGFHALSDPSLAQALFAFLMDQRSPHVIADYPNDLRLLREV
FT                   MSWGSVAKGMDERPGLPCTLMDRDPVTTSHLERWFRLNPELSRSRHHALVDANGLRMAW
FT                   LVSTGRLGWDFRPAV"
FT   CDS_pept        complement(248263..249543)
FT                   /transl_table=11
FT                   /locus_tag="XCV0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21843"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21843.1"
FT                   /translation="MGSSRSEGGPMTDARAWKWSTFPPLALSGLGTAHVESMASYVARL
FT                   SATQGQSTVAFLDSLDEVCNERPLRNDRARCALIGPGRRFMVRLIALEELTGGQILRPG
FT                   TLYAIAAAIRPGSEGLANARHWCPVCLDEFVQSGVSGRLSWVFSDLSHCSLHFARIESY
FT                   CWRCKSQQPFVPGNANIQNCVLCGASLAASAQSATGVSKQALWTDGCIEELVCFLSSNP
FT                   PMVVPGGYESYIDRLSKMGALSKSHHAFRRGAPSIRSLLNVCAYMGVRLVDVLLCPDDL
FT                   PVDRLVDGEEEPRLLSLPVESRNLQLRRLEYLLEALAGERHGLVPPLAFLLERYGLSAS
FT                   VKQLKERNSYQCYLRRHKLQKCLLTSRTSRPIIAAAFSMLDSGVTTEKAVQNLSESTRI
FT                   SVRALEPYVRCVGRVLVLESEARAAVL"
FT   CDS_pept        complement(249510..250532)
FT                   /transl_table=11
FT                   /locus_tag="XCV0213"
FT                   /product="putative transposition helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21844"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21844.1"
FT                   /translation="MPSSRVLLHPKFQSTERDLAATLTLAQPGSLVFLIGISGVGKSEL
FT                   RYRSMRSVAGAPSGWDKGILPAIAVRATLTDRGFFNPKDLAMRLAHALRAPDLTWLSDR
FT                   DQIDDPEVVHAKLEIAEKAQPWLDARRSTTEHALRFEFERHARARRLRWIFIEECASIG
FT                   TLSRGRSVHNYVLGLMQLAEECGLTIILFGTPRAAALWDCHPDIRRRSLFVWAQRYRED
FT                   RPEDHRPFASLVSSLGKHLPLERPDLLVQNLELALANSAGSYGEVKQFLLRADQARVRR
FT                   DSHTIDLCDLHQASYSREHLLGMWEHAKAFDGLCEINTDAADLGYLNLKWGAAEARVGQ
FT                   "
FT   CDS_pept        complement(250522..252924)
FT                   /transl_table=11
FT                   /locus_tag="XCV0214"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21845"
FT                   /db_xref="GOA:Q3BZ68"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21845.1"
FT                   /translation="MHELELRACFERAALTGPQIEHLLAMIAEAPSRRPGGAALNNVIA
FT                   QFWSDKNKASIWIESHTVERLFAYELELDPSVLAYYSQIPCRGIERRSANGRRHLGNAT
FT                   ADFLVIRADSVTVVECKAALRIESLLQQKPLEWVRSDDGVIERPALTSWASAWGLNYAV
FT                   WVQPSPFACLLANLELLYSIKPPDEPGKAHRQALRQLERSSLTIWELTRRVSGLTPLAV
FT                   HQLLRMGLVCGTIKSQPIALTEAFRLFLDPQQRSAAEATAAQLADHRFRQHCDPVSTSS
FT                   YRDLCAGRQRLETLKAMRLGNSVFTRRYRELDRVVRQAEVDGVSELEACLTNYRRSGNR
FT                   RARLTRTQTLAVDLAVRNWDAGKAHSRGHAYAEHVAHCQDVSCEPVSRTTLYRRLSAAN
FT                   ASRRALLTGGLREYQKNREATDPRYRSMASQILGLRIHIDSTQIDARVFPGVEDKLLLD
FT                   RPIIYVAVDSATSFPVCYELAFGPARSDALAALLRTYVRTTGSLPSIIQVDRGSENRSS
FT                   WLSAFCTEYHITLLIHPTGASVFNSAAENWLGRINSRLHSLPGSTIPDKKGRSVDGRFK
FT                   SRQTARLQFSALHEVVNDAIELLRDVPGADGESPIERKARLVDETGIAGHAVEIDDNFL
FT                   FHSSIPTRASALDPKRGIKTERTRYASSELLQAARRGDVIEVRRDCEDPTVMHVQMSSG
FT                   RCKAWSGMANKVAGLPDIELKFLAYYLHQRGSKVVERRLDAHVSHHRKVQEVLTTNDPD
FT                   ASEQKPSASKAARRSTKDRPASRSISVSLEGLDDYGQELREGGRDAI"
FT   CDS_pept        254489..254776
FT                   /transl_table=11
FT                   /locus_tag="XCV0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21846"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21846.1"
FT                   /translation="MLMSTINEPWDVTITLRDLSVALAEHVHAATVPTQRELNEWLHYI
FT                   TRAAPVYWALESACEDIVEDGASEYRIQALKQALTYAQGQVEYWHRKDRW"
FT   CDS_pept        254833..255855
FT                   /transl_table=11
FT                   /locus_tag="XCV0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21847"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21847.1"
FT                   /translation="MIGALRRLVVAHAPLSNDTLMKECPPAWKRAKLQFWRPSLLLSTK
FT                   GCSRPHCAGCFQPYADAFSAKGHNVRFNQILIVDSIPAGERNTARELYQDVGLRAQVFA
FT                   PAPEVRYRRVESPDEFLTLLPELAASASATGDIPVLHIECHGNDDGLAFSDGSFVTWVD
FT                   LKGPLTTLNIATAMNLLVVVAACDGSALTSTLGLVDRAPVHGLIGPTRAVTPEELMRAY
FT                   LELYGALIRTRSAREAVEAMLGATPDTFVYRAAQWLFQYVWDHYQATHETPEARLERGI
FT                   KMAANPPADYVGPPLQPETFAQALAERNREFFDAFRRKFFLCDLFPEHETRFPVRYDAL
FT                   "
FT   CDS_pept        256062..256994
FT                   /transl_table=11
FT                   /locus_tag="XCV0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21848"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21848.1"
FT                   /translation="MRWHNVDQLLTVPFLHYLIMMERIEDSPNLTPKNAEPWLSDLFSD
FT                   TISAASKGNAARRYAEMMIDLFLSDRLKEEIGEAEFRRLFLGDHIKQITPYTPPKIIED
FT                   LWHIKNFGDKASHYSPVRNVTHEEASGVVKAALGLIDLILTQELIERPLNVPPCRATIF
FT                   SVIFPGVRERVLENLLKECSPDAGDYYLLLVNKYSLALVKNLKFNKARRNLDDLLKKGS
FT                   IDEEFHVDQVESIKLIAGSIRYPGQPIPKRMADVARNYAQVRGELDEADLEANQRLLKI
FT                   MDTLVNNVVPSGNAIAGWVLSVDEPPSAA"
FT   CDS_pept        257376..257882
FT                   /transl_table=11
FT                   /locus_tag="XCV0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21849.1"
FT                   /translation="MSKRIQELRARLRKEISKYAGIDGEAFAEKWLVQSGWKYERVEQG
FT                   IFTLSPELRKYGGKRPDFIVDPGDDSLVLIDVKYHSTGNGIYFRLADDEIGKYRRLEAF
FT                   VEQQFPEVEIDVIFMVIPKEHNGKRLVWVHLAEFDAGTPAQIKDLPATEVSLLGRDDLW
FT                   CDIDA"
FT   CDS_pept        257942..258541
FT                   /transl_table=11
FT                   /locus_tag="XCV0219"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21850"
FT                   /db_xref="GOA:Q3BZ63"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21850.1"
FT                   /translation="MDNSSLWIAIVGLAGKTAASVAGLYFTHKSQRTPLRQQLHAKQIE
FT                   VLIDIAVGSTRLQKIAAALHEAGALPQEDQKVLDEAWDEVSQRLLDSVQVGGVVLPSDV
FT                   YSAMTAFRACAEEFEIAVVRRTNVGKAYYDLMGAAVHVNMLSREVVGADSLSAESILPH
FT                   NKDGYARMQEVGRASLARVARAFGHRLFVCAIESEF"
FT   CDS_pept        complement(258819..261017)
FT                   /transl_table=11
FT                   /locus_tag="XCV0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21851.1"
FT                   /translation="MARKFDLESDVVRWLVTQIQDGLLLDEIDGRDSITALAGMGSQEN
FT                   FLPAFGIDHFSRRASADAAANVLEHLGSLEIISVDTSISLTTGEVLRPDILCFNQETRT
FT                   LVVFEVKRATDTERQTVTELAGYEQELRNAAPFLGTYDVLFVVVAANWSPLLTHAVGNM
FT                   NAWSGKQYLGLKIAPATSGFRLTVEIPEAWHLTGALCLPGEALPSIDLYLWPKDHETCR
FT                   SDDQEGCGAAADLGGVDDASRYPARIVLTAMEMIAREGDRTGAHGFMMLWRDAGAYGSG
FT                   CWCLTLTTVDPYAMSAWATDNGLPQRSSEATQYFRSSVESGSAPRSLYGIARAALTLLR
FT                   ESFETGFESDLLWAVKAHGLRQRAVPVRFDFWGSLGRYAREFVANPAVRQNYMPFISAS
FT                   QLDWTDPVVGMTLVSNLTAGSPFPNGLIGCEEAFAVGRTLGDLGIAAHSSSQSHQHAAV
FT                   LEPMLEWSQLEAVRYGVEMLQMSNASIEVVKPMPTLSNRSEQRLERLQELVDWVALDLI
FT                   GSDHPAHQACFEIGFSNALLFDWIEDGAADPYAGPAATEAAKSARRVLEFALKQADGSQ
FT                   GQAFKSAPFLDLVELVGLADGEAKNCGESVGSLTAKLDDQRLLESFASVVLPGIDSIIP
FT                   RVLHTVRAPFHTLVDWDYLKSGVRALFESGVRHPAVLFAQDGTIGTGQMSSPFNMGSPV
FT                   ADPSVEVYVLDMSAASAIAIKMTWDKVEEFHAKRSTRS"
FT   CDS_pept        261238..261747
FT                   /transl_table=11
FT                   /locus_tag="XCV0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21852"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21852.1"
FT                   /translation="MPTIERLILKNFKKFRDFDVSFDDKLNILAGGNEAGKSSILQAID
FT                   LALSSSRSKVEALGVETIFSAQAISEFLGGDRNVANLPVLHIEVYFKGLGDQEFDGRNN
FT                   SLRRDGCGIRVSCLPMDEYTDEIKKALADKDGSFPFEFYEVRFRTFADSDLPPSSVPVI
FT                   TDKARG"
FT   misc_feature    complement(261696..262921)
FT                   /locus_tag="IS_1477_3"
FT                   /note="IS element 1477"
FT   CDS_pept        complement(261725..262558)
FT                   /transl_table=11
FT                   /locus_tag="XCV0222"
FT                   /product="IS1477 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21853"
FT                   /db_xref="GOA:Q3BZL6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21853.1"
FT                   /translation="MLEHTPLSERRACRLAGLSRDAFRHAPVPTPATQALSARLVELAQ
FT                   THRRFGYRRLHDLLRPEFPSVNHKKIYRLYEEAELKVRKRRKAKRPVGERQKLLASSMP
FT                   NDTWSMDFVFDALANARRIKCLTVVDDFTRESVDIAVDHGISGAYVVRLLDQAACFRGY
FT                   PRAVRTDNGPEFTSRAFIAWTQQHGIEHILIEPGAPTQNAYIESFNGKFRDECLNEHWF
FT                   TSLAQARDVIADWRRHYNQIRPHSSCGRIPPAQFAANYRTQQANNAVPFNPGLYQ"
FT   CDS_pept        complement(262591..262857)
FT                   /transl_table=11
FT                   /locus_tag="XCV0223"
FT                   /product="IS1477 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21854"
FT                   /db_xref="GOA:Q3BZL7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21854.1"
FT                   /translation="MKKSRFSTEQIIGFIKQADAGMAVAELCRRHGFSPASFYQWRAKY
FT                   GGMEADEAKRLKELEVQNTRLKKLLAEAHLDIEALKVGFGVKR"
FT   CDS_pept        263020..264033
FT                   /transl_table=11
FT                   /locus_tag="XCV0224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21855"
FT                   /db_xref="GOA:Q3BZ58"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21855.1"
FT                   /translation="MYVAQSTPSERNKHAYQYRKAKRVFRDTSLKAMNDTVVDYKFDVR
FT                   SSSKSSIESDLVITEDDIPIEGKGKGRQCFIKTEFALRNRESALDLLLLEEPENHLSHV
FT                   HMHKLIQRIDASKDKQLFIATHSSFIATRLNLRKVLLLNEVGAAKPASLQNLTDDTARF
FT                   FMKAPDNNVLELSLCNRAILVEGDAEFILLGALYEACSGGSSTEKDGIHVISVDGTSFK
FT                   RYMELAKVLGIKVAIVRDNDTDYQLNCVDNYKDFVSDKIRVFADPDPARSTFEICIYQD
FT                   NTKSCDDMFAAGRRTLSVQDYMLDNKTEVAFRLLEKHGKALTVPPYIEQAIAWIRG"
FT   CDS_pept        264018..265049
FT                   /transl_table=11
FT                   /locus_tag="XCV0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21856"
FT                   /db_xref="GOA:Q3BZ57"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21856.1"
FT                   /translation="MDKRVTLAVAGSGKTSMLVSKLDLDRRFLIVTYTDANIENIRQKI
FT                   IQKFGHIPRNVQVSTYFSFLYGFCYRPFLAMEKRSQGVTFKIPPQRPVFKLHDDRRYMT
FT                   PKRWLYSNRLADFIDRSGVLPLVRKRLEKYYDAFFVDEVQDFGGHDFSFLLEAAKADIE
FT                   MCFVGDFYQHTYDTSRDGQKNSTLHDDYARYKARFVAAGLRVDTDSLKVSRRCSVSVCQ
FT                   FISNQLGVSIVAHEDRETAVRFESDPDAVLALYSDPSVVKLFYQEHYKYGYFSENWGAS
FT                   KGADHYGDVCVVLSAPNVKAFHASTLSQLKPGPRNKLYVACSRARGSLTFIPESLLKQF
FT                   KQK"
FT   CDS_pept        complement(265199..265987)
FT                   /transl_table=11
FT                   /locus_tag="XCV0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21857"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21857.1"
FT                   /translation="MDPFAPPLTGQCCLCGSTEALSGEHKVKAAALRSEFGTQPMVIGR
FT                   PGERYRHAQSPSSKQFHFSARICETCNNARTQPADLAFDAFRALASDLLRTGKDPAKVH
FT                   EDPRFNANGGILYLDVFRYFAKLMCCHLAEMGATFYEPIADFAIGISDNNYVLLCVDAD
FT                   VAYRRLRENGAIHSYAAHGGLIVTGNPQSHAPEAFHSTLTIGPVRYCYRIHLNEVGQAQ
FT                   LLHEQPDFYAWCQRRIRHAIDNPMSADDRELLGLNGVNEK"
FT   CDS_pept        complement(266093..266497)
FT                   /transl_table=11
FT                   /locus_tag="XCV0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21858"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21858.1"
FT                   /translation="MAHGSIAEQWEGGLRELRLVHHKPASPNADQGGCYHDEAYWFAAK
FT                   RYTVSDLPLTSFVGPDGLVTLLAFLADRRFADPNEVLELIKRLHVPNYEGARNSFEAAI
FT                   AEGVFEPRSTPGYYDQRELLAVLNWISNEQ"
FT   misc_feature    complement(267366..268560)
FT                   /locus_tag="IS_Xac2_1"
FT                   /note="IS element Xac2"
FT   CDS_pept        complement(267404..268231)
FT                   /transl_table=11
FT                   /locus_tag="XCV0228"
FT                   /product="ISxac2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21859"
FT                   /db_xref="GOA:Q3BZ54"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21859.1"
FT                   /translation="MVRPSQRREMAQSAVTSGRTNIRHACQTFAVSQTCFRYQAKASEQ
FT                   NARIADWLIRLTTAHRDWGFGLCYLYLRNVKGFGWNHKRIYRIYRELELNLRIKPKKRL
FT                   VRERPQPLAVPETINQVWSMDFMQDQLADGRSFRLFNVLDDFNREGLGIEVDLSLPSAR
FT                   VIRSLEQIIEWRGKPAVIRCDNGPEYISGALLSWAQRHGIRVEHIQPGKPQQNAYVERY
FT                   NRTIRYAWLAQTLFDTIDQVQDKATRWLWTYNHERPNMALGGITPAMKLAMAA"
FT   CDS_pept        complement(268225..268491)
FT                   /transl_table=11
FT                   /locus_tag="XCV0229"
FT                   /product="ISxac2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21860"
FT                   /db_xref="GOA:Q3BZ53"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21860.1"
FT                   /translation="MKKSRFTDSQIIAVLKQAQAGAPVPELCREHGISSATFYKWRSKF
FT                   GGMDVSMVARMKELEEENRRLKKMYAEAQLSTDLLKEALAKKW"
FT   CDS_pept        269657..271384
FT                   /transl_table=11
FT                   /gene="poxB"
FT                   /locus_tag="XCV0230"
FT                   /product="pyruvate dehydrogenase"
FT                   /EC_number="1.2.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21861"
FT                   /db_xref="GOA:Q3BZ52"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21861.1"
FT                   /translation="MAKKKTLARFLAETLQSAGVERIWGVTGDSLNGLTDALREMQTIA
FT                   WMHVRHEEVAAFAAGAEAAVTGQLAVCAGSCGPGNLHLINGLFDCHRSRQPVLAIAAHI
FT                   PSSEIGLSYFQETHPQELFRECSHFVELVTNPAQLPEVLHRAMRTAILQQGVAVVVIPG
FT                   DIALLEVDKHVSSAWPALRQPRMLPAAEDVRQLAELLQQSKAVTLLCGSGCAGAHDAVV
FT                   ALADTLGAPVVHALRGKEYVEWDNPFDVGMTGLIGFSSGYHAMLNCDTLLMLGTDFPYR
FT                   QFYPKDATIVQVDRDPSALGRRTPLQLGIAADVGETIAALLPQLQRREERGFLEKSLAH
FT                   YRKAREGLDDLAVPADPGQPLHPQFVTRLISQIADQDAVFTCDVGTPTVWAARYLRMNG
FT                   KRRLLGSFNHGSMANAMPQALGAQAAFPGRQVISLSGDGGFAMLMGDFISLAQLNLPVK
FT                   VVVFNNASLGFVAMEMKAAGYLDTGTELRNPDFAAMSNAMGILGIRVDESSQLERALRQ
FT                   AFAHSGPALVDVRIATQELAVPPAIKLEQAKGMGLYLLKAVMSGRGDEVIELVKTNLR"
FT   CDS_pept        271434..272876
FT                   /transl_table=11
FT                   /locus_tag="XCV0231"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21862"
FT                   /db_xref="GOA:Q3BZ51"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21862.1"
FT                   /translation="MPRSLLRQLLLIWMVIVAACVGVATMLYGLYRQTEGVRLEEARQQ
FT                   LGGQCARIVQRYAGASEAARRGDDGAGLAAVVVQLVLADAPGVEGGVWDLHKGFVAYAY
FT                   PTYDGSDHKTDIPAAEWANIVNTAQQSVTTRQAAQYRRDGRREVLLISACPLASGSAAW
FT                   TMTRVPASKADAWRPLVVGMLLIFAMVAISAIALGVLVRRWSQRLQRIQQALAADTEMP
FT                   HIPPTGTPELDRLGAAVNDYAQRNAQALAQTRRLADELSRHERLAALGRMTATVAHEIR
FT                   NPIATMRLALENEIARRDATPDDAAHGELMLGQIRRLDGVVESLLGMVQPIRLQLETVV
FT                   VQDWLATLLEHSPLPPGTPPPRLLLPAAPLRWTLDPQQLGRAVHNLLRNAAQHADPGSE
FT                   VTLQAAAVEGMLQLQVCNRGAPIAEPIAAHLFEPFVSGRADGNGLGLALVREIARAHGG
FT                   HARYAHADGLTHFILELPWRAS"
FT   CDS_pept        272861..274204
FT                   /transl_table=11
FT                   /locus_tag="XCV0232"
FT                   /product="sigma 54-dependent response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21863"
FT                   /db_xref="GOA:Q3BZ50"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21863.1"
FT                   /translation="MARILIIDDDAAFRTTLQATLRSLGHTVVAAGNGPDGLARLSEGG
FT                   IDMAFVDFRMPGMDGIAVLRARLDDAQARQVPLVMLTAHVSSGNTIEAMTLGAFDHLVK
FT                   PVGRADIVEVVERALLSRADAQAAATDSSPAPVEDEDALVGHSPAMRTVHKRIGLAAAS
FT                   DLPVLITGETGTGKELAARALHRASPRANAPFVAVNCAAIPLDLMESELFGHRKGAFSG
FT                   ASSDRRGLIREADGGTLFLDEIGDMPLPMQAKLLRFLQEGEVTPLGGGPQKVDVRVLAA
FT                   THRDLAACVADGRFRSDLRYRLNVVPIELPPLRERGQDILLLAQHFLSADAARAQSLSP
FT                   AAQERLLAHRWPGNVRELRNVMQRSQVLVRGASIDAADLDEALGEAGELPPQEPSVVTG
FT                   TLPEAVARLETQMIRSALEHSQGNRAEAARRLGIHRQLLYRKLEEYGL"
FT   CDS_pept        274395..275147
FT                   /transl_table=11
FT                   /locus_tag="XCV0233"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21864"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21864.1"
FT                   /translation="MMRQTVLAIALACTIGAAAAQVAAPPPPPAPNGPIGGPPAPPTPV
FT                   AATPVSVSGTVERFLLNPNGEVDGLWLRDGTQVGFPPHLSSEVKAAVRAGDSVVVKGFR
FT                   LGNLPVLQVSSIRSGRSGREVVDRPPTFGAAPPPPPTPGQLTPLQSDGTIQRLVYGPAG
FT                   EVNGALVSDGTVVRMPPHLALQFADLLRVGEPLSASGFGVATPDGRAIEATQLGRDRSS
FT                   LRALFTAPRPDGPLPPPPPGAPVPPAGR"
FT   sig_peptide     274395..274454
FT                   /locus_tag="XCV0233"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        275250..275867
FT                   /transl_table=11
FT                   /locus_tag="XCV0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21865"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21865.1"
FT                   /translation="MHWVDPDFLPATRGTLARFLLNPKADIDGLLLTDGTEVHTPPHLS
FT                   EALLKALKPGSALTVRGLKPRDVEMLVALAIDPEGGKRILDEGPHGPHAKPKPKPPGKP
FT                   PKPEVAQHSGTITRLLHGPHGQVHGVLLDDAVTVRFPPHAGGDFAKQLVVGKPLVAEGE
FT                   TKATPHGVLIHAHALGGKAATLKQIEHPPHGPAHKPKPKPKH"
FT   CDS_pept        275960..277189
FT                   /transl_table=11
FT                   /locus_tag="XCV0235"
FT                   /product="putative major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21866"
FT                   /db_xref="GOA:Q3BZ47"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21866.1"
FT                   /translation="MPVTKDRPRGTRALEALHFSVADVQDGLGPFLSVFLQSKGWSVAA
FT                   IGTVMSVGGIAGMLATTPAGALVDATRRKRAVVVIGCLAILLATALIWLQPTSSGVVAA
FT                   QIASALAAAGIGPALTGITLGLVHAHGFDHQLARNQVANHAGNVLAAVLAGWLGWRYGF
FT                   AAVFLLTAFFGALALVAVLAIPAAAIDHRAARGLASNNGGDALSGWRVLLTCRPLALLA
FT                   ATLGLFHLGNAAMLPLYGMAIVAAHAGDPSALTATTIVVAQATMVVVALLAMRWIRVHG
FT                   HWWVLLVAFMALPLRALVAASVIHGWGVFPVQILDGLGAGLQSVVVPALVARLLQGTGR
FT                   VNVGQGAVMTVQGVGAALSPAFGGWLAHAFGYRIAFLTLGAIALLAVALWAGCRGMLQA
FT                   AASMQAETVL"
FT   CDS_pept        complement(277539..278015)
FT                   /transl_table=11
FT                   /locus_tag="XCV0236"
FT                   /product="tRNA/rRNA methyltransferase, SpoU class; TrmH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21867"
FT                   /db_xref="GOA:Q3BZ46"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21867.1"
FT                   /translation="MPAPVLDVILFQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLSD
FT                   KQLKRAGLDYHEYAPLQVHTDLPSALAAIAPKRVFALSTRSTVRYDTPQFADGDAFLFG
FT                   PETRGLPAEVLESIPPQHRLRLPMRPDNRSLNLSNTVAVMVFEAWRQWNFAGGQ"
FT   CDS_pept        complement(278042..278503)
FT                   /transl_table=11
FT                   /locus_tag="XCV0237"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21868"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21868.1"
FT                   /translation="MKTQTLRIALSTALFAGATLAGFAQAASLTTLDTVQVRPAADQIA
FT                   QQTLERNSAIRTLTAVQVRPSAEQVAALAAEQAGPRIVTLAAVQVRPSAEQRADLVVRS
FT                   AAASAQSASSQAAGAIGALMGQVIVNLPTPQLQPSPAEPEALVNAAISL"
FT   sig_peptide     complement(278426..278503)
FT                   /locus_tag="XCV0237"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        278890..279210
FT                   /transl_table=11
FT                   /locus_tag="XCV0238"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21869"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21869.1"
FT                   /translation="MRVLMLSVLVATTTAACTWVPIEQSGKSVRVLPAGPVPAGCQQQG
FT                   EVVVTVKSKVGFYNRNPLRVQEELETLARNEAPGANANAVQAQGQPADGSQRFNAFRCP
FT                   PR"
FT   CDS_pept        279312..280328
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="XCV0239"
FT                   /product="3-oxoacyl-[acyl-carrier protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21870"
FT                   /db_xref="GOA:Q3BZ43"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21870.1"
FT                   /translation="MLFQNVSIAGLAHVDAPHTLTSKEINERLQPTYDRLGIKTDVLGD
FT                   VAGIHARRLWDQDVQASDAATQAARKALIDAGIGIEKIGLLVNTSVSRDYLEPSTASIV
FT                   SGNLGVGDHCVTFDVANACLAFINGMDIAARMLERGEIDYALVVDGETANLVYEKTLER
FT                   MTSPDVTEEEFRNELAALTLGCGAAAMVMARTELVPDAPRYKGGVTRSATEWNKLCRGN
FT                   LDRMVTDTRLLLIEGIKLAQKTFMAARQVLGWAVEELDQFVIHQVSRPHTAAFVKSFGI
FT                   DPAKVMTIFGEHGNIGPASVPIVLSKLKELGRLKKGDRIALLGIGSGLNCSMAEVVW"
FT   CDS_pept        280412..281551
FT                   /transl_table=11
FT                   /locus_tag="XCV0240"
FT                   /product="putative regulatory protein, Fic family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21871"
FT                   /db_xref="GOA:Q3BZ42"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21871.1"
FT                   /translation="MDEPPAFDPGQPHNALPPLPPAGDIETRSLLKACIVARTALAELK
FT                   QATALLPNPAVLINTIPVLEAQASSEIENIVTTTDDLFRYADDQERAQNPATKEALRYR
FT                   SALYEGFQSLRQRPLCTETAIVVCSRIKAVQMQIRRVPGTALANDQIQQIIYTPPVGET
FT                   LLRDKLANWERFIHEHTDVDPLIRMAVAHYQFEAIHPFTDGNGRTGRVLNLLMLIEQGL
FT                   LDVPVLYLSRYIIRHRSDYYRLLLDVTRHGHWAEWIHYMLAAVAETAAWTTAKIQAIRG
FT                   LEAQAQDHVRSLAPKAYSRELVDVIFNQPYCRIQNVVEVLGVTRQTAARHLKELVDIGV
FT                   LKEQRLGKEKLFLHPAFLQLLSSDEHQLPPYRGHARQAE"
FT   CDS_pept        281700..282602
FT                   /transl_table=11
FT                   /locus_tag="XCV0241"
FT                   /product="putative hydrolase of the alpha/beta fold
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21872"
FT                   /db_xref="GOA:Q3BZ41"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21872.1"
FT                   /translation="MNYPGYPFTPKRLEVRPGVAMSYLDEGPRDGEVVVMLHGNPSWSY
FT                   LWRHLVSGLSDRYRCIVPDHIGMGLSDKPDDAPDAQPRYDYTLQSRVDDLDTLLRHLGI
FT                   TGPVTLAVHDWGGMIGFGWALSHHAQVKRLVITNTAAFPLPAEKPMPWQIAMGRHWRLG
FT                   EWFIRTFNAFSSGASWLGVSRPMPSDVRRAYVAPYNNWRNRISTIRFMQDIPLSPADKG
FT                   WSLLERSAQALPSFADRPAFIAWGLRDICFDKHFLAGFRKALPQAEVTAFDDANHYVLE
FT                   DKHEVLVPAIRAFLERNPL"
FT   CDS_pept        complement(282758..283141)
FT                   /transl_table=11
FT                   /locus_tag="XCV0242"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21873"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21873.1"
FT                   /translation="MAHPCLTCGACCAYFRVSFHWSEADPALGGRVPIELTDALRTHER
FT                   VMRGTSQSQPRCIALDADIGRYSRCSIHDRRPSSCAAVPASLEFGQRSAQCDKARLAHG
FT                   LHALTDADWVGVDDAQRNPLPPM"
FT   CDS_pept        283462..285123
FT                   /transl_table=11
FT                   /locus_tag="XCV0243"
FT                   /product="AMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21874"
FT                   /db_xref="GOA:Q3BZ39"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21874.1"
FT                   /translation="MTTLCNIAATLPQLARERPDQIAIRCPGARGANGFAAYDLTLSYA
FT                   ELDARSDAIAAGLARRGIGRGARAVVMVRPSPEFFLLMFALFKAGAVPVLVDPGIDKRA
FT                   LKQCLDEAQPQAFIGIALAQLARRLLRWARSAKQIVTVGGRYGWGGVTLARVERDGAGA
FT                   GSQLADTAPDDVAAILFTSGSTGVPKGVVYRHRHFVGQIELLRNAFNMQPGGVDLPTFP
FT                   PFALFDPALGLTSVIPDMDPTRPGSADPRKLHDAIARFGITQLFGSPALMRVLADDGQP
FT                   LPNVRLVTSAGAPVPPDVVAKIRALLPADAQFWTPYGATECLPVAAIEGRTLDATRAAT
FT                   EAGAGTCVGQVVAPNEVRIIAIDDAAIADWSGVRVLATGEVGEITVAGPTATDTYFNRD
FT                   AATRIAKIRERRSDGSERVVHRMGDVGYFDAEGRLWFCGRKTQRVETASGPLYTEQVEP
FT                   VFNVHPQVRRTALVGVGAPGQQQPVLCVELQPGVSAPAFAQVESDLRALGAARPHTAGI
FT                   ARFLRHSGFPVDIRHNAKIGRETLAVWAAQQLHENG"
FT   CDS_pept        285351..286361
FT                   /transl_table=11
FT                   /gene="cdh1"
FT                   /locus_tag="XCV0244"
FT                   /product="NAD(P)H steroid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21875"
FT                   /db_xref="GOA:Q3BZ38"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21875.1"
FT                   /translation="MKVLVTGGGGFLGQALCRGLRARGHEVVSFQRGDYPVLQRLGVGQ
FT                   IRGDLADPQAVRHAFAGIDAVFHNAAKAGAWGSYDSYHQANVVGTQNVIEACRANGVPR
FT                   LIYTSTPSVTHRATNPVEGLGADEVPYGENLRAAYAATKAIAERAVLAANDAQLATVAL
FT                   RPRLIWGPGDNHLLPRLAARARAGRLRMVGDGSNLVDSTYIDNAAQAHFDAFEHLAVGA
FT                   ACAGKAYFISNGEPLPMRELLNRLLAAVDAPAVTRSLSFNTAYRIGAVCETLWPLLRLP
FT                   GEVPLTRFLVEQLCTPHWYSMEPARRDFGYVPRISIEEGLQRLRSSSSNDIAITG"
FT   CDS_pept        286426..286584
FT                   /transl_table=11
FT                   /locus_tag="XCV0245"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21876"
FT                   /db_xref="GOA:Q3BZ37"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZ37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21876.1"
FT                   /translation="MLHYAIIFFVIAIIAAVLGFSGIAGAATNIAWILFVVFLILAVIS
FT                   MFRRGKV"
FT   CDS_pept        complement(286773..287876)
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="XCV0246"
FT                   /product="D-alanine--D-alanine ligase A"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21877"
FT                   /db_xref="GOA:Q3BZ36"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21877.1"
FT                   /translation="MRMIRVGLIFGGKSAEHEVSLQSARNILDALDPQRFEPVLIGIDK
FT                   QGQWHVNDPDSFLLHADDPARIALHRSGRGVALLPGAQQQQVRPIQPEQALAQIDVVFP
FT                   IVHGTLGEDGSLQGLLRMANLPFVGSGVLGSAVAMDKDMAKRVLRDAGLAVAPFVCFNR
FT                   HTAAMADVEALIAQFGLPLFVKPANQGSSVGVSQVRSADQFAAALALALAYDYKVLVEA
FT                   AIAGREIECAVLGNATPQASVCGEVVVHDAFYSYQTKYISEHGAEIVIPADIDARTQQR
FT                   IQQIAVQAYQALDCAGLARVDVFLCADGRIVINEVNTLPGFTRISMYPKLWQASGLDYR
FT                   SLIARLIELALERHADDQLLRSAVQLP"
FT   CDS_pept        288111..288755
FT                   /transl_table=11
FT                   /locus_tag="XCV0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21878"
FT                   /db_xref="GOA:Q3BZ35"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21878.1"
FT                   /translation="MPGSLFNSLKPLAGQALQAALNRALALDPDTRDALLPLEGQRIAL
FT                   TLEAPALALQIRVHERRLLVGPVDQAQEPDLAVRSSLAGLLGQLPLLANARRAGAPAGR
FT                   LKVSGDAELARQLQQLAGRFDPDWQLPFVTVFGDILGVQIAGAVRAALQQARRSAVDLA
FT                   QSAAEFVTEESRDVVPRAELEAFHDDVDELRDDVERLAARVRRLRASGGTA"
FT   CDS_pept        288752..290425
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="XCV0248"
FT                   /product="Ubiquinone biosynthesis protein UbiB"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21879"
FT                   /db_xref="GOA:Q3BZ34"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BZ34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21879.1"
FT                   /translation="MKAILRASRIGRVILRYRLDALLEGTPAERWLRLAKPFVPRASAE
FT                   IAAQSRGARLRLALQELGPIFVKFGQILSTRRDLIPADVAEELTLLQDRVKPFDGQAAR
FT                   LIVEAALGLPVSVAFASFDTVPLASASIAQVHAATLPPDANGVRREVVVKVLRPDIERQ
FT                   IDADIALLHSLATLVERTHPRADKIRPREVVAEIEGTLAAELDLQREGANASVLRRFWE
FT                   GSDDLYVPEVIWSHTAERALTLERVYGIPSDDIAKLDAAGIDRKALAAKGVRVFYTQVF
FT                   RDNFFHADAHAGNIWVDSDPERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDY
FT                   RRMAELHVEAGWMPSNVRIDELEAAARSVCEPYFTRPLSEISLAQVLIKLFRVAQRYEL
FT                   TLQPQLILLQKTLLNIEGVGRQLDPKLDIWAVARPVLERILRERYSPRRVLRELGKRLP
FT                   EIMTHAPDMPRLVHSWLKQQVEGRHQIDIRSPELLALDLSLRKLQTRVVTAITGSGLLV
FT                   VAAVLYGLHPDGWYLGTVPVWSWISGGAGSAALLVAWLRR"
FT   CDS_pept        290435..290938
FT                   /transl_table=11
FT                   /locus_tag="XCV0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21880"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21880.1"
FT                   /translation="MPDATDTLDASTSVAAIAALDAPPRTQESSYPPLFAAQMGGRQKR
FT                   ALGEVFGLRNFGVNLTTLAPGARSALRHGHSQQDEFVYIVSGAPSLITNAGEQLLQPGM
FT                   CVGFRAGDGDAHCLINRSQTVVTYLEVGDRSAGDCVTYPDDDLMLVPVADGQRAYRHKD
FT                   GTPY"
FT   CDS_pept        291231..291947
FT                   /transl_table=11
FT                   /gene="truC"
FT                   /locus_tag="XCV0250"
FT                   /product="Pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21881"
FT                   /db_xref="GOA:Q3BZ32"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21881.1"
FT                   /translation="MSISPKHLQILYQDDVLAVVDKPAGLMVHDSKLARGEDDFLADRL
FT                   REQLGKPIFLVHRLDRATSGCLLLAFDRDSASALGKALMAGEVEKDYLTVCRGWPAEER
FT                   FIVDHDLDGGPGKPVKKPAVTHFQRLATGELEIPSTGFTTSRYALLRCQPQTGRFRQIR
FT                   RHMKHLSHHMIGDTSHGDGRHNRSFRMLGIHRMLLHAERLGFPHPGGGRRISITAPLDA
FT                   EFTKACALFGWDVAQL"
FT   CDS_pept        complement(292124..292864)
FT                   /transl_table=11
FT                   /locus_tag="XCV0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21882"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21882.1"
FT                   /translation="MLTFCPPAPLARTKRSTSSLGGIVRLGVIWIGSLAMCADCIGSGV
FT                   DARANAGSRMLRPVPRLQDAPMTPTHSLTATRRLGRRLLLSALLAVAAPAALAQAPSDA
FT                   DINRLLAASRAQTMLDTMLPQIEALQQQQFAQLTAQRQLDPDQQAQLQRIQERTRQTVR
FT                   KALSWSELRPMYVDIYKRSFSREDVLAMAEFYESSAGQSLLDKTPALTQNLMGAIQQRM
FT                   LPLFADLQKDLEKIVNEPAPAKKP"
FT   CDS_pept        292878..293189
FT                   /transl_table=11
FT                   /locus_tag="XCV0252"
FT                   /product="putative peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21883"
FT                   /db_xref="GOA:Q3BZ30"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21883.1"
FT                   /translation="MELRFDVAGSPSLPEPLRARLLSRRDRRMTADGVLVIDAQRFRTQ
FT                   DRNRDDARERLVEIISACLSVPKRRVATKPSHGAKLRRLDAKRERSQIKRGRSASHWE"
FT   CDS_pept        293192..293821
FT                   /transl_table=11
FT                   /locus_tag="XCV0253"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21884"
FT                   /db_xref="GOA:Q3BZ29"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21884.1"
FT                   /translation="MSQPDPSLPPVTQANILLQPSPPRMPRAHGRFIRWLGRTALRVTG
FT                   WRLLGRLPDEPKLVMIVAPHSSNWDGFLGFAAKFALGFEVRVLGKAQLFWWPLGPLLRK
FT                   LGGIPLDRSSPQGTIGQAVRLIRNSEQMWYVITPEGTRKRVEQWKAGFWKIASDSNVPI
FT                   LPVYFDYPSKTVGIGEPFWTGNDMAADIAAIRTWYRPWRGKHRDTL"
FT   CDS_pept        293910..294926
FT                   /transl_table=11
FT                   /locus_tag="XCV0254"
FT                   /product="asparaginase precursor"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21885"
FT                   /db_xref="GOA:Q3BZ28"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21885.1"
FT                   /translation="MIARYARALCLSLSLLLIAGPALSATPMLVIHGGAGVEKSSLSKD
FT                   EQAQAREAMQRALRAGHAVLNRGGSAVDAVAATIIVLEDAPQFNAGRGAVFTHDGRNEL
FT                   DAAIMDGASGKAGAIAGVHTVKNPIQLARRVMDHSRHVMLVGNGAEQFAREQGIALVDP
FT                   SYFRTDKRWQQLQKALKAEAGDRQAQAQLDLETAKHFGTVGALALDRDGHLAAGTSTGG
FT                   MTNKRYGRVGDAPIIGAGTYANSQCAVSGTGWGEFYIRAVAAYDICARMKYAGQSLQQA
FT                   AETVIDQQIPKAGGDGGAIALDAQGNLAFPFNTEGMYRGWIGADGTPHVAIFKDETL"
FT   sig_peptide     293910..293981
FT                   /locus_tag="XCV0254"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        295125..297218
FT                   /transl_table=11
FT                   /gene="dcp2"
FT                   /locus_tag="XCV0255"
FT                   /product="peptidyl-dipeptidase"
FT                   /EC_number="3.4.15.5"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21886"
FT                   /db_xref="GOA:Q3BZ27"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21886.1"
FT                   /translation="MTEKTAPAPAADAASNPLLTASTLPFQAPPFDKIKDADYLPAFEE
FT                   GMRQHLADIRKIADNPQAPTFDNTIEAMERGGETLTRVSRIFFGLVQADTSDARQKIQE
FT                   EIAPKLAAHQDEINLDPKLFARVKTIYDQRDTLNLDPEQKRLVERDYEELVRAGAQLSD
FT                   ADKDSLRKLNVEETTLSTQFHTRLVAASAAGAVVVDDKAKLDGLSEGDIAAAADAAKAR
FT                   KLDGKYLLTLQNTTQQPVLASLKDRQLRAEVLKASETRAEKGDANDTRQTIQRLAQLRA
FT                   QKAKLLGFDNYAAYSLGDQMAKTPDAALKLLTDTVPAATAKARREVADMQKVIDAQRAD
FT                   AKTGDFKLAASDWDFYAEQVRKAKYDLDEAQIKPYFELDNVLQNGVFYAATQLYGITFK
FT                   QRTDIPTYHADMKVYEVFDADGTSMALFYTDYFKRDSKSGGAWMDVFVEQDGLTGAKPV
FT                   VYNVCNFTKPAAGQPALLSFDDVTTLFHEFGHALHGMFSKVKYPSIAGTSTSRDFVEFP
FT                   SQFNEHWASDPKVFAHYAKHYQTGAPMPAELVEKIKKAKTFNSGYATTEYLSAALLDLA
FT                   WHTQPADAPLQDVSKFEADALKRFKVDLAEVPPRYRSSYFDHIWGGGYSAGYYAYFWSE
FT                   VLDDDAFEWFKENGGLTRKNGDTFRAKILSRGNTVDLATLYRDFRGKDPSVKALLENRG
FT                   LTE"
FT   CDS_pept        complement(297472..298401)
FT                   /transl_table=11
FT                   /locus_tag="XCV0256"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21887"
FT                   /db_xref="GOA:Q3BZ26"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21887.1"
FT                   /translation="MSGWTLADLPSQRGRVAIVTGASPGGLGYETALALAGAGAHVVLT
FT                   ARNPDRGEAARWALLARHSEAEVRVEALDLASLASVRAFAKRLTTRHAAVDLLINNAGV
FT                   MAPPQRQTTADGMELQLGSNYLGHFALTAQVLPLLRAASAPRVVNLSSLAHRQARIDFD
FT                   DLQSERPYRPWKAYGQSKLAMLMFSLELQRRSNTHGWGVRAIAAHPGIARTALIANGPD
FT                   GAGRRSASGVATGLFTRCIGHSASAGARPTLYAATSPQAQAGGYYGPNGLFELKGDPAP
FT                   AKIAHQAHDQQVAARLWDTACALTGVAF"
FT   CDS_pept        complement(298401..299438)
FT                   /transl_table=11
FT                   /locus_tag="XCV0257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21888"
FT                   /db_xref="GOA:Q3BZ25"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21888.1"
FT                   /translation="MASPRPSPYVDSPQFRAGRFRNAMPLPTTVMTLREQLGLMWAMVF
FT                   GKPRTTAPSAPLPVQPLTRAQLLAAPDRSLYRLGHSTLLMKLAGGLWLTDPVFSKRASP
FT                   VPFAGPKRFHAPPIALDALPPLAGVILSHDHYDHLDRATIGALADRVGVFVAPLGVGDL
FT                   LVRWGVDPAKVRQLDWWESISVAGLQLTATPSQHFSGRGLFDNGRTLWCSWVIQAGDLR
FT                   LFFSGDGGYGPHFKTIGEQLGPFDVALIENGAYDHMWPHVHMQPEQTLQAFFDVGGHTL
FT                   LPIHNGTFDLALHAWSEPFERIVALAAAANVPLAIPQMGERVNAHRPDTDQRWWRTLPD
FT                   TLVLA"
FT   CDS_pept        299668..300300
FT                   /transl_table=11
FT                   /locus_tag="XCV0258"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21889"
FT                   /db_xref="GOA:Q3BZ24"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21889.1"
FT                   /translation="MSTASSSPATPQRLTDRKRNAIVEAAIAQFRQHGFEATSMDRVAA
FT                   TAGVSKRTVYNHFPSKDALFGEILRGLWQRSAEAVNLAYRPDQPLHLQLIALLQQKLRL
FT                   LDDPAFIDLSRVAIAEGIHSPARARELLSQLGSKEEGTTAWLRAALADGRLAGVEPEFA
FT                   AQQLQALVKGFAFWPQITMGQPPLSPQQQTQVAESAVAMFLGLYARK"
FT   CDS_pept        complement(300462..300809)
FT                   /transl_table=11
FT                   /locus_tag="XCV0259"
FT                   /product="putative glyoxalase I"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21890"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21890.1"
FT                   /translation="MTDTTQHRIDYLEFAVDSIAVAKAFYGQAFGWTFQDYGPDYCEFR
FT                   DGRLSGGFFHGTPQPGGALVVLASDDLARSQARIEAAGGRITQPVFAFPGGRRFHFADP
FT                   HGYPLAVWSKD"
FT   CDS_pept        complement(300878..301606)
FT                   /transl_table=11
FT                   /locus_tag="XCV0260"
FT                   /product="putative transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21891"
FT                   /db_xref="GOA:Q3BZ22"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21891.1"
FT                   /translation="MSDPAEPCYAESAAPPALRAQLQCSWQFRQGGPAPQPVLVLPDGS
FT                   VDLIWNGSEVFVAGPDRIANPASVAAGTTLTGVRLAAGVAAGLLQLPLHAIADQRVALE
FT                   TLWGERGRTWQHRLEDGADPLQTLQALCLQHAAARDPQMAWLFEQLSVGAPTRLSALTD
FT                   ALGISERSLRRRCQDAFGYGSKTLERVLRLQRFLRIVRRHRNLTEAALHAGYGDAPHLV
FT                   RDARQLTGLSPRALVQQHAR"
FT   CDS_pept        complement(301751..303013)
FT                   /transl_table=11
FT                   /locus_tag="XCV0261"
FT                   /product="Monovalent cation:proton antiporter-2 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21892"
FT                   /db_xref="GOA:Q3BZ21"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21892.1"
FT                   /translation="MNPTTLLLVQLAVILGAARLCGALLQRIGQPPVIGEMAAGLLLGP
FT                   IAFGAWLPDLHMALFAARSLPPLSGLATMGVVLFMFVVGVELRAPEGTKAQVRASILVG
FT                   VSGIVLPLLLGLAAAPWLFPRFAPQGVSFWPFALFIAAAMSVTAFPVLARILKDRNMTR
FT                   TPAGRLALGAAVIDDATVWIFLAIVLTLTGNNAHGGVAFTAIGALVLIAAVFGVLKPAY
FT                   ARVLRARAHDGRYAPSALVWVLIGLLACAALAEWIGLHAIFGAFLFGICLPRDDRLLEH
FT                   LAGRIEPLAITLLMPVLFAVAGQATSPGAFAGAGLSGLVLVIGVAVGGKLLGCTLGARL
FT                   SGHHWRDSLTVGSLMNARGLMELVVIKIGLDSGVIGPDLFTLLFGMTLVTTVMASPMVA
FT                   WFQRKRHAAADALAASNSPHG"
FT   CDS_pept        complement(303038..303256)
FT                   /transl_table=11
FT                   /locus_tag="XCV0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21893"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21893.1"
FT                   /translation="MCAVQQCERTRQDAVTCIGPSTPHVRTHCLRALIANLIAARRHAY
FT                   TKRRRAAHRRAVGWGKLADALQDARLS"
FT   CDS_pept        complement(303367..304323)
FT                   /transl_table=11
FT                   /locus_tag="XCV0263"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21894"
FT                   /db_xref="GOA:Q3BZ19"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21894.1"
FT                   /translation="MAPTPRFSYKSDRLKPLRAFCQTVRLGSVSRAAEALYVSQPAVTL
FT                   QLQALERDLGVPLFERSGRRMAPSREGQLLYDMAQPLVESLDGLEASFREKVRGLDAGE
FT                   LNIAANSSTILYLLPRIVANFRARHPDVRLTLHNAISADGTDLLREDAVDLAVGSMLDV
FT                   PADLNYAPVYRFEQLLITPPDHPLAGKAEVSLQDLSPYPLILPPRRQVTYRLVDLVFQQ
FT                   ARVPYTVALEVGGWEVIKQYVAMGMGISIVTAICLTDADRDKLATRSLKDFFPTRSYGV
FT                   VVRKGKYLSPQARAFIELIQPDLFTPRGYDESGDSER"
FT   CDS_pept        304424..306058
FT                   /transl_table=11
FT                   /locus_tag="XCV0264"
FT                   /product="putative malate synthase"
FT                   /EC_number="2.3.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21895"
FT                   /db_xref="GOA:Q3BZ18"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21895.1"
FT                   /translation="MHKDSHMAATAFAPRPTDHATPGIALTTQIAGQAELLPAAALALL
FT                   VSLHRAIEPGRQQRLAQRRQRQAAFDAGQLPDFRTDTQAIRAGDWRVAPLPAALQDRRV
FT                   EITGPTDPKMVINALNSGAKVFMADFEDSTAPTWRNLLAGQRTLAAAVRGDLSFDAPNG
FT                   KHYALRPEAERAVLIVRPRGWHLDEKHVLIDGQPLAGGLFDAALFAFHNGRALLAKDRG
FT                   PYLYLPKLQSMEEAALWDTALAHIEAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRE
FT                   RIVGLNCGRWDYIFSYLKTFRAHRDRVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHA
FT                   MGGMAAQIPINHDEAANEQAMARVRADKLREVTAGHDGTWVAHPALIPVAMKLFDEHMP
FT                   TAHQQHVVRNDVQVTRDMLIAPSPGNVTRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLM
FT                   EDAATAEISRAQLWQWLHHGQHLDDGTAIDQHLLQATLRALPARLGTATALPGAARIDE
FT                   AIALLEELSRADELADFLTVPAYRLID"
FT   CDS_pept        306218..307513
FT                   /transl_table=11
FT                   /gene="aceA"
FT                   /locus_tag="XCV0265"
FT                   /product="Isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21896"
FT                   /db_xref="GOA:Q3BZ17"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21896.1"
FT                   /translation="MSTTLQSAEQLQQDWSNNPRWSGITRNYSAADVVRLRGTVHVEHS
FT                   LARLGAEKLWTSLHATPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMY
FT                   PDQSLYPADSVPAVVKRINNTLLRADQLHHAEGNDAIDFLQPIVADAEAGFGGVLNAFE
FT                   LMKAMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVL
FT                   IARTDAEAADLITSDVDANDQPFTTGQRTVEGFFKTRNGLDQAISRGLAYAPYADLIWC
FT                   ETGKPDLEFARAFAQAIHARFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKF
FT                   QFITLAGFHALNYGMFHLAHGYARRQMSAFVELQQAEFEAAERGFTAVKHQREVGTGYF
FT                   DAVTQAIQQGQSSTTALRGSTEEAQFHSDKAA"
FT   CDS_pept        307813..308871
FT                   /transl_table=11
FT                   /locus_tag="XCV0266"
FT                   /product="putative cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21897"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21897.1"
FT                   /translation="MTCHNTAGALEPTGNVAKTVPDGLHALMTAEELAFFARFGRSREV
FT                   SAGQSLFERGAVGTQMYIVVSGQIDLDFGEDLMLKHLGPGEFFGELGLLIGDHARSAGA
FT                   SASTDSRLIELAHEDFQRLVDQDPSVVAHFLRRSIVRVVNNEQLLIRQLRRRNHDLEAA
FT                   LDNLYVTSHQLNHTEELSRTDELTGLHNRRGLALHLQECRRAGHVPGVGLILIDCDRFK
FT                   RINDEFGHLAGDRVLQNVAHALRSVIAEGDLACRLGGDEFCVLVAQGTSELVHHIGECI
FT                   VRAVEARLCNGQGEQGCSVSVGSCMIDADAAWNDWYTLADSALYQAKRQGGNVLCMQET
FT                   LALDQPPATGHR"
FT   CDS_pept        308875..311388
FT                   /transl_table=11
FT                   /locus_tag="XCV0267"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21898"
FT                   /db_xref="GOA:Q3BZ15"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR030966"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21898.1"
FT                   /translation="MSSRTHARKYASSEAIQAPRLRTLLLTDLCDSTALVERIGDNAAA
FT                   ALFREHDRLVVKLQQHWRGRLIDRSDGLLLLFDRPIDGLGFALDYARGLKTMGDAHALT
FT                   LCARQGLHVGEVLTWRNSDEAISIGAKPLEVEGLAKPTAARLMSMARPGQILLSAVAES
FT                   LTHRAARELGNRADRLLWKSHGRWRFKGMPTAMEIYEVGEVGLTPLRMPKNSAKAWRDV
FT                   PLWRRPAALVAEVGVVLGIGFAIWLFARPQPALAFAERDWVVVGTVRNLTNDVMLDGAL
FT                   DQAFRISLEQSRYVNVLSEDRTLKLLALMRKDPTKDPLDRKNASDVALRTGARAVLLPS
FT                   VGYVGGRTRFVVEVVDPKTQQTVAVSTAFGSNPSILSAVDTVTGELRTQLGENRDSIRQ
FT                   NSPALPDVTTSSLDALRAYALGQQRYSEGKYGAALDFFQKAVDIDPHFALAWLGQVRAH
FT                   FANVDYKKATETLRVAEQFKSRLPPREALYVKSWGVQILDPAQAADFWIQMAELYPDYA
FT                   PAQANAAMDLFVANRFADALPYARASAQGKYDLSSVSLDMYGRILLALGQYDQADQAVR
FT                   KAVGSGWNGALLRQAAVAAAKRDYSGARDALARVDKTNFHADITRTTIALDEGDLHAAV
FT                   AHAQVGLSAGLNRRGTDRINYYVPLATALLASGQRPKAAEVAEEGARLALRDLGADVPI
FT                   DRIDNLSTALAAALIMARTGDTQGAARVRQQVKVAPLAYANRLVVELGAVVDAEILLAE
FT                   QRPDDAFRMLSPYLDSMSRFQTRATAMRAAQLGQRNADARIQHDWIRQHRGLAYAEIEC
FT                   GYCLQPLNLVDLRTAEDSWIAETQG"
FT   CDS_pept        complement(311416..311730)
FT                   /transl_table=11
FT                   /locus_tag="XCV0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21899"
FT                   /db_xref="InterPro:IPR030976"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21899.1"
FT                   /translation="MPAMPMLKLEPAVASNLIDLLSTDDAFRALFVSDTLEALRQVGHI
FT                   AAPGDDIEAFVRDCACNIQLADKDVIAGAREQINTMLTSGTSHIVPQLDAGYNGDRTLK
FT                   "
FT   CDS_pept        311877..313037
FT                   /transl_table=11
FT                   /locus_tag="XCV0269"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21900"
FT                   /db_xref="GOA:Q3BZ13"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR030965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21900.1"
FT                   /translation="MLVKRCAIVVLEPRETVSYTLDSLLRGGNGLDHSMQWFALAPHLD
FT                   APVAVSEAQRALLGELSPSHWTTRLPYESEALDGLIAQGLVLEEQTQGSRFAKADSRLR
FT                   ASHWHPLAAVLHAFTRWDGVDAVKNTRDSGTDTAVAMRRVLGPAPPEVLPANDRRTLIG
FT                   LPPMVANDFDDLLGRRVTCRNFDQSRPVPLPTFAHMLQRVFAAHAKVKVGDDLVFLKKN
FT                   VPSGGGLHPIEAYILVRNVQDLESGVYHYRADSHALERMSGLECSDDFVMQAVGQQHWF
FT                   ADAHVLVALVPGFDRTFWKYRQHAKGYRVVALEAGHLSQTLYLAATDLGLGAFITGAVN
FT                   EKHLERALGLDPTSQGVLAVCGLGWRATTMVTAELDPMGAIWSAAT"
FT   CDS_pept        complement(313267..315351)
FT                   /transl_table=11
FT                   /locus_tag="XCV0270"
FT                   /product="putative aminopeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21901"
FT                   /db_xref="GOA:Q3BZ12"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21901.1"
FT                   /translation="MQRLLLVSSMLLALSACSDKPAPAPEKAAAPAPAAAAPAAPPALI
FT                   TRDALFGNPERANVSISPDGKYLSWVAPLAGVLNVWVAPVDAPDQARAITKDTARGIRN
FT                   YFWTYQPNTLLYLRDNGGDEDFHLFSVNLADGSSKDLTPFKKTNAEVYRVSAQHPESIM
FT                   VGMNDRDAKWHDLYRVDLASGKRTLVQKNTDSLDAYLLDGDYQLRYATRATDDAGRELL
FT                   VPDGNRWKSVDRIPFEDVTNTAPEGLTEDGKTLYMQDSRNRDTAALYAIDTASNTRTLL
FT                   FENPRADVGATLNDPKTGAVQAVSTDYLREEWKPLDNGIAADLQKLKSLGGGDASVAAR
FT                   TLDDRIWIVGYSAAETPLTYYRYDRADGGKLTKLFSARPALEGKPLVPMWPQELTARDG
FT                   LKLISYLTLPAEADANHDGKADKPVPLVLFVHGGPWARDSYGYGPYEQWLANRGYAVLS
FT                   VNFRGSTGFGKAFTNAGNGEWAGKMHEDLLDAVQWAVKQGVTKPDEVAIMGGSYGGYAT
FT                   LVGMTFTPDAFKCGVDIVGPANLNTLLGTVPPYWASFYKQLTRRMGDPATEAGKQWLTD
FT                   RSPLTHVDKISKPLLIGQGANDPRVKQAESDQIVNAMKAKNIPVTYVLFPDEGHGFRRP
FT                   ENSKAFNAVTESFLSQCLGGRVQPIGADLEGSSITVPEGADKINGLSEALKTHTQAIRK
FT                   "
FT   sig_peptide     complement(315244..315351)
FT                   /locus_tag="XCV0270"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(315451..317478)
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="XCV0271"
FT                   /product="biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21902"
FT                   /db_xref="GOA:Q3BZ11"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21902.1"
FT                   /translation="MTQRDPIAAATQAPFDKILIANRGEIACRVIATCRTLGIATVAVY
FT                   SDADRNARHVRMADEAVHIGAAPAQQSYLRGEAILQAARATGAQAIHPGYGFLSENAAF
FT                   AEACAHAGIVFIGPPAAAIRAMGDKSAAKALMQRAGVPLTPGYHGDEQAPAFLRAQADA
FT                   IGYPVLIKASAGGGGKGMRRVDTSAAFEDALASCQREAQSAFGNAHVLVEKYVQRPRHI
FT                   EIQVFGDTHGEVVYLFERDCSVQRRHQKVLEEAPAPGMSEARRAAMGKAAVDAAQAVGY
FT                   VGAGTVEFIAGPDGDFYFMEMNTRLQVEHPVTELITGTDLVEWQLRVAAGARLPRRQHE
FT                   LRIHGHALEARLYAEDAERGFLPSTGTLRQLQMPAASAHVRVDAGVEQGDTISPYYDPM
FT                   IAKLIVWDTDRTAALARMRAALAQFHAVGVTTNSAFLSRLIATDSFASANLDTALIERE
FT                   HAVLFPEARSPDNAWWCLAAVLIADALPPAAVDPADPHSPWQHADGWRIGAHAAQRIVL
FT                   EANGERRQLAVRPDADGWQVTDAGQTHAVRYHPHETGVRVEMDGRQWRAQVLRDGATLT
FT                   LIGATQRAVFRHHDALAEADQPTQDTGGLTAPMPGRIVALPAAVGQPVARGQALVVLEA
FT                   MKMEHTLHAPSDGTVQAYLVAEGDLVNDGAALVEFVSASA"
FT   CDS_pept        complement(317719..319329)
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="XCV0272"
FT                   /product="acetyl-CoA carboxylase beta chain"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21903"
FT                   /db_xref="GOA:Q3BZ10"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21903.1"
FT                   /translation="MSVIDSQLQVSGESFQHNAAAMRAVIDDLRHTLARTARGGSDAAR
FT                   VKHTARGKLLARERIDALLDPGSPLLEIAPLAAHGMYDDQVPCAGVVAGIGRVSGVECV
FT                   IVANDATVKGGTYYPMTVKKHLRAQEIAQQNRLPCIYLVDSGGAFLPLQDEVFPDRDHF
FT                   GRIFYNQANLSANGIPQIACVMGSCTAGGAYVPAMSDETVIVREQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGADVHTRISGVADHFADNDLQALARVRAIIAQLNWRKPAASLALQAPL
FT                   PPRYAADELYGVIPADTRKPFDVREVIARIVDDSRLDEFKPRYGSTLVTGFAHLHGYPV
FT                   GIIANNGILFSESALKGAHFIELCTQRGIPLVFLQNITGFMVGRKYEHGGIAKDGAKLV
FT                   MAVACAKVPKFTVVIGGSFGAGNYGMCGRAYSPNFLWMWPNARIGVMGGEQAASVLATV
FT                   RRDGIEAKGGAWSGEDEDAFKAPIRAQFEQQGHPYYASARLWDDGIIDPADTRRVLGLG
FT                   LSAALNAPIEPTRFGVFRM"
FT   CDS_pept        complement(319340..320503)
FT                   /transl_table=11
FT                   /gene="acdA"
FT                   /locus_tag="XCV0273"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21904"
FT                   /db_xref="GOA:Q3BZ09"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21904.1"
FT                   /translation="MHVPSLNFELGEEIDLLRESVAAFASHHIAPLAAAADHYNVFPAQ
FT                   LWRLLGEQGLLGLTVEDAYGGSGMGYLAHVVAMEEISRAGGAIGLSYGAHSNLCLNQLR
FT                   KNASHEQKQRYLPKLCSGEHVGALAMSEAGSGSDVVSMKLRADARGDRFVLNGSKMWIT
FT                   NGPDADVLVVYAKTDPDAGARGITAFIVEKGMPGFSTAQKLDKLGMRGSNTCELVFTDC
FT                   EVPAENVLGTLNGGVRVLMSGLDFERVVLAGGPLGLMAAAMDVVLPYVHERKQFGEPIG
FT                   TFQLMQAKLADMYVGLNACRAYVYAVARACDAGRTTRQDAAGAILYAAEKATWLTGQAI
FT                   QVLGGNGYINEYPTGRLWRDAKLYEIGAGTSEIRRMLIGRELFERTA"
FT   CDS_pept        320632..321252
FT                   /transl_table=11
FT                   /locus_tag="XCV0274"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21905"
FT                   /db_xref="GOA:Q3BZ08"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21905.1"
FT                   /translation="MAYRRSALMEERLAGNRERILHAARVLIAEGGYRNAPVTAVAAAA
FT                   GVSTGQIYRHFPSKAELFVEVLNEAVQREMVILRAIAATQASAAERLRSAIATFVRRAL
FT                   AGPALAYAFIAEPVESEVDAERIRGRRLFGEVFRQLLAEGVAAGEFPQQSLDAAAACIV
FT                   GAFTEALVGPIAPSRGDPQQGEQLVEAICGFCLRAVGAAQARS"
FT   CDS_pept        321339..321713
FT                   /transl_table=11
FT                   /locus_tag="XCV0275"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21906"
FT                   /db_xref="GOA:Q3BZ07"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21906.1"
FT                   /translation="MVAVLNPLALTERLRVPDRTILSPSAMAGLLDLSQQELADLAGVH
FT                   RNSLRVHPESPRVQDLLRNLSRLLVAMAQVQPDERQVVFHLKNTPIPAFEFATLLEVVK
FT                   QGRTDDALTYLRTVAAGAAG"
FT   CDS_pept        321710..322234
FT                   /transl_table=11
FT                   /locus_tag="XCV0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21907"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21907.1"
FT                   /translation="MKLSAPAHCTLYRAFTPRWAAEPLSGAGAARSGGRFNRFGQPALY
FT                   LSLQLETAAAEYAQAAPFLPPLTLVSYAADLPALADLRLLDASWDAVWADWADDWRKAL
FT                   VNKIEPVSWVLGDLLREAEIPGAIFPSMARPEGVNMVLFLDMLQPERVLQVLDDGRLPR
FT                   DGRSWGDPPTV"
FT   CDS_pept        complement(322341..322676)
FT                   /transl_table=11
FT                   /locus_tag="XCV0277"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21908"
FT                   /db_xref="GOA:Q3BZ05"
FT                   /db_xref="InterPro:IPR021762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21908.1"
FT                   /translation="MSVLLLLALNFSGFAALCLAMDKHQLELHGRLLGTARSRQLRVLA
FT                   WLLLCVTFALAVHAQGWGIGAVLWLGTLTASAAVLSLWLLPYRRGAIVPAAVAAPVLAG
FT                   VMQVLIG"
FT   CDS_pept        complement(322673..324292)
FT                   /transl_table=11
FT                   /locus_tag="XCV0278"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21909"
FT                   /db_xref="GOA:Q3BZ04"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21909.1"
FT                   /translation="MKQGFRQSMAWLHTWTGLLVGWVLLLIFMGGTASYYRDEISRWMR
FT                   PELPTTTVSTATALRSAEQYLQTHAADAVSWNITLPDPRTPVVSMYWQNPAPADGKPAE
FT                   RRQMYGTAIIDPATGKDIAARDTLGGEFFYRLHFDLHYVPVMWARYIVGFCAMFMLVAI
FT                   ISGVITHKKIFKDFFTFRPGKGLRSWLDFHNVSAVTALPYHAMITYTGIVTLMFMYLPW
FT                   GIKARYAGDEMRFYDEAANRVADTRKAAGVPAHMLPLEQFVARARSDWRGGQVSNVAVS
FT                   LPNDAHAAVGVSQLADNLSTDVPSILFDAVSGERLQRSGPPGGASQTRGVMVGLHLAHF
FT                   AGPWLRALFFGSGLLGCLMVASGVVMWAVKERPKHLKAGRIGFGLRLVDALNIGTVAGL
FT                   PIAFASFFWANRVLPVGLDARAAMEANVFFAAWATALLAAFVWPRRAMWSWQLYLGAAL
FT                   FALVPVLNAITTDAHLGVTLPAGQWALAGVDLVCLFLGLSLGIAAFRLQRWKAPQPASA
FT                   RRARAAAAATPVPHTAPIQESA"
FT   CDS_pept        complement(324289..324600)
FT                   /transl_table=11
FT                   /locus_tag="XCV0279"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21910"
FT                   /db_xref="GOA:Q3BZ03"
FT                   /db_xref="InterPro:IPR022109"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21910.1"
FT                   /translation="MSSASPLPLAWFRRPWLGVLARTLAAIFGGYALASATNLLLALVL
FT                   PMPRSEAVLTSMLIGIVVCACAPLWAFATASVWRAWAGIAVPAALMFALATWLQRSAA"
FT   CDS_pept        complement(324782..325426)
FT                   /transl_table=11
FT                   /locus_tag="XCV0280"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21911"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21911.1"
FT                   /translation="MKSFLLSCLALASISLSAQAHEIWIERDGSGPVRIFFGEPAQDAL
FT                   DHGEDEIKRVVKPNVFGTAGKAGPLQRGTEFLTAPLAGSGDAWLSDDSVFEPWKGEAGG
FT                   FETVSYYARAGRATPAAKLDFELVPTAANRNTLTVLYRNKPLPKVEVTVIDPQKWQKTL
FT                   TSDAKGQVTLPTLRAGRHILVATHKEPVKREIAGKQVSMVHHISTLTFLAE"
FT   sig_peptide     complement(325367..325426)
FT                   /locus_tag="XCV0280"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        325709..326227
FT                   /transl_table=11
FT                   /locus_tag="XCV0281"
FT                   /product="putative cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21912"
FT                   /db_xref="GOA:Q3BZ01"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21912.1"
FT                   /translation="MRNYDLEFLKKFSMVIGLLVVITLGLIALAAYLQRAIPDEVSPTA
FT                   AKRVQQRIAPAGAVYAGATGASAQAAAQAAALAKAASQSAYGGTTDGKTIFNNLCTACH
FT                   TTGVGKAPTLDHSHWDARIAQGKDTLYKHAIEGYTGPDGGIMPPKGGNPALTEEQVRAT
FT                   VDWMLGNLK"
FT   sig_peptide     325709..325798
FT                   /locus_tag="XCV0281"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        326504..328222
FT                   /transl_table=11
FT                   /locus_tag="XCV0282"
FT                   /product="putative extracellular nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21913"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZ00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21913.1"
FT                   /translation="MSPRPLVVLGLVGLLAPLLCSAADGAAQRLSIADVQGEDSRSPYD
FT                   GRVVEVEAIVTADTRAGLAGLFVQQPGFEPRRSHGLFVTGAGNAELAVGDRVRIVGTVR
FT                   EVSAGGEASLTTVDASSIERLASGQPVPVRMLSGPPANWEALEGEHVRIASLTLNGSDR
FT                   LDTYGELFAAFGGRLWQPSEVAAAGTPAFAQVQADNARRRVLLDDARNGRSPKTVSYLP
FT                   ADPVLRSGSLLKSVDGIVDQRYDGNYRIQVLSPLTLPAMPTAVAPQVGGDLRIASFNLE
FT                   NFFNGNGRGGGFPTKRGARTHEQFQAQLAKLVATIVPLDADVAALMEVENDGNGADAAV
FT                   SQLVAALNAAGKDKDWQFVDTGSGPGDDAIRVGILYRSSQVTPVGKPATLTGGPFENHS
FT                   RVPLAQAFRSARGATFVVVANHFKSKGCGNASGADADQQDGQACWNATRTESAKRLHQW
FT                   LQTDPTGAQTKLAVLLGDFNAYAMEMPMRSLRASGWQDAFAVAGVKQPYSYVYDGLSGR
FT                   LDHALLSPAMAKQLRGAAEWHINADVMDDAGYAKRNLPGPWRSSDHDPVLLGFSL"
FT   sig_peptide     326504..326569
FT                   /locus_tag="XCV0282"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(328812..329189)
FT                   /transl_table=11
FT                   /locus_tag="XCV0283"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21914"
FT                   /db_xref="GOA:Q3BYZ9"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21914.1"
FT                   /translation="MRATASLLDSSAIALSGLCLLHCLALPLLAATLPLLGAWSRAEWI
FT                   HVMFATAAVPLSGYALWSTHRRHALPAPVWVLALCGLAGLVIGASGLVGDALETPVTVA
FT                   GSLLLASTHLLNLRLRRRTHC"
FT   CDS_pept        329251..330576
FT                   /transl_table=11
FT                   /locus_tag="XCV0284"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21915"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21915.1"
FT                   /translation="MSLSPQRDARLPVTVLSGFLGAGKTTLLNRILHNRDGLRVAVIVN
FT                   DMSEVNIDAQLVREGGAALRRTEETLVEFSNGCICCTLRDDLLQEVRRLAEQGRYDYLL
FT                   IESTGIAEPMPVAATFAVRDADGFSLSDIARLDTMVTVVDGSRFLEDFGSAATLADLGQ
FT                   QAGPDDTRGLVQLLGEQVEFADVLVISKCDRIDAQQLQRLRAVLRALNRDAAIVDAAHG
FT                   EVPLQQLLDTGRFDFTRAQLAPGWMQELRGQHTPETEEYGISSFVYRARRPFHPQRFAR
FT                   MVHSGLPQVIRSKGFFWLASRMDWVGELSSVGGATQTSAAGFWFAARHRVDAQSVGQPL
FT                   QTSVTPLPYTDIGWQRQQTRCWTAPLPQPHEVGDANEYAAMQRLWHPLWGDRRQELAVI
FT                   GVDMDAPRTRAALDACLLSDQELRQGPAQWQLLDDPFPHWAR"
FT   CDS_pept        complement(330740..331954)
FT                   /transl_table=11
FT                   /locus_tag="XCV0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21916"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21916.1"
FT                   /translation="MRLTSFFRSTHPVAPEPFNPAATDTAATAGATPSPHLLSHAPKAG
FT                   TAQGAAKSRQGMLASARKSLAMLRKQLPSMCMGAPATKTAQSQPALATSAPNAARQGTH
FT                   PRPPALQAGVDARWKAPEAMPQPRNRAPIYTAAPPQQPPSPPRASERFQQRQRAPEQQR
FT                   QQQVPNVARREPLRPPQQPTFPVRPAPAASPKAATPAPPSPSRRLRPVRNMNLELAALN
FT                   EQCHYIGRRLYKERRAPSPQERSVFEMRAALIAERDAVRDRQLDGMLAALAPLEKIAAP
FT                   RTTSSRLAMVQYDVMQSNRRALLAVRENIDMTKMARYYARAQRRLQSLKESDAPPDKIR
FT                   RLERMMQGYTNVLALEDMVKRTDDQLHRMGAPRLMDSIPTTPQERALSEQNERDDHQEA
FT                   INNGY"
FT   CDS_pept        complement(332051..332926)
FT                   /transl_table=11
FT                   /locus_tag="XCV0286"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21917"
FT                   /db_xref="GOA:Q3BYZ6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21917.1"
FT                   /translation="MHFLLFAVVCSVLVSVLLKLAPRHRIDVFQAITWNYATAALLAWL
FT                   ILHPALDTLRATTTPWLALLLLAVALPSIFLVLARSVAVAGVVRTDVAQRLSLVLSLAA
FT                   AFTVFGEPVNGWKLAGLALGMVAIVCIVRRPRQHLATDPLPSTTGLPWLIGVWMGFALI
FT                   DLLLKHIAQAGTPSLTSLTLCFALAFLLMLGVQGVRWARGARLSTRSMLAGVLLGALNF
FT                   GNILCYVRAHQLLPHSPATVFASMNLGVVVLGALVGTLGFAERLGLRGWLGLALAAPAI
FT                   AAIAWGIRLG"
FT   CDS_pept        332993..333655
FT                   /transl_table=11
FT                   /locus_tag="XCV0287"
FT                   /product="putative hydrolase of the alpha/beta fold
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21918"
FT                   /db_xref="GOA:Q3BYZ5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21918.1"
FT                   /translation="MSNPSFPTESAALTLDGPVGPLDVAVDLPEPDVAAHAVTAIFCHP
FT                   LSTEGGSMHNKVVTMAARALRELGITVVRFNFRSVGNSAGAFDHGDGEQDDLRAVAEWV
FT                   RAQRPGHTLWLGGFSFGAYVSLRAAGSLEPQVLISIAPPAGRWDFSNIQPPAQWLVIQG
FT                   DADEIVDPQAVYDWLETLEQQPELVRMPDTSHFFHRKLIDLRGAIQHGVRRWLPAAA"
FT   CDS_pept        333737..334831
FT                   /transl_table=11
FT                   /locus_tag="XCV0288"
FT                   /product="putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21919"
FT                   /db_xref="GOA:Q3BYZ4"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21919.1"
FT                   /translation="MSEMTPSQRYAAGVQRGDWRADPAQQAALAELDRIHEALVDSAQD
FT                   GWLDRLSAFWKKPEPVRGLYFWGGVGRGKTFLVDLFYDGLPIKQKYRTHFHRFMRGVHE
FT                   QLREHAGQSDPLARIAQQWRENLRVLVLDEFFVTDIGDAMLLARLLERLFAEGVTLVTT
FT                   SNTAPENLYANGLQRDSFMPAIGLLQKFCVELYAEGTEDYRMRALTRSPVYRAPLDAQA
FT                   DDWLAQRWAELSGNAEARAGNIEIEARKIPVRARGKSIAWFDFAALCEGPRGPSDYIEI
FT                   AREFTTVLLGGIPHFDRMNEDAARRFVNLIDELYDRHVNLVCTAQDAPPALYSGQRLAG
FT                   AFERTASRLIEMQSAEYLATAHRA"
FT   CDS_pept        335231..335692
FT                   /transl_table=11
FT                   /gene="ohrR"
FT                   /locus_tag="XCV0289"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21920"
FT                   /db_xref="GOA:Q3BYZ3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21920.1"
FT                   /translation="MDTATATTARTDALLQLDNQLCFALYSANLAMHKLYRGLLKALDL
FT                   TYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRAANDERQVI
FT                   IALTETGRALRSKAGAVPEQVFCASACSLDELRQLKQELEKLRSSLGAG"
FT   CDS_pept        335792..336220
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="XCV0290"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21921"
FT                   /db_xref="GOA:Q3BYZ2"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21921.1"
FT                   /translation="MASPEKVLYTAHATATGGREGRAVSSDKALDAKLSTPRELGGAGG
FT                   DGTNPEQLFAAGYAACFIGAMKAVAAQDKLKLPGEVSIDSSVGIGQIPGGFGIVVELRI
FT                   AVPGMDKADLQALVDKAHQVCPYSNATRGNIDVTLTLA"
FT   CDS_pept        336234..336458
FT                   /transl_table=11
FT                   /locus_tag="XCV0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21922.1"
FT                   /translation="MMRSACHGFNDGPAHASGRCALWLEKIAGSRTRCPAMTRQRALRR
FT                   RLSWHATRGVRTVTHGKRIEQTRARRHAA"
FT   CDS_pept        complement(336455..337258)
FT                   /transl_table=11
FT                   /locus_tag="XCV0292"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21923"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21923.1"
FT                   /translation="MRSTVFFAPLWLLVACAAQAQTAAPRLSSQQCTVSTSYDVLADTG
FT                   GIWLRRKQGLPREIFFHGGELNVDRQPQPVSAADAQRLRELEQGTRALMPAVASLAQSV
FT                   VDITFDALNGVVHVLSGSARQQRKVEQLRTAAQAQVADTLGRGRWEQAVFDERFEAKVE
FT                   HAAEALAGSLTRSMMWTVMSGRAAQLERRGEQLDAQMQQQMQGRSDALQAQARTLCVQA
FT                   QALYAVQQALEYRFNGERLQMLELNAHPQPADVVASTGVAATARR"
FT   sig_peptide     complement(337199..337258)
FT                   /locus_tag="XCV0292"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        337478..337894
FT                   /transl_table=11
FT                   /locus_tag="XCV0293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21924"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21924.1"
FT                   /translation="MLDPRIEKVDLALTEIAQDPSEKVALWQWACREMLHETLIGMHQL
FT                   SHLAGIARQVANDWREPVDVIAPAKPYLAASALADRRLPQVLDGLGSTHDDNDRATLWR
FT                   LRYASLIASTLQGMQALAEKHRIDRQAVAIGPLN"
FT   CDS_pept        complement(338204..339406)
FT                   /transl_table=11
FT                   /gene="xopE1"
FT                   /locus_tag="XCV0294"
FT                   /product="Xanthomonas outer protein E1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21925"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYY8"
FT                   /protein_id="CAJ21925.1"
FT                   /translation="MGLCISKPAMSGSSVAASPEHPESPASEQVTAPTPLPEPSVPPSL
FT                   QGLARLGAARARRRRSGKPTLQPHEVQQAAYQLGMRLSGRPIEDVRDRQRLADATATVH
FT                   ETRLALHHGRGNIESDFRLSNGRSSTCSYLSYSFLSYWPGKHDINLMAGCALAVSAGNC
FT                   DQNAAINTRRHAARMEGGGQITNVCDQACAHMYALYQPPGSAEAQDSAVVLDSWSDGPA
FT                   VLLRDSRWAGTYHRTSTYPIERFDKPGAIDALARTRALQAEIEDPQTEFHAHLRGVESV
FT                   VRTPPVPRKIYASTPVIAPDLVQSTRQRLQELSPRTRKALAADAARQAYGLDDAQPISP
FT                   RTTSAILKDAARLDALGRPPLSWAPTSHARLKRFVTNARTNARQAFWYRRGWRPPVTVA
FT                   R"
FT   CDS_pept        complement(339585..340613)
FT                   /transl_table=11
FT                   /locus_tag="XCV0295"
FT                   /product="Zinc-containing alcohol dehydrogenase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21926"
FT                   /db_xref="GOA:Q3BYY7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21926.1"
FT                   /translation="MTSIINRRIVLASRPHGEPSADNFRIEEVAVEPTGHDQILVRNRF
FT                   LSLDPYMRGRMDEGPSYAAPVAIDAVMEGGTVGEVIASNHADYQPGDLLVLPGGWQTHS
FT                   LLTPTTPLRKLPKDDSLPLSTALGVYGMPGFTAYAGLHEIGKPQPGETLVVAAASGPVG
FT                   ATVAQLARLQGLRVVAIAGGEEKVRYLRDTLQVEVALDHRADDFAEQLRAATPDGIDIY
FT                   FENVGGKVFDAVLPQLNDFARIPVCGVIATYNSRGQAHPGPDRLPDFMGQVLRKRLTVR
FT                   GFIQHDFIRLMPAFLREMGQWLREDKIQYREHVLHGLDSAPQGLIDVLRGKNFGKAVVA
FT                   LD"
FT   CDS_pept        complement(340748..341719)
FT                   /transl_table=11
FT                   /locus_tag="XCV0296"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21927"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21927.1"
FT                   /translation="MTQPRALGRSGLQVQPIVFGGNVFGWSADEATSFALLDAFVDAGF
FT                   NLIDTADAYSGWVPGNRGGESETIIGRWLARSGKRDKVLIATKVAKWSEHPGLSPDNIA
FT                   AAVEDSLTRLQTDVIDLYQAHEDDESIPLEATLAAFGRLIEQGKVRAIGASNYSAARLR
FT                   DALDISEQYKLPRYESLQPEYNLYDRAGYEAELEPLVRERELGVISYYSLASGFLTGKY
FT                   RSADDAGKSSARGASVVKQYVNPRGLRILQALDDLAVTHNATPAQIALAWLIARPGLTA
FT                   PIVSATSVTQLHDVLAAARVALSADQIAQLDSASAPESSAPR"
FT   CDS_pept        341953..342807
FT                   /transl_table=11
FT                   /locus_tag="XCV0297"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21928"
FT                   /db_xref="GOA:Q3BYY5"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21928.1"
FT                   /translation="MIGNKLACACVMGVVVAMSAPLAMAVKPADSASLPAPDAALQAAI
FT                   NGNWRDRVYVQRDQYRHPGQTLAFFGIKPTQTVIEITPGGGWYSEILAPYLREKGKYVA
FT                   AVVDPASAPEGRSRDYAQRARDELEKKFHAKPEVYGKPSLVSYVPKSPSFGVDNSADLV
FT                   LTFRNVHNWRMAGTAEAMFAGFYKVLKPGGVLGVVEHRAKADVPADDKSGYVGQAQVIA
FT                   MAEAAGFTLVGKSEVNANPRDTKDYPGGVWTLPPSNSHDKADDAKYQAIGESDRMTLKF
FT                   VKR"
FT   sig_peptide     341953..342027
FT                   /locus_tag="XCV0297"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        342900..343472
FT                   /transl_table=11
FT                   /gene="rluE"
FT                   /locus_tag="XCV0298"
FT                   /product="pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21929"
FT                   /db_xref="GOA:Q3BYY4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21929.1"
FT                   /translation="MLVLLNKPYGVLSQFSDRSQPPKRTLAEFGLPPDVYAAGRLDHDS
FT                   EGLLLLTDDGALAHRLTDPRHKQPKTYWVQVEGAPQPEQLQALRDGVVLNDGPTRSAQV
FT                   RMLDPAPQLWPRDPPVRVRKTVPDAWLELQITEGRNRQVRRMTAAVGLPTLRLVRVAIG
FT                   DWRLDALAPGQWRAEDTASARPRRSPR"
FT   CDS_pept        complement(343803..344234)
FT                   /transl_table=11
FT                   /locus_tag="XCV0299"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21930"
FT                   /db_xref="GOA:Q3BYY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21930.1"
FT                   /translation="MSKLTVITERALERALELAGTAGDQLRHAASNAGDQARHAGSSLR
FT                   HFGPSASEWLKTGAALGAVRTGGKAASKLVKRNPAVTVAAAVAGLGLIGYAVYRKRQRD
FT                   QQVLGGNVHRLDREHASNANARRAAYQRRGAVTPSDGIE"
FT   CDS_pept        complement(344701..347301)
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="XCV0300"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21931"
FT                   /db_xref="GOA:Q3BYY2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21931.1"
FT                   /translation="MRCIVVSRNAAGCRQLRTGLCRTLCSRNVSFPRMTDPAFPISPLL
FT                   PQIRDSLAAHPRLVLEAPPGAGKTTQVPLALLDAPWLAGRRIVMLEPRRVAARSAAQFM
FT                   ARQLGEPVGETVGYRIRFENKTSARTRIEVVTEGILTRLIQDDPMLESVGALLFDEFHE
FT                   RHLAGDLGLALALDVQAQVRDDLRIVAMSATLDGERLAGFLEAPRLSSAGRSFPVEIAH
FT                   FPARRDEALEPQTRRAVEHALSTHPGDVLVFLPGQREIARVHRALQDALDPAVQVLPLH
FT                   GELSVEAQSQVLQPDPQGRRRVVLATNVAESSVTLPGVRVVIDSGLAREPHYDPNSGFS
FT                   RLDVAAIAQASAEQRAGRAGRVASGWAYRLWPQSQRLEPQRRAEITQVELAGLALELAA
FT                   WGSSALRFVDAPPSGALAAARELLRRLGALTASGGITTLGRRMLALGTHPRLAAMLAQA
FT                   GDAPRVALACDLAALLEARDPLRQGGDGLAARWRALAAFRQGRSAADADRGGLAAIDSA
FT                   AKQWRRRLRCDSAPPSSVEAHALGDLLSHAFPDRIAARHPADPLRYLLANGRSARLFDH
FT                   SDLRGEPWLVASELRYEAKDALLLRAAPVDEAYLRRSLPERFVQQDVVQWDADKRALVA
FT                   RRQSSFDRIVLDSRPAGRVDPAHAAAALTDAVRQLGLDALPWTENLQQWRARVQSLQRW
FT                   MPELALPDLSDATLLETLDTWLRPAFAGKTRLDALDEASLGEALKSALPWERRQWIDRH
FT                   APTRISVPSGMERPISYALDHAGQPLPPVLAVKLQELFGLAETPRIADGRIRLTLHLLS
FT                   PGGRPLQVTQDLKSFWANTYPDVKKEMKGRYPRHPWPDDPWTAAATHRAKPRGT"
FT   CDS_pept        347434..347718
FT                   /transl_table=11
FT                   /locus_tag="XCV0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21932"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21932.1"
FT                   /translation="MNDYGSYRYLPADGWYATYPQVTDTDQVRVFQRVALWRVAPHGTI
FT                   VGLISSPDGDQEDIESQLLSAPRGQGVHYIHMDDMTEQEREQIRNRRFS"
FT   CDS_pept        complement(347895..348368)
FT                   /transl_table=11
FT                   /locus_tag="XCV0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21933"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21933.1"
FT                   /translation="MIHNDVLRSIRYMLDLSDDKVVDITHLADPEFALDKPQVQAWLKK
FT                   EDEPGFEPCTDAMLARFLDGLVLRFRGRDESQPPRPLETRVGNNLVLKKLRVAFELKDV
FT                   DMHAIFASAGFPLSKPELSALFRQPGHKNFRPCGDQLLRAFLKGLTARMREAG"
FT   CDS_pept        complement(348536..348895)
FT                   /transl_table=11
FT                   /locus_tag="XCV0303"
FT                   /product="Transthyretin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21934"
FT                   /db_xref="GOA:Q3BYX9"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21934.1"
FT                   /translation="MAATHPGSGMSTLSTHVLDTASGRPAAGVPLRLFAGETLHFEGVT
FT                   NPDGRCPDLAALALQPGRYRLEFDLARYWQATGMALADPPFLDCIPIAFGIADDGHYHV
FT                   PLLLSPYGYSTYRGS"
FT   CDS_pept        complement(348865..350286)
FT                   /transl_table=11
FT                   /locus_tag="XCV0304"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21935"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21935.1"
FT                   /translation="MSLAHLERTLAHDLQCLAHGGDAWVQPRVHPSGHVYDVIIVGAGQ
FT                   SGLGAAFALQRERVHNLLVIDENPAGQEGPWVTYARMQTLRTPKHITSIDLGVPSLTFR
FT                   AWWEAQYGSAAWDALDKIPRARWMDYLRWYRTTLRLPVRNATRLVRVEPDFAPGIHRLH
FT                   LAMGAPLLTRKLILATGIQGGGQWVVPEWISRALPAHRYAHTSGQIDFAALAGKRVGIL
FT                   GGGASAFDNACFALEQGLASAEVFVRRSELPRINPFRHMEQAGIIPRFLALPDADKYRM
FT                   MASFFAHNQPPTNDTFQRACAHAGFALHLGAPWLDVAERDGEIVVRTPQREHRFDFLAI
FT                   ATGLVTDPQLRPELAALSGRIACWGDRYRPPPGQANPVLDAHPYLGPGFELLPRTPDDA
FT                   ALLHGLFAFNYSALINHGPSAAALSGLKVALPRLARAVADQLFLDDRQAIVDSYLAYDQ
FT                   PEFVGQWPQPTQAVA"
FT   CDS_pept        complement(350283..350774)
FT                   /transl_table=11
FT                   /locus_tag="XCV0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21936"
FT                   /db_xref="GOA:Q3BYX7"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21936.1"
FT                   /translation="MSVVDDPALDDAAFLARYRDLFEHSPWVVERALRRRPLADVHHGL
FT                   MQVVYDASPQDQVALIRAHPELAGKAAIDRTLTEASAAEQASAGLDRLSEDEFKRFHAL
FT                   NQAYRHRFGFPFVICVRLHDKAGILAALAQRLEAARNAEIATAIAEIGKIVHLRLEALP
FT                   "
FT   CDS_pept        complement(350771..351187)
FT                   /transl_table=11
FT                   /locus_tag="XCV0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21937"
FT                   /db_xref="InterPro:IPR024507"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21937.1"
FT                   /translation="MAAGAPGMSIAASRIDLPEVIAQVTAAFHAYETALMRDDIAAMDA
FT                   LFHAAPSTVRYGVGEVLYGIDAIRAFRSGRGGSPQRQLAHVQVHGFGHDFATTHAEFIR
FT                   EGSSARGRQSQSWVRFADGWKVVAAHVSLQGTHA"
FT   CDS_pept        complement(351163..352053)
FT                   /transl_table=11
FT                   /locus_tag="XCV0307"
FT                   /product="putative polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21938"
FT                   /db_xref="GOA:Q3BYX5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21938.1"
FT                   /translation="MNAARDLLGYGATPPAAQWPGGARIAVQFVINYEEGAENCVLNGD
FT                   AGSEAFLSEMVGAHAHPGARAMAMESLYEYGSRAGFWRLHRLFTARNVPMTVFGVAQAL
FT                   ASNPDAVAAMQAAQWEIASHGLRWIDYQHVDEATERAHIAQAIAVHTRVTGSRPLGWYQ
FT                   GRTSPNTARLIAEEGGFVYDADSYADDVPYYDHRHGRAQLIVPYTLDANDMKFVAYNGF
FT                   ADGEPFFRYLRDSFEQLRSEGGRMLSIGLHGRIVGKPARAAALARFVDHVLASGDAWIA
FT                   RRIDIARHWLQVHPA"
FT   CDS_pept        complement(352050..353243)
FT                   /transl_table=11
FT                   /locus_tag="XCV0308"
FT                   /product="putative serine-pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21939"
FT                   /db_xref="GOA:Q3BYX4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21939.1"
FT                   /translation="MGPGPVNAHPRVLRAMAADLLGQFDPEMTAYMNEVMALYRPLFGT
FT                   ENRWTFLVDGTARAGIEAALVSLVSPGERVLVLNFGRFGLLLTEILGRLGAEVHTVDAS
FT                   WGQVLPLSAIAEAIERVAPKLVATVHGDTSTTMAQPLDGLGALCRAAGALSYVDATATI
FT                   GGMPVASDRWEVDVVTGGLQKCLGGPSGSAPITVSERAAEAIFARRHVERGIVRADIAN
FT                   GSGPRIASNYFDLAMIMDYWSDKRLNHHTEATTMLYGARECARVALQEGLDARFARHAA
FT                   AGRAVSAGIRALGLEVFGDDAHRMRNVTGVVIPPGIDGEAVRRRMRENFEIEIGTAFGP
FT                   LQGKIWRIGAMGYNAMKHKVLITLAALEAVLRAEGDACTHGLAVEAALAAWHAEAQA"
FT   CDS_pept        complement(353296..354582)
FT                   /transl_table=11
FT                   /locus_tag="XCV0309"
FT                   /product="putative N-carbamyl-L-amino acid amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21940"
FT                   /db_xref="GOA:Q3BYX3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21940.1"
FT                   /translation="MPAALPSRQATADLTAPGGARAVARCDALGVASYSDSDTGLFRGW
FT                   LGPAHRATVEQVSTWMKAAGMQVRIDPLGTLVGRYAGTRPDTPALLIGSHLDSVRDAGR
FT                   YDGPLGILLGIECVAALHAQGRRLPFAIEVIAFGDEEGSRFPASMFCSGAVAGTLDPAR
FT                   LAVTDAAGITVASALAAWNLDIAHVQRAARAPGSVLAYLETHIEQGPVLEAEGLPLGIV
FT                   SAIAAQRRFALRFEGRAGHAGTTSMSLRRDALSAAAEALLAIERIARVGSSDLVATVGT
FT                   LQVAHGATNVVPGRVDCTLDVRAGSDASRDAAVHQIEQALAQIAIHRGIAIAIEPLQTL
FT                   AASPCAPALITRLEHAVAAQGIAPRQLVSGAGHDAMVMAALCPTAMLFVRCAGGISHHP
FT                   DEHVDPADAEIALAVMRHFIEHLGEPLVT"
FT   CDS_pept        complement(354679..354906)
FT                   /transl_table=11
FT                   /locus_tag="XCV0310"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21941"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21941.1"
FT                   /translation="MAHGLRVTQRPRRCGAFAALPPTGAGKTVAEVPLARARIRWMRSS
FT                   QGHACRGSTRPAGRLYRVAFFAAQAREKTL"
FT   CDS_pept        complement(355084..356088)
FT                   /transl_table=11
FT                   /locus_tag="XCV0311"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21942"
FT                   /db_xref="GOA:Q3BYX1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21942.1"
FT                   /translation="MRCMAHAASRGCSHRAARLRARSKVIVEVEAQVDRIQEMTLFAAL
FT                   AEHTSFAGVARRLGISTATVTRTIAQLEARLGVLLVVRSTRTMRFTAAGQQYASDCRRL
FT                   LAELEDVESRAAGLHTLPSGLLTVTAPQMFGALHVTPVVAHFLSRYPAMRARTLLVDRV
FT                   VPLLEEGIDVAIRIGTLPDSSLTAIPVGSVRRMVCASPGYLAEHGIPQHPDRLPQHATI
FT                   STSAAERAPKWAFRLDGRAHEVDVASRLSVSAFNAAIVAAVDGWGLTQVPSYQVRQHLQ
FT                   NGTLVSVLDAFEIAPEPVHVVHVEGRRGSSKVRTFVDECVAALRHDLGCADGG"
FT   CDS_pept        356382..357269
FT                   /transl_table=11
FT                   /locus_tag="XCV0312"
FT                   /product="putative hydrolase of the alpha/beta fold
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21943"
FT                   /db_xref="GOA:Q3BYX0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21943.1"
FT                   /translation="MSHDSTQRIRYRTQQVGDVQVFYREAGRKDAPVLLLLHGFPSASH
FT                   MFRDLMPLLASQYRLIAPDLPGFGMTKAPPRGQFDYTFEALYKVIEGFTDALGLTRYGL
FT                   YLFDYGAPVGFRLAAAHPERVSAIISQNGNAYLEGFSDQWDAWQAYWREPSAANREACR
FT                   ASLSPQTIREWQYGTGVAPGALSPDGYMLDIAYMARPGAEEIQLDLILDYRSNVAAYPA
FT                   FQAYFRTHQPPLLAVWGKHDPAFIPAGAQAYRKDLPKAEVHLLDTGHFALETHAVEIAH
FT                   SISEFLSRTLAPSV"
FT   CDS_pept        complement(357591..358049)
FT                   /transl_table=11
FT                   /locus_tag="XCV0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21944"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21944.1"
FT                   /translation="MTDQDQHQPSLEDVKLAFDGQSVDWYLQKLVGIANTSDVQFGVTL
FT                   FVEGIVISGQLVSGKRYFEAFAQEFSAAYPGAADEKEDIRRAFASHASIYDSEDDAQQS
FT                   STPPQFIHLIDARCFSPGGQPLPSNRGVLWRGKVNAVSGFTLGSLSAD"
FT   CDS_pept        complement(358273..359853)
FT                   /transl_table=11
FT                   /gene="ggt1"
FT                   /locus_tag="XCV0314"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21945"
FT                   /db_xref="GOA:Q3BYW8"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21945.1"
FT                   /translation="MVHTLRARRGMVVAPHHLAAQAGRDVLRDGGNAVEAVVATAACLA
FT                   VVYPHMTGIGGDGFWLIHEPDGRVHAIDACGRAAQAATLDFYRGHAHVPWRGPGAANTV
FT                   AGTVSGWALALQQANGSVSLQRLLSDAIHHASAGVPVTLGGAQIAASKGAELRLQPGAY
FT                   AEIFEPHGVPLGEGALLHQAQLARTLQRLADEGLESFYRGAIAHDIAADLQALDSPLSA
FT                   HDLAIHRADVSVPLSVVIQGARLYNHAPPTQGLASLLILALFDRLKVEDADSYAHLHGL
FT                   IEASKQAFLIRDAHLGDPAWMTLDAQALLDDSTALDALAARIDMSAALPWPQPSQAGDT
FT                   VWFGAIDAHGRAVSCIQSTYFEFGSGLVLPRTGITWQNRGCSFRLAPDGWNALAPGRKP
FT                   FHTLNPALATFDDGRVMAYGTMGGEGQPQTQAAVFSRYARFGMPLQQAVSAPRWLLGRT
FT                   WGEDSTALKLEDRFDPAVVQALRNAGHAVELLPAYSAVMGHAGALVREVDGVISGASDP
FT                   RSDGVVAGW"
FT   CDS_pept        complement(359853..361313)
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="XCV0315"
FT                   /product="glu-tRNAGln amidotransferase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21946"
FT                   /db_xref="GOA:Q3BYW7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR014087"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21946.1"
FT                   /translation="MQLPAQWQAGVDRNTEVLRGHAQLLASFHAPPATAHEGGGARGQI
FT                   ASIVSTTRSQPTLAARLATQTLTRINQANDRLCAITRLLPARAAADAARVQAALAGGSD
FT                   GGALAGVPFVVKDLFDVAGQVTTAGAAVRAHCPPASRDAAVVQRLSDAGAVLVGTANMD
FT                   EFAYGFATVNAHYGTTANPHDLQHLAGGSSGGSAAAVAAGLVPFALGSDTNGSIRVPAA
FT                   LCGIYGLRPTHGAVPLDGVFPFVDALDVAGPFATSVADLRRIHEVLRGQPLPSCHAGNL
FT                   RVARLGGWFERNLDPDLEAGLQALLTACNSLSSIDLPEAERARAAAFVLTAAEGGHRHR
FT                   SALTAHGAQFDPATRDRLLAGLQLPASAVADAHRFAQWFADAMHALWDQVEVLIAPATP
FT                   CVAPRIDQDTIQIDGLPVSARANLGIFTQPLGLAACPVLAAPLPRPGRLPLGVQLIAAP
FT                   GREDRLFALAAQLERDGLLAFSPPPESR"
FT   CDS_pept        complement(361780..362949)
FT                   /transl_table=11
FT                   /locus_tag="XCV0316"
FT                   /product="putative nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21947"
FT                   /db_xref="GOA:Q3BYW6"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21947.1"
FT                   /translation="MPLSIAVATPSTFHDKNAMNDPHRPSSRRRVILEDDIDGFTPAQL
FT                   LLLQSPDVQVLGISAVSGNIWRDEALAHTCRLLELAGHPQIPVLPGPVHPLLNSESATE
FT                   RWEALYGKLVWKGAWTRHWVDGDTVQSAPRYHAHDVVPELALGNPSVVRPADEPAALFM
FT                   LRMVRQYPGEVSIIATGPLTNLALAQSLDPSFATLARELVYMGGSLNPRQQRNSVSAQQ
FT                   FAREFVNSPRREFNIRWDPEAASIVMRAPWRQITMVPVDPSTATELTTELLARMSAADT
FT                   TIGHALRRREPGFPMWDELATAVWLRPDLATRTETLYVDTNTAFDAGYGDILSWAPGYQ
FT                   PGLGEQAQTVVHAVDVPAFEQLLVDRLTAPQPPAVGLPLPLFPIGPRSP"
FT   CDS_pept        complement(363047..364216)
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="XCV0317"
FT                   /product="putative adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21948"
FT                   /db_xref="GOA:Q3BYW5"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21948.1"
FT                   /translation="MRNFLPGPTHPSGHDQFFSTFGKFDAVVRTRVADTVAAVLEQAAR
FT                   DRVPYVEIIANPPQMDQAAKRMQLLPWKGEDDAANLRALQPDLAPLVQAAQRDLADVDA
FT                   QVRRVLRCDQADARPGRTVEYRYVPYVLRVLPQPMVFGQMALAHALIAAGGSRAVALNI
FT                   VAPEDNPVALADYARHMAMFRFFATRYPGVPLSLHAGELALGLVPPAQLRSHIRQAVDA
FT                   GARRIGHGVDLPYEDDAETLLQRMRRDQVAVEINLTSNDVILGVKGMAHPLALYLRAGV
FT                   PVVLSTDDAGVSRADMTHEYQRAMQEQGLDYPTLKQLARNGLTYSFLPGTSLWDADGKV
FT                   AQACATALQRETDDAACRAFRQGSEKARLQWQLETDLAQYERTLLLQHR"
FT   CDS_pept        complement(364725..366218)
FT                   /transl_table=11
FT                   /locus_tag="XCV0318"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21949"
FT                   /db_xref="GOA:Q3BYW4"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21949.1"
FT                   /translation="MCKRSCSAIRARCPWQAQRNRARWAARVRALPRTPPRIDEISADV
FT                   RLSCRQPAVRPERMLMRWPGFALAANGSSVRTELLAGATTFLTMAYIVFVNPDILATTG
FT                   MDHGAVFVATCLAAALGSLLMGMLANYPIGMAPGMGLNAFFAFSVVGTLGYSWQQTLGL
FT                   VFVSGCLFLLLTVTGARRWLVDGIPPTLRSAIAAGIGLFLALIGLQKAGLVVAHPQTLL
FT                   TLGDLHRPEPLLALAGLLLIGVLEVRRVRGAMLLGILAVTGAALALGLVRYQGVLALPP
FT                   SLAPTLLQLDIVGALHGHGGGGALAAVLHVVLVFVLVEMFDATGTLMGVAQRAGLLHTP
FT                   AQRRQFDRALLADSTAILAGSLLGTSSTTAYVESAAGVQVGGRTGLTALVVAALFLLAL
FT                   LFSPLAAMVPAYATAPALIYLASVMLRECTQIQWDDVGDALPAAICMLAMPLTYSIATG
FT                   LAFGFVTYAALRLGSGRWRGVHPATWAIAGLFVLRYALE"
FT   CDS_pept        complement(366404..367363)
FT                   /transl_table=11
FT                   /locus_tag="XCV0319"
FT                   /product="putative vanillate O-demethylase oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21950"
FT                   /db_xref="GOA:Q3BYW3"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21950.1"
FT                   /translation="MSLHEVRVAEVVDQGHRQRAIRLEPVGAQLPAFEAGAHVDLHLPD
FT                   GLVRQYSIASAPHVRDHYLLCVKLADASRGGSRHLCEQLATGDRLRISTPRNLFPLHPG
FT                   ERHVLLAAGIGITPLLSMAEALEARGEAFVLHYYARRHADVAFSQRLQQGFTHGQVYLH
FT                   LSDGGQSPRVHVPEELRQARARDQLYLCGPAAFMDHFTVLAKAHGWTAAQLHREHFAAA
FT                   APSLAHDADSAFEVELAASGRVVQVPADCSIASALRDAGIEVPLSCEQGMCGACLTGVL
FT                   AGTPDHRDSVLSDAERAANRQITVCCSRSRSPRLVLDL"
FT   CDS_pept        complement(367381..368433)
FT                   /transl_table=11
FT                   /locus_tag="XCV0320"
FT                   /product="putative vanillate O-demethylase oxygenase
FT                   subunit"
FT                   /EC_number="1.14.13.82"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21951"
FT                   /db_xref="GOA:Q3BYW2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21951.1"
FT                   /translation="MDVAVPALPLHCTFEAADWQRLARHWHAVALSSEVSEAPFKATLL
FT                   DEPLVLYRLGSELVAARDVCPHRGVPLSMGTADGGGVVCAYHGLRFGAGGRCNHIPASP
FT                   SQNIPARMRLHTYAVAERYGLIWVCLAKPAGVSDADIQIPPMPGWDEDGFQQIVCPAFD
FT                   IGGSAARQLEGFIDVAHFAFVHTATFAQPDKREVPAYTTTETPTGFNADYLSTVANYSV
FT                   DMPLPDVAPDFQWLRHFEVHLPFTATLTIHFPVPGKRLVIMNAASPVSKHATRLLVPIA
FT                   RNFDTHLPVEDVHAFNLRVFEEDRAMVEAQRPEYLPLDPLLEVHIPADRSSIAYRRGLR
FT                   SQGYSDFFLR"
FT   CDS_pept        368559..369476
FT                   /transl_table=11
FT                   /locus_tag="XCV0321"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21952"
FT                   /db_xref="GOA:Q3BYW1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21952.1"
FT                   /translation="MLTFSRFTRYFIEVARCGSIRKASEVLHVSASAIDRQILKAEEEL
FT                   GAQLFERLPGRLRLTAAGELLLVDVRGWEKAYARTLERFDELKGLRRGHVEIAMIDALS
FT                   EGVVPAAVAALVQEYPGITFNLSTARNQRVMEMVTSADVDIGLLLDPVSSVDLEVRAFA
FT                   DIPLGIAMPVGHPLSTRTELQLSETLEHRLLLPAAPLIVGEHAKVLYQRQHIDVKRLTH
FT                   CNDVRTLRGLVRAGAGVGLMSWLDAAPDVADGRLAFVPFRQHLTKPMTLALCVAPQRQL
FT                   SRSAQLAIQALAAKIDAMAVPAVG"
FT   CDS_pept        369633..370499
FT                   /transl_table=11
FT                   /locus_tag="XCV0322"
FT                   /product="TatD-related DNase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21953"
FT                   /db_xref="GOA:Q3BYW0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21953.1"
FT                   /translation="MSNLTQYNHPCSFRRHRSMQLIDIGANLTHDAFDHDRDAVLQRAR
FT                   DAGVAQLVITGASREHSPLALQLAQQHPGFLYATAGVHPHHAMEFTAECEAEMRTLQAH
FT                   PQVVAVGECGLDYFRDFAPRPAQHKAFERQLQLAADNGKPLFLHQRDAHEDFIAIMRSF
FT                   EGRLGAAVVHCFTGTRDELFAYLDRDYYIGITGWLCDERRGAHLRELVRNIPANRLMIE
FT                   TDAPYLLPRTLKPMPKDRRNEPMFLSHIVQELARDRGEDVAVTAANSTAAARAFFRLPE
FT                   PASATSG"
FT   CDS_pept        complement(370617..371342)
FT                   /transl_table=11
FT                   /locus_tag="XCV0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21954"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21954.1"
FT                   /translation="MTSTALEVVQCRFSNDIAAMHLRHLVLPCLDPDLTLRFYRDVLQL
FT                   PIHGNAVRIGWSTLECVQAQRPVGSVHLAFNVAPSRFQAAAQWIGARATLLSDAHGREH
FT                   FALDGVWQSHSVYFAGPDGAVLELIARNALQDAPVGDGQFGGEELLCLSEIGLPSNNVE
FT                   VVTRSLAHHFGLQPFAPPLEGFAALGDDHGLLIVVDQRRRWFPQQRQLPWADGLRISVD
FT                   APEPGLHLRDAQGWELLAA"
FT   CDS_pept        371571..372497
FT                   /transl_table=11
FT                   /locus_tag="XCV0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21955"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21955.1"
FT                   /translation="MGDVQMGNCLRIPSANMAPALPEHGTAEASTSNPMPHAGNMTAGP
FT                   QEHTAVEGCAGRQIADMWLSSLERPARRPSGSRSQPTAQSRPQSKLEKLTEQRQSMLQR
FT                   AIILEDQWRSLQERCARTSVGGRQAFNLDILKGIIDRDKQALERMGGEGSYIAERHLHR
FT                   IERTLQDFEKKISNQKKLQSHLAKANDFLARLKLLKDELSSRGENKDILNDIDLNIKDL
FT                   EGILNELTRIEANGAGIQYDGCRGGAIAYFDSVTISLEAMLRSQDSGYFDYMRPALANV
FT                   LQDGYSPSRRKAVSDAGMRGGASDGIS"
FT   CDS_pept        complement(372784..373671)
FT                   /transl_table=11
FT                   /locus_tag="XCV0325"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21956"
FT                   /db_xref="GOA:Q3BYV7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21956.1"
FT                   /translation="MELRHLRYFLAVAEEGNFTRAAARVGIGQPPLSQQIQTLERELGT
FT                   PLFRRTHSGAELTPAGEAFVGEVRRVLADVERAAETARRVARGESGRLRLGFTASAAFS
FT                   PVVPRLIRDFRRKWPQVELLLEETNTASLLVGLADGRLDAAFVRYGLNTPPDLELLRFA
FT                   DEPMKIAVPAAHPLATRNSAPLAALAGEPFILFPRSFGSSLYDEILAACRDSGVTLRIT
FT                   QEAPQMSSIINLVAAELGVSVVPASTAQLQRPGVRYLDIEGHMPLARLALAAAPGGLET
FT                   TPLVRHLWALAKLI"
FT   CDS_pept        373766..375046
FT                   /transl_table=11
FT                   /locus_tag="XCV0326"
FT                   /product="Acriflavin-sensitivity family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21957"
FT                   /db_xref="GOA:Q3BYV6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21957.1"
FT                   /translation="MSSSDHRPGLLPDPPTRSNPDTDAPAAVRIRLALFLAGFATFSLL
FT                   YSVQPLLPEFARAFKVDPATASLPLSLATGALALAIFGAGAVSENLGRRGLMFVSIALA
FT                   AGLNLIAAFLPHWGALVVVRTLSGIALGGVPAVAMVYLGEELPANKMGAATGLYVAGNA
FT                   FGGMSGRIVMSVLTDHTDWRTALAVLSVFDLLCALAFFWLLPPSRNFVRRHGINLRFHL
FT                   RAWAGHLRDRNLPFLFALPFLLMGVFVCLYNYAGFRLGGPEFGLSQSQIGMIFSAYVFG
FT                   IVSSSVAGAASDRFGRGPVVTIGIVLCGLGVALTLAHVLALVVAGIVVVTIGFFIAHSA
FT                   ASAWVSRLGGAHRSHAASLYLLAYYAGSSVIGALGGWFWQHGGWAALVGMCLTLLMLAL
FT                   ASAYVLRQRADDARPYGRFAPHPARGE"
FT   CDS_pept        complement(375066..375518)
FT                   /transl_table=11
FT                   /locus_tag="XCV0327"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21958"
FT                   /db_xref="GOA:Q3BYV5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21958.1"
FT                   /translation="MRAAYAWRMAACSEPLLRIGALAQQTGASVRSIRHYDAHGLLTSS
FT                   RSANGYRVFPHACIAQVRQIQRLIATGFNLDEIVGFPECMRLVEGAQMCPETAQAHRAR
FT                   LQLIERQLADLERRRAHLLATLAQAAGDATAATSSAAQATRRKRAR"
FT   CDS_pept        375584..376504
FT                   /transl_table=11
FT                   /locus_tag="XCV0328"
FT                   /product="putative hydrolase of the alpha/beta fold
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21959"
FT                   /db_xref="GOA:Q3BYV4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21959.1"
FT                   /translation="MSVRLLPGSRMLPLRYLLACALLICSMWATASPGAIAAARSYTVT
FT                   APDGVRLAVQEHGATDGPAIVFVHGLLGSRINWDAQLADVRLQRYRLITYDLRGHGASG
FT                   RPAAASAYQEGMRWADDLAAVLKAANARQAVLVGWSLGGAVISNYLSRYGDTGLAGVVY
FT                   VDGVIELRAEQLGAHPAVYRDLVSPDLRTHLQAVQDFLRLCFATQPAVPVFETLLANAS
FT                   LASWDMQRAVQGMSIDVGGLQRTRLPVLLMYGARDALVATEPTVARARQLQPRAQTVLY
FT                   PDAGHAPFLEDSARFNQDLLRFVDH"
FT   sig_peptide     375584..375694
FT                   /locus_tag="XCV0328"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        376762..377664
FT                   /transl_table=11
FT                   /locus_tag="XCV0329"
FT                   /product="SIR2-like regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21960"
FT                   /db_xref="GOA:Q3BYV3"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21960.1"
FT                   /translation="MAFRNYHMTVVPAHDDHPLQDFIARHRRLFVLTGAGCSTDSGIPD
FT                   YRDLQGGWKRPQPVTFQAFMGELSTRQRYWARSLVGWPRFGLAQPNATHHALAALEARG
FT                   QLEVLLTQNVDRLHQAAGSQAVIDLHGRLDVVRCMGCERRMPRSEFQLLLEQANPGWAA
FT                   LEAAQAPDGDADLDDVAFEHFVVPPCPVCGGVLKPDVVFFGENVPRERVERAFAHLHAA
FT                   DAVLVVGSSLMVYSGFRFVQTAARNGLPIAALNFGRTRADALLTLKVEQSCAQALAFLH
FT                   GPTDLPRVRSVNDAGARSA"
FT   CDS_pept        377724..378842
FT                   /transl_table=11
FT                   /locus_tag="XCV0330"
FT                   /product="putative NADH flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21961"
FT                   /db_xref="GOA:Q3BYV2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21961.1"
FT                   /translation="MSAVDAALSQLFSPITFGPLALANRIVIAPMCQYSAQDGRASDWH
FT                   RIHLGTLSQSGAGLLILEAAAVVPEGRISYADLGLYDDATEQALAEVLQSVRRWSPMPI
FT                   GIQLAHAGRKASTDLPWKGGEAIAPDHAHGWQTVSASALPFRQGQPVPQALDEAGIDAV
FT                   VDAFVASAKRAERLGLELIELHAAHGYLMHQFLSPLSNQRSDAYGGSLENRMRLTLRIF
FT                   DAVRAAVSEKIAVGVRISATDWVQGGWDVQQSIALSQALDARGAHYIHVSSGGLDPRQQ
FT                   IPLQAGYQIPFAQEIRAQVNTPVIGVGLITEPAQAEAILQEGQADAIALARGILYDPRW
FT                   PWHAAAALGASVTPAPQYLRCEPRDARGVFAN"
FT   CDS_pept        378877..379755
FT                   /transl_table=11
FT                   /locus_tag="XCV0331"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21962"
FT                   /db_xref="GOA:Q3BYV1"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21962.1"
FT                   /translation="MPIGFLGLGTMGLPMAHNLLRGGFALSVWNRSPERAQPLHDAGAT
FT                   VVEQPHDTAHGPLLFSMLADDDAVRQTLLERGVLDALPAGSVHVNMATISVALAHELTA
FT                   LHAERGVAYVAAPVLGRVDVAEVGKLNILAAGDEAAVARVQPMFDALGQKTWYIGRAPE
FT                   QANAVKLAANFCLASAIGAMAEASALARGHGVDATQFLGMLTSTLFAAPAYQGYGRLIM
FT                   QRQYLPAGFTATLGRKDVDLAIQAGADKQVPMPLGELLRAGLDEAIAHGDGNADWAVLA
FT                   DVSARRAGQVA"
FT   CDS_pept        379969..380361
FT                   /transl_table=11
FT                   /locus_tag="XCV0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21963"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21963.1"
FT                   /translation="MTDAPVIHQGPVGPDHPEHPDHYLFAQIREAVSVLDAELGKPVDQ
FT                   ASERMAARLLPLAKQHGFDQVDYVVLSRHLGEVGENVFLVRGELSDPAHLRAHITTQEA
FT                   METSVDASLAQLEEINRRLMLRLPPR"
FT   CDS_pept        380601..381452
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /locus_tag="XCV0333"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21964"
FT                   /db_xref="GOA:Q3BYU9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21964.1"
FT                   /translation="MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGR
FT                   FFLRVHFHKPAKTDIAALEQRFAVLADQFQMTWQLHDARRRARLLVLVSKQGHCLNDLL
FT                   FRMHSRQLPVDIAAVVSNHTDFAPLAASYGIAFHHLPVSADTRAAQEAQLLALVDDLQI
FT                   DLVVLARYMQILSPQLCRALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYV
FT                   TEDLDEGPIIEQDVARVDHAMTPRDLIRLGSDTESLVLARAVRRHVEHRIVLNGHRTVV
FT                   FR"
FT   CDS_pept        complement(381567..382250)
FT                   /transl_table=11
FT                   /locus_tag="XCV0334"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21965"
FT                   /db_xref="GOA:Q3BYU8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21965.1"
FT                   /translation="MSSASPIGHVLIVEDEPRLAAVLGEYLHAAGYSHDWIADGAQALG
FT                   AFRAQQPDLVLLDLMLPNRGGLDICRDLRKESAVPVIMVTARVEEIDRLLGLEIGADDY
FT                   ICKPFSPREVVARVQAVLRRHRHDPHGAPAPGLHIDEDACRASVDGRALDLTQVEFRLL
FT                   RTLAAAPGRVYSREQLMGRLYADHRIVTDRTVDSHVKNLRRKLADAGGEDWVRSVYGAG
FT                   YRFEP"
FT   CDS_pept        complement(382247..383626)
FT                   /transl_table=11
FT                   /locus_tag="XCV0335"
FT                   /product="two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21966"
FT                   /db_xref="GOA:Q3BYU7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21966.1"
FT                   /translation="MKLGITAKLFLAILAACVAVLLINGIAVQAFVKRQFLDYLNEQGV
FT                   ERMQETLPRVRAEYARHGSWEFVRDNPDAWFVLMRPERGPGPPREAPPISDQTGAVFRF
FT                   ALLDQDYTPVIGNPDVGRHDILRPVVVGGRTVGWMAMLPFQKALAAADARFYAAQQRAW
FT                   WAIGGACLLVAALLGWLLSRTLLRRLRGLTQATHLLAAGDYATRIDAAARDELGQLARD
FT                   FNLLAQALEHNERARRDFMADISHELRTPLAVLRAELEALQDGIRPMTPISLGSLHQQV
FT                   GQLGKLIEDLYDVSLTDVGALAYRRAPVDLAVILATVLDGLHARFAAAQLQVQAQIDAG
FT                   PLQLDGDERRLQQLLGNLLENTLRYTDAGGTVQVRCVRRGAVLELVVEDSAPGVDADKR
FT                   ARLFERFYRTEASRNRASGGGGLGLAICRNIAEAHGGSIHAEASALGGLRMVLRLPALA
FT                   A"
FT   CDS_pept        383787..385010
FT                   /transl_table=11
FT                   /locus_tag="XCV0336"
FT                   /product="membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21967"
FT                   /db_xref="GOA:Q3BYU6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21967.1"
FT                   /translation="MLPVATHRFRTASVRLLLLAAATTLMAACSSRQPPQMPQTQVGVQ
FT                   TLKVQRLAVDQTLSGRTVAYVTSDVRPQVGGILRKRLFTEGQDVQAGQVLYEIDPASYQ
FT                   AAYDTAKGDLAQAEAAVLSARPKAQRYQTLVGLDAVSKQDGDDALATLRSNQAAVVAAK
FT                   ASLQTARINLDYTRITAPVSGRIGTSSYTPGALVSAGQSEVLATINQLDPIYVDVTQSS
FT                   VQLLQLRRQLDAGQLKAVDGKAEVTLQLEDGSTYAQSGTLEVVDAAVDTATGTVKLRAV
FT                   VPNPERVLLPGMYVTAKLSMAVDEQAILVPQQAISRNSKGQAVAMVVGSDNKVAQRVLT
FT                   TGDAIGDKWVVRQGLKAGDKVIVQGLQKASVGAEVRAVEVSQTAAADSAANASPSTQGT
FT                   AAAAPKAD"
FT   sig_peptide     383787..383882
FT                   /locus_tag="XCV0336"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        385020..388097
FT                   /transl_table=11
FT                   /locus_tag="XCV0337"
FT                   /product="RND superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21968"
FT                   /db_xref="GOA:Q3BYU5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21968.1"
FT                   /translation="MARFFIDRPIFAWVIAIVITLAGALSILSLPLEQYPNIAPPTINV
FT                   SATYTGASAQTVQNSVTQILEQQMTGLDHLLYMSSSSSSAGTASITLTFDSGTDPDTAQ
FT                   VQVQNKVSQGESMLPEAVQSNGVTVTKSTGSSMFMVLAFTSEDGSMDSTDIGDYMVSTL
FT                   QDPISRLNGVGGVNVFGSEYSMRVWLDPDKLRTYALMPADVSNAISAQNADVSSGALGA
FT                   LPAVQGQQLNATVTSRSKLKTPAQFEAIVLKSQPGGATVYLRDVARVELGSKSYASSSK
FT                   YNGKSASGMGLELATGANALDAAKAVEDKLEQLKPYFPTGLKYEIAYDTTPFVRISIEE
FT                   VVKTLLEAIALVVLVIYLFLQNWRATLVPVIAVPVVLLGTFGVLALLGYSINTLTMFAM
FT                   VLAIGLLVDDAIVVVENVERLMSEQGMSPRQATHTSMGQISGALVGIALVLTAVFLPMA
FT                   FFGGATGEIYRQFSVTIAAAMLLSLLVALTLSPALCASLLKPIARGGHVSRQGMLGRFF
FT                   GRFNARFDRSAEGYGRGVGTLIGHRKLGGLVYLALLVVMALLFWRLPSSFLPDEDQGML
FT                   MVMFTTPAGATQQRTQQSIDQATDFILKQPEVAGMMTISGFSFAGSSQNSGMGFIKLKD
FT                   WAQRDAPAQEIANRITGAMMGALPDAQVFALSPPAINGLGTSSGFTLQLQDVAGKGHDA
FT                   LVTARQQLLQLANADKAGALGLDAADINTTLATVMGGSYVNDFLNNNRVKRVYVQGEPS
FT                   ARMLPADIGRWYVRNSSSEMVPFSAFSSSAWAYAPQVLSRFNGVESMEITGSAASGISS
FT                   GEAMNGIAGLVGKIGKDVGYAWSGMSYQEQAAGAQTWMLYAVSLVFVFLCLAALYESWS
FT                   IPISVMLAVPVGIVGALLATWLRGLSNDIYFQVGLLATMGLAAKNGILIVEFAKELEEK
FT                   GQPLIEATLHAARMRLRPIVMTSLAFLLGVLPMVVSSGAGSGGRHSLGTGVLGGTLVST
FT                   LLGIFFVPLFYVMVRSVFPDKASDHATAAETSEVAP"
FT   CDS_pept        388094..389545
FT                   /transl_table=11
FT                   /gene="oprN1"
FT                   /locus_tag="XCV0338"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21969"
FT                   /db_xref="GOA:Q3BYU4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21969.1"
FT                   /translation="MMRFSFASVAAACAIALSGCVSMAPHYARPDAPVPGVIGDTGSTG
FT                   NAGTGMPNAAAVDWRQVVTDARLQQVVALALDNNRDLRVAVLNIEQARAPYRIQRARLF
FT                   PAVDATVSHTAQRAAAATSFTGAPQIIRSASGEVGISSWELDLFGRIRSLKNQALETYL
FT                   ASEQTQRSTRLSLVAEVANDWLTVAADQQRLALAQQTLDSQRKTLRLTELQHDNGIASG
FT                   LYLAQIQTSVESARADVANYTTQLAQSRNALNLVVGTPVPAALLPASDAIETGVALAPL
FT                   PAQLESRVLLQRPDVLSAEHTLKAANADIGAARAAFFPTISLTANAGRGSDALSSLFDG
FT                   DHTWSFSPSVSLPIFRAGALKAELDVATLEKDITIAQYELAIQTAFSEVADALAERTQL
FT                   EERMHAQQAMVDAAQRSFSLSDARYRHGVDSYLVTLDAQRTLYSAQQTLISLRLTEASN
FT                   RVTLYKVLGGGADAQSGASVAGAAR"
FT   sig_peptide     388094..388162
FT                   /gene="oprN1"
FT                   /locus_tag="XCV0338"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(389782..391743)
FT                   /transl_table=11
FT                   /locus_tag="XCV0339"
FT                   /product="putative conditioned medium factor
FT                   (density-sensing factor)"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21970"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21970.1"
FT                   /translation="MPKPSPLSLLCSLSLLCAPLAAAELQPKQLAGPPEEFAQMRAPDP
FT                   AESAILSKSALLPVELAPAGQSARWQGSLPVENGHLRFMVLSGDQAWEAAVAAPQLAGA
FT                   RTAAVATPLQAQRTLLGSAEHGTSGMRYAVDSARNGAWALTLQSSSPVAQRGYVLMEGD
FT                   ARTQLASYLRTRQQQVGQSLTLNALLSGNDVRGATLLTAQAGTIDEASLRVIDPQGGVR
FT                   SMPMADDGKHDDGAAGDGVYGGTFQPTSEGTWIAQVVVHGHDQAGQPFVRTSEHVVPVV
FT                   DTSLRLLGNALGARAAAGTRLTIALPVAARGNAPSHYRVFGQVWGTDAKGKDIPVAWIG
FT                   GMLTPQQGQLPLSLDERWIARAGARAPFTLRSLRIEDPDHYIPLVQAATLPLQVPALRR
FT                   ASISRASTAIDESMRMGPRPTALASAMAMAQQPQAAGSQLVLVHGYCSNGVWPQAQFTN
FT                   ASTFLDAKQNRSNDQFAQRIAQFASQWSSFSTVAHSQGGMAALHLYTYYWSGLDNATGG
FT                   RVMQSVGTPYQGTNLSGVLAAVGSWFGVGCGTNSDMTYDGAKAWLAGIPADARAKVNYY
FT                   TTSFAKTNWYTNDYCNAASDLVLNDPEDGTVEQVNAQLPGGVNRGHTTGQCHTTGMRDP
FT                   AQYLDANRNAVMNANAAR"
FT   sig_peptide     complement(391678..391743)
FT                   /locus_tag="XCV0339"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(392160..393137)
FT                   /transl_table=11
FT                   /locus_tag="XCV0340"
FT                   /product="putative 5,10-methylenetetrahydrofolate
FT                   reductase"
FT                   /EC_number="1.7.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21971"
FT                   /db_xref="GOA:Q3BYU2"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21971.1"
FT                   /translation="MDFGSFPLDQCVVAMPPDHHDKTARPVISTDTPNFASTVTEAYSL
FT                   EVSAKDIGALTNAAPRILPGCAMFIPYLPGQNQAVRLAAAQMVRSLGFEPVPHLSARRI
FT                   GSLGELQACIARLVDEAGVTRCLVIAGDPSTPKGPFPDSVSLIETGVFERSGIRTIAVA
FT                   GHPEGHPILRTTEQWEVLERKCRSIQERGMAPLIVTQFGFDADIVVTWLEALRARGMTH
FT                   PVRVGVPGPASVAVLARYAASCGVGACASVLSNYGISIGKLFGNAGPDRFVDRLASRLT
FT                   EAHGDVRLHLFPFGGIAQSVEWVAHYRSRASQQDRMRSVRADQA"
FT   CDS_pept        complement(393167..393832)
FT                   /transl_table=11
FT                   /locus_tag="XCV0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21972"
FT                   /db_xref="GOA:Q3BYU1"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21972.1"
FT                   /translation="MDSTAQRMPLPLPDGHTKVLLHSCCAPCSGEVMEAMLASGIDYTI
FT                   FFYNPNIHPRKEYELRKDENVRFAEQFGVPFIDADYDRDNWFERARGMENEPERGVRCT
FT                   MCFDMRFERTALYAHEHGFPVITSSLGISRWKNMQQINDCGIRAASRYPGLMYWEYNWR
FT                   KGGGASRMIQISKRENFYQQEYCGCVYSLRDTNRHRVDSGRKRIQLGVKFYGDDAPED"
FT   CDS_pept        complement(393832..394746)
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="XCV0342"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21973"
FT                   /db_xref="GOA:Q3BYU0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21973.1"
FT                   /translation="MLERIHLTIVQQVEQQGSLTAAAGVLNLTQSALSHSMKKLEQQLG
FT                   TDIWLREGRSLRLTQAGQYLLAVANRVLPQLDLAEERLGQFAQGERGALRIGMECHPCY
FT                   QWLLKLVAPYLATWPDVDVDVKQKFQFGGIGALFGYEIDLLVTPDPLFKPGLRFEPVFD
FT                   YEQVLVVAKRHALASAAYVRPQQLTREVLISYPVDLERLDIYSQFLLPAGVTPRRHKAI
FT                   ETTDIMMQMVASGRGVAAMPRWLVEEYAARMDVVPVRLGARGIPKQIYLGAREADIAID
FT                   YLRAFIELARAPANATAYTQGPH"
FT   CDS_pept        394935..395522
FT                   /transl_table=11
FT                   /locus_tag="XCV0343"
FT                   /product="NADH-dependent FMN reductase"
FT                   /EC_number="1.5.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21974"
FT                   /db_xref="GOA:Q3BYT9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR019912"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21974.1"
FT                   /translation="MTVKHPLRVVAVSGGMQRPSKAVALAEHLLELIADQVPCERHLVE
FT                   LGALAPHFAGALWRTQVPDTVEQALCLVEQADVLVVATPVYRGSFTGLFKHFFDFIDQD
FT                   ALIDTPVLLAATGGSERHALVIDHQLRPLFSFFQARTLPLGVYATDRDFLDYRVHNDAL
FT                   AERARLAVQRALPLIELTRHARSIAAPGVAAA"
FT   CDS_pept        395604..396647
FT                   /transl_table=11
FT                   /locus_tag="XCV0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21975"
FT                   /db_xref="InterPro:IPR015004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21975.1"
FT                   /translation="MTRYAAHARVPILETRHRFAMTHALNFTIKSLRFDEDYRPSATTR
FT                   NTTNFANLARGQRRQENLRNTLAMIDNRCNELAHWDNPDRDRYAVELDIISVEMHIGER
FT                   ALDDAFPLIEILKPTIVDRHTGARIDGIAGNNFSSYVRDYDFSVLLPAHNQDASGFNVP
FT                   DDFGELHGKLFKHFVHSPAYCAHFRKPPVICISVSTSRTYHRTGNRHPILGIEYRQDAF
FT                   SLTDQYFEKMGLQVRYFMPPNSVAPLAFYFFGDLLGDYTNLELIGTIATMETFQKIYRP
FT                   EIYNANAAAGPTYRPSLKHQDYSSTQIVYDRQERSQLAVTQGKFTEEHFIRPYGNLLAQ
FT                   WASSHAS"
FT   CDS_pept        396676..397704
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="XCV0345"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21976"
FT                   /db_xref="GOA:Q3BYT7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR016456"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21976.1"
FT                   /translation="MTKLLPTSTAGSLPKPSWLAQPETLWSPWKLQDADLIEGKQDALR
FT                   LSLQEQQHAGIDIVSDGEQTRQHFVTTFIEHLSGVDFEKRQTVRIRDRYDASVPTVVGA
FT                   VSRPKSVFVDDARFLRQQTRQPIKWALPGPMTMIDTLFDAHYKSREKLAWEFAKILNQE
FT                   ARELEAAGVDIIQFDEPAFNVFFDEVNDWGVATLERAVEGLKCETAVHICYGYGIKANT
FT                   DWKQTLGSEWRQYEESFPKLQTSSLDIISLECHNSHVPIDLIELVRGKKVMVGAIDVAS
FT                   TTIETPQEVAETLRKALRFVDADKLYPSTNCGMAPLARHVARGKLGALSAGAQIVRDEL
FT                   SA"
FT   CDS_pept        complement(398058..399014)
FT                   /transl_table=11
FT                   /gene="kdgT"
FT                   /locus_tag="XCV0346"
FT                   /product="2-keto-3-deoxy-D-gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21977"
FT                   /db_xref="GOA:Q3BYT6"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="InterPro:IPR018395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21977.1"
FT                   /translation="MHIKATVERLPGGMMLVPLLLGAVCHTLWPQAGSTLGSFSNGLIS
FT                   GTVPILAVWFFCMGATIQLRASGRVLRRSGSLVLTKIAMAWLVAVLCAPLLPIGGVPSG
FT                   PLAGLSVLALVAAMDMTNGGLYAALMQQYGSSEDAGAVVLMSLESGPLISMLILGASGL
FT                   ASFDPLLFVGAVLPLLLGFALGNLDAQLRQFFAQATTTLVPFFGFALGNTLDLSTIAHT
FT                   GASGVLLGVAVIVITGLPLLLADRWIGGGNGTAGVAASSTAGAAVATPALIAGMAPQFA
FT                   PAAPAATALVASAVIVTSLLVPLLTALYARRGVARSG"
FT   CDS_pept        complement(399167..400624)
FT                   /transl_table=11
FT                   /locus_tag="XCV0347"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21978"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21978.1"
FT                   /translation="MKKRNFATVLCALSATASGSTLAAELELYVDRKTKQIFAEPAPGR
FT                   DKLGTFVQVDENGKLPASAMPATPAQPLAPAPGAATPADTAVAQAGPAPAPAATPAPAK
FT                   SGDAGKKWYDKLSLRGYTQIRYNQGIGGDAQDLRAPGDRFIGNDQSLGIRRARLVLSGD
FT                   LNEHVSLYFQPDFASTPTGSTTSNFAQLRDAYADIFFDKKREYRVRVGQSKMPYGWENL
FT                   QSSQNRLSLDRADALNSGLRDERDIGAVFYYSPTVAKGRFQDLVKSGLKGSGDYGVIGA
FT                   GVYNGQGANRAERNDSMHAVVHATYPFKFANGQYLEVGADAYAGRFVPTAAAVNIGGRS
FT                   FTPAITEPNGYTDQRVAAHIIYYPQPFGLQAEWTVGRGPELDVAQRRIRTRSLSGGYVQ
FT                   AMFKHDFNYGTLLPYLKWQTYRGGSKFDTNAPRMRLDEVEAGVEWQPMDVLELVFAYSK
FT                   MKRTDVSTAPYPVVEGDLLRLQLQVNY"
FT   sig_peptide     complement(400556..400624)
FT                   /locus_tag="XCV0347"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(401235..401396)
FT                   /transl_table=11
FT                   /locus_tag="XCV0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21979.1"
FT                   /translation="MRRDPLEPGELRGASPHATSGDGRLVGVAACVGMISSALDQWHWF
FT                   RRSGVALL"
FT   CDS_pept        complement(401462..402340)
FT                   /transl_table=11
FT                   /locus_tag="XCV0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21980"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21980.1"
FT                   /translation="MTSTSPLILVTGASGQLGALVVEALLGHLPANRIVATARDTASLA
FT                   EFAKRDIAVRQADYANPQSLDTAFAGVGRVLLVSSNAVGQRVPQHRNVIEAARRAGVEL
FT                   LAYTSILHADTSTLSLAAEHVATEALLRESGVPHALLRNGWYTENYTGSIAAEVAHGAV
FT                   IGSAGDGKISAATRADYAAAAAAVLASDAPQAGQVYELAGDAAFTMAEYAAEVAQQSGK
FT                   PVAYHDLPEADYAAALVQIGLPAGFAQVLAQCSAASRDGALFDESQTLGRLIGRPTTPL
FT                   RDAVAAALAAR"
FT   CDS_pept        402408..402908
FT                   /transl_table=11
FT                   /locus_tag="XCV0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21981"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21981.1"
FT                   /translation="MSAPPRPPQGGSFAPPGYREIPHVNAIALFPLPPSLEGPFDATKC
FT                   PVRDVLDQIGDKWTLLILLTLIPGPSRFSAIQRAVPDISKRMLTQTLRNLERNGMITRK
FT                   VYATKPPSVEYALSKLGISLLGPVSQLLTWAGENHGSIRAARERFDRAQQAAVALDPDE
FT                   AMA"
FT   CDS_pept        complement(403102..403398)
FT                   /transl_table=11
FT                   /locus_tag="XCV0351"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21982"
FT                   /db_xref="GOA:Q3BYT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21982.1"
FT                   /translation="MLFRNRCMDKSQADAIAQAILQPDLEAREKIRRRRAAKDRAVAGR
FT                   RMVAWFSLSGFVIGAGVAHLTGYRFTDGIIWGGIAGGGVGWAALTLCRRRLAP"
FT   CDS_pept        complement(403869..404165)
FT                   /transl_table=11
FT                   /locus_tag="XCV0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21983"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21983.1"
FT                   /translation="MAAPAGVDRHLEIHFPFVRAFQVMDEGDMLEYWESPLTTGHLLYK
FT                   VISGGWRDRTAGHFLHVTASLDSMQEWLIVSECLCVSVLSAYVPHLREFGDAS"
FT   CDS_pept        complement(404289..404804)
FT                   /transl_table=11
FT                   /locus_tag="XCV0353"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21984"
FT                   /db_xref="GOA:Q3BYS9"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21984.1"
FT                   /translation="MHLDRKQRGVVLGMASGLFASLLVVFLLSRAFLRWDTPERTVISL
FT                   LLPAAAMFVAIARMAKHRFVTPADIDGSAMGDGTVRAKTLQSLLQNTTEQLAFALPVYV
FT                   AALMNPHRGIQAAVPACACAFLLGRLTFFATYSGGAGARALGFALTFYPTVLLLIWQLV
FT                   LLAVSVAG"
FT   misc_feature    complement(405127..406350)
FT                   /locus_tag="IS_Xac3_1"
FT                   /note="IS element Xac3"
FT   CDS_pept        complement(405132..405992)
FT                   /transl_table=11
FT                   /locus_tag="XCV0354"
FT                   /product="ISxac3 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21985"
FT                   /db_xref="GOA:Q3BYS8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21985.1"
FT                   /translation="MIERCRDEFPIRLMCRCLKVSASGYYEWSKRPASARQLDNERLVV
FT                   RMRELHEDSRGTLGAGRMREDLAEEGETASLNRVARLMAADGLQGWPRRKRRGQRGSPA
FT                   VTPPGVVNLLERDFLALEPETKWVTDITEIKTQQGKLYLCIVLDLYDQRIVGWSMHARQ
FT                   DRQMVIRAVQMAVWQRQGSDEVIVHSDRGSQFRSGDYQRYLTANGLICSMSAVGHCGDN
FT                   AACEGFFGLLKRERIYRTSYATLDGARADVFDYIERRHNPRMRRRAAKQDQKVAALLQP
FT                   SVISG"
FT   CDS_pept        complement(406001..406288)
FT                   /transl_table=11
FT                   /locus_tag="XCV0355"
FT                   /product="ISxac3 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21986"
FT                   /db_xref="GOA:Q3BYS7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21986.1"
FT                   /translation="MSKRRKFTAEFKRGAVEQASQPGVSCAQVARELGIRDTLLTRWKR
FT                   EAQTPGTAAFGGSGTPRDEELARLKRELARVKKERDFLREAATFFAKGSP"
FT   CDS_pept        406984..408033
FT                   /transl_table=11
FT                   /locus_tag="XCV0356"
FT                   /product="putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21987"
FT                   /db_xref="GOA:Q3BYS6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011946"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21987.1"
FT                   /translation="MTCRMATDSLGIDAGGVIRRLSRRMSYTREAAGAMTRLTPKLLDQ
FT                   VRGRLRLRHYSLRTEQAYVGWIRRFILANGKRHPGQMGQVEVEAFLTDLATRGQVSAGT
FT                   QNQALAALLFLYREVLGVELPWMENLVRAKRPRRIPVVLSAEEVARLLTMLEGSCRLMA
FT                   GLLYGSGMRLLECLRLRIKDVDVVRGEIVVRDGKGGKDRRVPPPHSLRGELMQQRERAL
FT                   LLHAADLAEGAGRVFLPHALARKYPNANVEPGWQYLFLAARRSVDPRSGRVGRHHVSEE
FT                   VLQRAVQSARRQAGIAKPATCHTLRHSFATHLLEAGHDIRTVQELLGHKDVTTKQIYAH
FT                   VLGRGASAV"
FT   CDS_pept        complement(408308..410146)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="XCV0357"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21988"
FT                   /db_xref="GOA:Q3BYS5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21988.1"
FT                   /translation="MPEYRSKTSTHGRNMAGARALWRATGMRDGDFHKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAREIERVGGVAKEFDTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMVNAHCADALVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTKLAEHKLDLI
FT                   DAMVIAADDSASDEKVAEFERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGTVVAT
FT                   HADREQLFLRAGRVAVELCHRWYGGEDPTALPRGIATFEAFENAMTLDIAMGGSTNTIL
FT                   HLLAAAQEGEVAFGMHDIDRLSKRVPQLCKVAPNTPKYHIEDVHRAGGIMAILGELARG
FT                   GLLHTNAATVHARTLAEAIAQWDVTQTDDETVHTFYKAGPAGIPTQIAFSQATRWDSLD
FT                   TDRSEGCIRDIAHAFSQEGGLAVLYGNIARDGCVVKTAGVDESIHVFEGTARVFESQDA
FT                   AVKGILADEVVAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLVRDGDRILIDIPKRSINLLISDEELALRRAEQDAKGWK
FT                   PVEVRPRKVTTALKAYALLATSADKGAVRDKALLDG"
FT   CDS_pept        410531..411892
FT                   /transl_table=11
FT                   /locus_tag="XCV0358"
FT                   /product="putative cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21989"
FT                   /db_xref="GOA:Q3BYS4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21989.1"
FT                   /translation="MSDHPSPRRAPAASSHSTTPPVAGGISRRRVLQGAAGAAVVATTG
FT                   WAGHAAAQSASLPFAGLNLSGLASNSYVENAEIGTHYRAITAQHVAAAGSCPLFRLPTT
FT                   AARFTRGQGAPLNESYCRQVQDALDNIAARGKRAIVELHDYMRLPQRVAAKSGYRRDAS
FT                   GAVVDARGNRVGDLAAAGLWADTYPLRNFNYVGYLDSRDQLLKLYEYRVIGTPGCTLYN
FT                   DAGLPDLWARLVNRFKQHPAVFGWGVMNEPYQGAERNADGSVLSMAAHWQKTATACSKA
FT                   IIDRDRNHFVFVCGNGYASARRWQDDSMGLFDIPDPYDCIVYEAHNYLDSDGSGGGNWI
FT                   GPGGRNEVIKPDTGIDMVSPFIEALQQAGKRGYLGEHGYPAGNRSAEIATTRMLAHLQA
FT                   YNIPSTQWCFGPGWPDDDVLGMSRDVGADIQTKANLAAVQAFFDVRLSSYVPPR"
FT   CDS_pept        411947..412207
FT                   /transl_table=11
FT                   /locus_tag="XCV0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21990"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21990.1"
FT                   /translation="MDIPCRAGCAACCIAPSISSAIPGMPHGKPAGVPCVQLDGQGRCR
FT                   LFGLPTRPAVCTSLRPSQDMCGASRAQALAMLTALEHATQP"
FT   CDS_pept        complement(412264..412809)
FT                   /transl_table=11
FT                   /locus_tag="XCV0360"
FT                   /product="putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21991"
FT                   /db_xref="GOA:Q3BYS2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21991.1"
FT                   /translation="MTPIRSFLHHTPQLGARVYVDSACTIIGEVSLGDDVSVWPGTVIR
FT                   GDVNHVQIGARTNVQDGTIIHVSHHSPFNKAGYPTVIGEDVTVGHGTILHACTIEDLCL
FT                   IGMGACVLDGATVKRYGFVGAGAVVGPGKVVGEAELWLGNPARLARTLSDKEIESLHYS
FT                   AQHYVRLKDQYLGASPAG"
FT   CDS_pept        complement(412820..413152)
FT                   /transl_table=11
FT                   /locus_tag="XCV0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21992"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21992.1"
FT                   /translation="MACDRLHTLAHCAAGSRPMTATLCAYRKCANTLGQRCDVFGCTAS
FT                   RAARGFGISGDATHSIARRPTRPPLPATSHTLHPCVGDCSPVRCRSGNRSAGIIRGVSA
FT                   VGGTLT"
FT   CDS_pept        413271..414581
FT                   /transl_table=11
FT                   /locus_tag="XCV0362"
FT                   /product="aromatic acid:H+ symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21993"
FT                   /db_xref="GOA:Q3BYS0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21993.1"
FT                   /translation="MPQHTASFGHFVLERMTPFQWRAVAVCVLLTMLDGFDVMAMAFTA
FT                   PHVSADWQLSGKLLGMLFSAGLIGMALGALGLAPLADRIGRRALTLACLAILTVGMGMS
FT                   AVASTAWQLGALRLLTGLGIGGMLACVAVTAGEFSSPRWRNTAIVLQVTGYPVGATLGG
FT                   MIAELLMQQWSWPAVFVLGAVASLLCVPLVLAFLPESLEFLIMRRPPDAVARFNAVLAR
FT                   MGMPPHDALPPLPPQSATQAQGYRALFDAAMRRHTLLIALGFFSLMFAFYFVISWTPKL
FT                   LVTAGASATDGVTGGVLLNLGGIGGGLLFSGLASCVRLARLTIGSLLLMGLAMLASGLC
FT                   STQLSWAFAVALLTGAAMFAAVGGMYAIVPIVFNAAVRSTALGWAIGVGRLGAILSPFC
FT                   AGVLLDAGWSPAMLYLACSVPLLLAIFAVLAMRLPNR"
FT   CDS_pept        414731..415978
FT                   /transl_table=11
FT                   /locus_tag="XCV0363"
FT                   /product="putative metal-dependent phosphohydrolase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21994"
FT                   /db_xref="GOA:Q3BYR9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21994.1"
FT                   /translation="MLRTIDSDQLRPGMYVYKLLGAWVHHPFWKTSFLVDSDDVEKIHD
FT                   SRIEQLVIDTARGLDVEAPAPPGVSAEPAAPPSPAPAASEPPEPAAAPRSVRTNSVTVQ
FT                   VGIEAEVVRARRIFEDGRDMVEAMFRDVRLGRTVDTEAAMPLVEAINDSVLRHPQALIS
FT                   VARLKTADDYTYLHSMAVAGLMSGLARQLGLPESQVVEAAMGGLLHDMGKAVTPLEILN
FT                   KPGRLTNDEMEIMRQHPLDGHRLLVAGGVQNAVVLEIALHHHEKMDGSGYPNQLVGENI
FT                   SLMSRMGAVCDVYDAISSDRPYKRGWDPAESLKQMASWKGHFDPVVFQAFVRRLGIYPV
FT                   GSLVRLESQKLAVVIEQTPDALLKPKVRVFYSAKLRSHVLVQDIDLSRPDCHDRIAQME
FT                   SPAEWGFRDLEKLWLP"
FT   CDS_pept        416361..416891
FT                   /transl_table=11
FT                   /locus_tag="XCV0364"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21995"
FT                   /db_xref="GOA:Q3BYR8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21995.1"
FT                   /translation="MRRIARTGPPAAPVARTAMPVTALAAPLPDAVTSVDQARLLRLLG
FT                   YRITRTELMVRRMFQECVAAFDLKPVDFSLLMLVDGNPGINQRQIGDVLHVSPPNLAIV
FT                   VARLVKRRLLRQVRGRQDRRMQHLSLTAAGAALLAAAEAEVLRMEQQLSAVLGSSEAPL
FT                   LRALDRLDRLDTP"
FT   CDS_pept        417066..418052
FT                   /transl_table=11
FT                   /locus_tag="XCV0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21996"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21996.1"
FT                   /translation="MRVWQQAGGCARCSAWRHAWQAGAAPAQNAPQSAALTNGINTGGT
FT                   SFLDGFTSTTPGLAVVTYLRHNALDAIKDARGNDIPVFDNPRIDSTVLLTQFAYVTPYH
FT                   VFGGALGITALVPLVNLDASFGRNSIATLRDNGAGVGDVTFGPYLQMPPVIRNGRPVFS
FT                   QRFEFDAVAPIGKYDGNRDLNQSSGYWSLIPSYAFTVLPTPNWELSARINYIYNFRSER
FT                   RPNLPPGFDFRNGQAGDAGWINFATSWEVAPKLRLGINAYYLTQFRDNRTNDQRVPDSR
FT                   QRAFYAGPGGVWRFDANNILFANVYLPVEVRNAASGNNVNFEYVHVF"
FT   CDS_pept        418086..418853
FT                   /transl_table=11
FT                   /locus_tag="XCV0366"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21997"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21997.1"
FT                   /translation="MNLQNKTIVVTGVASGIGAEVARLARFHGAKVIGVDRTPVQMTLH
FT                   GFHQADLGDPASIDALVKALPDHIDALANIAGVPGTAPLDVVARVNYLGLRHLTQGLLP
FT                   RIVLGGSIINVASILGAEWPQRLDLHKQLAATDSFESGRAWLAAHPVAHDTCYQYFKEA
FT                   LIVWTLLQSRPWFADHGVRVNNVSPGPVFTPILGDFAAMLGEERVKADAKRMTRPAYAD
FT                   EVAEGIVFLASDAARWINGITLPIDGGLASTTL"
FT   CDS_pept        418885..420366
FT                   /transl_table=11
FT                   /locus_tag="XCV0367"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21998"
FT                   /db_xref="GOA:Q3BYR5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21998.1"
FT                   /translation="MNALTSATAAATDSPAWHGCIFNGDWVPGRGGSVPIHEPATGALL
FT                   HEVGKADLADVAAAIAQAKQAQRAWAATPPRERAAVFHRAAQAMQARSAEATLLIARET
FT                   GGILPKAQREVDESVVFYQQAAAMPLQASGQMLPTASGQLSLARRLPLGVIGVISPFNF
FT                   PLILSLRSVAPALAMGNAVILKPDPRTPYTGGVIIAQVLEEAGLPKGLLHVLHGDAQIG
FT                   QALVESPDVPMIAFTGSTAAGRRIGEIAGRHLKKVSLELGGNNAVIVLDDADLDKAASA
FT                   VAFGAYMHQGQICMATGRVLVHRSVAQALTQRLAEKARHLPVGDPVSGIVALGPIIDQR
FT                   QLQRVVDIVNDSVAAGAVVEAGATHEGLFYAPTVLSNVRPGMRAFDEEVFGPVINITVF
FT                   DTGDDAAELANQGEYGLAAGILSASVSRALALGEKLHTGLLHINDQTVADEVVNPFGGA
FT                   GASGNGTSVGGPADWEQYTHWQWLTIKSEVPQYPF"
FT   CDS_pept        complement(420637..421548)
FT                   /transl_table=11
FT                   /gene="pobR"
FT                   /locus_tag="XCV0368"
FT                   /product="transcriptional regulator PobR, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ21999"
FT                   /db_xref="GOA:Q3BYR4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ21999.1"
FT                   /translation="MQSLDFSTMATSVPDTAAVPAFGLYGEQHADAAELLHWESIAARS
FT                   RLHDWQIVPHRHEDLAQLVYVQRGPATLQLDGRTQRLRGASVVWLPPLCVHGFAFDPAV
FT                   RGHVITMCMPLVRTALNAAPLLQQVMAAPAVVHAQHARKWLDVLFGSIAQDHARRSIGD
FT                   DLAAQAAAAQLVIWMARTALERARHAAAISPQADPALRHLRAYQGLIDQHYRAHWPISR
FT                   YADQLGLTPGHLNALCQRLAGASALQLLQRRIMLEARRTLRYTSLSVQQIAASLGFFDA
FT                   AYFSRYFARHAGCSPTRFRAGQ"
FT   CDS_pept        421621..422805
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="XCV0369"
FT                   /product="P-hydroxybenzoate hydroxylase"
FT                   /EC_number="1.14.13.2"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22000"
FT                   /db_xref="GOA:Q3BYR3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22000.1"
FT                   /translation="MRTQVAIIGAGPSGLLLGELLRLAGIDCVIVERQTPQHVLARIRA
FT                   GVLEQGSVELLQRAGVGERLQREGLLHHGFELSLDGQRERIDLLRGCGRGVTVYGQTEV
FT                   TADLMHARQRSGAPTHYNAQDVALCDVEGPTPAVEFTQDGQRRRLDCDYIVGCDGYHGV
FT                   SRASIPAERLRLFERVYPFGWLGVLADTPPVHEELVYARHRRGFALCSMRSPTRTRYYI
FT                   QVPASAQVEAWSDQAFWDELRARLPPALAAQLVTGTSIEKSIAPLRSFVAEPMQYGRLF
FT                   LAGDAAHIVPPTGAKGLNLALGDVGLLAQLFERWQTSGDAGVLEQYSTLALQRVWKAER
FT                   FSWWMTTLLHRFDDEDAFTARLHGAELDYLLGSEAGRATLAENYAGLPLAALSD"
FT   CDS_pept        complement(422827..423225)
FT                   /transl_table=11
FT                   /locus_tag="XCV0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22001"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22001.1"
FT                   /translation="MAVRSSGTPATCPLSGGKTRVRTAALTRHRHPTGAVHRPASRLSM
FT                   HLGTCATVGEKNITHVVSGSVLLHRVQNGHGCRGRADDDRSGSNACALTRIIQAGLGKR
FT                   CCAHASHLRSQGDIEPRCPPRNPLRGVC"
FT   CDS_pept        423246..423758
FT                   /transl_table=11
FT                   /locus_tag="XCV0371"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22002"
FT                   /db_xref="GOA:Q3BYR1"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22002.1"
FT                   /translation="MKKLLSRALLLVMLVAPMAAFAQTAVTANPNHQKMLLGSTWYETA
FT                   NKRLVYDFWRTVFEAGQVQYAPMYMDKNYIQHNPNVANGRDAFIAFLTAFVKPTPVQPR
FT                   VRLPLVAITADGDLVTLVSVRTLPNPNKPGTTYTTTWFDMFRIEKGLIKEHWDPDTIAG
FT                   RASTGGQ"
FT   sig_peptide     423246..423311
FT                   /locus_tag="XCV0371"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(423874..425373)
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="XCV0372"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22003"
FT                   /db_xref="GOA:Q3BYR0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22003.1"
FT                   /translation="MEKQYVLAIDQGTTSSRAMLFDRQGKVAGVAQREFGQIFPQPGWV
FT                   EHNPREIMTSVYTTITELLNNAQIDARAIAGIGITNQRETAVVWDKATGQPIYNAIVWQ
FT                   SRQTKDICTQLKEAGHEQMVREKTGLLIDAYFSGTKVKWILDHVEGARERAQKGELAFG
FT                   TIDSWLIWNLTGGKVHVTDYTNASRTMMFNIHTLEWDAELLAMLDVPAQMLPDVRSSSE
FT                   IYGMTQTQYFYGEQVPIAGIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMNTGDKAVA
FT                   SKAGLLTTIAWGIDGKVEYALEGAIFVAGSVVQWLRDGLRMLGKASDSQAYAERAGDND
FT                   GVYIVPAFVGLGAPYWRSDIRGAVFGLTRGTTKEHFVRAAVESMAYQTRDVLTAMQSDS
FT                   GIELKELRADGGAIANDFMAQFQSDILNVPVLRPEVAETTALGAAYLAGLATGFWGSRE
FT                   EIAKQWAVDRRFEPAMADDKRQGLYAGWQQAVEATMGFRIS"
FT   CDS_pept        complement(425513..426334)
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="XCV0373"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22004"
FT                   /db_xref="GOA:Q3BYQ9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22004.1"
FT                   /translation="MSRQLVGELISEAVAMFIIIALGDSVAAMYILYDPSPYQNAYWGV
FT                   CIAWGLAVTLAIYVTGSVSGTHANPAVTLALALFRGFSWKKVLPYWFAQVVGAFLGAAI
FT                   VYQLYGPVIDHFNQVQQLTREAGGAAGVFFTAPGLAVTPMHALVDQIIITAFLIFGIFA
FT                   ITEQFNEAAPTANSGALMIGLLVATLGASMGYLEAWAMNPARDFGPRLLAYFAGWGEAA
FT                   LPAKDNYWWIPIVGPLIGGPIGALAYQWLILPFLPARVRHLQGGSKPLDPL"
FT   CDS_pept        complement(426776..428290)
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="XCV0374"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22005"
FT                   /db_xref="GOA:Q3BYQ8"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22005.1"
FT                   /translation="MGEMYDLLVIGGGINGVGIARDAAGRGLSVCLCEQDDLAAHTSSA
FT                   STKLIHGGLRYLEQYEFALVGKALAEREVLLRLAPHIIWPLRFLLPHQPHLRPAWMIRA
FT                   GLFLYDHLGGSKRSLPRSRRLSLRTHPVGAPLQESLRTGFVYSDAWVQDARLVVLNAMD
FT                   AARRGAKIHTRTRCVGAWHDAGFWYAELEDREGRRRTVQARALANAAGPWAVAFLDTVA
FT                   SVPHEHALRLVKGSHIVVPKLFDHDHAYIFQQPDRRIVFAIPYEHDFTLIGTTDVDYEA
FT                   DPAAPKIDAAEVQYLCDAVNLYFQQQISPADVVWNYSGVRPLLDDAEDNAAEVTRDYQL
FT                   EVVTEGAPLLNVFGGKLTTYRKLAEEAVDRLTHALGARKPAWTARGEALPGGEQRDIAS
FT                   LLERVGRGRPWLPAATAQRLVRNYGTCAEQLLGDAQSLADLGTHFGADLYQAEVDYLRQ
FT                   HEWAVAADDILWRRSKLGLRIDAAGRQRLEDYLQTQSIRQRDAVSA"
FT   CDS_pept        complement(428514..429476)
FT                   /transl_table=11
FT                   /gene="glpR"
FT                   /locus_tag="XCV0375"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22006"
FT                   /db_xref="GOA:Q3BYQ7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22006.1"
FT                   /translation="MPPEPCSLSAARPACRHACTASGRCSPASPCRAQRAPRRVCILTR
FT                   MRDHLRMESTHYRTVPAPALNPRQEQLVALVRQQGFAEVEGLATRFEVTPQTIRRDLTL
FT                   LCDAGVLRRYHGGVSMPSSVENLAYTARKALQAREKQHIAARVARFIPDDASLFINLGT
FT                   TNEEVARALLQHRGLRVITNNLNVAVMLSANPSFEVIVAGGVVRGRDQGVTGEATVELI
FT                   RQFKVDFGVIGISGIDLDGTLLDFDYQEVRVAQAIIEHSRHVLLAADHSKFGRNAMVRL
FT                   GALAQVHDWFTDRPPPQELASVLAEAGTRVHLADADGTA"
FT   CDS_pept        complement(429684..430667)
FT                   /transl_table=11
FT                   /locus_tag="XCV0376"
FT                   /product="putative vanillate o-demethylase oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22007"
FT                   /db_xref="GOA:Q3BYQ6"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22007.1"
FT                   /translation="MRKDTQWHRARVVSIADACPGVREIVLDPGAAARSFEVGSHVDFR
FT                   VQLHGRDDVRSYSLVGEPRADGYYQIAVRQMPDSRGGSLHMWTLAPGDVVEMSPPSNNF
FT                   ALDESGEEILLIAGGIGITPIVGMAQRLARGHRAFRLLYAGRSRSAMAYVDTLEALLGE
FT                   RLQLQCDDSAGPPDLAAELARLSPNAEVYVCGPLGMLEAVRQHWHAAGRPRARLHFETF
FT                   GNSGRVPAQAFVVKLPGLGLEVPVAENESMLDALADAGVELIAECRRGECGLCAVDVLD
FT                   SSADIDHRDVFFSDEQRRENRKLCACVSRAVGGSISIDTGYRSKLG"
FT   CDS_pept        complement(430768..431844)
FT                   /transl_table=11
FT                   /locus_tag="XCV0377"
FT                   /product="putative vanillate O-demethylase oxygenase
FT                   subunit"
FT                   /EC_number="1.14.13.82"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22008"
FT                   /db_xref="GOA:Q3BYQ5"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22008.1"
FT                   /translation="MSQSKPLFPLNAWYAVAWDHEIKHVLSPRKLCNLDVVVYRTTAGA
FT                   VVALEDACWHRLVPLSMGKLRGDDVVCGYHGLVYNTQGRCVHMPSQDTINPSACVRSFP
FT                   VAEKHRYVWIWPGDPAKADTRLIPDLHWSHDPAWAGDGRTIHAKCDYRLVLDNLMDLTH
FT                   ETFVHGSSIGQDEVAEAPFDVVHGDRGVIVSRWMRNIDPPPFWASQIARHLDYRGKVDR
FT                   WQIIRFEAPSTIAIDVGVAIAGTGAPEGDRSQGVNGYVLNTITPETDTTCHYFWAFMRN
FT                   YALHDQSLTTLTRDGVTGVFGEDEAVLEAQQRAIDAHPDHTFYNLNVDAGGMWARRVID
FT                   RLIAQEQRAQDLSLRMVG"
FT   CDS_pept        432096..432959
FT                   /transl_table=11
FT                   /gene="gctA"
FT                   /locus_tag="XCV0378"
FT                   /product="glutaconate CoA transferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22009"
FT                   /db_xref="GOA:Q3BYQ4"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22009.1"
FT                   /translation="MAEIVALADAVSQLIADGDCVAMEGFTHLIPHAAGHEVIRQRKRA
FT                   LRLVRMTPDLIYDQLIGAGCAAALRFSWGGNPGVGSLHRLRDAVEHAWPQPLQIREHSH
FT                   ADMANAYVAGASGLPFAVLRGYVGSDLPRVNDSIKFLQCPYTGQTLATTPAVNPDVAVI
FT                   HAQRADRRGNVLLWGILGVQKEAALAARKVIVTVEEIVDSLDAPPNACILPRWVVDAVC
FT                   VVPSGAAPSYAHGYYARDNRFYLAWDAIARNRATFQAWIQTHILDTDDFAGFQRVYAQS
FT                   QQQVAA"
FT   CDS_pept        432956..433744
FT                   /transl_table=11
FT                   /gene="gctB"
FT                   /locus_tag="XCV0379"
FT                   /product="glutaconate CoA transferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22010"
FT                   /db_xref="GOA:Q3BYQ3"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22010.1"
FT                   /translation="MSAYSTNEMMTVAAARRLPDGAVCFVGIGLPSTAANLARLTHAPD
FT                   VTLIYESGPIGARPQVLPLSIGDGELAETAATVVSTPEIFRYWLQGGRVDVGFLGAAQI
FT                   DRYANLNTTVIGSYAAPKTRLPGAGGAPEIAASAKRVFIIMRQSERSFVSRLDFITTVG
FT                   HLDGGDARARAGLPGAGPTVVVTDLCVMEPDPVTRELTVTSLHPGATREQVSAATGWPI
FT                   RFAADLAQTTPPSTAELDALRALQARTDAAHGVQAMGAQA"
FT   CDS_pept        433741..434949
FT                   /transl_table=11
FT                   /gene="pcaF"
FT                   /locus_tag="XCV0380"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22011"
FT                   /db_xref="GOA:Q3BYQ2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22011.1"
FT                   /translation="MSEVYLIDGIRTPIGRYGGALSSVRADDLGAVPIAALLARQSQLE
FT                   PASIDDVYLGCANQAGEDNRNVARMSLLLAGLPSSVPGSTLNRLCGSGLDAIGTVARGI
FT                   RAGELDLAIAGGVESMSRAPWVMGKADSAFARTQQLEDTTMGWRFINPRLQAVYGTELM
FT                   GETAENVAQRYAIAREDQDAFALRSQQRVAAAQAAGFFDAEITPVAVAARKGGDASTVK
FT                   HDEAPRPNTTADMLAKLKPVFRQPGTVTAGNASGLNDGAAALLLASAQAVQTHRLTPRA
FT                   RVLGFASAGVEPAYMGIGPVPATQRLLARLHLRIAQFDAIELNEAFAAQALACTRALGL
FT                   ADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLEAGNGRLGLASMCIGVGQGVALAI
FT                   ERL"
FT   CDS_pept        435028..435762
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="XCV0381"
FT                   /product="protocatechuate 3,4-dioxygenase beta chain"
FT                   /EC_number="1.13.11.3"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22012"
FT                   /db_xref="GOA:Q3BYQ1"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22012.1"
FT                   /translation="MRDPTADQPAIADPLLGYRRSRPGTQPAYLHPAYASTTLRGPTRD
FT                   PIDLPVTLSEVTGPRLDRLTLGAHAADLTAGFSGAPLGERIIVSGRVLDENGRPVRNSV
FT                   VEVWQCNAAGRYQHAGDRHDAPLDPNFRGTGQVLTDEHGRYSFKTIKPGAYPWRNHYNA
FT                   WRPAHIHFSLHGDGIGQRLVTQMYFPGDPLLAHDPIFNCVDDALARERMVSSFDWENAV
FT                   SEYALAYRFDIVLRGRKQTVWE"
FT   CDS_pept        435767..436330
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="XCV0382"
FT                   /product="protocatechuate 3,4-dioxygenase alpha chain"
FT                   /EC_number="1.13.11.3"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22013"
FT                   /db_xref="GOA:Q3BYQ0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22013.1"
FT                   /translation="MSLHATPSQTVGPYYRLGLEPLYRQQIAPAQAAGTHVQISGCIFD
FT                   GAGAPVADAVLEVWQADAAGIYAHVADGRCEAHDPSFDGWGRVPTDANGRFTFSTIKPG
FT                   RVAGPDGKQQAAHLTVLVFMRGLLRGVSTRLYFADDPQLGSDPILALVPAERRATLLAQ
FT                   PHPGSAYTWDIHMQGDAETVFFRY"
FT   CDS_pept        436658..438040
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="XCV0383"
FT                   /product="putative 3-carboxy-cis,cis-muconate
FT                   cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22014"
FT                   /db_xref="GOA:Q3BYP9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22014.1"
FT                   /translation="MLPARLEMQCMSATSSLLGSLFGEPACEALFDDAARVQAMLQFES
FT                   ALARAQAQCGVIPAQAAQAIAAACDVQHYDLAALAQATALAGNPAIPLVKALTAQVAAH
FT                   DNAAARWVHWGATSQDVIDTGTVLQLRAALDLLLPRLHALCADLAVLAERERHTGLPGR
FT                   TLLQQAVPVTFGLKVVGWLDALQRAQRRLHALRHDALVLQFGGAAGTLASLQGRGLEVA
FT                   QALASALALPLPALPWHTARDRIVEVGCAFGLLAGTLGKIGGDVVLLMQTEVGEAFEPA
FT                   AAGKGGSSAMPHKRNPVSSVAAVAAATRVPGLVATLFSAMAQPHERAAGQWHAEWDTLP
FT                   QIVCLTAGSLAQMQLCLSGLELDRPRMQAHLDSHGGLLYAEAAVFALAPHLGKPQAHAL
FT                   VEQAALRAQAQQRHLREVLGEHAQVSAVLTHAQLQAVFDSASWRGMSSVWIDRVLAGSS
FT                   SC"
FT   CDS_pept        438051..438833
FT                   /transl_table=11
FT                   /locus_tag="XCV0384"
FT                   /product="putative 3-oxoadipate enol-lactonase"
FT                   /EC_number="3.1.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22015"
FT                   /db_xref="GOA:Q3BYP8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22015.1"
FT                   /translation="MAYLQLPTHRLHYRLDGTEGRPWLTFCNSLGTDLHMWDVQLEAFA
FT                   AHYRILRYDRRGHGYSETPPGPYSVADLGQDVLALWDALEIAQSDFCGLSIGGLTGQWL
FT                   GLHAPQRLRRLVVCATAQKIGSAATWETRIEQVRSEGLPTLIDATLQRWFTPEFAISHA
FT                   QRLDMIAAAFVSTSPAGYIACCQAVADADFRGALDGLSLPLLALAGDDDPVCPPPDLRE
FT                   IAYAAPDGHYAQVPGRHICNLESPAAFNQAVLGFLQGQ"
FT   CDS_pept        438860..439273
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="XCV0385"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22016"
FT                   /db_xref="GOA:Q3BYP7"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22016.1"
FT                   /translation="MHEDERYQAGMRERRRVLGDAHVDRALAGSSEFTEEFQDLITRYA
FT                   WGSIWTRDGLPAHTRSLITLSMMIALGHDEEFKLHVRAARNNGVTPAQIKEVLLQAAIY
FT                   CGVPAANHAFALARPILEEQAADAGAASAAQPR"
FT   CDS_pept        439454..440380
FT                   /transl_table=11
FT                   /locus_tag="XCV0386"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22017"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22017.1"
FT                   /translation="MLHRLVCLLVVSLATAALHAQPQPGPGTVSARVRTDDGQTLAVWS
FT                   RVPAQPRGTIVLVHGRTWSALPNFDLQVPGEPRDARSVLAALAQAGFAAYAVDLRGYGG
FT                   SPRDRTGWNTPARAVADVRNVLAWVAQTHPGLPPPALLGYSNGARVALLLAQQQPQAMS
FT                   ALVLFGFPDDVDAAPAPAVPADRPLRAPTTAAAAGEDFITANAAPPGVRAAYVAQALAA
FT                   DPVRTDWRAMEQFAFHPEQVATVPVLLLRGVDDPIATQADNAHLYARLRSEDRSWVTLP
FT                   HADHVAQVEDSHAAWVDAVVSFLRRPR"
FT   sig_peptide     439454..439513
FT                   /locus_tag="XCV0386"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(440741..441649)
FT                   /transl_table=11
FT                   /gene="pcaR"
FT                   /locus_tag="XCV0387"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22018"
FT                   /db_xref="GOA:Q3BYP5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22018.1"
FT                   /translation="MARALTMHGPVRCRTPMPEPASSRRKRPATVVAAGSDRGLPHELM
FT                   QQIAAAQGDPDFMTSLGRGLVVLSVFAQHAREVTMSQISLETGISRAAVRRVLHTLAKL
FT                   GYVGEQGRGYVLLPRVLGIGGAYAASSSMTAAAQPVLDGLRDQLHESCSLGVLDGDDLL
FT                   YVARSETVRIMSIGLRPGTRLPAYCTSMGRVLLAALPGDTLQAYLERTTLRPRTDRTVT
FT                   QASALLEVLARTRREGMCLTDQELEIGLRSIAVPVRNLRGEVIAALNIGAQAGRVSLQT
FT                   MQTQLLEPLKQAAQRLGTLLS"
FT   CDS_pept        441750..442610
FT                   /transl_table=11
FT                   /locus_tag="XCV0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22019"
FT                   /db_xref="GOA:Q3BYP4"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22019.1"
FT                   /translation="MKTPNGLQPLIDDGVIDEVLRPLKSGKEASVYVVSAGAEILCAKV
FT                   YKDMAQRSFQARVQYQEGRKVRGSRQARAMGKATKFGRKEAETAWKNTEADALYQLVDA
FT                   GVHVPKPRGYFHGVLLMDLVTDDAGHSAPRLGEVDLEPEQARAFHTSLIGDVVKMLSLG
FT                   LVHGDLSEYNVLVSPDGPVVIDFPQVVSAAGNNAARDMLLRDVHNLRDCLGRFAPELLD
FT                   THYGEEMWALFEKGELRPDSVLTGRFKFDTRRADVRAVRASIEDARQENLIRQQGREAA
FT                   AEDND"
FT   CDS_pept        442865..443833
FT                   /transl_table=11
FT                   /locus_tag="XCV0389"
FT                   /product="esterase/lipase/thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22020"
FT                   /db_xref="GOA:Q3BYP3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22020.1"
FT                   /translation="MSFDPDVVRLFAQLQEAAQPPMETLPIEGARAMMRAVGAQFGFPR
FT                   IEMAEVRDLQAEAATGAVPLRLYRPTGLAAGPAPTCLFVHGGGGLVGDLESHDDVCRQL
FT                   AARAGCQVLAIHYRLAPEHPAPAGVEDVIATLHWLVAHPDTVGADVQRLAVCGDSIGGA
FT                   MAAVAALAARDAGIALRCQLLVYPLTDARQDSGVYPSRSLNAGLPPLTAAAVEFFNRHL
FT                   LPDMAVANDWRVSPMLAPDVAGVAPALVVVCDRDMLYDEGRAYAERLRAAGMEVTLHSF
FT                   PGMIHGFINMGSVLRAAGETLDLAALTLRQRLLPAIERRAA"
FT   CDS_pept        complement(444132..444812)
FT                   /transl_table=11
FT                   /locus_tag="XCV0390"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22021"
FT                   /db_xref="InterPro:IPR019619"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22021.1"
FT                   /translation="MFRSACALLLLTLACSWPAHARTEEDGRYWLSVYAQGKLPVENLY
FT                   WSMDVHPRWREEGEQFDQLILRPAVFYRLNPKASVWMGYDTIISHPAGQPSNRENRWWG
FT                   QFQYQFDPIAEITVTSRTRLEQRHREGFSDEGYRVRQMIRAVRPSGFSPQLSWVAFNEV
FT                   FVNLDQTRWGAQRGLDQNRVFVGINWKFNAIANADVGYLNQFVNTRTVDRENHVLMTTF
FT                   RFNF"
FT   sig_peptide     complement(444750..444812)
FT                   /locus_tag="XCV0390"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(445051..446955)
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="XCV0391"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22022"
FT                   /db_xref="GOA:Q3BYP1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22022.1"
FT                   /translation="MSDSFYRYDVIVIGGGHAGTEAALASARTGARTLLLTHNIETVGA
FT                   MSCNPAIGGIGKGHLVKEIDGLGGAMARAADLAGIQWRTLNASKGPAVRATRCQADRNL
FT                   YRTAIRCIVEAQPNLTVFQAAVDDLIIHNGTSEADSVRGVITQTGLRFQAPSVVLTAGT
FT                   FLAGKIHVGETQYAAGRMGDPPATTLAARLRERPFAIDRLKTGTPPRIDGRTLDYGVMA
FT                   EQPGDDPLPVMSFMGQVSDHPRQVSCWITQTTEQTHEIIRNALHRSPLYSGQIEGIGPR
FT                   YCPSIEDKVVRFAEKTSHQIFVEPEGLEVAEIYPNGISTSLPFDVQLALVRSIHGFANA
FT                   HITRPGYAIEYDFFDPRGLKASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAAR
FT                   HVQGLPAWSPRRDEAYLGVLVDDLITHGTTEPYRMFTSRAEYRLQLREDNADARLTGVG
FT                   RAMGLVDDARWARFAAKQEAVQRETTRLSALWATPGNALGREVAGALGVTVSRETNVLD
FT                   LIKRPELTYATLMRVPTLGPGVDDAQVAEQVEISVKYAGYLDRQRDDIARQQRHETTPI
FT                   PEGFDYASVRGLSIEVQQKLERVRPQHIGQAQRIPGMTPAAISLLLVHLERARRSQVA"
FT   CDS_pept        complement(447217..447393)
FT                   /transl_table=11
FT                   /locus_tag="XCV0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22023"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22023.1"
FT                   /translation="MSMSDREIWIPPVPALSDIGAYNTESPGMPGLSVFVSMVAKQAAA
FT                   ERARAPFRRNLKK"
FT   CDS_pept        complement(447526..448008)
FT                   /transl_table=11
FT                   /locus_tag="XCV0393"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22024"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22024.1"
FT                   /translation="MKFRLIFAAGLLALGGCATYDYTGGGSGGYYRGAPAVQYRYPPGY
FT                   SPYFYGNPYGLPYGYGAGSIGLYDYPVYPVYPVYRGGGGYYYRQYDRRPQYRPPRPNGS
FT                   FNNGQRPGGSRPQQPNRPPANGAPPSRPPPRIGAPPRVIREIQRQTAPRNTREQIP"
FT   sig_peptide     complement(447940..448008)
FT                   /locus_tag="XCV0393"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        448166..449125
FT                   /transl_table=11
FT                   /locus_tag="XCV0394"
FT                   /product="threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22025"
FT                   /db_xref="GOA:Q3BYN8"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22025.1"
FT                   /translation="MIETVPLAHSDVLQAAARIAPHCAPTPLLTSHSLDALSSAQLFFK
FT                   AEHLQRSGAFKFRGACNAVWSLPDELAAHGVVTHSSGNHGAALALAARTRGIGCHVVVP
FT                   EGAVAAKLANISRNGATLWRCAPTIAAREQMCAEVQAGSGAKLVHPYTDRAVIAGQGTA
FT                   TLELLHQSGGLDVLVAPVGGGGLAAGAALALQSSPDCELVLAEPAGAADTARSLAAGQR
FT                   LVDFVPDTICDGLRGTLGAPNFAVLQRAGAQVITVDDAAVVQAMRLVWQLLKQVVEPSS
FT                   AIALAAVLAQPARFAGRRVGLILSGGNVDLDALPWAAA"
FT   CDS_pept        449176..449727
FT                   /transl_table=11
FT                   /locus_tag="XCV0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22026"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22026.1"
FT                   /translation="MLALIWLVAVAGWIVWIGDRDQAAPADVIIVLGAAAYDARPSPVF
FT                   EERIRHALDLYAQGYAPRLLFTGGFGNGARFAESQVARRYALRHGIPPEAIVIETTSRT
FT                   TRQNLEQARTLMERHGLHRAIIVSDPLHMARALRLSQELGIDALASSTPSTRFRSFHTS
FT                   WRFLLQEVYYFHRDLVVQGP"
FT   CDS_pept        449771..450190
FT                   /transl_table=11
FT                   /locus_tag="XCV0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22027"
FT                   /db_xref="InterPro:IPR011721"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22027.1"
FT                   /translation="MSETHRQHAIGLVQAYYAAFNRGDWDGMLAFLAEDVAHDLNQGPR
FT                   EIGRNAFAAFLQRMNDSYREQLRDVVVIANDDGTRVGAEYVVHGVYHTTDEGLPEANGQ
FT                   TYVLVGGAFFDVRGDTITRVTNYYNLQEWIAQVSR"
FT   CDS_pept        complement(450292..451197)
FT                   /transl_table=11
FT                   /gene="aspH"
FT                   /locus_tag="XCV0397"
FT                   /product="peptide-aspartate beta-dioxygenase"
FT                   /EC_number="1.14.11.16"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22028"
FT                   /db_xref="GOA:Q3BYN5"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22028.1"
FT                   /translation="MLKWLLIALFIASALYIHYRGRVRHRLSRQLLDHSTFMAPINTLM
FT                   YLCSRVPTTPFIDPGKEFPELAPLRASWPLIRDEAVALQQMQKIRAAEGYTDIGFNSFF
FT                   RRGWKRFYLKWYGTAHPSAAELCPQTTALLKSIPTVKAAMFAELPPGSELRPHRDPFAG
FT                   SMRLHLGLATPNDDRCFIDVDGQRHSWRDGEWTMFDETYIHYARNDTDQDRIILFCDIE
FT                   RPMRWRWAAAVNRFVGRSLLSAGASPNQEGDKTGGINRVFRYFYAARLKAKALKERNNP
FT                   LYQVLKWSIFILVVVGIVLL"
FT   CDS_pept        complement(451447..452331)
FT                   /transl_table=11
FT                   /gene="bioC"
FT                   /locus_tag="XCV0398"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22029"
FT                   /db_xref="GOA:Q3BYN4"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22029.1"
FT                   /translation="MTSTFDPRHVRRAFARAASTYTAAAALQREAEARLLESLDYLGEH
FT                   VPKVVLDVGAGPGHASAAIKKRWPKAQVIALDQAMPMLRQARKAAGWWKPFTQVCADAR
FT                   ALPVADGSVDVIFSNLCLQWVEDLPAVFAGFRRALRPGGLLLCSTFGPETLIELREAFA
FT                   QTDPAPHVSRFPPIAQFGDALLMSGFRDPVLDRDLFTLTYNDLPALMRELRAMGATNAL
FT                   SNRRATLTGRGRFAAASAAYEPLRRPDGTLPSSWEVIYAHAWAPAPGAPIREHGHEVAS
FT                   VPVSAIPIRRRID"
FT   CDS_pept        complement(452395..453177)
FT                   /transl_table=11
FT                   /locus_tag="XCV0399"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22030"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22030.1"
FT                   /translation="MDLGIAGRWALVCAASKGLGLGCARALAGEGANVVIAARGREALE
FT                   HAADALRALPGAGQVRSVVADIATPEGRSAALAACPQVDILINNAGGPPPGDFRQWERA
FT                   DWLRALDANMLAPIELIRATVDGMRARRFGRIVNITSSAVKAPIDILGLSNGARAGLTG
FT                   FVAGLARSTVADNVTINNLLPGQFVTDRLRGNFAAIAQQQGSSADEVAERKRAGIPAAR
FT                   FGEPDEFGAACAFLCSAQAGYITGQNLLIDGGSYPGTF"
FT   CDS_pept        complement(453223..454152)
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="XCV0400"
FT                   /product="biotin biosynthesis protein BioH"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22031"
FT                   /db_xref="GOA:Q3BYN2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22031.1"
FT                   /translation="MRARNGHCWLQRSSHCVQPPRIDSQALHPTSDLRASNDQRASHDA
FT                   CRHATIGDNARMHIDVIGHGPALVLLHGWALHGGVFAPLVDRLAPHYQLHLVDLPGHGF
FT                   SRDDSTPLALPYVVAEIAAATPPAVWLGWSLGGLFALHAAATLRQVRGLAMIAATPRFV
FT                   RGNDWPSAVQREVFVQFGIELSRDYRGTLERFLALDTLGSAHARSELRSLRETLTARGE
FT                   PAPEALQQGLALLERTDLRRAVPQLARPSLWIAGQRDRLVPAAGMHATAALSPHAQALT
FT                   IAGGGHAPFLGHADQVSEALQRFVASVP"
FT   CDS_pept        complement(454085..454459)
FT                   /transl_table=11
FT                   /locus_tag="XCV0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22032.1"
FT                   /translation="MPLATPGTDTVAQRRVWEALSRLYLDSDSCDDDGIARVLAASPFT
FT                   LDQLRTMLLYEVHPVLIGNLRSVAGVWDGFDPDWLAAAIQARRARRRHWPARWHWCGHA
FT                   RAQWALLAPKIVALRAAATH"
FT   CDS_pept        complement(454651..456024)
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="XCV0402"
FT                   /product="8-amino-7-oxononanoate synthase BioF"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22033"
FT                   /db_xref="GOA:Q3BYN0"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22033.1"
FT                   /translation="MRPSTIIPAPSMRRSPAARPASTPPDPAPGTGRRWRLGAPSPARY
FT                   ASGPSLPLNAPMARPDLHERISSLRKLRVAQERVRVRRQVGRRDGVRLEIDGRWLTGFC
FT                   SNDYLGLSQQFEVVAALQDAAARDGAGATASHLICGHHTAHETLEREIADWLGYPSALL
FT                   FGSGFIANLAVQQALLSEEDDVCVQDRLNHASLLDATRLAGCRLRRYPHLDVEGAMRQL
FT                   KGAPEGAAMLATDGVFSMDGDVAPLRALSLVARMQHALFYVDDAHGVGVLGPQGRGCVA
FT                   DAGLGVAEVPLQLVTLGKALGGYGAVVVGEEALVRHLAETARPYIYTTALPPAQVAATL
FT                   AAVRLARRDDWRRTRLVELIGAFRDGARKHGFELMASDTPIQPLLCGEEATVMAMSAAL
FT                   EHAGFMVGAIRPPTVPEGKARLRVTLSALHTPQQVQALIEAIVQARDVVSRQPLRASA"
FT   CDS_pept        complement(455948..456982)
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="XCV0403"
FT                   /product="biotin synthase BioB"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22034"
FT                   /db_xref="GOA:Q3BYM9"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22034.1"
FT                   /translation="MSVVVRHDWDRKELQALFDLPFPELLHRAASVHRAHFDPAQVQVS
FT                   TLLSVKTGGCPEDCAYCPQAQRYDTGVSAQKLMETEEVVAKARQAKAAGASRFCMGAAW
FT                   RSPKERDIPKVAAMIREVKAMGLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYY
FT                   DSIIHTRQYQDRLNTLEHVRDVGLKTCCGGIVGMGETREHRVGLLLALATLPAHPDSVP
FT                   INQLVQVPGTPLHGTQQLDPFEFVRMIAVARIAMPKSMVRLSAGREAMSDELQALCFLA
FT                   GANSIFYGEKLLTTGNPDTERDQALFQRLGLRPMQITVDAAEHDHPGTVHAEITRSAAC
FT                   EHAA"
FT   CDS_pept        457032..457757
FT                   /transl_table=11
FT                   /locus_tag="XCV0404"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22035"
FT                   /db_xref="GOA:Q3BYM8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22035.1"
FT                   /translation="MEEAVNFNQVRSVYRWPQRVLRLLLPSLCLVCAEAGTPDGDLCPA
FT                   CRAALPDHGHACLCCATQLFVSDAVALCGQCLQHPSPLQRVHACFTYRWPVDGLLRRFK
FT                   FHQDLAAGRLLSELMARRCVGLPRPQALVPVSLHRQRLRQRGYDQALELARPLGRALQL
FT                   PCLPLLRRVRATAPQSELDAVERQRNLRDAFEARGALPAHVALVDDVMTTGATLHAAAK
FT                   ALRKAGVQRVDAWVCARVP"
FT   CDS_pept        complement(458096..459001)
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="XCV0405"
FT                   /product="4-hydroxybenzoate octaprenyltransferase UbiA"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22036"
FT                   /db_xref="GOA:Q3BYM7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22036.1"
FT                   /translation="MSKHGVEQLPAARALTWPQRLGQYWKLVRGDRPIGSLLLLWPTWW
FT                   ALWLAADGLPPLWTLLVFTAGVWLTRSAGCVINDYADRWLDPHVERTKSRPLATGAVSG
FT                   REALWVFVVLMLVAFALVLTLNWLTVALSVPGVFLAASYPYLKRHTHLPQVYLGMAFGW
FT                   GIPMAFAAVQGRVPLLGWLLYAANILWATAYDTWYAMVDRDDDIRMGSKSTAILFGRFD
FT                   LIAQGILYALMAATLVLVGLRADLGVAYWAGLAVAALLVAYEFRIARHRERGPCFRAFL
FT                   HNNWVGLAIFVGIAVAVAGR"
FT   CDS_pept        complement(459108..459392)
FT                   /transl_table=11
FT                   /locus_tag="XCV0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22037"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22037.1"
FT                   /translation="MQRHRPLGPGSRRATPDAQVQAHRVQTCSGVAISSGRRQRQPAQR
FT                   PHLTVSLGTRLSAVTAEPAWQPHHLPQPTRANARPWPLATLIAAASRTP"
FT   tRNA            459479..459555
FT                   /gene="tRNA-Arg"
FT                   /locus_tag="XCV_tRNA01"
FT                   /product="transfer RNA-Arg"
FT   CDS_pept        complement(459721..459909)
FT                   /transl_table=11
FT                   /locus_tag="XCV0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22038"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22038.1"
FT                   /translation="MLMMLIAEPGGCLPAASMQSLSAVCNQPSGSGLFARVAQTAEATH
FT                   IQDAALVAAVAAFHEAA"
FT   CDS_pept        complement(459955..461253)
FT                   /transl_table=11
FT                   /gene="hpaG"
FT                   /locus_tag="XCV0408"
FT                   /product="HpaG LRR protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22039"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYM4"
FT                   /protein_id="CAJ22039.1"
FT                   /translation="MVPLDELPADLGRMQGLRNLSLGGGHYARLPARIVELSRLSELRM
FT                   SHSSHFRQLPENIGLMQGLRSLEVASNSKLEQLPGSLTQLHRLEKLDLSSNRRLAHLPE
FT                   DIGQLRGLTELSLRSCTALQQLPDSVGDLAQLQLLDLRDTGLQTLPQSLARLPAQCDIK
FT                   VPDHLADRLLQIRDPERAQRQAQRAAQRLAERRRRAPVPAAQQAGSSWNRVPEFTRVLR
FT                   SVDADLGERFEKWTQGLMQNARMFGASITSADMPLLDQVVAEAIRSPEFRSSFGQFLSD
FT                   HTIKTLNLDGMTQVGGRGPAVRGDAKTAFAEMLKHKLMHTQDHETALGLLLEALRNSDL
FT                   GLSRQTLLRSRNELTGRVEMWPPLKAYISMHDVEGKAAQDAAITWAMAQLDEAHEGVIG
FT                   EAEAKQESEQAQANANRFIERRAPVLLQEWGIH"
FT   CDS_pept        complement(461310..461903)
FT                   /transl_table=11
FT                   /gene="hpaF"
FT                   /locus_tag="XCV0409"
FT                   /product="HpaF protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22040"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22040.1"
FT                   /translation="MFNVNRLLRSRPRTDNADQAPAQDSPSRQPSNAEGLLSPLLARPR
FT                   RREATSSAHTSTPRNAAQGRLFRSPLHPSSQPAELAGASSAPPRSIEHDIDDWLAQSLP
FT                   MAERVQTGYNLHDGQRDTSREVLQSVADAIRRAATHHGTALVFDYGLPATTLPDAIGRL
FT                   EELQKLTLIHTSRCQTAWGSCASSAIYRSLVHRA"
FT   CDS_pept        complement(461953..462333)
FT                   /transl_table=11
FT                   /locus_tag="XCV0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22041"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22041.1"
FT                   /translation="MRCGIARRPSYERASRCLEARSGAAAAMCLGEQATGYRKLSREHR
FT                   HPDNEDRRYAWRLRRERCGASPDRSPVAILYIAPTADDIERRTITAVGEQGCCTGARFY
FT                   KKLIRQAMQPLRVDAAMAVAPQ"
FT   CDS_pept        complement(462449..464869)
FT                   /transl_table=11
FT                   /gene="hrpF"
FT                   /locus_tag="XCV0411"
FT                   /product="HrpF protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22042"
FT                   /db_xref="GOA:Q3BYM1"
FT                   /db_xref="InterPro:IPR008718"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYM1"
FT                   /protein_id="CAJ22042.1"
FT                   /translation="MSLNTLSTGSNPSQLLGTSFNESSSSELLGSDSSKDGSDLPSTMD
FT                   NIFQRIYLLLEALQANTPNSASGNAPANTASGDADTQLSASDWQATQPIEKRTSWPSLG
FT                   YDFDPKHIKGKDAPPALEGSTVTWNDGTLTKSELQIVSTLNAHKDQMPLEYKNLDDKIN
FT                   DPSTPADLKAALQGLKQDPRLFFAIGSQGDGKCGGKISAQDLWDFSDSHPQVKELGGKN
FT                   DEFNPKNIKGSNPPPAAEGSTVTWNEGQLNQSELEIVSVLDRHKDQVDSLSFDQLDAKI
FT                   NDPSTQPDLKKALQGLQKDPRLFFAIGSQKDGKCGGKIKAQDLTDFSYYHPQIAEYNDK
FT                   QAKSYTQNYIASDSPDKTKASVMTKSDALRELYRYSDYLPGNLSEDEFAKIVDGDSKTG
FT                   KCPPQVIAAAQYFRDHPDEWKEFAGDSGSMSTPDFLQKSTSEMHLTADEQKTLDTINSH
FT                   QDAFYGDGKEITRDKLDAISKDDKADPAVKQAATQLLADPLLFGLLNNSITGYKKPHHF
FT                   FGGGHVVDSGKISQDDFRQFYDHMSAANKTVDTPATHEASSPDQQKAVADMLVGKDDPP
FT                   AIKKPKKDVGTFQQGLHEFLKWDSKILDWMSVGLSALNGIPIIGEIADAASIALESEAQ
FT                   AAQVVDTAIQGGDMSLALKLAGINMAGAVVGAVGGPTARIGAKGVAKGVAEAAAKEAAE
FT                   GAAKGAAKGTAKSVAKGGGKTAAERPSAAEFAKGYVGGTAISKSTEILKTPVLAGLHYE
FT                   EYQLDKQKDGEIHQKMENAGGVPVGKQIIPKGIADNFEGDLRQNLRNVRIRRR"
FT   CDS_pept        465756..465917
FT                   /transl_table=11
FT                   /gene="hpaI"
FT                   /locus_tag="XCV0412"
FT                   /product="HpaI protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22043"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYM0"
FT                   /protein_id="CAJ22043.1"
FT                   /translation="MTLESHNQQTANTAFFIGLSACLGLPGELAQRLGEGETILGPAGM
FT                   LCRVHTQG"
FT   CDS_pept        465927..466202
FT                   /transl_table=11
FT                   /gene="hpaD"
FT                   /locus_tag="XCV0413"
FT                   /product="HpaD protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYL9"
FT                   /protein_id="CAJ22044.1"
FT                   /translation="MMAFPEVILPLAARELGGEEVVMLLSLQEQLLTEYGWRLTLSDLG
FT                   LLCVCPLLLVRTPEEVAAALDRGQVVARVVLDALATQVDTAKEVAS"
FT   CDS_pept        466199..468211
FT                   /transl_table=11
FT                   /gene="xopF1"
FT                   /locus_tag="XCV0414"
FT                   /product="Xanthomonas outer protein F1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYL8"
FT                   /protein_id="CAJ22045.1"
FT                   /translation="MKLSSDIGTAASRGAASHPPVQPTQAEDVAAPREERAPTGPLAGL
FT                   ASSSAALRGRRASLAGRASPHADEEGAMLGGSHRSDSSQSSQASDATFYTAQVVSPARE
FT                   IDTPDVPAAAATYAERSTAAAAEVKAQLRARLDALPFAAPSEEQTALQASYLEWADARV
FT                   QERINAFGPDAGYQAVGDMKTAGTKAALPIAYECLRSFIIGAMRIPVGLATGAAYASRR
FT                   PADAEELSTAMVAGVAAGSASYTSDTLLIPAMDRRAPVSNLPRFQAIDPKILVPDPPPV
FT                   ILEITAEGKRFTRPGENNAPTLADLKAQTYDRRLGITQRQSTLDDKSLDTLLLKPVINA
FT                   GFNAARRTGGEPGLLTPVGQWGLSALAIGGAGVVQKALLETGKAVARTGQMRVPDLVGG
FT                   EQRLNLFALALPDKARRPAQWSDAVHFPPTYLLDTGKEALALARQGFNSANAVATTARD
FT                   LLTRHMLSNVMASFGPMGAGRIITAPLRRGSHIRVAGEAVNSTAVVVQQAVQTLFNDTF
FT                   WNALKAKNGANTSQAARLDNERAALAAEHQRTIERTLEALAEPVDQAIARLSGPTPAEA
FT                   ERAMEEGMRAAPGPGPLGQTLRTALQTLRTEIGTQSVSIATIDAVRTALREGWSQTFSG
FT                   VPRDAATQALDGQLQTLKRALHDSEALRQWQSGRA"
FT   CDS_pept        complement(468512..468814)
FT                   /transl_table=11
FT                   /gene="hpaE"
FT                   /locus_tag="XCV0415"
FT                   /product="HpaE protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22046"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22046.1"
FT                   /translation="MPKSQSRPQRRPSAMAQQLGLPANSAGLALLCPMAPVALSETHLA
FT                   MSKPDTRASALACSPIQVWREIAGLSCRLTAMADTAQNKGRRRLMVYTVHTRDGS"
FT   CDS_pept        complement(468833..469303)
FT                   /transl_table=11
FT                   /gene="hpaB"
FT                   /locus_tag="XCV0416"
FT                   /product="HpaB protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22047"
FT                   /db_xref="GOA:Q3BYL6"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22047.1"
FT                   /translation="MSSARFETIVRQMCEALDLPDVESVLDRRVLWVEGFEVYLHLPTP
FT                   QPEDDVKEEALYLRIAYGLPPAGRTLTVFRLLLEANLSVYAQDQAQLGLNDDGVIVLIV
FT                   RVPLDDDVDGAWICDLLAHYAEHGRYWNNNIFVAHDEMFEGIATGNYLWLRA"
FT   CDS_pept        complement(469358..469639)
FT                   /transl_table=11
FT                   /gene="hrpE"
FT                   /locus_tag="XCV0417"
FT                   /product="HrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22048"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYL5"
FT                   /protein_id="CAJ22048.1"
FT                   /translation="MQIFPEVSSWRSRVGQGMDCFTGGLSNGISGAAALSGANGQMDSL
FT                   LGDMSASDEAQKSMNNKITMLKNDLDFNVALNKFIGKAGDNAKQLVGQ"
FT   CDS_pept        complement(469721..469978)
FT                   /transl_table=11
FT                   /gene="hrpD6"
FT                   /locus_tag="XCV0418"
FT                   /product="HrpD6 protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22049"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYL4"
FT                   /protein_id="CAJ22049.1"
FT                   /translation="MRDHTMFDAMTDAVTQDMSKILQAKAMDLSGERLRNVETALDATA
FT                   QQIRVHWSAASDQVARNDFNVLYDGITAARNIVAHIASMP"
FT   CDS_pept        complement(469975..470913)
FT                   /transl_table=11
FT                   /gene="hrcD"
FT                   /locus_tag="XCV0419"
FT                   /product="HrcD protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22050"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYL3"
FT                   /protein_id="CAJ22050.1"
FT                   /translation="MTMQLRVMTGTHAGARLDLAQGRYTLGSDPQTDIRIDDWPGCSLI
FT                   IEVDQDGQIRYGSDTVQETFFVAFQPVRFGPLVLCVGDAAADWPDDVALLERLLSPAPP
FT                   PAPRTSRRKVLRTAVGAVLALAAAALLPSLQPAFLSDAATRQHPENTLNQAKALLKQLG
FT                   FREAHAEQVGTRVLIEGLVPSSADAARLRAQVHRYHPGVAVNVAVVDEVVATLRDTLAD
FT                   PALTVRYEGNGVFSVSGSSDYAERASRRIADVRSDLGPEVRALHVEISQQDPSIKPPDN
FT                   YDAALLADGLHYVETPDGTKHMTSLPQQAAQ"
FT   CDS_pept        complement(470910..471737)
FT                   /transl_table=11
FT                   /gene="hpaA"
FT                   /locus_tag="XCV0420"
FT                   /product="HpaA protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22051"
FT                   /db_xref="GOA:Q3BYL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYL2"
FT                   /protein_id="CAJ22051.1"
FT                   /translation="MIRRISPGTLRPSVSIEHGGSHHHGDHHADASGTSAGSPTDIAAR
FT                   APRLRPAPPRRRRRGIRSLDGQEDEFDANEQEEIEAKRECALRGRVSVAITPAQSREHG
FT                   QGDQHGGDRSTHTDDPQAGPWHSAAPAQLSDSIRTCIDAIVDRYVTRRDADPVAKRHAL
FT                   AAALVELRAVGVSHPAVAPLTATIWRLMREHLRAYDKATAAENLLALRTRLLELMPSEL
FT                   EPVPALRNFHLLLPLILLNAEKPRRRVDRTHAITRLNTLLIEQPQQAAQEVRP"
FT   CDS_pept        complement(471734..471994)
FT                   /transl_table=11
FT                   /gene="hrcS"
FT                   /locus_tag="XCV0421"
FT                   /product="HrcS protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22052"
FT                   /db_xref="GOA:Q3BYL1"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYL1"
FT                   /protein_id="CAJ22052.1"
FT                   /translation="MDHDDLVRFTSEALLLCLKVSLPVVGVAALAGLLIAFVQAVMSLQ
FT                   DASISFALKLVVVVAAIAVTAPWGASAIMQFGQALMQAAFP"
FT   CDS_pept        complement(471999..472643)
FT                   /transl_table=11
FT                   /gene="hrcR"
FT                   /locus_tag="XCV0422"
FT                   /product="HrcR protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22053"
FT                   /db_xref="GOA:Q3BYL0"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYL0"
FT                   /protein_id="CAJ22053.1"
FT                   /translation="MQMPDVGSLLLVVIMLGLLPFAAMVVTSYTKIVVVLGLLRNAIGV
FT                   QQVPPNMVLNGVALLVSCFVMAPVGMEAFKAAQNYGAGSDNSRVVVLLDACREPFRQFL
FT                   LKHTREREKAFFMRSAQQIWPKDKAATLKSDDLLVLAPAFTLSELTEAFRIGFLLYLVF
FT                   IVIDLVVANALMAMGLSQVTPTNVAIPFKLLLFVAMDGWSMLIHGLVLSYR"
FT   CDS_pept        complement(472630..473544)
FT                   /transl_table=11
FT                   /gene="hrcQ"
FT                   /locus_tag="XCV0423"
FT                   /product="HrcQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22054"
FT                   /db_xref="GOA:Q3BYK9"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYK9"
FT                   /protein_id="CAJ22054.1"
FT                   /translation="MFGDPRAARQCGFATHCRRISPNDAARLRLQLDAGQMELRIAARD
FT                   GLALLLNEDDDSLRVSIAGMLLADRLGAFAPLGLGAAEVIAFERDAEPDDCHGIGMTLG
FT                   DLDAIALTASAPLLATLQAAVGGLAPPAQQPAWLAALRVNTRLRIGGRTASAALLQSLR
FT                   PGDVLLHCTASAAVTSGDVLWGIAGGVVLRAPVRLNLQQMILEASPTMQHDTFEPEVAP
FT                   STSNVAELELPVQLEVDQLALSLSTLSGLQPGQILELSVPVDQADIRLVVYGQTIGTGR
FT                   LLAVGEHLGVQILSMSESTHADA"
FT   CDS_pept        complement(473676..474314)
FT                   /transl_table=11
FT                   /gene="hpaC"
FT                   /locus_tag="XCV0424"
FT                   /product="HpaC protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22055"
FT                   /db_xref="InterPro:IPR013390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22055.1"
FT                   /translation="MRKPPLRHVRILPVSGALQRPAAPATPARSALRSSFLQLRQRLRS
FT                   AQLALPCMVLPPQCDEDRPGPDAEEGFTEAHDSVPVQTDPPLRIEGTKHQEPSQGNDDG
FT                   AVGRQIATEWIRTQRAHMAIDHIALRVAEFCNAQPVRSAGSWEAWLAIDQEVVAQTTLF
FT                   LRLSPDQLSLRFNTSSPDAREVLWCGKQRLEAALTSTLSSTLQISIEVV"
FT   CDS_pept        complement(474314..476236)
FT                   /transl_table=11
FT                   /gene="hrcV"
FT                   /locus_tag="XCV0425"
FT                   /product="HrcV protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22056"
FT                   /db_xref="GOA:Q3BYK7"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYK7"
FT                   /protein_id="CAJ22056.1"
FT                   /translation="MRATRYFAYSGEVAIAALVVAVIGLMILPLPTPMIDTLLGINITL
FT                   SVVLLMVTMYVPDSISLSSFPSLLLFTTLLRLSLNIASTKSILLHAEAGHIIESFGELV
FT                   VGGNLVVGLVVFLIITTVQFIVIAKGSERVAEVGARFTLDAMPGKQMSIDADLRGGNLT
FT                   ADEARRKRARLAMESQLHGGMDGAMKFVKGDAIAGLVITMVNILAGIVVGVTYHGMTAG
FT                   DAANRFAILSVGDAMVSQIASLLISVAAGVMITRVANENETRLSSLGLDIGRQLTSNAR
FT                   ALMAASVLLACFAFVPGFPAVLFLLLAAAVGAGGYTIWRKQRDISGTDQRKLPSASRKG
FT                   AKGEAPHIRKNAPDFASPLSMRLSPQLAALLDPARLDQAIESERRQLVELLGLPFPGIA
FT                   IWQTESLQGMQYEVLIHDVPETRAELENTDDMQAALARQAISPLHARAHLFVGIQETQW
FT                   MLEQVAVDYPGLVAEVNKAMPAQRIADVLRRLLEERIPVRNIKSILESLVVWGPKEKDL
FT                   LMLTEYVRCDLGRYLAHTATAGTGQLPAVMLDHAVEQLIRQSIRATAAGNFLALPPEQA
FT                   NQLVEQVERIVGDHAQHPLAVVASMDVRRYVRRMIEARLTWLQVYSFQELGSEVQLQPI
FT                   GRVVV"
FT   CDS_pept        complement(476245..477318)
FT                   /transl_table=11
FT                   /gene="hrcU"
FT                   /locus_tag="XCV0426"
FT                   /product="HrcU protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22057"
FT                   /db_xref="GOA:Q3BYK6"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYK6"
FT                   /protein_id="CAJ22057.1"
FT                   /translation="MSEEKTEKPTEKKLRDARKDGEVPVSPDVTAAAVLFGALLVMKSA
FT                   GDYFSDHMRALMTIGFDFSEHTRDAAAINRALGHIGIQGLLLMLPFLAACLVAGMAGGA
FT                   FQTGLNASLKPVAPKFDSLNPATGVKKLFSLRSLINLLKLIIKAILIGVVLWVGIRALM
FT                   PMIIGLAYETPLDVAQIAWRTLGMLFALGVLLFVLVGAADWSVQRWLFIRDKRMSKDEQ
FT                   KREVKESEGDPEIKDKRKEFAKELVFGDPRERVAKAKVMVVNPTHYAVALAYEPDDFGL
FT                   PQVVAKGVDDGALELRAFAHNQGIPIVANPPLARALYQVELGDAIPEPLFETVAVVLRW
FT                   VDELGRDHGDGDGALPC"
FT   CDS_pept        477533..477988
FT                   /transl_table=11
FT                   /gene="hrpB1"
FT                   /locus_tag="XCV0427"
FT                   /product="HrpB1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22058"
FT                   /db_xref="InterPro:IPR013394"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYK5"
FT                   /protein_id="CAJ22058.1"
FT                   /translation="MEKTQCPGSVVSGLIELITVGLTHEKIQDAAAVLAAVRVLRPELK
FT                   ALDTFDAWISIKRGNYVEGARLLRELESDAGSKPLCRALYACCLFAMGDPSWHGVADGL
FT                   IEEDADADAVALVKALSGRSTPTSAPAEVPVESSAPMEVPNSQYLRA"
FT   CDS_pept        478022..478414
FT                   /transl_table=11
FT                   /gene="hrpB2"
FT                   /locus_tag="XCV0428"
FT                   /product="HrpB2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22059"
FT                   /db_xref="InterPro:IPR013391"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYK4"
FT                   /protein_id="CAJ22059.1"
FT                   /translation="MTLIPPVQAIAGTSAAATQALSPVATPNQALVNRFQALMQSSSPL
FT                   PPAMQRVGNPSMMSRVVDVQNDGVRTIAEHIDAFSMQAPTMGLQEMAAQQIKLMHELTM
FT                   VGFNLNVSVGVAQSGKNAVQTLVKNQ"
FT   CDS_pept        478416..479177
FT                   /transl_table=11
FT                   /gene="hrcJ"
FT                   /locus_tag="XCV0429"
FT                   /product="HrcJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22060"
FT                   /db_xref="GOA:Q3BYK3"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYK3"
FT                   /protein_id="CAJ22060.1"
FT                   /translation="MRAPRCLVVLLVALLLSACSQQLYSGLTENDANDMLEVLLHAGVD
FT                   ASKVTPDDGKTWAVNAPHDQVSYSLEVLRAHGLPHERHANLGEMFKKDGLISTPTEERV
FT                   RFIYGVSQQLSQTLSNIDGVISADVEIVLPNNDPLSTSVKPSSAAVFIKFRVGSDLTSL
FT                   VPNIKTLVMHSVEGLTYENVSVTLVPGGAESDAQFTASAPPRPSPWPWLAGCALALCLA
FT                   GAAALYWWPNPQAGRWGGWQRLRELKKGKAG"
FT   sig_peptide     478416..478469
FT                   /gene="hrcJ"
FT                   /locus_tag="XCV0429"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        479185..479814
FT                   /transl_table=11
FT                   /gene="hrpB4"
FT                   /locus_tag="XCV0430"
FT                   /product="HrpB4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22061"
FT                   /db_xref="InterPro:IPR013393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYK2"
FT                   /protein_id="CAJ22061.1"
FT                   /translation="MDNTRIDNAARCVQRWTDALAQLAESLDAARVAHWLGPVAASGWA
FT                   AAPVHRRMRVIQAWSGWSELSPSALGLHANQLALLMPARLAKVLIARALFSRGLAVRRC
FT                   IERERLDWLEQCVGPAVLEHVRQNASAGLPVPLLPRDADQAAWVGDGWRRMQADGVWSN
FT                   PVVAKLLALSLPLGAAQVATVAADGASDAFLTALPTLIPEASCVCG"
FT   CDS_pept        479799..480500
FT                   /transl_table=11
FT                   /gene="hrcL"
FT                   /locus_tag="XCV0431"
FT                   /product="HrcL protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22062"
FT                   /db_xref="GOA:Q3BYK1"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYK1"
FT                   /protein_id="CAJ22062.1"
FT                   /translation="MRLWLRSTPDAIGLDCDVIPREALASVLALDAATAEVHARCEQAL
FT                   SQAQTRAQTLVDEAQQQAEAILHDARQKAERSARLGYAAGLRRQLDEWNESGLRHAFAA
FT                   EAAAQRSRERLAEIVARTCEHIILGHDPAALYARAAQALEGALDEAKALRVSVYPDAVD
FT                   AARRAFDAAATEAGWTLQVELCGDADLAVGACVCEWDTGVFETDLRDQLSSLRRVIRRV
FT                   LAAPQEPADAG"
FT   CDS_pept        480490..481818
FT                   /transl_table=11
FT                   /gene="hrcN"
FT                   /locus_tag="XCV0432"
FT                   /product="HrcN protein"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22063"
FT                   /db_xref="GOA:Q3BYK0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR013380"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYK0"
FT                   /protein_id="CAJ22063.1"
FT                   /translation="MLAETPLLETTLERELATLAVGRRYGKVVEVVGTMLKVAGVQVSL
FT                   GEVCELRQRDGTLLQRAEVVGFSRDLALLAPFGELIGLSRETRVIGLGRPLAVPVGPAL
FT                   LGRVLDGLGEPSDGQGAIACDTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTLGEG
FT                   QRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVV
FT                   VCATSDRSSIERAKAAYVGTAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPT
FT                   RRGFPPSVFAELPRLLERAGMGESGSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILS
FT                   REIAAKNQYPAIDVLASLSRVMSQIVPYDHSQAAGRLRRLLAKYNEVETLVQVGEYRQG
FT                   SDAVADEAIDRIDAIRDFLSQPTDQLSAYENTLELLTSVTDDA"
FT   CDS_pept        481811..482320
FT                   /transl_table=11
FT                   /gene="hrpB7"
FT                   /locus_tag="XCV0433"
FT                   /product="HrpB7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22064"
FT                   /db_xref="InterPro:IPR013392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYJ9"
FT                   /protein_id="CAJ22064.1"
FT                   /translation="MREPAYTWSVLHQLKARRCERMQERLSDCRRALEHCDRELARCRQ
FT                   EAEACTTRLANCDAALMDKTGVGGSIDIDTILQHERFRTVLVETCRAAEQARAAADQSL
FT                   HSARDELASVQQALSKLQAQAQVYADKAASARRARQAQRDAAEEEDAIEALVGLRSHRA
FT                   AHGGAR"
FT   CDS_pept        482317..483147
FT                   /transl_table=11
FT                   /gene="hrcT"
FT                   /locus_tag="XCV0434"
FT                   /product="HrcT protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22065"
FT                   /db_xref="GOA:Q3BYJ8"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYJ8"
FT                   /protein_id="CAJ22065.1"
FT                   /translation="MNDATEALLAISSQGVSLLTLLALCGVRVFVMFIVLPATAQDSLP
FT                   GIARNGVIYVLSSFIAYGQPADALAKIQTAGLVGVVFKEAFVGLLIGFAASTVFWIAES
FT                   VGLLIDDLAGYNNVQMTNPLSGQQSTPVSTVLLQLAIVSFYALGGMLMLLGALFESFRW
FT                   WPLTQLGPNMGAVAESFVIQQSDSMMAAVVKLSAPVMLVLVLVDLAIGLVARAADKLEP
FT                   SNLSQPIRGVLALLLLALLTSVFIAQFGEALGFLHFQQQLHDAANLSGKGGATH"
FT   CDS_pept        483229..485052
FT                   /transl_table=11
FT                   /gene="hrcC"
FT                   /locus_tag="XCV0435"
FT                   /product="HrcC protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22066"
FT                   /db_xref="GOA:Q3BYJ7"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYJ7"
FT                   /protein_id="CAJ22066.1"
FT                   /translation="MAPACTTAHRRRAPLAAVLMLSLLPLLSPHADAAQVPWHSRTFKY
FT                   VADNKDLKEVLRDLSASQSIATWISPEVTGTLSGKFETSPQEFLDDLAATYGFVWYYDG
FT                   AVLRIWGANESKSATLSLGTASTKSLRDALARMRLDDPRFPVRYDEAAHVAVVSGPPGY
FT                   VDTVSAIAKQVEQGARQRDATEVQVFQLHYAQAADHTTRIGGQDVQIPGMASLLRSMYG
FT                   ARGAPVAAIPGPGANFGRVQPIGGGSSNTFGNAAQGQGGGASGILGLPSSWFGGASSSD
FT                   RVPVSPPLPGSGAAAAAGSPASVWPELSKGRRDESNPIDAGGGAELASDAPVIEADPRT
FT                   NAILIRDRPERMQSYGTLIQQLDNRPKLLQIDATIIEIRDGAMQDLGVDWRFHSQHTDI
FT                   QTGDGRGGQLGFNGALSGAATDGATTPVGGTLTAVLGDAGRYLMTRVSALETTNKAKIV
FT                   SSPQVATLDNVEAVMDHKQQAFVRVSGYASADLYNLSAGVSLRVLPSVVPGSPNGQMRL
FT                   DVRIEDGQLGSNTVDGIPVITSSEITTQAFVNEGQSLLIAGYAYDADETDLNAIPGLSK
FT                   IPLVGNLFKHRQKSGTRMQRLFLLTPHVVSP"
FT   sig_peptide     483229..483327
FT                   /gene="hrcC"
FT                   /locus_tag="XCV0435"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    complement(485261..486331)
FT                   /locus_tag="IS_1595_2"
FT                   /note="IS element 1595"
FT   CDS_pept        complement(485279..486124)
FT                   /transl_table=11
FT                   /locus_tag="XCV0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22067"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22067.1"
FT                   /translation="MSLSVLRRARALALQAGWRRLLPVQLVPAPDQPDRRHDVPGHQAA
FT                   TARLDAGVAPVDLEQSQHGCAGADASPGRQLQDRLADEAQIMQVMAEREAMRRLSGFVQ
FT                   IDDAYLGGERNGGKAGRGSENKQPFLIAVQTDTSLTAPSFVVIEPVRSFDNVALTDWIA
FT                   RRLAPECEAYTDGLACFRRLEEAGHAHTTLDTDGGRAATEAAGARWVNVVLGNLKRAIS
FT                   GVYHAIAQGKYARRYLAEAAYRFNRRFRLREMLPRLATAMMRCKPCPEPVLHAASNFHG
FT                   "
FT   CDS_pept        487189..488826
FT                   /transl_table=11
FT                   /gene="xopD"
FT                   /locus_tag="XCV0437"
FT                   /product="Xanthomonas outer protein D"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22068"
FT                   /db_xref="GOA:Q3BYJ5"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="PDB:2OIV"
FT                   /db_xref="PDB:2OIX"
FT                   /db_xref="PDB:5JP1"
FT                   /db_xref="PDB:5JP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYJ5"
FT                   /protein_id="CAJ22068.1"
FT                   /translation="MEYIPRYEALEKVPVRVRFHAYLRGDGSFGPGLPGILRYMTPDQK
FT                   KRLYLASERRKLALAAPKSKPTPKSKPLKGVFRTLHQKPNLLLEISSKFSNRAYSINDS
FT                   SSGYLSQADLEEMVDEETGELTRLGEAVISGASQGIQTAIRANFRMRYQQPDLPPYSPP
FT                   QAFHRPEETWNPHTPAGSSYSSLFPPTPSGGWPQNASGEWHPDTPAGYSHRAWPAQPEA
FT                   SSSTFDDLESLDYRQNYGYREFDLNTPQEIEQPGWWQQATPAQSTDSTFDGLSSMSHYG
FT                   SEFDLNIPQQEEYPNNHGTQTPMGYSAMTPERIDVDNLPSPQDVADPELPPVRATSWLL
FT                   DGHLRAYTDDLARRLRGEPNAHLLHFADSQVVTMLSSADPDQQARAQRLLAGDDIPPIV
FT                   FLPINQPNAHWSLLVVDRRNKDAVAAYHYDSMAQKDPQQRYLADMAAYHLGLDYQQTHE
FT                   MPIAIQSDGYSCGDHVLTGIEVLAHRVLDGTFDYAGGRDLTDIEPDRGLIRDRLAQAEQ
FT                   APAESSIRQVPARSNEQKKKKSKWWKKF"
FT   CDS_pept        488966..489232
FT                   /transl_table=11
FT                   /locus_tag="XCV0438"
FT                   /product="putative ISRSO12 transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22069"
FT                   /db_xref="GOA:Q3BYJ4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22069.1"
FT                   /translation="MKKSRFTEEQIAYALKQVELGMAVGEVCRKMGIAEATFYVWRKKY
FT                   GGLGPSELKCLRVLEEENRKLKQLVADLSLDKAMLQEVVTKKL"
FT   CDS_pept        489283..490197
FT                   /transl_table=11
FT                   /locus_tag="XCV0439"
FT                   /product="putative ISRSO12 transposase (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22070"
FT                   /db_xref="GOA:Q3BYJ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22070.1"
FT                   /translation="MSERRALRIVAMSRSAFSYKAKARDCSAIRLRMREITQTRIHYGC
FT                   ERVLVVLRREGWRDNHKRVHRIYKEEGLSLRHCRPRRSRSSRRRQPIKVATAPNTLWGM
FT                   DFVSDALFDGRRFRLLPVLDHFTHECLEIFVDQSLGADDVADAVVRLVVQRGKPEAIKV
FT                   DNGSEFAGKVLDRWAYENGVELDFSRRGTPTDNAMVESFNGRLRQECLNAHWFLSLADA
FT                   RSKIEAWRRFYNEERPHSALAWNPCGIRPRTRVPSEFNEGACRLKHETATCRPWSVGAT
FT                   NSCLLHRCSVAREAEASVEPSIG"
FT   CDS_pept        complement(490135..490488)
FT                   /transl_table=11
FT                   /gene="xopA"
FT                   /locus_tag="XCV0440"
FT                   /product="Xanthomonas outer protein A"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22071"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYJ2"
FT                   /protein_id="CAJ22071.1"
FT                   /translation="MINSLNTSHLGVDSSFMQVNPDQFQKFDSNQSNQGISEKQLDQLL
FT                   TQFIFSMLLQDDNADDSPNSDKPTDFPSPRTQMLMNVIGDILQAKNGGRLGGLSDGGLN
FT                   TSLSLSGDTASMQ"
FT   CDS_pept        490947..491420
FT                   /transl_table=11
FT                   /gene="hpaH"
FT                   /locus_tag="XCV0441"
FT                   /product="putative transglycosylase HpaH"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22072"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22072.1"
FT                   /translation="MRAQWSGRGRRAGAGPQRILFAAALACAAPFARADCFEEAAGYQH
FT                   VNPWVLRAIAWQESRGRADAIHRNNNGTVDYGKMQINSIHLRRLSGYGISKDALMQPCV
FT                   SVYVAAWRLREMTNKYGNTWAAVGAYHSETPGERDKYAHAIHSILLRRGVIDE"
FT   sig_peptide     490947..491048
FT                   /gene="hpaH"
FT                   /locus_tag="XCV0441"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(491884..493443)
FT                   /transl_table=11
FT                   /locus_tag="XCV0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22073"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22073.1"
FT                   /translation="MTKISSASTSQQPQATSGDIVIEIPAQRRDDTSTPRIDSPLSALP
FT                   PRPSGRRNSTGSDSGYETANDADLSPYGSPQPHAPLRGEESSSEQFYDAEDSLEPSALP
FT                   SLPQEHAAQHGSQAHASTSATGTARLGALAASVRAGATHGVTTLLGPAATAVAAAARGV
FT                   IPISFDKQYLGAALGHLVHQTTSVGPTTFVRELIGEALFAAFRQLPPEAVVAMQAVSGT
FT                   LHLALHTLRRNRENRNPDAAARGFHNLNLEQWEALSEDERHHKRSEQQHYSDLVTRLAL
FT                   TGILSNIAIGAAGKASGRPEMAARLLASELKVAPYAAARDAIQATFRMVGMRSPTNGGV
FT                   SDPHVTSAGRFYGMANVLTNLASNELEAPDFASARQRWAGLMSPFNMGEATRVVFQQAA
FT                   VNAALNVGLETADWLNVTQHEADEAGTQQISEPTWKAKREDYERVMDHSVARTAAINSN
FT                   IAFGTAVNMIGTWLGLSPARSALLSNTLAGMAAGMQYKVIAGTWQAAAAVREAEGARTR
FT                   TE"
FT   CDS_pept        complement(493724..494176)
FT                   /transl_table=11
FT                   /locus_tag="XCV0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22074"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22074.1"
FT                   /translation="MWLACESGYAQKQRSQWWEGKRGSKRPTAALVRLHLVGFAILVLG
FT                   NAAICSPSHTTRPGRSLERSTPSLRHRSARAPTPINQHMSQRWHTRTSSSLQGRPRQQT
FT                   YLASTDELIVRMWNDRFAKRASRFCGFMRTSSSPTTMTHTTQGGRG"
FT   CDS_pept        complement(494868..495209)
FT                   /transl_table=11
FT                   /locus_tag="XCV0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22075"
FT                   /db_xref="GOA:Q3BYI8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22075.1"
FT                   /translation="MQIQIQTDKHVPHDPSVVAHVEKTCTAQLAHFASDITRVEVHLRD
FT                   ENGQRGGAADRTCSIEAHVAGLPPIAATNSAETTASAVTGAARKLRTAIEHARGKQHSK
FT                   ATAPPPDML"
FT   CDS_pept        495529..497952
FT                   /transl_table=11
FT                   /gene="mscK"
FT                   /locus_tag="XCV0445"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22076"
FT                   /db_xref="GOA:Q3BYI7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR022249"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22076.1"
FT                   /translation="MRRLLLLAALGMVCVGTAVAQDEDTVLETAQTQLDSMQKVLTHAE
FT                   AGMEKSDTDQLRKLADDVTGAQRQAQDLARSLEPPLKELSVRLAGLGEEQKTDPPDLRD
FT                   QRRALTRERNGLDAELKRANLLALDAKDLADRLEGERAQRFSEKLSARAASPLSPALWN
FT                   EIAREWPDDRARLQALSDKAVQAVRTGTATNGVAGLMIGTLAALMLAFPLRIFLRHLGR
FT                   RYAASRAPGGRLRRSGLALWFLLVGTLTLGMAAWALAESVRALSELPTDLEQLLSAFVV
FT                   ISCVAAFVGSLSASLLMKHQPTWRLFPLDDATVDRLRVHCLATAAVSWFSGMAIRINDV
FT                   ARSSSALTIATDAVAALLYAGLILSALAGLTLSLRAHAANVGAADADSSAPPPVVSRGG
FT                   GYIVLIRLLGHLAVIFALVAALFGYINMALFVEQQIIWITMVCSVLALLVMFADDLTTW
FT                   VFKPESRFSRALSHALNVGSGRLVQVGLLISAAVRVLLVLLGIAALVTPYGANLAAVTG
FT                   WLENVSHGIAIGKELVITPGDVARALCVFLLGMGLVHVVQKWLLNTYLPKTELDAGARN
FT                   SISTVARYLGWLIVMVWGLTALGLDLKRLALVLSALSVGIGFGLQAITQNFVSGLILLA
FT                   ERPVKIGDWVRIGDQEGDVRKISVRATEIQVGDRSTLIVPNSELITKSVRNMTLSNPMG
FT                   RVQLQFSVPLETDVAKVRDMLLALFAEHEKVLAEPAPSVFIDSLAGGHVNFNSFAYVSS
FT                   PRDSYGVRSQLFFALLQRMATVGIALQSPQEIRFSRAGAAVAREAGDGAPASDD"
FT   CDS_pept        complement(498049..500157)
FT                   /transl_table=11
FT                   /gene="mdoB"
FT                   /locus_tag="XCV0446"
FT                   /product="phosphatidylglycerol--membrane-oligosaccharide
FT                   glycerophosphotransferase"
FT                   /EC_number="2.7.8.20"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22077"
FT                   /db_xref="GOA:Q3BYI6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR020881"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22077.1"
FT                   /translation="MHWMLLVSLLLLLWLLVASPRLAWLKAGLLSLFLLLLSVWGLVDR
FT                   LSGDGINAATLYHLRADMDGAGVSDFSGYIAVFVGMLLLSLSPLLLVRVRRFQRPRGGG
FT                   AVFAGFVGMLLVGIAASPLYRDGKRLYYQLRPVDYATVVPEYQVPQQPLHKRKNIVWIY
FT                   GESLERTYFDEQVFPGLMPNLRALATEAVDVRNLASTEGSGWTIAGMVASMCGVPLTTA
FT                   PGDENSMDRMGMFLPEARCLGDYLKDQGYRNHYVGGADASFAGKGRFLSSHGFDVVHDV
FT                   HHFHDQGVAPKHFSAWGVHDDVLLDDAWDTFQTLSRAGQPFMLTTLTMDTHHPAGHLPL
FT                   ACKGQQYDSALGDIGLLHAIKCSDRLIGELVARIRNSRYGKNTIIVIASDHLAMPNDLS
FT                   DVLAKQKRENLLLFLGKDIAPQQVLTRAGSTLDSGATLLQLLEPGMRTLGFGRSLLARD
FT                   APPSASVAASRDSGKDYPRYLAYARTLWTGRSTRMLRINGNGDVVVGVQQVRPPVLLEY
FT                   DKDTNLKTVYLENTSRQFDRTHSKGTLAYVDRCTAFEDGSADGHWCALVVDRHQSMKLY
FT                   RDPDLTRGIAVDAPLEATQQGPRPRVRQPIMLTQAARKTDAGRYMLELYAKRRPTRAFW
FT                   VEAVSSERKVVLAQQWVVPDAAGRIRMPVGLEHAVEDLEIRAWLDYTEDVSVDDLALVK
FT                   DIPVADRS"
FT   CDS_pept        500152..500673
FT                   /transl_table=11
FT                   /locus_tag="XCV0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22078.1"
FT                   /translation="MHAQRPWGNGASAYRTPCSPCPVRHLQCDTRMTDYAAPKLTEMFV
FT                   ADRSGMTSGPASPDSGDTSVRTNQREDAEAQVASDALRPRVIVVVLAAALLHAASRGGD
FT                   TVVCAGRLQSAASSTMQDARTEPALFLHRSLRVAHAFNAEITGATPDAQSLTPACAVER
FT                   TVDTIRNSRY"
FT   CDS_pept        complement(500848..502749)
FT                   /transl_table=11
FT                   /locus_tag="XCV0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22079"
FT                   /db_xref="GOA:Q3BYI4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22079.1"
FT                   /translation="MSRHCAVVACCWQGDAGTAAPALAAVRACPGQVCLRCAQARGFTT
FT                   RRPVAGHTRRLHDAPEMALSHNDPHRAPAASPADHAVIGGMSRRTQILRLLLRYRGSGV
FT                   FAGMNLDPAAINEYEVPAEGTPDQFVSDLESLGPTFVKLGQMLSTRPDIVPPEFATALE
FT                   RMQENTSSVPVERIRQIIEEELGVSVNKAFSFFDPVPLGCASLAQVHRAALRDGTPVAI
FT                   KVQKPEVAAQVRSDLDVLKSFATAADRLTGIGRRVRFADWLGEFGKTLRAELNYEDEAE
FT                   TLARFGKHLKPFPLLWVPQPVWDLSSRKVLTMQLAEGVRVDKISGLRRTEQPMDELAAE
FT                   LVKGYLDQMFVHGEIHADPHPGNLRVLQDGRLAIFDLGMVAHVPPRLRERLLKLLFAAV
FT                   DGRGEEVAEETIALSTRLEDYDEERYQRETGQMIARYAAHDATSEGRVVLDLVRIATST
FT                   GLRTPPELSLLGKTLLNLEGVCRALSPTLDTRRIVERHLQHVMRARLKKSLSAANLASE
FT                   AMELQHLVREGPRRMSEILSLAAENRLQMRVTGLEESHLMESLQKIANRVAAGIVTAAL
FT                   IMASAQMMRIETGLKLWGYPAIAMVLFLLGVVLGLGIVVSALLFDRRVRAREERGHR"
FT   sig_peptide     complement(502678..502749)
FT                   /locus_tag="XCV0448"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        502809..503750
FT                   /transl_table=11
FT                   /locus_tag="XCV0449"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22080"
FT                   /db_xref="GOA:Q3BYI3"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22080.1"
FT                   /translation="MAGASLFTLLDDIATLLDDVSILTKVAAKKTAGVLGDDLALNAQQ
FT                   VTGVTADRELPVVWAVAKGSLVNKMILVPAALAISALEAWLRGRGYNVPLVMPLMMIGG
FT                   AYLCFEGVEKLAHKFLHNDEQEAQRHAERTRALADQNVDVVALEKDKVKGAIRTDFILS
FT                   AEIIVLTLGSVTSAPFAQQVLTVIAIALVMTIGVYGLVAAIVKLDDLGLYLSKKGTALA
FT                   AFGRGILFGAPWLMKFLSVAGTVAMFLVGGHILVKDTPILHHSVTDLAESSGSMGWLVE
FT                   ALGNMLVGVVAGALVLGAVMLFQKLRGAKPAH"
FT   CDS_pept        complement(503837..505666)
FT                   /transl_table=11
FT                   /locus_tag="XCV0450"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22081"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22081.1"
FT                   /translation="MHRMRELPAAFALIRVTGSSMPCFAPGDHASRPACMPLPRATARL
FT                   AQAPPSMGRYRALAQDLSRPWRMADQPEHPSRPRGGLRRLLPWGGTDTARPAAALPTVI
FT                   NGERSGHGLAAHQLVPAKAKSGAHDPAAATALLIRLFSHAAHPEALLLAFAEGIASLHG
FT                   ELGDMGVRLSAAYAAGDWPGYGRALRQLIDKYIRTIDIGDSLAEGRTEAEQLRDLLRHA
FT                   LGNALATLLQRSPELAEEAQTLASALRHWRPGHELITLEQRLRELSHQIGLRAEDASEQ
FT                   QNLLLGLFDLLLENVGELLDDRSWLQGQISVVRQLISGPLDVSSIEQARGTLREVTYKQ
FT                   GLLKQGIAESKTAMREMMVSFVDRLDGMATSTGQYHDRVAGYSQAIGEARGIPDLNRLL
FT                   QDLLQDTAGVQAQALAARDELLAARRQVEDSEQRIALLEQELKDVAGLVREDQLTGALN
FT                   RRGFEELFQREAVRTQRSGQPLCVAMLDLDDFRRLNETHGHAGGDAALRHTVEVAKAVL
FT                   RTTDAIARFGGEEFVLLLPDSTIFEASAAVIRLQRALSQRSLLHDDVRVFISFSAGVAL
FT                   RGTDETQDEVIRRADRAMYDAKAAGKNRVINAD"
FT   CDS_pept        505952..507535
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="XCV0451"
FT                   /product="glycogen synthase"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22082"
FT                   /db_xref="GOA:Q3BYI1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22082.1"
FT                   /translation="MVAMMPLHATTARLERSTLLPTLKKSGRPRDARGRFIRHHERLPV
FT                   SLADTRGALFVASEMADFIKAGGLGDVAAALPRALRHRYDVRVLIPGYRAVLERAGKVE
FT                   IVGRVLAHAALPACDIGRIVQSDGLPIYILLSKELFERDGSPYVSTSGSEFEDNAIRFA
FT                   TLSHAAAQIAAGHAGLGWKPRLLHLNDWPCALAAGYVRWSGGTTPCLLTIHNLAYQGLV
FT                   PYSMAAALGIPAERVAELEFYGQMSFLRGGIVNADHVNTVSVSYAKQITGPAQGCGLDR
FT                   LLAGRAAKGALTGIVNGIDASWDPRTDEYLDSHFSVNQWQGRQANAAQVRKAFGLREST
FT                   GPLFAVVSRLVHQKGLDLICEVAPQIVAAGGQIAVIGGGEPEIERQVAELTRRYPGQVG
FT                   AFIGFEEGLARRMFAGADFLLMPSRFEPCGLSQMYAQRFGCLPIAHATGGLIDTVDDGV
FT                   TGFLFQHASVEALRRCLERAFRTFRLPSLLSAMRRAAMLRPSGWDVAGKKYLSLYEHTA
FT                   ATAPALATVS"
FT   CDS_pept        507532..509763
FT                   /transl_table=11
FT                   /gene="glgB2"
FT                   /locus_tag="XCV0452"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22083"
FT                   /db_xref="GOA:Q3BYI0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22083.1"
FT                   /translation="MSERQGGQEQRTEADGMTTEGISETSQTLQALANGLPADAFAVLG
FT                   PKPLAEGRRQVRVLAPGAEAMGLIDPRGKLLARMQASAIDGVFEGILAADGPYRLRIVW
FT                   PDRVQEVEDPYAFAATLDESLLLQIAAGDGQAVRRALGAQHVHCGDVPGVRFAVWAPHA
FT                   QRVAVVGDFNGWDVRRHPMRQRIGGFWELFLPRVEAGARYKYAVTAADGRVLLKADPVA
FT                   RQTELPPATASVVPSAAAFAWTDAAWMANRDPGAVPAPLSIYEVHAASWRRDGHNQPLD
FT                   WPTLAEQLIPYVQQLGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSPDGFAQFVD
FT                   ACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEV
FT                   TAYLLGSALEWIEHYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQ
FT                   LNREIATQFPGVLTIAEESTAWPGVTAAISDGGLGFTHKWNMGWMHDTLGYMQRDPAER
FT                   AQHHSQLTFGLVYAFDERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLALMWA
FT                   HPGDKLLFMGAEFGQWADWNHDQSLDWHLLDGARHRGMQQLVGDLNAALRRTPALYRGS
FT                   HRADGFDWSVADDARNSVLAFVRHDPAGGAPLLAVSNLTPQPHHDYHVGVPRAGLWREI
FT                   LNTDSAHYGGSNLGNSGRLATEPVGMHGHAQRLRLTLPPLATIYLQAEK"
FT   CDS_pept        509766..511523
FT                   /transl_table=11
FT                   /locus_tag="XCV0453"
FT                   /product="alpha-amylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22084"
FT                   /db_xref="GOA:Q3BYH9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22084.1"
FT                   /translation="MNQRNAITPSWGAWPAGEGQVRFALWAPAAKSVDVVFDDSARCAL
FT                   QAGQDGFFSAVIDCAANARYRYSVDGAEPVPDPASRWQPEGVHGPSAVQPTDGYAWQNA
FT                   QWQGRPWDEAVIYEVHVGTCGGYAGVQAQLPQLAAMGITTIELMPLSAFPGAHNWGYDG
FT                   VLPYAPVEAYGTPDELKALIDAAHGHGLMVLLDVVYNHFGPDGNYLHSYAAPFFNEDKP
FT                   TPWGAAIDFRKPPVQRYFLDNALMWLHEYGFDGLRLDAVHAISPNAFLDTLRETVEASL
FT                   PAGRHVHLVLENEANQASQLQRGYTAQWDDDFHNALHVLLTGEEEGYYAAFADKPTEHL
FT                   ARVLGEGFAYQGEPDPRGHVRGEPSGALPPHKFVVFAQNHDQIGNRARGERLSVLVSPQ
FT                   RLRAALALTALTPMIPLFFMGEPWGAKQPFLFFTDFGPPLDDAVREGRRKEFAHFAAFA
FT                   DEAQRATIPDPNSHTTFAASRAPIADAAHGDGAQWASWFTALLDVRRRWLVPGLAQARA
FT                   VRASVLADGAVAATWELPGGLWHIAFNVGTQPVPLPPLRGRVAHVENVAADARELPVDG
FT                   FIAWHEAQA"
FT   CDS_pept        511520..513469
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="XCV0454"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22085"
FT                   /db_xref="GOA:Q3BYH8"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22085.1"
FT                   /translation="MSTRDPGGDDLNTLAAAAGVMVDWVDASDQPRQVSEQSVHAVLSA
FT                   LEFPAATAAQRADSLRRCQAQADEPAPLLTVQVGQPLPLRVAAHASGRWSDDSGASEDV
FT                   RADAQGRLRAPQRFGYWTLQIGAITQQVAVAPPRCFSVADACGQPSPRAWGMALQVYSA
FT                   RSLDDGGIGDAAGTVEWLRHAALAGADALALSPVHAARPVSGGYSPYSPSDRRFLDPLH
FT                   AAPVRILGELALDAINAVPGLRERFDGLHNAALIDWQASAHAKWELLRQLYTRVSPDHA
FT                   DLVAFRNAGGAALEGFARFAAQDFGDNDPQLHVFTQWLAARSWSDAQREAHERGMKIGL
FT                   IADLAVGFDPNGAEAAAAADTVLRGLVLGAPPDAFNADGQHWGIGAYSPTALRRSGYAP
FT                   YIALLRAVLRDRGGIRIDHILGLMRLWVVPDGASSNEGAYLAYPLHDLLNLLALESWRH
FT                   RAIVIGEDLGVVPPGIREELSQRGVMGIDVLMFTRDDDGAFVSPALWRPDAIATTTTHD
FT                   LPTLTGWRTGRDIEWRRKLELIQPAQASDDAAARNKDVARLDAAVELAGLSSARDPLLG
FT                   ALRFTATNVSPLALLPVEDALALDEQPNLPGTVEVHPNWRRRLPDPLPHARLNSALHGF
FT                   AEARRVAAVSEPHP"
FT   CDS_pept        513466..516075
FT                   /transl_table=11
FT                   /gene="glgY"
FT                   /locus_tag="XCV0455"
FT                   /product="Maltooligosyltrehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22086"
FT                   /db_xref="GOA:Q3BYH7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22086.1"
FT                   /translation="MIDLRATARLQLHAGFTLHDALAQVPYYAGLGISHLYLSPIGMAV
FT                   PGSAHGYDNIDPTVVNPELGGEDALMALSQAAREHGMGLIADIVPNHMATHAQNAWWWD
FT                   VLRNGRSARHADWFDIDWRAPGRDGKLWLAVLDRPYATALAEGLITLVIENDGSAALAH
FT                   YDQRYPIRPQTLDIPEKAARAQWLRDYNDGAKRGDGRLHKLIERQPYRLNWWRVGNDML
FT                   NYRRFFDITSLVALRVELPAVFDAVHALPLRLVAEGHLDGLRIDHVDGLTDPTGYVRKL
FT                   RSRLDAAGRTRGLKPGTLGLYLEKILAPGEHLPADWPCDGTTGYDFMDQVGGLLHDAAG
FT                   FRPLVRAWQKVSGRSGDFAQEERTARDEILRGPLQSEFNRAVGALSALARLDPPTREFS
FT                   PQMLARGLCVLLRWFPVYRTYAGAKGVTGSEAERLRATAAKAREGMPESIVAAVDAIER
FT                   WLLDDAGADRAQIALRRILRRRVEQLSAPLNAKSVEDTAFYRHGVLLSRNEVGSHPTHF
FT                   ANESAEFHAQNLERAKHYPRALLATATHDHKRGEDLRMRLAVLSEQPRWWVEQSAQFDA
FT                   LVDALESPALSGGDQQMLWQTLVAAWPIGLGADQTEPLAGYAERIAQWLLKAVREAKLH
FT                   TSWTDGSPAYEHAVQATVEQVLCSRAGLPLRRALLRASNYIAAAGARNSLVQTTLRLTV
FT                   PGVPDLYQGTEGWDLSLVDPDNRRPVDYVQRQQWLQQARDFSGLLRSWRDGAVKARLTA
FT                   LLLQLRREFPALFAKGDYQPLNVAVGGDAQALAFRRQYRGQSLVVAVTRLGAGVEGDGD
FT                   LPLLVAPATWGQASLALGEGTYRNVLDGSTLQSQRGRVALSTLFARAPVAVLLSQEN"
FT   CDS_pept        516097..516282
FT                   /transl_table=11
FT                   /locus_tag="XCV0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22087"
FT                   /db_xref="InterPro:IPR021327"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22087.1"
FT                   /translation="MNDMERQARLAQLAREIWEAEGRPDGHADRHWAMAERLVEAEERA
FT                   AEQAAEYAATPIAARQ"
FT   CDS_pept        516400..518562
FT                   /transl_table=11
FT                   /gene="glgX1"
FT                   /locus_tag="XCV0457"
FT                   /product="glycogen debranching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22088"
FT                   /db_xref="GOA:Q3BYH5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22088.1"
FT                   /translation="MATRKFTQRSRIREGRPNPLGATWDGLGVNFALYSRNATRVELCL
FT                   FDERGREQERIALPEYTDEVWHGYLPDARPGQLYGYRVHGPYAPDAGHRFNHNKLLLDP
FT                   YAKQIVGELKWAPHLFGYIIGHRDKDLSFDRRDSAAFMPKSAVIDPAFTWGQDRPPQTP
FT                   WNRTVIYEAHVRGLSMLHPAVPPEERGTFSALKTDELIDHISSLGVTAVELLPVHAFVD
FT                   DQYLLEKGLRNYWGYNTLGFFAPQARYMSTRTVAEFKQMVARLHHAGLEVLLDVVYNHT
FT                   AEGNELGPTLSFKGIDNASYYRLADDRRFYINDTGTGNTFDLTNVGALRMVMDSLRYWV
FT                   QEMHVDGFRFDLASILGRERYGFDPSGSFLDAVRQDPVLSQTKLIAEPWDIGPGGYQVG
FT                   NFPPGWVEWNDKFRDNVRAFWRGDSGQLAELATRLTGSADLFNHSGRRPTASVNFVTAH
FT                   DGFTLRDLVSYETKHNLANGEDGRDGSDHNISSNYGVEGETNDPAIKQLRRQQMRNLLA
FT                   TLLLSQGTPMLLAGDEFGHSQNGNNNAYCQDNELTWIDWTAATKAAAADQAAFVRRLIR
FT                   IRQRYPLLHRARFFDGKFDEALGLKDLTWLAPNGTEMDEAAWHDPEARALMLRLDGRSP
FT                   TTGLREIAANVTLLMLINAASTAVSFTLPAMHDEHWRVLVDTARHGGRVVAGGSEWKAP
FT                   AHSLTLLAVERDRIVSSARIVSEGAR"
FT   CDS_pept        518579..519211
FT                   /transl_table=11
FT                   /locus_tag="XCV0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22089.1"
FT                   /translation="MDVLLAGATGLVGRHVLQQLLGDTRCTGVVAMTRRPLAQIHPKLR
FT                   NQVIDFERLEHWTAPRMEAAICALGSTMKQAGSRDAFYRIDHDYPLAIARAACAQGTSV
FT                   FVLNSPAGANAQSRIFYSRVKGELERDLRQIGFPSLTFVRPGLIGGEREERRTGEHIGS
FT                   VVLGALGPLLPRRFRINPAERIAAAMVSAALAPARGEHSIEAAELAG"
FT   CDS_pept        complement(519382..520140)
FT                   /transl_table=11
FT                   /locus_tag="XCV0459"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22090"
FT                   /db_xref="GOA:Q3BYH3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22090.1"
FT                   /translation="MSNTAVRPQRVLIAGGSRGIGLAIAEGFVRHGAQVSICARNAAGL
FT                   AHAADALAAHGTPVHTLPCDLADATQIDAYVHAAAQALGGLDVVINNASGFGHGNDDAS
FT                   WQAGLDVDLMAAVRCNRAALPYLRRSAAAVILNISSINAQRPTPRAIAYSTAKAALDYY
FT                   TTTLAAELARERIRVNAISPGSIEFPGGLWDKRSREEPELYARIRDSIPFGGFGQVQHV
FT                   ADAALFLASPQASWITGQVLAVDGGQSLGV"
FT   CDS_pept        complement(520104..520325)
FT                   /transl_table=11
FT                   /locus_tag="XCV0460"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22091"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22091.1"
FT                   /translation="MRCAWLFSAALRNLAMQTAEANGPVQRKHAGRSSSVPHLRYAWRP
FT                   RGPRLSDNTAIQTEQPPCQTPQFVRNAC"
FT   CDS_pept        520517..521926
FT                   /transl_table=11
FT                   /locus_tag="XCV0461"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22092"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22092.1"
FT                   /translation="METHITVIGAGFCGTALVRALAQTADAQVRITLVGVADTFGSGIA
FT                   YGAARPEHLLNVRAKDLGIDAQAPGAFADTLHLGESGRLEFLPRLAYGDYLRSELDAAV
FT                   SSAQASVMRLSQEAVAVERVRKGFRVFLANGDAFQSDRVVLAVGALQPQALAGIGPRLS
FT                   VHPRYIGWPWQGDALARLSPDDDVLIVGTGLTMVDVALTLHTRGHRGRLLAISRRGLAP
FT                   QAHLRQPGAPLELPPHLQRALKDADLRGLLRGVRQLSAVVDDWRRVVDALRPHLQPLWQ
FT                   RLELPQRARFLRHLRPYWEVARHRVAPGAAEQLAQLQASGQLQIVSARLLRARWVPDGV
FT                   EAVIRPRGAADAQTGHYDAVIRATGLDTDIDRTSDPLIAGMREAGLLRADPLGLGVDTD
FT                   AQLRVRDSAGQIVPGLYCVGPLLRGRYWEITAVPELRVATRALADRLLLGATPALQPTP
FT                   EHVPREVNARL"
FT   sig_peptide     520517..520582
FT                   /locus_tag="XCV0461"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        522157..522588
FT                   /transl_table=11
FT                   /gene="virK"
FT                   /locus_tag="XCV0462"
FT                   /product="VirK protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22093"
FT                   /db_xref="InterPro:IPR010694"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22093.1"
FT                   /translation="MPRLVPAALFATLCACALPALATESLNNRAEVLAALDAGYDVSVS
FT                   TDLARCTPEEGTPATQTRGGRHIDAYRITADGTVAFSDAHFTVANDGKPIQQFMRYQLR
FT                   PDDTLRFTTYMYDLPGLQQRGPVLAYQCKINAGVRFHAD"
FT   sig_peptide     522157..522222
FT                   /gene="virK"
FT                   /locus_tag="XCV0462"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(522714..524222)
FT                   /transl_table=11
FT                   /gene="oprN2"
FT                   /locus_tag="XCV0463"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22094"
FT                   /db_xref="GOA:Q3BYG9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22094.1"
FT                   /translation="MSSLRTLAVFVAASLVAGCAVGPDYARPEVPLPDRYIGQADIAQR
FT                   QAAVPADLSTWWDGFNDPDLSRYVTAALAQNLDLAQAGARVAQARAGLSAATAALLPAG
FT                   NVSGSATRAYQSLETPLGQVISSTPNFDRHASVYEANLGASWELDLFGGLRRGRQAALA
FT                   DYQATEAGAAATRLAVAAQTADIYISIRGLQARLDVAQRQVATQRGLLSMVTLLHGKGL
FT                   AAELQLQQAQGALAQAQAGVPGLEAGLVAAMNALDVMLGVPPGTHRAELSATKPIPPAP
FT                   QIADSGTPGDLLRRRPDLIVAERRLAASNARIGVAMAEYYPKFSLSGLLGSATAISGAN
FT                   LFTGDAAQSSGVLGLRWRLFDFGRINAQIAQAKGQQAEQLAAYRLAVLRATEDVENAFT
FT                   ALIKREQQAAVLTQGVDALGKARGASALAYEKGTVSLIEVLNADDSLLRASDAQVQART
FT                   DAARSAVATFKALGGGWQAGGAGPAAIAVAVDSNRHQDDTTATK"
FT   sig_peptide     complement(524145..524222)
FT                   /gene="oprN2"
FT                   /locus_tag="XCV0463"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        524311..524928
FT                   /transl_table=11
FT                   /locus_tag="XCV0464"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22095"
FT                   /db_xref="GOA:Q3BYG8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041478"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22095.1"
FT                   /translation="MSKASNYPVSGRGPADHDVRDQIVVAATEHFSRYGYEKTAVSDLA
FT                   REIGFSKAYIYKFFESKQAIGEMICSHCLGEIEAEVLAAVSAAASPPEKLRSLFKAIIE
FT                   ASLRLYSRERKLYEIATSAATERWPPVIAYEGHIQALLQDILVQGRQNGDFERKTPLDE
FT                   LTQATYLVMRPYINPVLLQHSLDHAGDVPLLLSSLVLRSLSP"
FT   CDS_pept        525006..526154
FT                   /transl_table=11
FT                   /locus_tag="XCV0465"
FT                   /product="membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22096"
FT                   /db_xref="GOA:Q3BYG7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22096.1"
FT                   /translation="MRRCRLVAFTFLCVLPLALSACGGKAQPDPRTAAPRVRVATAGDA
FT                   SAAVRTFSGTVAARVQSDLGFRVAGKVSERLVDAGQSVKRGQPLMRIDPADLQLAARAQ
FT                   QDTVAAARARAQQTAEDEARYRDLRGTGAISASAYDQIKAAADAARAQLSAAQAQADVA
FT                   RNANRYTDLAADADGVVMETLVEPGQVVAAGQPVVRLAHAGPREAVIQLPETLRPQVGS
FT                   VAQATLFGNAAVTVPATLRQLSESADRLTRTFEARYVLDGALAQAPLGTTVSVRVPGGT
FT                   ASGNQAGLQVPLAALFDAGKGPGVWVIAGNPTRVSWRPVTVLGLDDDHANVAGKLARGE
FT                   RIVALGAHLLREGEQVRIAGEGVAGSSAATAGSTAKAAGAQP"
FT   sig_peptide     525006..525068
FT                   /locus_tag="XCV0465"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        526151..529249
FT                   /transl_table=11
FT                   /locus_tag="XCV0466"
FT                   /product="RND superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22097"
FT                   /db_xref="GOA:Q3BYG6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22097.1"
FT                   /translation="MSEGRFNLSALAVRERSITLFLIFLISLAGLVAFLKLGRAEDPAF
FT                   TIKVMTIVTAWPGATPQEMQDQVAEKLEKRMQELRWYDRTETYTRPGLAFTTLTLMDST
FT                   PPGEVQEQFYQARKKAGDEVANLPAGVIGPLINDEYADVTFALFALKAKGEPQRLLARD
FT                   AETLRQRILHVPGVKKVNIIGEQPERIFVEFSHERLATLGVSPQDVFAALNAQNALNAA
FT                   GSVETRGPQVFIRLDGALDSLQKIRDTPLVVQGRTLKLSDIATVKRGYEDPSTFMIRSG
FT                   GEPALLLGIIMRDGWNGLDLGKSLDAEVGAINAELPLGMRLSKVTDQAVNIDASVGEFM
FT                   TKFFVALLVVMLVCFVSMGWRVGIVVAAAVPLTLAAVFVVMLATGKNFDRITLGSLILA
FT                   LGLLVDDAIIAIEMMVVKMEEGYSRVAASAYAWSHTAAPMLSGTLVTAVGFMPNGFAAS
FT                   TAGEYTSNMFWIVGIALIVSWVVAVVFTPYLGVKMLPDLKKVEGGHAAIYNTPRYNRFR
FT                   QALGRVIARKWLVAGSVVGLFVLAVVGMGMVKKQFFPISDRPEVLVEVQLPYGTSINQT
FT                   STAAAKVEDWLSKQKEAKIVTAYIGQGAPRFFLAMGPELPDPSFAKIVVRTDDQHERDA
FT                   LKLRLREAIAQGLAPEARVRVTQLTFGPYSKFPVAYRVSGPDPTVLRGIAAQVMQVMQD
FT                   SLMLRTVNTDWGVRTPTLHFSLDQDRLQAVGLTSAAVAQQLQFLLSGVPTTLVREDIRS
FT                   VQVVARSAGDTRLDPARIADFTLAGGNGQRVPLSQVGKVDVRMEEPVMRRRDRVPTITV
FT                   GGDVDDTLQPPDVSAAITRQLQPIIDKLPSGYQIKEAGSIEESGKATAAMLPLFPIMLA
FT                   ATLLIIILQVRSISAMVMVFLTSPLGLIGVVPTLILFQQPFGINALVGLIALSGILMRN
FT                   TLILIGQIHHNEAEGLDPFHALVEATVQRARPVILTALAAILAFIPLTHSVFWGTLAYT
FT                   LIGGTLAGTVLTLVFLPAMYSIWFKIRPDPGKGNNAPDIARPA"
FT   CDS_pept        529382..530188
FT                   /transl_table=11
FT                   /locus_tag="XCV0467"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22098"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22098.1"
FT                   /translation="MQQQTVVLITGVSSGIGRAAAEHFARAGCIVYGSVRHLAGATPLT
FT                   AVELVEMDIRDAASVQRAVDGIIARAGRIDVLVNNAGTNLVGAIEETSVDEAAALFDIN
FT                   LLGILRTVQAVLPHMRARGQGRIVNVSSVLGFLPAPYMGVYAASKHAVEGLSETLDHEL
FT                   RQFGIRVTLVEPAYTKTSLGSNSPVVQATIAGCDRERGVVARAVTHSIDTAPEPHGVAA
FT                   TVVEAALGRWRMRRTPAGQASLLSKLRRFLPASAVDGSLRKQLGLR"
FT   CDS_pept        530190..530702
FT                   /transl_table=11
FT                   /locus_tag="XCV0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22099.1"
FT                   /translation="MRQGVDAAVNAGVGRTARLRQSRRACRHLAVLQRHLMLDSPRMPP
FT                   WPHNRRPVPTTDVAMRKTYQLNLEGKNRDRLLESSKHDIRKYIRRERRKELPAGADYWD
FT                   FEMRFGVDEASAVALPPAELIRSINALVADGGEQFFVEILRKPGKRTPRAQSDHAFGDG
FT                   ELDFEQD"
FT   CDS_pept        530699..530917
FT                   /transl_table=11
FT                   /locus_tag="XCV0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22100"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22100.1"
FT                   /translation="MRFDRRPVGGAPLRNEQLLADCRPYRMDEPGLARCGWQLAGVQEA
FT                   CGALTLASALVGEATGTLPPANPAGAW"
FT   CDS_pept        complement(531139..532500)
FT                   /transl_table=11
FT                   /gene="rhlE"
FT                   /locus_tag="XCV0470"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22101"
FT                   /db_xref="GOA:Q3BYG2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22101.1"
FT                   /translation="MRGQRTCTSFRHARRRQCADNRAMSLKADLLSLQLQPVFESALAR
FT                   AGVHALTPIQVAMIPPMLAARDLIATAQTGSGKTLAYALPLLLQRLQAPEQAPRVLGGL
FT                   ILVPTRELVAQVAQTLLSLAAALPRRLKIVAATGGEAINPQLMALRGGADIVIATPGRL
FT                   LDLVTHNALRLSQVSTLVLDEADRLLDLGFGAELDRILALLPAQRQSVLVSATFPAAIA
FT                   SLAKRRLRDPLRITHDAMPEQAPSITQRAIAVDAGQRTQLLRHLLLEHGWPQLLVFVAS
FT                   RHGADKVAEKLSKTGIAALPLHGELSQGRRERTLRAFKQADVQVLVATDLAGRGIDIDA
FT                   LPAVLNYDLPRSTVDYTHRIGRTARAGASGVAISFVTADSAQQWRLIEKRQGLRVPTSV
FT                   IEGFEPTPVQAPAPDHAPGAAVRAADDNGGIKGKRPSKKDKLRAAAQAQAGKPG"
FT   CDS_pept        532770..533891
FT                   /transl_table=11
FT                   /gene="avrRxv"
FT                   /locus_tag="XCV0471"
FT                   /product="avirulence protein AvrRxv"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22102"
FT                   /db_xref="InterPro:IPR005083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYG1"
FT                   /protein_id="CAJ22102.1"
FT                   /translation="MCDSIRVQFRSIQKMVVKMKKFFRSLGVGGSSSSRFQHHIPEADS
FT                   APSSKASTPPASPPPDSPPSNSAFSALPTRPRKKAEALSDAVESRGHLAPPSLVSYANA
FT                   TLDQLRRNEPISESLRLMDIENLPHLVRSYDNRLNNLNLRSFDTPGQFLHDLSRWHKTG
FT                   LPLRAVVRLDEDPRRWHRVAFDVRNHESGHTTIIALEPASAYNPDHMPGFVKMRENLTS
FT                   QFGRKISFAVIEAEALKSIGGCVIFSLDYALAAYQERSTFDQWHKDLRKKGNIKGMTPE
FT                   SQHLNELGVYLLKGTRLLPANFYKHAHSRRTIDELEADQPGASGTDVRSGRAAVYKESL
FT                   SRRLEEFQVQRDKTYSMSIEASRARKIRHALES"
FT   CDS_pept        complement(533926..534195)
FT                   /transl_table=11
FT                   /locus_tag="XCV0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22103"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22103.1"
FT                   /translation="MLRNLDQAPGWLHQVQIRSMDKNTAPVLTSLALSHLSRCAGSRCH
FT                   WMILPGVATSPSDTANLIRQACRCAFHQGRLITYRKKARWEAGL"
FT   CDS_pept        complement(534361..535869)
FT                   /transl_table=11
FT                   /locus_tag="XCV0473"
FT                   /product="putative dihydrolipoamide acyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22104"
FT                   /db_xref="GOA:Q3BYF9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22104.1"
FT                   /translation="MSDNKNFHLPDLGEGLPDATIVEWFVKEGDTVRLDDPLVSMETAK
FT                   AVVEVPSPFSGTVVKLAGAAGDVIVTGSVLAQFALDASQPQRADGQDTGHSHGPAPTHA
FT                   PTPSTGDSAAGHTTRVVASDNGGEIADADAGDGSSDRDDAGTVVGAMQSSNAVQSEQAI
FT                   TVGGVRAMPVVRALARKLRVDLVQVRATGPDGTVTLADVKQAAAAGTAQPSPGAHGAPT
FT                   SPASGRGGPIGDGGRAAGSAADGRDRPATAPLLPPAGEGARRADEGNARSTLSASGKPM
FT                   RTQSPGISAKGQPEQLKGVRRNMARVMADAHTKVVPTTLNDDADLHAWQPGNDVTVRLV
FT                   RGIVRACQAVPALNAWFDGDALSRTLHHQVDIGIAVDTEEGLFVPALRNADMLDAHGIR
FT                   EGVNRLRQQVESRSIAASELSGYTISLSNFGMFAGRYATPVVVPPCVAIVAAGRARYQL
FT                   TPVMGGVETHKVMPLSLTFDHRAATGGEAARFLRALLDDLALAN"
FT   CDS_pept        complement(535866..536249)
FT                   /transl_table=11
FT                   /locus_tag="XCV0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22105"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR014593"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22105.1"
FT                   /translation="MRARLLCDHRAAYANPVRFQAGQQVGVGVRDEEWPAFAWVTTDSG
FT                   RAGWAPLAWLRPLGDGRAEALRDYDARELDAQTGEDVLLHHEHGGWWWSERADGTQGWL
FT                   PAADLELLDDTTPQLPAAQENLP"
FT   CDS_pept        complement(536251..537321)
FT                   /transl_table=11
FT                   /locus_tag="XCV0475"
FT                   /product="putative pyruvate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22106"
FT                   /db_xref="GOA:Q3BYF7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22106.1"
FT                   /translation="MDELTHVPADTSQHASAPYNAAATRGEIAMSSPITLIEAITQALA
FT                   WELEHDPAVLVLGEDVGVNGGVFRATAGLQQRFGSDRVLDTPLDETTIAGLSVGLAAQG
FT                   MKPVAEAQFDGFVYPMVDHLICHAARLRNRTRGRLHCPMVLRVPWGGGIRAPEHHSEAN
FT                   EAIFTNVPGLRVVLPSSPQRAYGLLLAAIRDPDPVIYMEPKRIYRQYKEVVANDGQALP
FT                   LDVCFVLRDGTDVTLVTWGAQVKEALEAADKLAGEGISAEVIDVATLRPLDFDTIAESV
FT                   AKTGRCVIVQEAPRTAGFGAEIAARLAEQSMYDLVAPVERVTGYDTHIPLFRLEMKFLP
FT                   SVERIVAAARRAVAAG"
FT   CDS_pept        complement(537314..538402)
FT                   /transl_table=11
FT                   /locus_tag="XCV0476"
FT                   /product="putative pyruvate dehydrogenase E1 alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22107"
FT                   /db_xref="GOA:Q3BYF6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22107.1"
FT                   /translation="MSVAAQFQIDYLQYMDADGQWVRDDLPADAANPQQLLALFKRMLF
FT                   VRTFDTKSVALQRTGKLGTYAACIGHEATHVGIGASMRSGDVFAPSYREYGTMFERGVR
FT                   PRDVLLYWGGDERGSDYPRDADAAIDFPICVPISTQCLHAAGSALSFKLQGKPQVAVAC
FT                   CGDGGSSKTDFYAALNSAGAYKLPLILCVINNGWAISVPRSAQTGAQTLAQKGLAGGLQ
FT                   CLQVDGNDLVAVLEAMRQARVRALAGDGGTVIEFLTYRLSDHTTADDARRYRGEEEVKQ
FT                   GWAREPLLRLRRYLTAQGLWDAAQEDAWKAECSARVDEEVNAYLNTPVQPVEAMFDYLY
FT                   GDPPAELLAQRAEVMALESRHG"
FT   CDS_pept        complement(538580..542161)
FT                   /transl_table=11
FT                   /locus_tag="XCV0477"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22108"
FT                   /db_xref="GOA:Q3BYF5"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22108.1"
FT                   /translation="MHVLQRRAAVFLCALAVAGHANAQVVISQVYGGGGNSGATLRSDF
FT                   IELHNIGGAPVSLDGWSVQYASAAGSSWQVTPLAGTVPAGGYYLIKQADGSGGSVALPT
FT                   PDAIGTLAMSGTAGKVALSNSASALSGTCPTGNADLVGYGSTASCAEGNAPTPAPSNTL
FT                   AVLRGNDGCTDTDNNAADFATGAPAPRNAASPARLCSGGGQPVATLADVSQAEGNAGTR
FT                   SLVFTLSLSQPAGAGGVSFTAATVDGTATAGSDYVALPATSLRIAAGERSATISVDVLG
FT                   DTTPEPDESFRLQISGLTGALPATLSATGTILNDDFSLLPIHAIQGKGTRSPLEGQVVA
FT                   TSGIVTARRSAGFFLQAPDSEADADPSTSEGVYVYTGSPPPEAAAIGNRVRVQGTVIEY
FT                   VPTADPTQPPLTEIGGSLTVLADSTGNPLPMPVALSANFPNPNGAFDQLEALEGMRVAA
FT                   ASLTVNTPTGGSVNETNATATSNGVFHAVVTGVPRAYREPGVQLPDPLPAGSPAGVPRW
FT                   NTNPEVIAVGSAGVGAERLDLASGCQVLDVVGPLDYSFRRYTLYPERTPQVSCNGADQP
FT                   RPAPVPQADDVAVATYNMERFFDDQNDPAIGEPVLTPAAFQARLNKASLAIRNYLHTPD
FT                   ILGTVEVENLSVLQTLAARVNADAVAAGQQDPKYVAYLQEGNDVGGIDVGFLVKTAQIA
FT                   GGVARVEVLSIAQEGKTTTWTEPGGGVSLLNDRPPLVLTANVHQADGRVLPLTAIVVHQ
FT                   RSLNGAETDDAAGMRIRAKRQAQAEYLARLLQTRQQLNPDEKVLVMGDFNAFEFNDGYV
FT                   DAVGTVTGKPAPDAQTVVGGDGTDLVNPDYTDLTWFNTPDQSYSYAFDGNVQSLDHILA
FT                   NDALMRAPQIASLSVGHARINADFPGTARNDANTPTRLSDHDPTVVLLRMTKQVNADLG
FT                   VAVTAARDQVTEGERIDFSVDVENRGPDSAAFAAVALAFDAAVSPCVTAAPGWVCQPPQ
FT                   TGTQTVVTCTIAALAAGNAQNFSVQVEADAALAGRTLTLAASAASQTPDPQSGNDTDAA
FT                   SVTVQAQPRSDLAVRFDGPSSLPTTAFSATYRVLVSNVGAAPAQGSGLVIEGNTVSALS
FT                   QLVPPQGWRCDKQTQSLRRARFVCSTAAVVLPGAQATFQLTVAARPIPADGAVRVQATA
FT                   TSRSPDANPADNTALIVTPIGGGDGRR"
FT   sig_peptide     complement(542093..542161)
FT                   /locus_tag="XCV0477"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        542366..543484
FT                   /transl_table=11
FT                   /locus_tag="XCV0478"
FT                   /product="tryptophan 2,3-dioxygenase"
FT                   /EC_number="1.13.11.11"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22109"
FT                   /db_xref="GOA:Q3BYF4"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22109.1"
FT                   /translation="MPIVHTDFLRGTCAHISLAPIHSGNPARAASSQPGPAIAVGQYAS
FT                   PSAIRQSRIPNPESRPLRYPAWPDLQRDAMPVDKNLRDLEPGIHTDLEGRLTYGGYLRL
FT                   DQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLA
FT                   RSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQV
FT                   FAYDPHGQARLREALEAPSLYEEFLRYLARFGHAIPQHYQARDWTAAHVADDSLRPVFE
FT                   RIYENTDRYWREYALCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQA
FT                   LALTFFPELFDVRTSVGVDGRPPQGAPDAAQG"
FT   CDS_pept        543734..545254
FT                   /transl_table=11
FT                   /locus_tag="XCV0479"
FT                   /product="proton-dependent oligopeptide transporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22110"
FT                   /db_xref="GOA:Q3BYF3"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22110.1"
FT                   /translation="MSVDATAPTSASTPPQPPAPPEFPTLLGHPRPLWLLFMTEFWERF
FT                   AFYGIRWALVLYIVAQFFNGDATGQAPAGRTYGAYLALVYAAAIFGGYVADRVLGYQRS
FT                   ILVGAAVMATGLFLIAIPDHTMFEIGLATVVVGNGLFKPNISTMVGKLYSVADPRRDSG
FT                   FTIFYMGINLGAMISPVLTQLLAEKVFGTEVMPSYKMVFMASGVGMLISLVWFWFGRVQ
FT                   LKGIGAPAPNAQGMGRVLMVLVGCLLAIPGVYFLLAVGADVLQIVLTVLFIGLSVMLLV
FT                   EGIREGKVQRDKVIAMLIIFAFNVLFWMFFEQAGSSFTFLADNIVNRNFGSWTFPTAWF
FT                   QSVNSIAIIALAPVIAWIWVKSGRFNPSIPRKFGLGLLFNGLAFLLLMFALSSLVNDAG
FT                   KIPFWTLFMVYVIQSVGELCLSPIGLSMVTKLAPVRLVGFGMGGWFLSTGIGNNLSGIF
FT                   AGHVSGNEGMSVSSALGGYTFGFWALVGAGALLFLIAPLINKLMHGVK"
FT   CDS_pept        545266..545856
FT                   /transl_table=11
FT                   /locus_tag="XCV0480"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22111"
FT                   /db_xref="GOA:Q3BYF2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22111.1"
FT                   /translation="MPIKPLVCGLLLTGLLSACGQTSSPQEAPKPLDTSMQKPPSADPS
FT                   QPVSSGNTPTAADIAAAAALNAQYDPSRDPAADLETAKVEAKRGGKRIVLNVGNAACEP
FT                   CKALDELMGGDAELRSFRDAHFVVVKVNRDAANENAAFLSAFAQLNDAPSLLVLDSDGK
FT                   LLTTQSGPELRKGEGFDRKKLFDFLKQWAPPQA"
FT   sig_peptide     545266..545325
FT                   /locus_tag="XCV0480"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(546215..546703)
FT                   /transl_table=11
FT                   /locus_tag="XCV0481"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22112"
FT                   /db_xref="GOA:Q3BYF1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22112.1"
FT                   /translation="MSDLDSPHPPQYPVLLNLEQFLPYRLSVLSNRISSNIAKVYGDRY
FT                   GMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRR
FT                   SMLALSPAGRQVYETVAPLVNEMEQRLMSVFSTEEQQVLETLIDRLAKDGLPRMASKD"
FT   CDS_pept        546871..547941
FT                   /transl_table=11
FT                   /locus_tag="XCV0482"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22113"
FT                   /db_xref="GOA:Q3BYF0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22113.1"
FT                   /translation="MQVTTFDNPMGIDGFEFVEFAAPAGQGEQLHDYFRKMGFSAVLRH
FT                   RSRPITVYRQGGVNFLLNEDPDSFAADFAAAHGPCACGFAIRFRTPSETVLQTVLGNGG
FT                   EAVQNKPDTRAVPAPVVKGIGDCMLYLVDRYGEAGSIYDADFEPIDGADQHPAGFGLTF
FT                   IDHLTHNLYFGNMQRWSDYYERLFNFREIRYFDIKGAKTGLVSKAMTAPDGIVRIPLNE
FT                   SSDPKSQINEYLDAYQGEGIQHIACFTDDIYTSVEKMRTAGVSFLDTPDTYFDVVDLRI
FT                   PAHGEDVERLRRNKILIDADPDTKQRKLLQIFTTNCIGPIFFEIIQRKGNEGFGEGNFQ
FT                   ALFESIERDQIKRGVL"
FT   CDS_pept        548113..548505
FT                   /transl_table=11
FT                   /locus_tag="XCV0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22114"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22114.1"
FT                   /translation="MKIKPPLPTVTRAHARASRRHMTEAERALWRRPRGNQLQGFKFRR
FT                   QHPIAPYIADFCCIEAKVIVELDGSQHQASFDQARTRWLQSKGWIVLRFWNNDVLLSLD
FT                   AVVEAIFTIVATPYPHPNPPPGGRGA"
FT   CDS_pept        548566..549885
FT                   /transl_table=11
FT                   /gene="hmgA"
FT                   /locus_tag="XCV0484"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22115"
FT                   /db_xref="GOA:Q3BYE8"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22115.1"
FT                   /translation="MPMHDQTSYMTGFGNEFATEAVAGSLPVGQNSPQRVAHGLYAEQL
FT                   SGTAFTAPRGENRRSWLYRIRPAAVHGRFSLIEQSRLHNDFGGGPVPPDQMRWSPLPLP
FT                   ATRTDFVDGLYTMAGNGSPEAMTGVAVHLYAANASMRDRFFYNADGELLLVPQLGRLRV
FT                   CTELGVLELEPQQIGVIPRGLRFRVELLDSEARGYVCENFGGLLRLPELGPIGANGLAN
FT                   PRDFQTPRAAFEQREGRFELVAKFQGHLWRADIGHSPLDVVAWHGNYAPYRYDLRRFNT
FT                   IGSISFDHPDPSIFTVLTSPSDTHGTANMDFAIFPPRWLVAQHTFRPPWFHRNVASEFM
FT                   GLVHGVYDAKAEGFAPGGASLHNCMSGHGPDAATFDKASQADLTRPDVIADTMAFMFET
FT                   RAVLRPTQQALNAAHRQADYQQCWSGLRAAFQPPTTEDAT"
FT   CDS_pept        complement(550195..550746)
FT                   /transl_table=11
FT                   /locus_tag="XCV0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22116"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22116.1"
FT                   /translation="MIPRKTELALTTLQSHRSPLTLLQRRALILADGQRDLATLATLLG
FT                   GDGTGLVQSLCAMGYLDLGPAACGAAGQTRTAATAALPDVHEAPVALPDAGPSEEELRR
FT                   LRRRAATNARLYLLDILQLQRNALAAALHRQLHAARDDDQIRTTIAEALHALPQITSAS
FT                   YAERVRTRIGELLPETLQAA"
FT   CDS_pept        550888..551535
FT                   /transl_table=11
FT                   /locus_tag="XCV0486"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22117"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22117.1"
FT                   /translation="MTYRLLGLMSALLVLTSCNRADQSPAPAAPANAEHVPVAAADDQP
FT                   AATVPPATAPAGTFPPRTQQDPAALARMDGYGDLRFGMDASQARAAWGGDLQGEAAPDN
FT                   GCYLLRPRWASDPRRLGFMFEGGQLVRLQTNEAKETAPGGGKVGMTLAQLRALYPDGLT
FT                   EQPHKYIPGALTLRLPDAATQTALVFETDADGKVTSWRVGKPPQVDYVEGCG"
FT   sig_peptide     550888..550947
FT                   /locus_tag="XCV0486"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(551877..552296)
FT                   /transl_table=11
FT                   /gene="phag"
FT                   /locus_tag="XCV0487"
FT                   /product="putative monovalent cation:proton antiporter
FT                   subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22118"
FT                   /db_xref="GOA:Q3BYE5"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22118.1"
FT                   /translation="MIALTEYLLSALLLAGTFFILIGAFGLVKLSDFFKRLHAPTKAST
FT                   LGVGCVLLASVGYHLFLGVDPQPRELLITVFLFITAPISAHLMAKAALSLMMENRPEVP
FT                   NHGDAQQEGLPQVKGDLGENEETEKQHPGPASEGG"
FT   CDS_pept        complement(552293..552577)
FT                   /transl_table=11
FT                   /gene="phaF"
FT                   /locus_tag="XCV0488"
FT                   /product="putative monovalent cation:proton antiporter
FT                   subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22119"
FT                   /db_xref="GOA:Q3BYE4"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22119.1"
FT                   /translation="MTGHMFIESTIVICMHAVGLAILMALWRLLRGPTVPDRILALDTL
FT                   SVTAIAELMLLGMYLDSPIYFEAALVIAMLGFGSTVVLSKYVLRRSIVE"
FT   CDS_pept        complement(552574..553080)
FT                   /transl_table=11
FT                   /gene="phaE"
FT                   /locus_tag="XCV0489"
FT                   /product="putative monovalent cation:proton antiporter
FT                   subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22120"
FT                   /db_xref="GOA:Q3BYE3"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22120.1"
FT                   /translation="MNTRLPLRRRLFPSPPLSVTVFVFWLLLSDSFGLQQWVLGMLLGV
FT                   VVPIFAARLDREFAQIGSLRSVPRMLLVAAGDIVRSNIKVAAQVLGPESRIHPGFIWVP
FT                   LDIANIHGIAALTSMITLTPGTVSAALSDDRKYLLVHVLHLDDPQALIAEIKTRYEKPL
FT                   MEIFP"
FT   CDS_pept        complement(553077..554621)
FT                   /transl_table=11
FT                   /gene="phaD"
FT                   /locus_tag="XCV0490"
FT                   /product="putative monovalent cation:proton antiporter
FT                   subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22121"
FT                   /db_xref="GOA:Q3BYE2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22121.1"
FT                   /translation="MNHLLILPILIPMLGASASLFVEHRRYGPRVQRSVAWVSIALLAA
FT                   AVIALFARAADGRILVYLLGDWPARIGIVLMGDRLSAWMLLTTLILGSACLLHACAGWD
FT                   RRAPHFHALFQFQLMGLNGAFLTGDIFNLFVFFEVMLIASYGLLLSGGRGLQMRVGLHY
FT                   VVFNVCASTLFLIALGLLFGVFGTLNMAELSQRIADLPAQDLPLAKAALGLLLLVFCSK
FT                   AALLPLYLWLPETYSRAPAAVAALFAIMTKVGLYAALRVSSLWFGAGAGALHGFGRHAL
FT                   LWLGIATLLMAAFGVMAASRLRVMVSYLVVFSAATLFIAFSLDDAGALGAGLYYLPHSS
FT                   FVAAALFMVSDLIRRRRGSASDRKEVVAPLPGRAIPGTMFMIAAVAVAGLPPLSGFLAK
FT                   AALLQHVPEGLVGPVWIAVLGSSLLMVIGLTRAGVRLFWRVPAAAENAPELQPPRRGRM
FT                   RPVETAATVLLLSGLVAMTGAAGPLMHYTDAAAAQLRDPGAYVDQVRATTPQRRQP"
FT   CDS_pept        complement(554618..554992)
FT                   /transl_table=11
FT                   /gene="phaC"
FT                   /locus_tag="XCV0491"
FT                   /product="putative monovalent cation:proton antiporter
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22122"
FT                   /db_xref="GOA:Q3BYE1"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22122.1"
FT                   /translation="MELAVASAIGVLTALAIYLLLRARSFDVILGMTFLSYATNLLIFA
FT                   GGRLRSGQAPVLRDGVPAELMHHTDPLPQALVLTAIVIAFAMTAVSLVLAIRSRSDNGS
FT                   DHVDAHEDAATGTDTRQARR"
FT   CDS_pept        complement(554992..557820)
FT                   /transl_table=11
FT                   /gene="phaA"
FT                   /locus_tag="XCV0492"
FT                   /product="putative monovalent cation:proton antiporter
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22123"
FT                   /db_xref="GOA:Q3BYE0"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22123.1"
FT                   /translation="MPFSLEILLALPFVMAAAAALLWRASRSITAWLAAAAPLAGLLVL
FT                   ALLTPAVLRGEVIASDHAWLPQIGLMFSLRLDGLAWMFALLVLGIGALVVLYAHYYLSP
FT                   RDSASRFFAYLLLFMGAMLGMVLSGNLLLLMVFWELTSISSFLLIGFWSHRKDAREGAR
FT                   MAFVLTAGGGLSLLGGVLMIGRIVGSFQLDAVLAAGDVIRASPLYPYALGLVLLGIFTK
FT                   SAQFPFHFWLPHAMAAPTPVSAYLHSATMVKAGVFLLARLHPALAGTDLFFYTVTSIGA
FT                   ITVLLGAWHAIFQHDLKGVLAYSTISHLGLITMLFGLSTPMAVVAGVFHLINHAVFKAS
FT                   LFMAAGIIDHETGTRDMRKLGNLRRLMPVTSALAITASLAMAGIPLLNGFLSKEMFFAV
FT                   ALDTEAPQLMRILASTAALLAGLLGVAYSLRFVHDTFFGEGPRALDTTPHEPPRWMRIP
FT                   VDVLVLTCVAVGIVPAWTVAPVLRAGATAILGDQLPDYSLALWHGVNLPLAMSVAGIVG
FT                   GALLYVALRRTLDLYAIQNRSPGKALFQWNLRALFSATARMTDAVTNGNLQRMLMLLVL
FT                   SAVVVALVPFLQGGALPQWPAPMPMPALGWMVWLLMIACALGSLFLYKQRLLAVLVLGG
FT                   TGLAVSLTFVFLSAPDLALTQLLVEMVTLVLMLLAMNYLPERSLPERARLRKMRDAAIA
FT                   IAGGAGLAALAYTLMTQPSHSVAGELLQRALPEAYGRNVVNVILVDFRGFDTFGEITVF
FT                   AIAGLVVHALLRRARMAPERTMPGPPIKLPVPADLAQIMFPLTLTVSLFLFLRGHNAPG
FT                   GGFIAGLVLAVPLLMQYVIQGTASVESRFGFDYIRLIGIGLLCALISGAGSLVFGLPFL
FT                   SSGHLEIPLPLLGELELASALGFDTGVYLVVFGAAMLMLSMMGTIKPSRTRSSQRGEID
FT                   PTQRSTRTAEQH"
FT   CDS_pept        557939..558889
FT                   /transl_table=11
FT                   /locus_tag="XCV0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22124"
FT                   /db_xref="GOA:Q3BYD9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22124.1"
FT                   /translation="MPHSLCCRHACIDNCPVTAANPAPSTAASAPRALVFGGSGQIGER
FT                   LLIRLLSSRWQVTAWSRQPRAARSGLIWRQGDLAVPAAAGEAFEVIFSCGPLDHFARWY
FT                   AENPVVAPRIVAFGSTSVEVKEHSIDAAERDVAQRLATAEQALFSAARARGASATVLRP
FT                   TLVYGAGRDKTLTQIAGLAQRTGAFVLPANATGLRQPVHVEDLASAALAVVGQPATQQR
FT                   SYAVGGGEVLAYTQMVERVLEALPRPARLYQVPPSLFGLALTAAQRLGRLRGLNAAALQ
FT                   RMREDLVFDLEPARRDFGYAPRAFRPLPEELGIGA"
FT   CDS_pept        complement(558915..559400)
FT                   /transl_table=11
FT                   /locus_tag="XCV0494"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22125"
FT                   /db_xref="GOA:Q3BYD8"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22125.1"
FT                   /translation="MSQSTTTARPIERYFASYSDDHQNATNQQIHVLAVPAILWSVVAL
FT                   LWCIPVGGSWFSSGVWAALSMFAAWSYYNRLSRPLGLGMLGIFFFFGCLCRLIEGRIGL
FT                   GGLFTTALTVFVLAWIAQFVGHKIEGRKPSFLTDLTYLLIGPIWVLAKAYRQLGWRY"
FT   CDS_pept        complement(559497..561095)
FT                   /transl_table=11
FT                   /locus_tag="XCV0495"
FT                   /product="Zinc metalloprotease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22126"
FT                   /db_xref="GOA:Q3BYD7"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22126.1"
FT                   /translation="MQFHVLGAAICCALSFSAAANAADVSANAAVSRAQSLLGNNASAL
FT                   ANRAPADAFIARDSIVDADGTEHVRFDRTYQGLPVIGGDVVVHSRRGVMRELSQTMDTT
FT                   VRPSLVPGIDAATALRVAGSHFDVAQDAAPRASLALYARQGAPRLVYEVIYSGVKPDQT
FT                   PTEMHYIVDAVNQRILESWDTVHTACSGGTSAAGTGRSLYAGSVTVNTTRCSSTSYEMT
FT                   DLSRGSGATYNMRNSTSGNGTLVTDADNAWGSGTTGDTVTAAVDAHYGVALTWDYYRTT
FT                   HSRTGIANDGAGARSRVHYGSRYNNAFWQDSCFCMTFGDGDGSTFTPLVSVDVAGHEMT
FT                   HGVTSRTAALTYSGESGGLNEATSDIMGTMVEYSAANSAEPGNYLIGEKIIPNNSTGTL
FT                   ALRYMFKPSLDGKSPDCYSSSLGSLNVHYRSGVANHFYYLLAEGAVVPSGFGSGTSYNL
FT                   TPTSLVCSGSTALTAIGRAAASRIWYRALTVYMTSSTNYAAARRATLSAATDLYGSTST
FT                   QYRAVAAAWSAVSVN"
FT   sig_peptide     complement(561030..561095)
FT                   /locus_tag="XCV0495"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(561521..563275)
FT                   /transl_table=11
FT                   /locus_tag="XCV0496"
FT                   /product="putative lytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22127"
FT                   /db_xref="GOA:Q3BYD6"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22127.1"
FT                   /translation="MATDRETGLLQAAYAAGITRPNELANFMAQVGHESGGLNRLEEGF
FT                   RYTRGPSQVSSKVRSALREGPEALEEARLEALRGQPEKLAELMYGGRMGNNEPGDGYLY
FT                   RGRGYIQLTGKDQYREAGEALKLDLVAHPELAAQPENASRIATWYWQHNVPQAARQDAH
FT                   AAGVAINGGDPPNGLADRESRFARWQRDLTPDVMHKLEHGQLGQTVAPAQHSAPTQAPH
FT                   AGSNAHSFQATMERMLPPQNGTAPHITGHYGEHRSARDHGGTDFNYQGGQAGRNLQHPT
FT                   VHSPVAGTVTFAGGSYGTVKIRDAQGNSHEILHLDGVKVKEGQTLSAGDAIGTMGGRGP
FT                   NGASQYAQHVHYQLRDANGKLTSPETFWNQGHQHEAGARHTQAAPASGTSALRHGDNSQ
FT                   DVGKLQQDLNRLGVRDAQGNRLAEDGRFGDNTREAVMAFQKQHGLQQDGVVGRDTRAAL
FT                   AAQPAQTREAQVAGPKGPSLNDASHPDHALHNAIRSRLPSMISNETAAHVTLQAKQNGI
FT                   DSADKLQNVTVQDGKAFVMGTTPGFRAAVDLNQPAPTLEQTSAQLLAGHSQQQQAQQEL
FT                   QKVAMGGR"
FT   CDS_pept        complement(563348..563884)
FT                   /transl_table=11
FT                   /locus_tag="XCV0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22128"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22128.1"
FT                   /translation="MATIDSFVPAGSKALDTQRGDLTGAGHSDALVVISPPATGNEKLG
FT                   EGQPRRVLLLTQNADGSVQKAAENNRIVPCARCGGLAGDPYAFSRVQPGQFTISISGGS
FT                   RERWADDFTFKYSADKQTWLLDKVVRDLSDTETEQHNTLELTDKDFGTVTFQDFDPVTL
FT                   KKVAALDEAGAQKQN"
FT   CDS_pept        complement(564121..564699)
FT                   /transl_table=11
FT                   /locus_tag="XCV0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22129"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22129.1"
FT                   /translation="MRRYHPARSHIARYDQEDPLALLRTSLHALALSLALAACKPQAEP
FT                   AGAAMPAATAEAAGTAPAASTPATASATPVQPTTCPTADFSAFLKSFSADIAAQEKATA
FT                   DPLTMIRIDPDAQPEPAPVTREVALADVKWPVIPNLDVARSAGREVVVSENAGGRQVLV
FT                   RTPDSGDQQVYHFAQRPCWTLVKVDDQSL"
FT   CDS_pept        complement(564930..565676)
FT                   /transl_table=11
FT                   /locus_tag="XCV0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22130"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22130.1"
FT                   /translation="MTAIAHTRPPVSPPRPLRWCVLLPSKAAMTMSSHLCRVLPALRSA
FT                   LIPGLALALSACTPGESAPHAVPSSAPVAPAKNNAPAALQVNARLAALIQAAGATCTDA
FT                   TGCTAGNVDTRDFYDVEFLPDCGDKGFFAGVAQANGADLLDAVPVTGSSATATANLAQG
FT                   QLVCVQAIGRAGQNPRYYYVAAIPADTIAKCKNNALCKTYGDRPIKQIKPESSESCHAA
FT                   APGQSTGNCAQGWVGADALEVFSNGI"
FT   CDS_pept        complement(565808..566734)
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="XCV0500"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22131"
FT                   /db_xref="GOA:Q3BYD2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22131.1"
FT                   /translation="MSTTLLQSDLPGLPLRHRGKVRDVFDLPRDRLPADAPPGDYLLMV
FT                   ATDRLSAFDVVLPDPIPGKGEMLCQVSNFWFHKTEHLMPNHLMDIRVEQVLPEGVDPAL
FT                   YAKRAVVTRKLKPVPVEAIARGYVIGSGWKDYQRTGKISGIELPDGLRQAEKLPEPIFT
FT                   PSTKAAVGDHDENIDFDAMVKTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFE
FT                   FGTDADGRLYIMDEMLTPDSSRYWPADQYEPGTSPPSYDKQFVRDYLETLDWGKTAPGP
FT                   RLPADVIDRTRAKYAEALQRLADISVD"
FT   CDS_pept        566866..567273
FT                   /transl_table=11
FT                   /locus_tag="XCV0501"
FT                   /product="DnaJ-related chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22132"
FT                   /db_xref="GOA:Q3BYD1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22132.1"
FT                   /translation="MCRSRQLGRAGVRVRSPARLPPPIAPMSWYGKLLGALAGALLFRG
FT                   APVVGLLIGLAIGHAVDAGWFKRRAENPYEALGLEPDATTAEIDLAYRRLMSRYHPDKV
FT                   ANADPEARRQAEKKASQINAAYDRIQRQRKR"
FT   CDS_pept        567397..568098
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="XCV0502"
FT                   /product="D-ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22133"
FT                   /db_xref="GOA:Q3BYD0"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22133.1"
FT                   /translation="MALLHFSELPMQPTAIAPSILSADFARLGEEVNNVLKAGADWVHF
FT                   DVMDNHYVPNLTIGPMVCQALRKHGITAPIDVHLMVEPVDRIVPDFADAGATTISFHPE
FT                   ASRHVHRTIQLIKSHGCQAGLVLNPATPVDILDWVLPELDLVLVMSVNPGFGGQAFIPS
FT                   ALDKLRAIRRKIDATGKPIRLEIDGGVKADNIGAIAAAGADTFVAGSAIFNAPDYAQVI
FT                   AQMRAAVDAVR"
FT   CDS_pept        568095..568586
FT                   /transl_table=11
FT                   /locus_tag="XCV0503"
FT                   /product="putative N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22134"
FT                   /db_xref="GOA:Q3BYC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22134.1"
FT                   /translation="MSRPAPQIRSATPEDVPLLHELITALAVYEREPGAVKAGLEELRA
FT                   SLFGDGATAHALICEQDGQALGFAVYFFNYSTWLGRNGLYLEDLFVRPEARGKGAGLAL
FT                   LRHLAQLAVQRGCGRFEWSVLDWNQPAIDFYKAVGARPMDGWTVYRLDGERLAAFAAGA
FT                   "
FT   CDS_pept        568822..569751
FT                   /transl_table=11
FT                   /locus_tag="XCV0504"
FT                   /product="diacylglycerol kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22135"
FT                   /db_xref="GOA:Q3BYC8"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR022433"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22135.1"
FT                   /translation="MAPSHWRVILNGKSTDNMDLREAVGTLRKRGIQLDVRVTWEDGDA
FT                   ERYVGEAVADGVHTVVAAGGDGTLSEVAAALAHHEGDAASLPSLGLVPLGTANDFATAA
FT                   NLPIAPLEALTLIAERVAQPVDLLRIDADHGPHWCANVASGGFGTQVTVETDEGLKKML
FT                   GGLAYLITGMSRLGRIDPISARFSGPEFSWEGEFIALGLGNGRQAGGGQALCPEALIDD
FT                   GLLDVTIVPDLDGEVAATLGTLVIGGKQAALERVAVRARVPWLEIVSQQPLTLNLDGEP
FT                   ETSRHFRIECVPARLRMHLPGECPLLGG"
FT   CDS_pept        570009..571484
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="XCV0505"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22136"
FT                   /db_xref="GOA:Q3BYC7"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22136.1"
FT                   /translation="MITAEQFQRQAAEGHTRIPVVREVLSDLDTPLSVYLKLADGAYTY
FT                   LFESVEGGERFGRYSIIGLPARRVYSFRGHTLEVSEHGEVVETREVADPLAEVDALRAE
FT                   HSVPQLDGLPGFTGGLVGWFGFECIQYIEPRLGSGDKPDELGTPDILLMLSEELAVFDN
FT                   LKGRLYLIVHADPRQPQAYVRANRRLDELAHRLRQGGAGYPRAQISDAIDEADFHSSFT
FT                   REEYHAVVRKAQEYVRAGDIFQVVPSQRLRVPFRARPVDVYRALRALNPSPYMYFLDVG
FT                   GTQVVGSSPEILARLRDGVVTVRPIAGTRPRGATPELDKALEAELLADPKERAEHVMLI
FT                   DLGRNDVGRVAEPGTVKVGEQFVIERYSHVMHIVSEVTGTLKAGLNYSDVLRATFPAGT
FT                   VSGAPKIRALEIIRELEPVKRNVYSGAVGYIGWHGDADTAIAIRTAVIQDGYLYVQAGG
FT                   GVVYDSDPDLEWQETMNKGRALFRAVAQAAKGL"
FT   CDS_pept        571484..572560
FT                   /transl_table=11
FT                   /locus_tag="XCV0506"
FT                   /product="putative threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22137"
FT                   /db_xref="GOA:Q3BYC6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22137.1"
FT                   /translation="MDGQGSTTRISFRNDYSEGAHPRLLQALAQASADQHAGYGTDRHT
FT                   AHAVALIRHAVAQPQADVHLLVGGTQTNLIAISAFLRPHQAVIAVDAAHIATHETGAIE
FT                   ATGHKVLTVPALHDKLTPALIQPVLAVHGNEHMVQPRLVYISNSTESGTLYTRAELEEL
FT                   SGFCRANDLLLYLDGARLGAALTADGNDLDLPTIAALTDAFYIGGTKNGALLGEALVIV
FT                   NPALQPDLRYLIKQRGALLAKGMVLGVQFAALFEDGLFFELAAHANAMAQRLRAGLLAA
FT                   GAHFTSDSPTNQQFIAVSAQQAAQLAQGYDFERWEMRTDGSQVIRFVTSWATTATAVDR
FT                   LCADVAALLQQHAVQGHD"
FT   CDS_pept        572579..573361
FT                   /transl_table=11
FT                   /locus_tag="XCV0507"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22138"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22138.1"
FT                   /translation="MNTIAGWMLAAVLTLPTVGMAQINALPSQPHLLVKGQAFRTVDPD
FT                   RFIVDLKISKTELQPDLARKFVEGRARLVLDGLQRDHVLKDSLYASALSISPQSRYEAG
FT                   KSVFDGTRVERRIRGAFTSLKDVHAFLGDLDANENVQVLSMQTAYADAAALRAELKREA
FT                   ATQSRQSAQGLAAAYGVRLGGIYSISDVAPNFAYGVEAGTWSAATAATPGSIVSPPSPP
FT                   APPSSPAPSAVGQGVGESLMTGTITYTENIYAVFLIAQ"
FT   sig_peptide     572579..572641
FT                   /locus_tag="XCV0507"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        573506..573715
FT                   /transl_table=11
FT                   /locus_tag="XCV0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22139"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22139.1"
FT                   /translation="MICEAFNVCIAALPGFRRCAGESLASFNPSAIARSMGVGGSLPGA
FT                   ASGKIVHHLPNILMARQPSEIEVS"
FT   CDS_pept        573715..576699
FT                   /transl_table=11
FT                   /gene="hsdR1"
FT                   /locus_tag="XCV0509"
FT                   /product="type I site-specific deoxyribonuclease
FT                   (restriction subunit)"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22140"
FT                   /db_xref="GOA:Q3BYC3"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22140.1"
FT                   /translation="MRVREATIEQELVEKLAGLKYTLRSDIRSRAALEANFRKHFEELN
FT                   RVALTNAEFQRLLEEVVTADVFKAAHTLRHRSAFTRDDGTPLNYTLVNINDWCKNTFEV
FT                   ASQLRINTDDSHHRYDVILLINGVPVVQIELKTLGINPRRAIEQIVEYKHDVGNGYTRT
FT                   LLCFIQLFIVSNRDATYYFANNNARHFAFNADERFLPIYQYAAPDNGKISGLNAFADAF
FT                   LPKCTLGQMISRYMVLVASEQKLLMMRPYQIYAVKNIVECIDKNLGNGYIWHTTGSGKT
FT                   LTSFKASTLLKANPAIEKCLFVVDRKDLDRQTREEFNRFQEGCVEENTNTESMVRRLVS
FT                   DEAADKVIVTTIQKLGRALDPARADYRQRLEPLRDQRIVFIFDECHRSQFGENHQAIKE
FT                   FFPKAQLFGFTGTPIFEDNASYKRIEGDEQTLKTTEDLFQQSLHEYTITHAIEDKNVLR
FT                   FHVDYYKPDGKSTPKPGETLAKRAVVDAILSKHDAATGGRRFNAILATASINDAIGYFG
FT                   LFKTAQAEKQRVEPGYVPLNIAAVFSPPSDVSADVRQLQEDLPQEQEDNKKDSDAKKAA
FT                   LKAIIGDYNTRFGTNHRIEEFDAYYQDVQQRIKDQQFPNADLPDKGREKLDIVIVVDML
FT                   LTGFDSKYLNTLYVDKNLKYHGLIQAFSRTNRVLNDTKPYGNILDFRGQQKEVDAAIAL
FT                   FSGAKADKAREIWLVDTAPVVIDKLKEARGSLDSFLASQGLGGKPEDIANLKGTAAKVA
FT                   FIKHFKDVQKLQTQLDQYTDLTAEQQAQVEAILPKDELRSFRGQYLQKAEELRADQKKA
FT                   GGLDDVTRNDVEQLDFEFVLFASSTIDYDYIMKLIADYSGKAPGKASMSREQLIGLIAS
FT                   DAKFIDEREDISAYVRGLKAGEGLGEETIRAGYEAFKAEKAAQEMTALSGKHGLPVAAL
FT                   QTFVDAILARRIFDGERLTELLAPLDLGWKARTQAELALMRDLLPLLHKRAGGREIAGL
FT                   KAYEE"
FT   CDS_pept        576702..577961
FT                   /transl_table=11
FT                   /gene="hsdS1"
FT                   /locus_tag="XCV0510"
FT                   /product="type I site-specific deoxyribonuclease
FT                   (specificity subunit)"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22141"
FT                   /db_xref="GOA:Q3BYC2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22141.1"
FT                   /translation="MGKQGVKTVVPRLRFPEFRKMASWPIVPLERIAARISTKNCNGQV
FT                   TRVLTNSAEFGVLDQRDYFDKDIATAGKVDGYYVVSKGDYVYNPRTSAIAPVGPISRNN
FT                   LGEGVMSPLYTVFCFSEEKTDFYEHYFKSPGWHSYLRSAASTGARHDRMSITAGAFMRM
FT                   PVPSPSREEQQKIADCLTSLEEVIAAQGRKVEALKVHKRGLMQQLFPLEGEALPRLRFP
FT                   EFRDAPEWAERPLCQVIEVASGQVDPTEAPYCDFPHVGGENIESETGSLVGLKSAREDG
FT                   VTSGKYLFDEKDVLYSKIRPILNKVAVPDFNGICSADIYPIRPSSSDITRQFLVYLLRS
FT                   ASFVEYATKHSERGKIPKINREALAAYGARLPQQVEQQRIADCLFSVDTAITAESAQLT
FT                   VLKTHKQGLMQQLFPAQRAG"
FT   CDS_pept        577963..579129
FT                   /transl_table=11
FT                   /locus_tag="XCV0511"
FT                   /product="putative anticodon nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22142"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22142.1"
FT                   /translation="MADVALPDLPALAQHLRDELERKKFVLLYAYNGVGKTRLSGAFRD
FT                   LGRVVDADGQTTQRDTLYFNAYTEDLFTWDNDIAFERKRVLELNADSKFFAGLSELEME
FT                   VKIGRLLARYTDLNFYIDYERRQSTESSSEPGMLLPPAVTFFREREEDGDPRPIKASRG
FT                   EENIFIWCFFLAIVELAMDPEIEVYRWVKYVYIDDPISSLDEQNAISVANHLAQLLTSV
FT                   ENGPRVVVSTHHVLFFNVLCNELKSKAFRHFLKNGVEPGRYALLDTTSKPFLHHLSTLV
FT                   ELHEVQASGELYTHHFNMLRRVMEQTANFLGLEDWKTCIKVTDVDPDRTLFTRMIDLMS
FT                   HGDYSIYEPREMMEENKAHFRTVFRRFVTGHPFNPALFPRMEQGVGDP"
FT   CDS_pept        579126..580136
FT                   /transl_table=11
FT                   /locus_tag="XCV0512"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22143"
FT                   /db_xref="GOA:Q3BYC0"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22143.1"
FT                   /translation="MSELILYTSEDGKSRIQLRAEGQTVWLTQAQMAELFDVSTDTISL
FT                   HLKNIFSDNELEPERTTEESSVVQREGEREVRRPVTLYNLDAILAVGYRVRSKRGVQFR
FT                   RWASTALKDYLLKGFVMDDERLKNPDGRPDHFDEMLARIRDIRASEKRFYQKVRELFAL
FT                   SVDYDKTDRATQVFFATVQNQLLYAVTGQTAAELITARANPDDPHFGLRAWSGGRVRKQ
FT                   DILIAKNYLSEDEIDTLNRLVTIFLETAELRAKNRKEIHMRFWRENVGQIISSNDFPLL
FT                   ANAGSVSHARMETETNARYFAFDEQRKQQEAQAADTADAVELAAIENKIKRRLKP"
FT   CDS_pept        580133..581749
FT                   /transl_table=11
FT                   /gene="hsdM1"
FT                   /locus_tag="XCV0513"
FT                   /product="type I site-specific deoxyribonuclease
FT                   (modification subunit)"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22144"
FT                   /db_xref="GOA:Q3BYB9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22144.1"
FT                   /translation="MTKDDQKELGKTLWAIADQLRGSMNADDFRDYMLSFLFLRYLSDN
FT                   YEAAAKKELGSDYPDAKAIGNSDKTPLSVWYAANPDDVAAFEQQMRRKAHYVIKPKYLW
FT                   GNIVNLAKTQSHDLLDTLQQGFKHIEEDSFESEFQGLFSEINLASDKLGRKYDDRNAKL
FT                   CSIISEIARGMALSTKTDSLGDAYEYLIGQFAAGSGKKAGEFYTPQEISNILSAIVTLD
FT                   SQEPKTGPRGKLDSVFDFACGSGSLLLNIRNRMTSSGGSIGKIYGQEYNVTTYNLARMN
FT                   MLLHGVKDTEFEIYHGDTLKNDWDWLRETNPAKKPRFDAVVANPPFSYRWEPGEAMAQD
FT                   ARFKNHGVAPKSAADFAFLLHGLQYLKDDGVMAIILPHGVLFRGGKEADIRRKLLDDGH
FT                   IDTVIGLPPNLFYSTGIPVCILVLKKCKKPDDVLFINACEQFTRGKRQNQLTDEHIKRI
FT                   VDTYKNRDEQERYSKRISMTRIAEEGYNLNISRYVSTAKADKEINLEAVHVDLKAIESE
FT                   LEKAKKRHNAFLVELGLKPLP"
FT   CDS_pept        581895..582473
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="XCV0514"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22145"
FT                   /db_xref="GOA:Q3BYB8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22145.1"
FT                   /translation="MLLMLDNYDSFTYNLVQYLQALGAEVMVVRNDAMSVDQIAALKPE
FT                   RIVISPGPCTPNEAGISLQLIEQLGQTTPILGVCLGHQSIGQVYGGDVIRAGNIMHGKT
FT                   SPIRHQGKGVFAGLPDSYEATRYHSLVVDKTTLPDALEVTAWTENPDGSMEEIMGLRHR
FT                   QFPVEGVQFHPESILTQHGHALLKNFLQR"
FT   CDS_pept        582574..583248
FT                   /transl_table=11
FT                   /locus_tag="XCV0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22146"
FT                   /db_xref="GOA:Q3BYB7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22146.1"
FT                   /translation="MFKHRADFHRIRITMSTPDDSIHFYEPTQGHGLPHDPFNAIVGPR
FT                   PIGWIGSRSAEGIANLAPYSFFNAFNYIPPIVGFASIGRKDSLRNIEATGEFTWNLATR
FT                   PLAEAMNASAAMVPAEVDEFGLAGLQVAPSRLIAAPRVAASPVSFECRLSQLLPLQTAA
FT                   GHAIQTWLVLGEVVGVHLAKSALHEGIYDPGAVQTILRAGGPADYYEVQPQARFRMTRP
FT                   GQ"
FT   CDS_pept        583364..584401
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="XCV0516"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22147"
FT                   /db_xref="GOA:Q3BYB6"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22147.1"
FT                   /translation="MPITPQEALQRTIEHREIFHDEMVELMRQVMRGEVSDMMVAAILT
FT                   GLRVKKETIGEIAGAATVMREFSRRVDVADRQHMVDIVGTGGDGSDTFNISTCAMFVAA
FT                   AGGAKVAKHGNRSVSSKSGSADALEALGAVIELQPEQVASALAHTGIGFMYAPVHHPAM
FT                   KVVAPVRREMGVRTIFNILGPLTNPAGSPNILMGVFHPDLVGIQARVLHELGAERALVV
FT                   WGRDGMDELSLGAGTLVGELRDGQVREYEVHPEDFGIAMSASRNLKVADAAQSRAMLLQ
FT                   VLDNVPGPALDIVALNAGAALYVAGVAHSIADGVLRARAVIADGSARARVDAYVAYTRQ
FT                   LAVQA"
FT   CDS_pept        584542..585339
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="XCV0517"
FT                   /product="Indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22148"
FT                   /db_xref="GOA:Q3BYB5"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22148.1"
FT                   /translation="MSDILNTILARKADEVAERSARVPLAELIARSADLPLTRGFAAAM
FT                   QASIAAGDPAVIAEVKKASPSKGVIRPDFQPADIAVSYEFGGATCLSVLTDVDFFQGSD
FT                   AYLRQARDACTLPVLRKDFTVDPYQVYEARVLGADCILLIVSALEDAQLADLSGLAMQL
FT                   GLDVLVEVHDIDELERAVQVPVPLIGINNRNLRTFEVTLQTTLDMRAAVPRDRVLVTES
FT                   GIVTQADVQLMRSHDVNAFLVGETFMRAAEPGESLRQLFFAHD"
FT   CDS_pept        585332..586048
FT                   /transl_table=11
FT                   /locus_tag="XCV0518"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22149"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22149.1"
FT                   /translation="MTESYPVPREDAPLVVFDFDHTLYDGDSGSHLFAWLIKRNPLRLL
FT                   VALLASPILGPMVAMLPTRRRGVSGYVWIATFGLHRAREFNRFIDAYVLKHEAQIRQRL
FT                   LPHALKVFTQHRAAGDRVVVATGAPPELARAILGFVAHQDVPVIGSLVGPRLGAVTARR
FT                   HCHNEEKMRMLRERGYADIAIAYSDSTADLPLLKAARAPVVVNPKANREALFRQVLPTG
FT                   TPILNWGCRDRGGKAL"
FT   CDS_pept        complement(586368..587060)
FT                   /transl_table=11
FT                   /gene="clp"
FT                   /locus_tag="XCV0519"
FT                   /product="CAP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22150"
FT                   /db_xref="GOA:Q3BYB3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22150.1"
FT                   /translation="MSPGNTTVVTTTVRNATPSLALDAGTIERFLAHSHRRRYPTRTDV
FT                   FRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRT
FT                   RTQCELAEISYERLQQLFQTSLSPDAPKILYAIGVQLSKRLLDTTRKASRLAFLDVTDR
FT                   IVRTLHDLAKEPEAMSHPQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGK
FT                   TVVLYGTR"
FT   CDS_pept        587198..587992
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="XCV0520"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /EC_number="4.1.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22151"
FT                   /db_xref="GOA:Q3BYB2"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22151.1"
FT                   /translation="MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDE
FT                   QYDADRLTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVIDKKQAGKELISD
FT                   AVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPLKALNYLIESLESDIVI
FT                   MDYRVRGFTRDVKGRKHYIDHKINSIQQFLAKNVKSRYEMFDVNVYQENIFHTKMHLKD
FT                   FDLDQYLFEERAKNLSFKERMKIETLLKREIEELFHGRNLSE"
FT   CDS_pept        588157..588471
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="XCV0521"
FT                   /product="small multidrug resistance family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22152"
FT                   /db_xref="GOA:Q3BYB1"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22152.1"
FT                   /translation="MPWIYLLLAGLFEIGFAMGLKYSDGFTRLWPTVLTIGLAGISLWF
FT                   LTQALKTIPVGTGYAIWTGIGALGVTIAGIALFGDSASWSRLACIGLIVAGVIGLKLVG
FT                   "
FT   CDS_pept        complement(588774..589469)
FT                   /transl_table=11
FT                   /locus_tag="XCV0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22153"
FT                   /db_xref="GOA:Q3BYB0"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22153.1"
FT                   /translation="MAVGSTAERGQNRRMTQISPTRLHSPLDRLLVEAQRALDTVFGNP
FT                   PAERPNPAADTPDVVLDPEQRRHAAGLMRINHVGEVCAQGLYFGQAAVARDAHTQHHLL
FT                   EAAQEETDHLAWCADRLHELDSRPSLFNPVWYAGSYALGALAGLRGDDWSLGFVVETER
FT                   QVEAHLDEHLETLPQNDQRSRAILRVMKIDEARHADQAEQAGARPLPAPIPSAMALASK
FT                   LMKTVAYRL"
FT   CDS_pept        589610..590038
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="XCV0523"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22154"
FT                   /db_xref="GOA:Q3BYA9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22154.1"
FT                   /translation="MTTFTAKSETVQRDWYLVDAAGKTLGRLSTELARRLRGKHKPVYT
FT                   PHVDTGDYLVVINAEKIVVTGNKLKDKKYHRFTGYIGNLKTESLEQALQRHPERVIEIA
FT                   VKGMLPKGPLGRTMYRKLKVYSGAEHPHAAQQPQVLDI"
FT   CDS_pept        590041..590433
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="XCV0524"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22155"
FT                   /db_xref="GOA:Q3BYA8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22155.1"
FT                   /translation="MAITQNYGTGRRKSSTARVFLRKGTGNITVNDRPLDEFFGRETAR
FT                   MIVRQPLELTKNTESFDIMVTASGGGTTGQAGAIRLGIARALVEYDETLKSELRKAGFM
FT                   TRDAREVERKKVGLHKARRATQFSKR"
FT   tRNA            complement(590658..590732)
FT                   /gene="tRNA-Gln"
FT                   /locus_tag="XCV_tRNA02"
FT                   /product="transfer RNA-Gln"
FT   tRNA            complement(590785..590861)
FT                   /gene="tRNA-Met"
FT                   /locus_tag="XCV_tRNA03"
FT                   /product="transfer RNA-Met"
FT   CDS_pept        590980..591597
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="XCV0525"
FT                   /product="(Di)nucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22156"
FT                   /db_xref="GOA:Q3BYA7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BYA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22156.1"
FT                   /translation="MIDPDGFRPNVGIVLMRQDGQVFWARRVRRDGWQFPQGGMNTDET
FT                   PVEAMYRELREETGLLPEHVELLGATPGWLRYRLPSRAVRRNERQVCIGQKQVWFLLQF
FT                   TGDESHLKLDHTDTPEFDHWRWVDFWYPVEHVVMFKRGVYARALRHLAPLAQSLAGPAA
FT                   VGAMPQRALEAWLPGSSAAGHDSPRKRPRKRSGARAMRINND"
FT   CDS_pept        591678..591887
FT                   /transl_table=11
FT                   /locus_tag="XCV0526"
FT                   /product="bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22157"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22157.1"
FT                   /translation="MYVCICNGVTDHQIREAAENGCASLAELTMRTGCGSNCGSCLEMA
FT                   GDLLNQAHATRALPLPLLGLASAA"
FT   CDS_pept        592202..592672
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="XCV0527"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22158"
FT                   /db_xref="GOA:Q3BYA5"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22158.1"
FT                   /translation="MKGDTKVIEYLNKVLYNELTAINQYFLHAKMLKNWGLKELAEHEY
FT                   KESIDEMKHADKLSDRILFLEGLPNFQALGKLRIGENPTEMFRCDLTLEREAVVVLREA
FT                   VAYAETVKDYVSRQLLVDILESEEEHIDWLETQLDLVARIGEPNYLLTKLDD"
FT   CDS_pept        complement(593039..595348)
FT                   /transl_table=11
FT                   /locus_tag="XCV0528"
FT                   /product="two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22159"
FT                   /db_xref="GOA:Q3BYA4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22159.1"
FT                   /translation="MRERAAGLRAWSILAVLAALAAALGAGLQWSSLQGPWRAVSAVSA
FT                   VLAVVCGLCAALAAHRAAQAQHALAQRLEEADLARERLQQELRRHGELEQELLRAKQAA
FT                   EAATLAKGEFLATMSHEIRTPLNGIIPMLELISSGQLSVDQRDMLQTATGSSLQLLRIV
FT                   DDILDYSKLEANKLELEITTFNLRELLDGVIQLLQRTAEGRQLRLSLDIEPSVRLLVRG
FT                   DPIRLRQVLGNLIGNAIKFTERGSVDIQLRRLGETRAQHLLRFQVRDTGIGIAPDQQAR
FT                   LFRSFAQADASTTRLYGGTGLGLAICKRIIDLMGGRIGVESEPGRGSTFWFEIPLLKVI
FT                   GDLQQATGADAARVMVISSDARLSQRLKRLLDSWGVSHVLMETTQEALERVRRHNDSEG
FT                   FRCVIADHDTLRYSARAVHRALARPENANSARLIWLYGEEPVPAELQDHATLVPRQSPD
FT                   ETLRALVLPPEPKPAHVTTLASAMIPEPLPPPMANAREVRILLVEDNPVNLLVAQKLLA
FT                   VLGFEADTATDGEAALASMESTRYDMVFMDCQMPVLDGYAATRRWRAMETESGGRPIPI
FT                   VAMTANAMAGDRERCLAAGMDDYLSKPVAREQLDACLQRWLPRQALLPGPSSAGQATHD
FT                   PESASAAAQARALPILDNNVIDELYEVAGADTITILQLFLEDAPLIIEQLEAAAANRDS
FT                   MQLRDLAHTLKSSSANVGAQAVSNAARRIELAARTGTIERPSVMVALVIAEYARARLAL
FT                   LGQVARLQAAASTTNQ"
FT   CDS_pept        complement(595349..596947)
FT                   /transl_table=11
FT                   /locus_tag="XCV0529"
FT                   /product="putative two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22160"
FT                   /db_xref="GOA:Q3BYA3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22160.1"
FT                   /translation="MFAQSVLHGAGMHAQVEMTAASVPQAIQDYHPDLILMDLHMPELD
FT                   GIRLTTLIRQQPGQQLLPIVFLTGDPDPERQFEVLDSGADDFLTKPIRPRHLIAAVSNR
FT                   IRRARQQALQQAGEQVSARSNPETGLPTRGHVMDLLADALKRKQSGGLFFIEIASALGL
FT                   RERYGYAAYERLMTQAGHRLASAAQPYPLARLNDNSFLLLAIDMPEASLEQQALEIRQR
FT                   LSANAFPVREEESVHVRCAIGVAPLGVGFDDTGSALEAVERTALQARLRSDGVQTYLAP
FT                   SQAEQQEQLRLVEGQLELAYQPIVAVAGGDTAQYQVLLRLRQADGTLLSAGQVIPAAEA
FT                   AGRIADLDQQVMDHALGLLHLYQHASPPLRLFVSQSPRTLARDAFADWLLKALVERGVA
FT                   GQSLIVDLRLDDALIHAVTVQQFCAKLMPAGVQFCLSQFEPGDEANALLAQLPLSFVRM
FT                   ANRFADAHGNAAVRDELRGVIDIAHQRGLLIIGQRIEDPQAAAAMWMSGVDFIQGNLVQ
FT                   TVGKELDFDFTSAVL"
FT   CDS_pept        597057..597398
FT                   /transl_table=11
FT                   /locus_tag="XCV0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22161"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22161.1"
FT                   /translation="MGADAAAARALPLAADARGADTAAAGLGTAAAAGAGMIAALTGTA
FT                   VSTGDATSSAQRRQWSAGGVSARSGRLRVAVSSRVVEETGSRAAIDTPYSRCDYAMNFT
FT                   VAGSCVQLA"
FT   CDS_pept        complement(597364..597990)
FT                   /transl_table=11
FT                   /locus_tag="XCV0531"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22162"
FT                   /db_xref="GOA:Q3BYA1"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22162.1"
FT                   /translation="MSEAHLFVIGILLAWLAGIRVYLTVFGVGLAGLLGWIDLPPALHP
FT                   AQSWWVLGTSGALAVAEFFADKIPGVDSGWDLLQTLARVPAGAFLAAATLSPDGDLGAG
FT                   ALAAGAGVALTSHTLKAGTRALLNTSPEPASNWIASLAEDTIATTALALALAHPWLALG
FT                   LAVGSSLLAGLVVWWVWRLLWRGMRRLVAPMRPAATPTARSSPLP"
FT   CDS_pept        598098..598868
FT                   /transl_table=11
FT                   /locus_tag="XCV0532"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22163"
FT                   /db_xref="GOA:Q3BYA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BYA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22163.1"
FT                   /translation="MIAPARPDPMPMRPAARVQIVQRASGGGRPGRRWLWLLLAIVWLA
FT                   SLGGVWWMATRTAAPRLVKAEAALQQAQRSQAQQRRQIEQLQQRQVNLAMSDKISRAAN
FT                   TEVQASLAERDEQIAALRADVAFYERLVGSTAQRKGLNAHSVQFTAEAGGTWNYSVVLT
FT                   QNLNRGAISQGQLHFAVEGVRAGKLVTVSWNELHQKPDAAGQPYSFRYFQQLDGSVILP
FT                   KDFTPQRVKISLSGDGAPVSQTFDWKVAGNGAGE"
FT   CDS_pept        598872..599321
FT                   /transl_table=11
FT                   /locus_tag="XCV0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22164"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22164.1"
FT                   /translation="MFGNKSNRGAQTVVDTLIGPQVVIRGDLMFSGGLYVEGRILGKVI
FT                   AEDGASATLTVAEQGSIEGEVRAPVVIINGQLTGDVHAAERVELAANARVQGNVHYQVV
FT                   EMSAGAQLTGRLIHAATAGATAALPAPEAGRAEPATALQAETADA"
FT   CDS_pept        599405..599791
FT                   /transl_table=11
FT                   /locus_tag="XCV0534"
FT                   /product="putative Iron-sulfur cluster assembly accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22165"
FT                   /db_xref="GOA:Q3BY98"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BY98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22165.1"
FT                   /translation="MSTLVSLPTVAPAPDYQSIDRPLNFSVAAAAKVRELIQEEGNADL
FT                   ALRVYIQGGGCSGFQYGFEFDENRAEDDLAVATDGVTLLVDPLSLQYLMGAEVDYTESL
FT                   TGAQFVIRNPNAKTTCGCGSSFSV"
FT   CDS_pept        complement(600088..600594)
FT                   /transl_table=11
FT                   /locus_tag="XCV0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22166"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22166.1"
FT                   /translation="MLHTTAVDQRGQAAMPGENAHIVAPAVSTHAVWSSGSAHHRARTK
FT                   LARAPRNLQRRKWRGALRTRADRPPCGRSPSNRVRARRSTASDSLHSCRRAEAPCSAAQ
FT                   DAGIFNYARGSQRRARFARLHVAHSAVIVLKHCRSHWATWKHSHACLTSGGHVRTAQLG
FT                   LAASS"
FT   CDS_pept        600751..602013
FT                   /transl_table=11
FT                   /locus_tag="XCV0536"
FT                   /product="putative secreted lipase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22167"
FT                   /db_xref="GOA:Q3BY96"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22167.1"
FT                   /translation="MLQINSRSAFGLAAMLGIASAVLAPAAQAAPARGTLLTSNFLTSY
FT                   SRDAIGAMLASEPQAEQPKCNVRVAEFTYATVGVEGEPATASGVLLVPDGERCVGPYPL
FT                   LGWGRPTRTVRTEEQAKDIRDAKGNDPLVTRLASQGYVVVSSDYLGLGKSNYGYHPYLH
FT                   SATEASATIDAMRAARSVLQRLNTPLSGKVMLSGYSQGGHTAMATQREIETHLSKEFHL
FT                   VASAPISGPYALQQTFLDSWSGSNAVGESSFGIILGSYAIVAMQHTYKNIYLEPGQVFQ
FT                   EPWTAKVEPLFPGKQSLTDLFLGDTLPGIDQIKAYFQPGFYRDFASNPANPFRQDLARN
FT                   DLLAWTPQTPTLLCGSSNDATIPLKNAQTAIASFKRRGSNQVALVDIGTGNSSDNSAFA
FT                   HLLTNEPCIVAVRHQLLDKQR"
FT   sig_peptide     600751..600837
FT                   /locus_tag="XCV0536"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        602285..603211
FT                   /transl_table=11
FT                   /locus_tag="XCV0537"
FT                   /product="NUDIX hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22168"
FT                   /db_xref="GOA:Q3BY95"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22168.1"
FT                   /translation="MQALPIIGRLAPMSESLFSSSGFAFTHAPLDRGDMLRDDPDALAR
FT                   LWPQGRVLLIDAKGAALADADGQPLLLDGAELGDGPEAAIFLGLRDAVGWFCVPADIVA
FT                   VQAPQRIDLRQAAADWPAEIATAFAYARAMLHWQSRTRFCGVCGGAIAFRRAGFIAHCT
FT                   QCQTEHYPRVDPAIIVAVSDGARLLLGRQASWAPGRYSVIAGFVEPGESLEQTVAREVF
FT                   EETRVHVQDCRYLGAQPWPFPGALMLGFTARAAATEVPQVTGELEDARWVSHAQVSAAL
FT                   AGEGDIGLPPRISIARALIEHWHRAHG"
FT   CDS_pept        603285..604175
FT                   /transl_table=11
FT                   /locus_tag="XCV0538"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22169"
FT                   /db_xref="GOA:Q3BY94"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22169.1"
FT                   /translation="MFTTLVAVVVALTLGHLVPAQVARLRNFAWFGQWLRRLDGYAAGR
FT                   GAWQGRYGVLLAVLPALVVLLVQWLLDDVWHGFLDLLFGVAVLAWTWGPRDLDRDVEAV
FT                   IDADEPHTRREAISHLQAAGGSVHEDAPSLVEAVVVNGLRRWFAVLWWFLLLGPFGAVL
FT                   YRLTALAVESPLAVLLPPRNLAGARWLLAVLEWPVAQLMTMSMALVGNFDTVFRAWREA
FT                   HGNRWSLEPHFLGAVARASVSAELREEAHDYTDSGLVPVWRRLPEVRDAMSLVWRVLLL
FT                   WLVVLALLVIAGWVR"
FT   CDS_pept        complement(604255..604617)
FT                   /transl_table=11
FT                   /locus_tag="XCV0539"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22170"
FT                   /db_xref="GOA:Q3BY93"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22170.1"
FT                   /translation="MAALGVSLLYRFDPNAGNSPFPPCVFRAVTGCYCPGCGMTRALYA
FT                   LVHFDLPGAFAMNPAAVLGLFTLPGLIAWKAGWRARWFAPVVAVMSEPKFWLWALPMYW
FT                   IARNLPWYPFTLLAPG"
FT   CDS_pept        complement(604665..605009)
FT                   /transl_table=11
FT                   /locus_tag="XCV0540"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22171"
FT                   /db_xref="GOA:Q3BY92"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22171.1"
FT                   /translation="MSAMPPPIHPSSSAAPGPVPNHLIWAIVSTVLGFCLCCPALISGI
FT                   VAIVFSSKVNGLLNQGDIDGARRASNTAKTWCIVTSVLAAIGLLINIGMVATGGMQGYM
FT                   DYMQQLQHMQ"
FT   CDS_pept        complement(605472..607394)
FT                   /transl_table=11
FT                   /locus_tag="XCV0541"
FT                   /product="putative fatty acid permease / acyltransferase
FT                   fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22172"
FT                   /db_xref="GOA:Q3BY91"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22172.1"
FT                   /translation="MSGHSQFALLRQRRFLPFFAVQALGAFNDNVYRQAIIGLLFYLGI
FT                   DAAQRTLYTNLAPALFILPYFLFSALAGQIAEKLEKQKLIVITTTMEIAIMSLAAVGFI
FT                   TENMVILLIALFCTGLQSTLFGPVKYSILPSVLKPEELTGGNGLVEMGTSISILCGMIF
FT                   GGLIFQIAGSHGPEAAATAVIAIAVTGNLVARLVPRVDAGAPELKINWNPIPESRAIMR
FT                   LTRRTLAVRNAVLGVSWFWFVGTVLTAQLPTYAQLNLGGQQDLYVFALALFSIGTGAGS
FT                   LLCERLSGRTVEIGLVPLGAFGISAFLLDLYFARPGAAPATGLSIGQFVQQPGSVRLII
FT                   DLVGIGLFTGLFVVPLFALIQSRTPKAELSRVIAGLNIQNSLFIVAAAVIGIALQLPQV
FT                   VLFGVRIPLPGLSIPQVFLALAIANTLVALWIFTLVPEFLMRFLSWVLVSVLYRLRARN
FT                   IDAHVPDEGAALLVCNHVSYMDALILSAVIPRPVRFVMYYKIFRIPVMRWIFRTAKAIP
FT                   IAGAREDPALMQQAFDRIDAALADGELVCIFPEGALTKDGEIAPFKSGVEKVLQRRNVP
FT                   VIPMALRGMWSSMWSRRDTRLGRMRVPRRMRAQIDVVAGAAVAGDQASAALLEQQVRAL
FT                   RQDQP"
FT   CDS_pept        complement(607463..608464)
FT                   /transl_table=11
FT                   /locus_tag="XCV0542"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22173"
FT                   /db_xref="GOA:Q3BY90"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22173.1"
FT                   /translation="MAAAWSRNVHSVGSRHASFQCIVFTVAIFFRDCMLTLRQLEFAIA
FT                   VAEEGGFTAAARRCNTVQSALSHQVAKIEETFGARLFERGIRQVRPTAAGEVFLHNARQ
FT                   TLRAAERLHEEMAQALGTVRGRLALGQISSLTTVQLPALLQQFRSAHARVDVHLRTAMS
FT                   EALLHDLGEGRLDVALVGVGPQLAVPAQRLLLHEEALALIVAPGHRFAARKRVALAELD
FT                   DEPMAGLVPGAGVRGIIDAAFAHGGLRQRQQYEVTHADLVRELVAANLGVGIVPQTMAG
FT                   AMHGVVTVALKERYRFLTYAVWRPDPSPAARAFVALLRAQLAQRRPPARRSR"
FT   CDS_pept        608463..609653
FT                   /transl_table=11
FT                   /locus_tag="XCV0543"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22174"
FT                   /db_xref="GOA:Q3BY89"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22174.1"
FT                   /translation="MQTEPTSHPPLPRRLVLLMAAATGLAVASNYYAQPLLETLAQAFG
FT                   IQVRSAGAVVTAAQLAYAAGLLLLVPLGDRLERRGLIVGLFVLSALGLLVSASSHSFAM
FT                   LLVGTIVTGASSVAAQILVPFAATLAAPHERGRVIGTVMSGLLLGILLARTAAGVLAGV
FT                   GGWHTVYWIASVALLLTAGLLWRGLPRHPGNAQLAYPQLVGSVLALLRDDAVLRSRAVL
FT                   GGLIFAGFSMFWTTLAFLLSGPSYGYGTAVIGLFGLIGAAGALAANRSGHWSDHGHGDR
FT                   VSWGGLAMLLLSWGLLAFAPQSIGLLIVGVLLLDIAVQGVHIANQSVIYQRNPAARNRI
FT                   TSAYITCYFIGGAVGSTLGTAAYAQAGWMGVVIGGAVLAAAALGWVGLSVARRQWK"
FT   CDS_pept        complement(609785..611998)
FT                   /transl_table=11
FT                   /locus_tag="XCV0544"
FT                   /product="putative efflux transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22175"
FT                   /db_xref="GOA:Q3BY88"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22175.1"
FT                   /translation="MATPSFETRLSRLWAHEKASYGLRVFIALAVAMGVCWHWQQLTAV
FT                   PALFLGAIASAIAETDDNWLGRIKSVLLSLLCFAAAAAAVVVLFPYPLPFVLGMALATF
FT                   SLTLLGALGERYASIAQATVALSIYAMIGMDQHGSRDPLVAWHGAALLLIGATWYGVLS
FT                   ILWTILFANRPVRERLSRLFFELGRYLKLKADLFEPVRQSDLHARRLALAEQNAKVVGA
FT                   LNAAKTAIMSRFGRSGRPGVQSGLYFRLYYMAQDFHERASSSHYPYEALTDAFFHSDVL
FT                   YRCQRLLALQGKACAALGEAIRLRQPFDYGDSSRLATEDLRQSLDYLHARADPALARLL
FT                   GALELLVTNLQSIERRLSEAAQSDSTSDNLDTRLRDSSPHTLREMGARLVQQLTPGSVL
FT                   FRHGLRMAIALLVGYAIMQSIHADNGYWILLTTAFVCRPNYGATRLRLVQRIAGTLIGL
FT                   VATWALMQLFPTTEVQLLLALAGALVFFITRTDRYMLATAGITVMALFCFNLLGDGFVL
FT                   IWPRLIDTLIGCAIAAAASFLILPDWQGRRLNQVMATVLASCARYLAQVLEQYASGKRD
FT                   DLPYRIARRDMHNADAALSVALSNMLREPGRYRRNLDAGFRFLALSNTLLGYLSALGAH
FT                   RAALEGEHDATIAQAGEYLQRALSEIASALGQRQPLPAHDESEELATAEALEHHPVQLP
FT                   PKQRLVRDQLALTLRLLPKLRAAALAVTTAPAENTPRLAASKT"
FT   CDS_pept        complement(612207..613502)
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="XCV0545"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22176"
FT                   /db_xref="GOA:Q3BY87"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22176.1"
FT                   /translation="MKILVIGSGGREHALAWKIAQSARVREVLVAPGNAGTATEAKCRN
FT                   VAIKVNDLDGLLALAQREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGS
FT                   KAFAKDFLARHGIPTAYYAVHTEVDAALAYVREKGAPIVVKADGLAAGKGVIVAMTLAE
FT                   AEDAVRDMLSGNAFGDAGARVVIEEFLDGEEASFISMVDGKHALPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTPEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGA
FT                   PKVIEFNVRFGDPETQPVMLRLQSDLVDLLDAAIDGKLDGAHAQWDPRPSLGVVIAAKP
FT                   YPDTPVTGEVITGLDAVPASAKVFHAGTALNAAGEVISAGGRVLCVAALGDSVQDAQRN
FT                   AYAGLKPIHWPNAFQRSDIGWRAIAREQAAQG"
FT   CDS_pept        complement(613535..614380)
FT                   /transl_table=11
FT                   /locus_tag="XCV0546"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22177.1"
FT                   /translation="MQRLRCFAAFLATAALLSACKQAPAPAAAPGAAAPAASSDGPRLS
FT                   RTERLDGFLRTRYGAKAGLAEQWSGEADGFEADSAVCAEQPVVVGDQVQQLLAVCHSLS
FT                   DAGHGNPGLIDFFVLRGDGDGFKVVAERLADGYGSAGQPGSVDVLRLGNDFYGFAVHSF
FT                   WMGQGLILESQDLVVPGPKGLVNAGSLRAHIDNSGALACDDDAREPDQTQAQCLAEAFD
FT                   VDFALEVDNSAPQARTWPLRIREHGSDCGVALDKTHVFALDTKTWTYPFPNALQREGCR
FT                   "
FT   sig_peptide     complement(614300..614380)
FT                   /locus_tag="XCV0546"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(614405..615988)
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="XCV0547"
FT                   /product="bifunctional purine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22178"
FT                   /db_xref="GOA:Q3BY85"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BY85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22178.1"
FT                   /translation="MASDFLPVRRALLSVSDKTGLIDLARALVARNVELLSTGGTAKAI
FT                   REAGLPVKDVAELTGFPEMMDGRVKTLHPLVHGGLLGRAGVDEAVMAEHGIVPIDLLVL
FT                   NLYPFESVTVKADCTLADAVENIDIGGPAMLRSAAKNFARVAVATDPAQYADLLAELEV
FT                   NDGQLSAAKRFALSVAAFNRVAQYDAAISNYLSAVADSSEAVPTRSPFPAQINSNFVKV
FT                   MDLRYGENPHQSGAFYRDLYPVPGTLATFQQLQGKELSYNNLADADAAWECVRQFDAPA
FT                   CVIVKHANPCGVAVGAGCGDAYELAYATDPTSAFGGILAFNKTLDAATAKAILDRQFVE
FT                   VLIAPDYEAGALEYATRKANVRVLKIPHGNGLNNYDTKRIGSGLLMQSADNRSMSLGEL
FT                   SVVTQRAPNEAELGDLLFAWRVAKYVKSNAIVYAKDSRTIGVGAGQMSRVVSAKIAALK
FT                   AEEAKLTVAGSVMASDAFFPFRDGIDAAAAAGIKAVIQPGGSMRDGEVIAAADEHGIAM
FT                   VFTGVRHFRH"
FT   CDS_pept        616062..616679
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="XCV0548"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22179"
FT                   /db_xref="GOA:Q3BY84"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22179.1"
FT                   /translation="MASIYALKGRFQALLRPMVGALYRGGITANQVTLGAAAVSLMVAA
FT                   VVLRGGPSWPLLYLLLPVWMLLRMALNAVDGMLAREFGQQSRLGAYLNELCDVVADAAL
FT                   YLSLLGVPGVSAPWLWIFALLAALTEYAGVLGLMVGASRRYDGPMGKSDRAFVIGVLGV
FT                   GLACGWLGARGVTWVAIAVSLACVVTVWRRVRAGLAQAPART"
FT   CDS_pept        616771..618531
FT                   /transl_table=11
FT                   /locus_tag="XCV0549"
FT                   /product="putative esterase/lipase/thioesterase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22180"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR022744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22180.1"
FT                   /translation="MRTVLEREFVSFDGVPLFYRHWPLHDAAATGTPKAVVVLHRGHEH
FT                   SGRVMHLAEELDMPDAQFFAWDARGNGRSPGVRGDAPGFEALVRDLDSFIAHLRATHGI
FT                   AVQDIVVIARSVGAVVAATWVHDYAPPLRALVLASPAFKVKLYVPFARPGLALLHALRG
FT                   NFFVNSYVKPQWLTHDPARVESYRTDPLITRPISVRVLLGLYAAADRVVDDAQAITVPT
FT                   QLLVSGADFVVHRGPQDRFYENLRSPIKQRHWLPGFFHDTLGERDRAMAIAHIRQFVQA
FT                   RFAQPPVRAALGDAHRAGPSFEEAERLAWPPQRNSLQDLRWRGVRAGLRLGGRLSEGIA
FT                   LGLQTGFDSGSTLDYIYRNQARGRGPLGRMIDRTYLNAIGWRGIRIRGSHLGELLRDAA
FT                   ARLRGAGKPVRVLDVAAGHGRYVLQALGSGAQRADAIVLRDFSPLNVTQGTALIQALGA
FT                   GDIACFEQGDAFDPAALAAVQPAPTLAVVSGLYELFADNDQVALSLAGLATAVQPGGYL
FT                   LYTGQPWHPQLEFIARALTSHRDGVAWVMRRRSQQEMDGLVEAAGFRKVAQRIDAFGIF
FT                   TVSMAQRIDA"
FT   CDS_pept        618528..619865
FT                   /transl_table=11
FT                   /locus_tag="XCV0550"
FT                   /product="putative membrane-associated phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22181"
FT                   /db_xref="GOA:Q3BY82"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22181.1"
FT                   /translation="MSHVARPSGRAALWLALLGPFFFLSYGLANTLAGRATQVPSVVFG
FT                   WEHGMPFWPWTIVPYWSIDVFYAVSFFVCRNRRELDTHALRLLSAQLICVACFVLWPLR
FT                   YSFVRPQTEGVFGWLFAVLLGFDKPFNQAPSLHVVLLVVLWVRYGQHLCGVWRWLLHAW
FT                   FALIGVSVLTTYQHHFLDIPTGLAVGWLCVWLWPERVAAPFAQARFARDLRRWRLAAMY
FT                   LAGALVSAALALWSGGAALWLLWITLALLLVALNYALLGPGGFQKRSDGRLSLAARWLY
FT                   APYLSAAWCNSRLWTWRAPSPRAVCDGVWLGRIPLPGQRDKRAAVVDVSAELSLYAAQA
FT                   QDRVVPMLDLVAPSPAQLREAAQAIAQAQAIGPVLVCCALGYSRSAASVATWLVRSGRA
FT                   RDVDAAIAQLRTVRPSIVLGHAHRAAIVAACDGHDGGDDIPERRAQ"
FT   CDS_pept        619862..620308
FT                   /transl_table=11
FT                   /locus_tag="XCV0551"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22182"
FT                   /db_xref="GOA:Q3BY81"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22182.1"
FT                   /translation="MNIAPLTLAAMRAVLRQGAALDRFSLLLLAAAIGLLGVAQAPPLM
FT                   QLSYAISMLAGVLQRYWAFRVGLDADLLAASIAHLERCGGTEQDAAHQLDAAMHAIGLI
FT                   PKPSPTRDWASRWTGMRRLLRWQLASVVVQLLLVAAALALRIFG"
FT   CDS_pept        620305..621801
FT                   /transl_table=11
FT                   /locus_tag="XCV0552"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22183"
FT                   /db_xref="GOA:Q3BY80"
FT                   /db_xref="InterPro:IPR026467"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22183.1"
FT                   /translation="MSNQPDSAQREPRHATQAQRALWQRLQAYRFGQDEAAFAAFVRRV
FT                   AKQAQCSTAQAQALVEEYRRFCFLACTDTVDVTPSPLVDQVWHTHLTDTREYWQQFCPH
FT                   VLQTTLHHRPGRGDAGEEARFQAQYRQTLERYRTQFGEPPAQWWPVARPPQSTLDPLHG
FT                   HTAEQTLQALRGAPQSAGPQRGVPYAVVVWAIIAVTVGMVCHSANGRALSPLHWRGVYF
FT                   LPLFIALIGLAWSMAAWLRRVLRRGRTAAAVDASELAYLSGGADRVADLWFTELLVRNA
FT                   VYLERDATEPARRWVRCHRQIAVPPALEPALEAVRTTEDPVWALRALRALAAPLEQRLI
FT                   DKGLWLSQAQAHAVRLACTVPVALVWGLGLCKLVIGVQGNHPVGYLLCLMVLTTLLVLG
FT                   FALVPVRRTLGGEARLATLRQARRRDAARTGGDPGEAVALYGTAALIGTAWADYHSLRA
FT                   PHGHAGGSGSSCGGGGGDSGGDGGSSDGGGGCGGCGGGGD"
FT   CDS_pept        621801..622439
FT                   /transl_table=11
FT                   /locus_tag="XCV0553"
FT                   /product="CDP-diacylglycerol-glycerol-3-phosphate3-phosphatidyltransferase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22184"
FT                   /db_xref="GOA:Q3BY79"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22184.1"
FT                   /translation="MQQGRRQRQLLWARVLRGRGATPNGVSWVGIACAALAGLMFYIGL
FT                   SAPAREGAMPLLLAVLGLQGRLWCNRMDGVLARQARMVSRAGEVYNDAPDRLSDVLVCV
FT                   GLGYGLQAGLPWAAQLGWAAALCCVTTAYVRMLGLACGTPEPRQGPMSRVQRMQWLSLA
FT                   GALALPLQWMGQPRLAAWLLIGALAVLIAGALLTVAVRLRTIVRTLEQK"
FT   CDS_pept        622436..623068
FT                   /transl_table=11
FT                   /locus_tag="XCV0554"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22185"
FT                   /db_xref="GOA:Q3BY78"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22185.1"
FT                   /translation="MIARLIARACSGAIRTLTGARALWRGCAPSNERRVYYGNHASHGD
FT                   FVLIWSSLPASLRHEVRPVAAADYWQRTALRRYLIHAVFNGVLIERDPAQRTRDPIQCL
FT                   CDAVDAGDSLILFPEGTRNPDDGVLPFKSGLYHLARQRPELEFVPVWIDNLKRVMPKGK
FT                   WLPLPLLCTTTFGAPLRLDADETKDAFLARARAALLALSPDQLEARA"
FT   CDS_pept        623065..624039
FT                   /transl_table=11
FT                   /locus_tag="XCV0555"
FT                   /product="putative phosphatidate cytidiltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22186"
FT                   /db_xref="GOA:Q3BY77"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22186.1"
FT                   /translation="MSLYVYSGQLQQSSMHQQTLWLFSGIALVLVIATLISETLRWRAR
FT                   ERPSAVLDNLVARIRAWWVMAAVVGLAFVFGRAGVIGLFALVSLFALREFITLTPTRRG
FT                   DYYALLAAFYIVLPWQYGLVWTGWYGMYTLLIPVYAFLVLPILATIGGDTTRYLERTAK
FT                   VQWGLMICVFCISHVPALLNLDIPGYAGRNLLLIAFLVIVVQSSDVLQYVWGKLAGRHL
FT                   IAPKLSPSKTVEGFIGGVLSASLLGMALWWITPFAPWHAFGLALVANLMGFFGGLVMSA
FT                   IKRDRGIKDWGHMIEGHGGVLDRLDSVCFAAPVFFHLIRYGWA"
FT   CDS_pept        complement(624283..624555)
FT                   /transl_table=11
FT                   /locus_tag="XCV0556"
FT                   /product="putative transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22187"
FT                   /db_xref="GOA:Q3BY76"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22187.1"
FT                   /translation="MNAAPSRPDTSRGAPKSPLREHVAQSVRRYLRDLDGSDADDVYEI
FT                   VLREMEIPLFVEVLNHCEGNQSRAAAMLGIHRATLRKKLKEYGLT"
FT   CDS_pept        complement(624661..625404)
FT                   /transl_table=11
FT                   /locus_tag="XCV0557"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22188"
FT                   /db_xref="GOA:Q3BY75"
FT                   /db_xref="InterPro:IPR021834"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22188.1"
FT                   /translation="MATAAAATQADTSASERSAGTADGQSHPGRPSSHPDPATTDSGAA
FT                   SALAGEHAQSDAGIAQPRTTAVQMQPLPAPALAAPAFARRGVTRPRLRASGRQWALLVG
FT                   LVGVLGLQIVIADRAHLAANARWRPLVGAACTLAPCSLPAWREPEALTLLNREVRPLPG
FT                   VAGVLQIQASFRNDARWAQAWPWLQLSLSDADGRVIGTRILSPQEYLGPSPPAQDTLAP
FT                   GQAVQVAFRVREPAASTAAFSFDFR"
FT   CDS_pept        complement(626359..626736)
FT                   /transl_table=11
FT                   /locus_tag="XCV0558"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22189"
FT                   /db_xref="GOA:Q3BY74"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22189.1"
FT                   /translation="MSKLYERVREARSLTKLTQEALAGELGVTRSAVAQWEMAEGTAPS
FT                   VENLIGLARRSGMAFEYLATGRGDRVFGPPVSAIAEEPAQYRRLDDQQRVLLTRFDTLT
FT                   PRQRAGLLDLLLAEGKTRRRR"
FT   CDS_pept        626886..627389
FT                   /transl_table=11
FT                   /locus_tag="XCV0559"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22190"
FT                   /db_xref="GOA:Q3BY73"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22190.1"
FT                   /translation="MVEPAGRKPDPQRRSPPPPAAPADAPWPAHSPLDPAVRRFRGAAR
FT                   YAIWRRGDEWTAVADGPQWSAALAPRVWALRQRHWPLLAVSALMLVVAGAVALAGVRAW
FT                   SPVAWTALLVAEMLLRVWVARQAGPWRTAALQRDGWQPVTRLRAISVADAVTTAQIRAG
FT                   RPQR"
FT   CDS_pept        complement(627412..628332)
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="XCV0560"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22191"
FT                   /db_xref="GOA:Q3BY72"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BY72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22191.1"
FT                   /translation="MPFLELTLSCSEVTLPRFQNALDDVGALAVTMLDADADTSNERAI
FT                   LEPGVGEMPLWDRLTMTALFDGDSDALVVLAALEAFDPGLDWSQVAFRMVEDSDWERAW
FT                   MDLFKPMQFGERTFIVPWNHALPEAADTPEAAVVRLDPGLAFGSGTHQTTALCLRWLDS
FT                   LAGSGELQGRSVLDFGCGSGILAVAALKLGAAGAVGVDNDPQALLATADNAQRNGVDAQ
FT                   LTVYMPQDEPVQTYQVVVANILASALDALADTLAARVAPGGRIALSGILHGQEDDLLKR
FT                   YAPWFDQLRCERDEDWMRIDGVRRG"
FT   CDS_pept        629226..630155
FT                   /transl_table=11
FT                   /locus_tag="XCV0561"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22192"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22192.1"
FT                   /translation="MPLARARHLWLLLAPAALAAAAWWHVRAQPAERDVDRAVPVAAEA
FT                   APVSAATPQLHAAAEHGAALQLPHRDAVEAQPDLYRYAQQLQQQVRAGDAQAGWRLSRV
FT                   YDYCAPYAASPSGYAADSAWIAAQRTPGVAAMHAARERLAQRCAGFAPTDGLSPRMVAQ
FT                   QRLAAARAGSLAAEAAMLALGEPLHASPGYKRALVQRVLASRDPEAYLALAPAMGARAS
FT                   GDDSLQGYVAGDQFAELAWQVAACRLGLDCSASSTLVTSYCANAGICSRDSAQDFVSFV
FT                   FDAAVPRQGADRVDEMVDTLVSDAGAQS"
FT   sig_peptide     629226..629309
FT                   /locus_tag="XCV0561"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        630152..630517
FT                   /transl_table=11
FT                   /locus_tag="XCV0562"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22193"
FT                   /db_xref="GOA:Q3BY70"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22193.1"
FT                   /translation="MNYRRLAHGAKFWLWVALFVAYSAAAVSIVMIDTADHRYQPLSVK
FT                   STSVTGDEQQRRRGASQVAAVYRASSAMPFSTLPAGSTFQVVWPDGSTETMTVVDPSSA
FT                   SGIVPVPGSQQAPAPRR"
FT   CDS_pept        complement(630887..632254)
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="XCV0563"
FT                   /product="biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22194"
FT                   /db_xref="GOA:Q3BY69"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22194.1"
FT                   /translation="MLDKVVIANRGEIALRILRACHTLGIRTVAVHSTVDRNLKHVAMA
FT                   DESVCIGPAASSDSYLNIPALIAAAEVTDAQAIHPGYGFLSENADFAERVEQSGFIFIG
FT                   PKADTIRLMGDKVEAIRAMKAAGVPCVPGSGGPLGDDIVANTKVAREIGYPVIIKAAGG
FT                   GGGRGMRVVHSEAALKAAIETTKSEAKAAFSNDQVYMEKFLENPRHVEIQVLADGQGGA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITEELRNEIGKVCVDACIRIGYRGAGTFEFLFEN
FT                   GRFYFIEMNTRIQVEHPVTERITGIDLVCEQLRIAAGHKLSIKQSDIVLRGHAIECRIN
FT                   AEDPETFMPNPGLITAFHPPGGPGVRVDTHIYSGYKVPPNYDSMIGKLIVHGPDRETAI
FT                   ARMRVALSEMVVDGIKTNIPLQQRIMRDKGFQAGGQNIHYLEKRLAERKNKSIALT"
FT   CDS_pept        complement(632244..632678)
FT                   /transl_table=11
FT                   /locus_tag="XCV0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22195"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22195.1"
FT                   /translation="MIRDSQERPHERLTVWRDAMSLVEAIYRLSHDFPDSERFGLTAQM
FT                   RRAAISIPSNIAEGAAHRSTAEYLRYLSMARGSLAELDTQLQIATRLQFASPDAAIADL
FT                   LNRTFAKLNALIRSLEKSRHLREPSAFYESPIPNPQSHAR"
FT   CDS_pept        complement(632699..633187)
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="XCV0565"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase (BCCP)"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22196"
FT                   /db_xref="GOA:Q3BY67"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22196.1"
FT                   /translation="MDLRKIKKLIDLLEESNLAEIEIKEGEESVRLARVPKGAAMLSAP
FT                   VQQQYAPAPVQAPAAAATMPMQSPTEASTGGAKQAAALPEGHVLRAPMVGTFYTSPSPD
FT                   KPAFVTVGQQVKVGDTLAIIEAMKMFNPIEADASGTIVAILGETGQPVEFDQPLFVIG"
FT   CDS_pept        complement(633284..633730)
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="XCV0566"
FT                   /product="3-dehydroquinate dehydratase II"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22197"
FT                   /db_xref="GOA:Q3BY66"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BY66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22197.1"
FT                   /translation="MAHLLLLHGPNLNLLGTREPEVYGRTTLAQIDAALVDRAQAAGHV
FT                   LHCLQSNAEHVLVERIHAAREDGTAYILINPAAFTHTSVALRDALLGVGLPFVEIHLSN
FT                   PHAREPFRHHSYLSDKADGVICGFGADSYRLALEAVIARLERDA"
FT   CDS_pept        complement(634575..636893)
FT                   /transl_table=11
FT                   /locus_tag="XCV0567"
FT                   /product="putative C-type cytochrome biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22198"
FT                   /db_xref="GOA:Q3BY65"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22198.1"
FT                   /translation="MKSLSRWIARCALLAAPLLAAPLAVLAPAPAQAAVTEADLLPVDQ
FT                   AFALSATADSRDRIALHWKIAPGYYLYRHRISVKAGKGFAAGELALPEGESKHDEFFGQ
FT                   VQTYRKQLQATLAGKADPAVQTAVLQVQYQGCADAGVCYPPQRREIRLDLPAADATGAQ
FT                   ATAAPRENLGALVPRNAAAPRLFGAPGQTAGVDALPLPAEQAFNFEAIVGDGNSLLLRF
FT                   TPAPGYYIYRDRTSLALEGANGVRTGLPRWPQGKAHRDEHFGDVVVYFDQAEVTLPLLR
FT                   DHPDPAHVTLVATFQGCQTDGICYPPMTRRVALDVPAGTVSPQNQAQAAPLMISPLAAG
FT                   QAPVEPAPAASTAVPVADASAGNPERTPPPHTDKGLLGMLVLALLGGLVLNLMPCVLPI
FT                   LSLKVLGLAHSGESRSHARSHAIWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQP
FT                   WFVAALAYLMFAVGLSLSGVFTLGTNLGGIGQSLAARNGPLGDFFTGVLACVVASPCIA
FT                   PFMGTALAYAFTAPALLAMLVFLVLGLGLALPFLLIGFVPSLARRLPTPGAWMETLKQV
FT                   LAFPMYLTAIWLLWVLGKQRGVDALALMLVGATLLALGLWCFERSRWKSHRLGMGLATT
FT                   MLVLALVPVVAVTRLSLPAATAAEGVVAFSPQLLDRLRADNRVVFVNMTADWCVTCKAN
FT                   EKNVLSSAEFRDALRRVDAVYMKGDWTNVDPAISTFLDQHQAVGVPLYVVYGPGAPPAI
FT                   LPTVLTGAITEDALLRAAR"
FT   CDS_pept        complement(636899..637231)
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="XCV0568"
FT                   /product="periplasmic divalent cation tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22199"
FT                   /db_xref="GOA:Q3BY64"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22199.1"
FT                   /translation="MSAPSLHLLVSTCPDTDSAERIAQALLDERLAACVTLLPGVQSLY
FT                   RWKGAIERSTEVQLLIKTWDDCLPDAIARLQALHPYELPEAVAVQASAGLPAYLDWVRA
FT                   ETRKEF"
FT   CDS_pept        complement(637698..639488)
FT                   /transl_table=11
FT                   /locus_tag="XCV0569"
FT                   /product="putative extracellular ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22200"
FT                   /db_xref="GOA:Q3BY63"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22200.1"
FT                   /translation="MRLPSRFVSLRCTLPLACAFALGATSANAAVFINELHYDDVGASG
FT                   DSGEGVEVVATAGESLSGYRIYLYNGNSPSAAVVYANTAVPAGTVVSCGSQVRMATVSY
FT                   ASNGVQNGPNDGVALVDPNGQLVQFLSYEGAITGSGGPAAGVTSQNLPVSESNSTAVGS
FT                   SLQLTGTGSSAANFSWAGSAAQTFGACNRGQTFTGSDGGGSTGAPTISSTTPTQGATGF
FT                   PAAGDLAVGFSEAVTLGSGAFALSCASSGNVALTYPTSGTRFTLSTNTALVGGERCTLA
FT                   ITASAIRDASGLSPAANQSIAFTVATASGGGTGYYARVNTASASQLRCSLHATIKGHTV
FT                   YPYSGSGTSTWTILEMADEDPNNSGRILDAYRNRSYAKVSDRAGTGSGLTYNREHTWPN
FT                   SLGFGSATGDRGLPYAPYTDTHMLYLTDTSFNADRGNKPYATCTSSCGERVTEVNDGSG
FT                   GGSGRYPGNSNWVRTPDGNSGTFEVWGRRKGDMARAVMYMAIRYEGGLDAATGQSEPDL
FT                   ELTDDRSKIVQTAASPAYMGLLSTLLAWHQADPPDDAERARNEVIFSFQGNRNPFVDHP
FT                   EWATASLFNSAKPASCQLAN"
FT   sig_peptide     complement(639402..639488)
FT                   /locus_tag="XCV0569"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        639897..640184
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="XCV0570"
FT                   /product="10kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22201"
FT                   /db_xref="GOA:Q3BY62"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BY62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22201.1"
FT                   /translation="MSIKPLHDRVVVKPIEADEVSAGGIVIPDSAKEKSTKGEVVAIGA
FT                   GKPLDNGSLRAPVVKVGDKVIYGQYAGSSYKSEGVEYKVLREDDILAVIG"
FT   CDS_pept        640327..641967
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="XCV0571"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22202"
FT                   /db_xref="GOA:Q3BY61"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BY61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22202.1"
FT                   /translation="MAAKDIRFGEDARTRMVRGVNVLANAVKATLGPKGRNVVLEKSFG
FT                   APTITKDGVSVAKEIELADKFENMGAQMVKEVASKTNDNAGDGTTTATVLAQALIREGA
FT                   KAVAAGMNPMDLKRGIDQAVKAAVVELKNISKPTTDDKAIAQVGTISANSDESIGNIIA
FT                   EAMKKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILL
FT                   HDKKISNVRDLLPVLEGVAKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGF
FT                   GDRRKAMLEDMAVLTGGTVISEEVGLALEKATIKDLGRAKKVQVSKENTTIIDGAGDTA
FT                   AIESRVGQIKTQIEDTSSDYDREKLQERVAKLAGGVAVIKVGASTEIEMKEKKARVEDA
FT                   LHATRAAVEEGVVPGGGVALVRALVAVGELKGANEDQTHGIQIALRAMEAPLREIVANA
FT                   GEEPSVILNKVKEGSGNYGYNAANGEFGDMVEFGILDPTKVTRSALQNAASIAGLMITT
FT                   EAMVADAPKKDEPAMPAGGGMGGMGGMDF"
FT   CDS_pept        complement(642081..644180)
FT                   /transl_table=11
FT                   /gene="xopX"
FT                   /locus_tag="XCV0572"
FT                   /product="Xanthomonas outer protein X"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22203"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY60"
FT                   /protein_id="CAJ22203.1"
FT                   /translation="MEIKKQQTAGPSSLAPLHDIHTDNAPVADATSPTQTPLHPSLAAL
FT                   TPRSRSRASSADSEHGASPVPSHDTEPQADSPERASGPSTAATLAARANAALASGVQQA
FT                   YAAVSKGASNLWSLADLRTMLQIHADDPAFLQMVRHTDPEQSAPHTLAACRQQITQLRD
FT                   AIEAATGLEARFRQQLLGDIKAVEDALQPLEHGTPATGRALKSLANLVNLWPLMVPSPL
FT                   LGNQAKTFAYSIAAATKGVMTLSASALRPTADGLPFPLMGGQLGRDANEMHFYSVLLNG
FT                   LFLTTELPKKFGTPSMRHQAEAVENNLGFAAAASTACAAMVLTPFLWNSLNVLGNRLQH
FT                   KLSHLGAGIAENAGFQSQAQRLRARLTPGQVSAQLRTQLNEICAALEHGREAFQQARRD
FT                   FTDPSQGRELTRTLNAQCTHLLETLDRCSKRLSAALQVDQDQPATLPRQVTNHDIAPKL
FT                   ALALLGAGVTGLTVYLIQPDRIGTVDLLADSVVVTAVMMQSAVNAHATRQDAMERFKAM
FT                   CSGSLVMALALGVEKLSKTFADKSLIEASSSSPYYAGAIMSLMSMTMPGPMARGAELAM
FT                   NWGGGQIMRVFRGPDGTALATRMPSSPEELIQHVQDTARYVQSLSPEQAQEYAQTVADS
FT                   ALQGIEDAGAQAQTRPASSVTITEITEANEEEALAAASASPEQRSPARTHPSPDQAAAS
FT                   TVPSS"
FT   CDS_pept        644605..647496
FT                   /transl_table=11
FT                   /locus_tag="XCV0573"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22204"
FT                   /db_xref="GOA:Q3BY59"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22204.1"
FT                   /translation="MNCRSHRLALSISVSLAVTAACAPPLMAQQTEPDATRATSTLDAV
FT                   SVTGSRIKRAQVEGAQPVVTISAQQIQQEGFATVYDVLNSMNQQGSVEADTQWGSHTPN
FT                   ASPINLRDLGPGRTLLLVNGHRVADYPLPYGGESNFSNYSNIPSAAVERIDILTGGASA
FT                   IYGSDAVAGVINVILKRDYQGDQVRLRGGTATEGGRDSFDVSWAGGRTGENWSLTYALQ
FT                   ATKRDPLSGRDRPEMDDSDDMSYSNWTGQNRLYGFNPFTGLSLIDANTNERLAPPAGTC
FT                   ARFGGEFIDGQRLSYNQNTGALTNAGDYCGVARDYGDWGLVTGSEDYSAYLYGTWKFGE
FT                   HTEAWATLSANRSIGRWTYDPPYAYLGPFQDAATGRSLNLIRQLTRREAGGWDRLANYN
FT                   KEQSWDLSAGLRGVWADRFDWELSVGRSRYTVDEYIRTVDTARATDYFLGSSLGTAADG
FT                   TPIHAINEARLYTPLSSDQYDALVAKSHNSAYSWVNQASFSVSGDVVQGWAGPIRFATV
FT                   AEVAKQGYQLSPDPCANACYPVDVVDSGGGERMRSSAGLEFQIPLLSTLSANVAGRYDR
FT                   YGNYRSSAAIPTDVGTQSDTTWSAGLEWRPVESLLVRSTVATSFRAPDMHYVLGEPSST
FT                   NQTVIDQYRCISSGAYLTGGCNDENNNIFYTVDVNRRGTPDLRSETGRSFTGGVVWDIA
FT                   QGLSLSVDYYRIQLEEMIKDLDRDEILSAEAGCRTGTTISGGTWNNPGGAGYCDTITSR
FT                   VMRNADGTIASIERGPINLAQMETSGIDASLKYRLATAGWGNFQLSLDYNNLIAYREQI
FT                   YRTDSDENRRDERVRSRVRGSVHWDNGGAWDWTVYFRRIGSMRAVNWGTCERFDDGYQP
FT                   SASDACLVTDTANVHLGETSKRYFGRVGPAIYWNLSTGYRITDHAKVNFYVNNVFNEVG
FT                   YDHKERFYGYGFYNTTLFNPIGREVAAEYVFTF"
FT   sig_peptide     644605..644688
FT                   /locus_tag="XCV0573"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        648029..649102
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="XCV0574"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   phe-sensitive"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22205"
FT                   /db_xref="GOA:Q3BY58"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22205.1"
FT                   /translation="MPPVTDDLRIRKIEALAPPAQLLSLLPCDERASETVTNARAALHD
FT                   ILHGRDDRLAVVIGPCSIHDPVAAMEYAQRLRPLRDQFGDALEIVMRVYFEKPRTTIGW
FT                   KGLINDPDLDGSFQINKGLRVARGLLRDINNLGLPAGVEFLDIISPQYIADLVAWGAIG
FT                   ARTTESQVHREMASGLSCPVGFKNGTGGDVKIAVDAVGAASHPHHFLAVTKDGHTAVAA
FT                   TAGNPDCHVILRGGKQPNFDAAHVEAASQVLNASGLPARLMIDASHANSSKNPENQPKV
FT                   VEDIAHQLENGETRIVGVMVESHLVGGRQDLLPGCELTYGQSITDGCIGWDSSVQVLER
FT                   LASAVRARRMRRIAEAA"
FT   CDS_pept        649887..652070
FT                   /transl_table=11
FT                   /locus_tag="XCV0575"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22206"
FT                   /db_xref="GOA:Q3BY57"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22206.1"
FT                   /translation="MPMPSLRDRFQRWPRPWRRAVGVVLALYALYLLAGNLYLNTPLFD
FT                   ASTNRQPHKFTMQTGPAVTLFPGEVIAWNVRMRGQANRTVYVFHADRAHARIALLALFR
FT                   REVRLPWLHATGVSAEVETSDTPIPPPPRGNQGWTLRFDAITSNSIRSARLGKLLIAGQ
FT                   GHGKVGFLKQLKGGPSELFPSEAGFTDAVVSYDGVQVFNGAQLDAQFQFPRHYRDQAPG
FT                   LRKLGITAARLQLKANSVALKIDTGAPHVDIGSGPSAARVEADIRLASGALQPGSRAVW
FT                   RLPLLAGVGATDRGMLALQLDVAQDIRVQARLPRDEKTGSELHADLRVAGRSVPFERPA
FT                   QLLPRLSGQVRGRWKFESLNWIAELFVRKPWFQLEGGGLVEADLRLAQGRLSAGSTLDI
FT                   PRVEAVAQVFDTRLAGVAKAHGRIDDAATPQAHLDVSIPTFKAAPRDAPKQLLLDGRDL
FT                   QLAMHGDAELARLSDTLKAQLRFSDARVPDLTAYNRYLPGNNVRLLGGSGSLTGDVALN
FT                   ASGDVGNGHAHLRGQGAHLALAGVQMRGDAELQATLQRADFKNKFFDLSGTRIRLRNMR
FT                   VGDDGKDADWWGELQVGAGTIQAEAPFQVDAEAALRMRDIAPLLSVFAQRADYPRWVLG
FT                   LLDSGELDATGRLRWRKQQLLIDDLHAENARLSLRARLALNDAQRRGDLYLRWGVLGAG
FT                   IELDGKQRQWHLAGARQWYDAQPALLPAVSKTK"
FT   CDS_pept        652164..654614
FT                   /transl_table=11
FT                   /locus_tag="XCV0576"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22207"
FT                   /db_xref="GOA:Q3BY56"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22207.1"
FT                   /translation="MTMPVRARWRALPRLLRWPLSALIALYASYLLLGNLLLNTPLGPA
FT                   ALNRSPDKFTMHWGPALTWWPGRVVLWDVDLQGHSARTHWNVSAQRMSGQIRLLPLLHR
FT                   QLLVPQLHVRGVRGGMQAAAATPGTGAMQSPAAAQATRAAVAAAKGAADTPAALANERA
FT                   PTATPNAEHSATTQTPAQDLRVTIATATTDAKPGMPITSTPQSARRADTQAGTPASPTA
FT                   WTLQLDRIVAEQVQAVSLRQLHIEGQGQLQLGLFKQLRGGPMEIFPSHAVFESARVRWG
FT                   QDEVMRNGQLRIDASIARHAPDQASGLAVLQLTDALIAVHGDTAALDVTRHAQGRHTLA
FT                   TRAGKGRADGELRWIRGALQPGSQLQWRAPLHDSTRTPAALLGELTAQLQVDQDMRLKV
FT                   SMPEPADAGLTLDADLRVQGRQLPVQSMRSLLPRTSGHARLHWQLSSLRWIAALFPDVD
FT                   WLTLEGEGLVDADLRIDRGQLAAGSRLQVPHVHAQVGVMGHAITGQASADLRVDADASG
FT                   QLLPALALQMQQFSIAHTDAPARPFVQGRDLRLDLRTRADARNLSSLRDATRAHLVFAN
FT                   ARVPDLRAYNRYLPQQQLRFDGGNGVLSGDLQIEPGGRIGKGGVRIGARAARLQFAGLA
FT                   LRGDVDADLRLQRGDLRAEQFSLDASSIQLRNVGFTGPDGQQRDGWWARIVLDDARMQW
FT                   RQPVGVDGRVRIQVRDLAFLVALYARDRSIPNWMLRLVDAGQAQLTARAHWQGETVIVD
FT                   GLQARNERFQVDARLRLQDNQRRGSLLARWGLLSAAVGLRGDTPEWHLRGAPEWYRAQP
FT                   DLLR"
FT   CDS_pept        complement(655036..655956)
FT                   /transl_table=11
FT                   /gene="gnl"
FT                   /locus_tag="XCV0577"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22208"
FT                   /db_xref="GOA:Q3BY55"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22208.1"
FT                   /translation="MDRHCRVRAPGAARPAECPPPATRHAGLAARLGNARLLTLYDQAT
FT                   WSEGPAWWEAQRTLVWSDVVGRRVLGWREDGAVDVLLDATAFTNGNAVDAQQRLVHCEH
FT                   GRRAITRSDVDGRAHLLVGRFEGKRLNSPNDLIVAHDGAIWFTDPPFGLLKPSQGCPGP
FT                   QELDHHGVYRLPPDGGALQCMVGLDHPNGLAFSPDERVLYVSQTPEGGPTSPEITAFDW
FT                   RDGALHNRRRFAVVPDGLPDGFCVDRQGWLWSSSGAGVCVFDTDGQYLGLVPTPATASN
FT                   CTFDLEQRRLFITGGSTLWLLELQQ"
FT   CDS_pept        complement(655956..656474)
FT                   /transl_table=11
FT                   /locus_tag="XCV0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22209"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22209.1"
FT                   /translation="MSPTTLPAHLLPSQIPLQTDGNDPALPPSLPFLHLWTGPDGNSCL
FT                   NASQLPGFGRKSVGGGAAPQWLRPFPGEVLGIQFAVLPVGWVGDWHESPHPQWVIPLRG
FT                   RWFIETGDGTRVEMGPGDIHFGQDQGTTDQRGHRSGQLGDEPCLQMMVQFAQSPGAATA
FT                   HPFGHPAPR"
FT   CDS_pept        656595..659462
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="XCV0579"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22210"
FT                   /db_xref="GOA:Q3BY53"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22210.1"
FT                   /translation="MRVLPAWRGCQNPVMPMPTVSMSPALTALIERAVARVRQSLPVEQ
FT                   AWPGGAFDRQLAQVALASEFALDTLARQPALLQHLAQPDPPPLPLPQLDPAQPPLWPAQ
FT                   LRRYRSAESTRLVWRDVLGLDSVEATLAGATRLAEHCLQCGLQALEQQFHTRHGKVIAA
FT                   DGSVQRLVVFGLGKLGGGELNFSSDVDLVYAYPQGGQSDGARPLAAEEYFARLGQQLAR
FT                   LLDETTADGFSHRVDLRLRPFGTAGRVALSFAGMDQYFQREGRDWERYAWLKARAVAGD
FT                   IDAGEAWLETLRPFVYRRYLDFTALDGLREMKAAITAEVARHDRLDDIKRGPGGIREIE
FT                   FLAQSLQLIRGGREPSLRERRLLPALQALVAAGQIDQENGQALSTAYRFLRRLENRLQM
FT                   LRDAQTHALPQAPLDRERIALGLGYADWSALLDALAPQRTRVAAEFAELLAPRVRATAP
FT                   DALADYWRALPGGDAAPLAGIGLHDPDGAHQALADFAQSSGVRALSDSARARLDRVMPA
FT                   LLHAATRASQPDAAVRRMLGLLQATLRRTSYLALLDEQPSALARLVDVLSRSALLAERL
FT                   AAYPLLLDELLDTRISGPLPDRAALHAACAETLQIDDTEAALRELNERRLALSFRIALA
FT                   TLDGRQQAVESTRQLAWLAEAVVQTVLHLARSDMLAAHGHVPGGSFAIVGYGSLGGLEL
FT                   GFGSDLDLVFLYDHPPEVDASDGKRPLEAGRWFARLAQKVMALLAAETGAGRLYDIDVR
FT                   LRPDGGKGALVSSLASYRDYQRDRAWTWEHQALVRARAVAGDAALCDAFAHVRRDTLMR
FT                   VRDTAQLHEDVRKMRARMRAELDRSDAGRLDLKQGAGGLVDLEFVLQAGVLGLAAQQPQ
FT                   LLDACDTPALIDALARTHWLPDESSAPLHQAHAALVDAGLSCTLDRRPRLLAPTPAIQQ
FT                   ARGIIFNAARGQGLTFPLGKDETAL"
FT   CDS_pept        complement(659566..659943)
FT                   /transl_table=11
FT                   /locus_tag="XCV0580"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22211"
FT                   /db_xref="GOA:Q3BY52"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22211.1"
FT                   /translation="MVNRRFGPRAARHVAWCGFALAVLLSIWLATPRIAVASCSAFIAA
FT                   QLLDISVFDRLRDGSWWRAPIVATTCSATLDTTIFWSIAFAGASLPWVSWAAGDLAVKL
FT                   GMGVFLLGPFRALLWRSAPRR"
FT   CDS_pept        660643..662484
FT                   /transl_table=11
FT                   /gene="xopB"
FT                   /locus_tag="XCV0581"
FT                   /product="Xanthomonas outer protein B"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22212"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY51"
FT                   /protein_id="CAJ22212.1"
FT                   /translation="MKAELTRSHSLSSLERIRHPESDMGNDCDLEVGAQPKHSGFCQSE
FT                   DSRLPTTRPPRRRSTSSGATSPKSTVQGSGHTDNSGLETPLLISLTGLQKPRHMGLVRR
FT                   ESSRLVSADPVVHALLSFAQVDQPFPPQVASTDGVRLELVSRRDPEKALEEFKDAFTVE
FT                   TAQLMPAANSSERTAEQIDADIHIPLLLKAIERGSAAFGPSALIEMADGSQISAKAFLA
FT                   SCAPDVMSNDDVLSAFINQKLKGDEDLQVRLGAQELLYVATKKEFQLGGLAGSIGVSSV
FT                   IGSVWELGASELLKKAIFGKNFSPSQYALQLAGIDSVPPLIIETMDTMCVLAIIKGMKG
FT                   EDWSLRDLLPKAMKAGAISSIVSFPNNVLQYTGFKSGLGDLAANMTTTEAAIFGAASGI
FT                   PPEVKESEETMRAGLFQSIKDGVMACPSEKMGPEEAIEQMARHALDVAPGESTAVKSMG
FT                   LAAIVGMIPLIAGSKATGLLSEKVLRIFRSTVFNPIEAIALNALALGGRIHVPGLFESD
FT                   NAKHARVVQTILARASEQMESEAREITAEELHHILAPRSEFLRHVGTAIVKGMNASFEV
FT                   LPALARKLGYGETPLNKRIPYQDLAVSNTSHQPAPEP"
FT   CDS_pept        complement(662647..663405)
FT                   /transl_table=11
FT                   /locus_tag="XCV0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22213"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22213.1"
FT                   /translation="MSTAEMPAGEVVSPSARCARLRQQVPLRASSLRVAASRCTPLPRV
FT                   HASAHCAHLRPLITAVPTSRLPPALRSPRTADAAGQASCARVTDDDPMSWRRLAPLRTS
FT                   HADGAAERRRRHERTRLCIVAAMCARAQSPPPPIQARSGARRLRDTGRGLRAAAPWSRR
FT                   VSLRWSSSAVEAIIARPINRVAMRPASTPVFAPLTAHASLWAVLAMGAAVLLSNILVQY
FT                   PINDWLTWGAFSYPLAFLRVGRDRVNNSQK"
FT   CDS_pept        663717..665591
FT                   /transl_table=11
FT                   /locus_tag="XCV0583"
FT                   /product="putative secreted protease; subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22214"
FT                   /db_xref="GOA:Q3BY49"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22214.1"
FT                   /translation="MLTRIRCRPLLAAVLSASLLAFGSANAATTVPDARIDAITASLRT
FT                   APVSFDVHLPPRDQVALNALLADIQDPLSPQYHKWLSAAEFQRRFGPAPAQLAQVRAAL
FT                   QAAHMTVVQQGPTLHVSANADSVERLFAAPLVADLNAGQQVRLAAAAPLQLPAALRANG
FT                   VTVTGLSRGLPAARMDSRMLAGTPGNRTGDGTTSYWYNDLKQAYGYPSYQTMIGAPGKQ
FT                   QRLDGSGSTIAVLIGSDVLDTDIAAMFDHERFSRYAGNHANPTLYARRYVAGAKPGVQG
FT                   GNRAAVREATLDVDMALGGAPGAHVLLYVIPDLSIDSILAGYRQIVQDNEADVVSSSFG
FT                   FCEQIFTAAYNGKDATSILGLFDSVFKQGNAQGISFVASSGDNAGLDCPDTQYLVEGKN
FT                   GRYVPSVHWPAADAHVTAVGGGNLLTAYKKGSLDSSYLSESAFADPLQAEDPYGVGALL
FT                   SGGYWGAGGGVSTLFQRPAYQLRALGGTRTSMRALPDVGMLVGGCPGIAVHPCQQGTSS
FT                   VSIYVAGAITKVIGTSVAAPEFASVAALLVQKQGRQGNLNDYLYRLAANGPQAYHRGIP
FT                   GNNGVVGNDVPIAGKYNYTTGLGTPVVRLMIGALDAAPAGIPRSPSNP"
FT   sig_peptide     663717..663797
FT                   /locus_tag="XCV0583"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(665700..666209)
FT                   /transl_table=11
FT                   /locus_tag="XCV0584"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22215"
FT                   /db_xref="GOA:Q3BY48"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22215.1"
FT                   /translation="MMHARSFLAASACLFAALTLPCAHAGEATTPGEKSKFYSALSLAM
FT                   PVLIASGVAGSVFSAPVAASNTVAESRREARAGKLPPMRVQAVDTLPAGARQVRLQDPQ
FT                   QAENTAVLQWQARQDDPAAGFHVGEMVTFQPSPAGSGWTVHAEQGQALAFVPTEAAAAY
FT                   GSSQTW"
FT   CDS_pept        complement(666206..667075)
FT                   /transl_table=11
FT                   /locus_tag="XCV0585"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22216"
FT                   /db_xref="InterPro:IPR014547"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22216.1"
FT                   /translation="MTGTINARWIRQTRRKAIALLVLAALPLAATATTPRCVPRYPTPH
FT                   AAAAMFDMATSTAQALDALPDAKVVLLARGGQDLSRYGLKHSHLAFAVRDDDGGWRVRH
FT                   LLNRCKSDASQLYQEGLSNFIGESALSSDLRVGIPTQALQQRLYARLTGSGDLAHRLHE
FT                   TRYSIVAYPFSTDYQNSNQWVLEVLAVALAADAQPAVAIANSGDAQAWLRTARYHPSAL
FT                   HLDLSQRIGARFVAANAAVTDHPVSERVSGNYSVVTVESVFDFLHQRDAVDKELSIARA
FT                   APTPGATP"
FT   sig_peptide     complement(666980..667075)
FT                   /locus_tag="XCV0585"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(667118..668065)
FT                   /transl_table=11
FT                   /locus_tag="XCV0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22217"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22217.1"
FT                   /translation="MGLTWALSDGRAGNARQAEALARAFHPAAYQPLHLQTNAPWRWAA
FT                   PRRLPGARQAFGAAFARQLQQPPALAIGCGRQAALATRLLRAHGSRSVQILDPRLDPRH
FT                   WDLLVVPEHDALRGSNVLTLLGSLHPVDDAWLAAGRAAFPALGGLPGPRLALLVGGPTA
FT                   QVPWTPQALAALCTRVSAQLRALGGSLLVTTSRRTPGDALATLRAACAGLPHLLWCDER
FT                   DGPNPYAGLLGWADAIVASADSVNLLSEACATRVPVAAAFGEQARGRVDTYLQALRQRQ
FT                   RLHLVDEVLASAVDIVPVRETERIAMQVRARLLP"
FT   CDS_pept        668200..668790
FT                   /transl_table=11
FT                   /locus_tag="XCV0587"
FT                   /product="putative NADH dehydrogenase/NAD(P)H
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22218"
FT                   /db_xref="GOA:Q3BY45"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BY45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22218.1"
FT                   /translation="MSDSLNAAALDQLFRTARTQNAFADTPVSHEVLRELYELVKWGPT
FT                   AANSGPARFVFVTSAEGKAKLKPALSEGNAAKTLAAPVTVIVAHDEDFHEKLPYLFPHA
FT                   DAKSWFDGPREGRTESAFRNGSLQGAYLILAARALGLDAGPMSGFDNAKVDAAFFAGTP
FT                   IKSNFLVNLGYGDPAGLFPRSPRLSFDEAARFE"
FT   CDS_pept        669022..669765
FT                   /transl_table=11
FT                   /locus_tag="XCV0588"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22219"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22219.1"
FT                   /translation="MKTTHKLLLPLALTLAIAACSKPAENTAAPAAETPAAATAPADAA
FT                   AAPAPAPAAAASTAPAVEVASGTYTLDPSHTDVLAQWSHFGFSNPSAHFGNVDGTLVYD
FT                   AADVTKSTVQVTLPLSGLNSFTAKFDEHLKSGDFFDAAKFPTATFKSTKVEAAGTNKLT
FT                   VTGDLTIKGQTKPVVLDVTLNGAGEHPMKKVPAAGFDATTTIKRSDFGLGQYAPNVSDE
FT                   VKIRITTEALQAKAGDAAAKDAAAK"
FT   sig_peptide     669022..669114
FT                   /locus_tag="XCV0588"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        670132..670308
FT                   /transl_table=11
FT                   /locus_tag="XCV0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22220"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22220.1"
FT                   /translation="MSVVRLGRLLPLFRQGQPLRHRDVRPRGTRTVGARSTHAPRYAGQ
FT                   PGRGRVLALSATL"
FT   CDS_pept        670317..671588
FT                   /transl_table=11
FT                   /gene="appA"
FT                   /locus_tag="XCV0590"
FT                   /product="Acid phosphatase precursor"
FT                   /EC_number="3.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22221"
FT                   /db_xref="GOA:Q3BY42"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22221.1"
FT                   /translation="MHNRSFAGTMRHALLGLALCLPMAKPVVAKETAAATAHLRLTIVL
FT                   VRHGIRAPTQPGSELDRYSAQPWPHWPVATGQLTPHGRAGMQALGARYRALFAPPLGLA
FT                   PSGCAGTEQIVTIADSTARNHASAQALLQGMAPGCAVHYQALPEGERTVLFDGGKAPTP
FT                   PVRLEAETRAQLAHLQAVLSACQHGRCATPPPTRLLYEPATRDGSPAAASTLKLAGGLA
FT                   ENLMLEDIEGFDAAQLGWGRVDRAAVAQLIALHNTSFAQSKRPLPVATAAASNLLAHLL
FT                   ATVQAAAGQTPSAAALAPPSTRLLVLVGHDTTLATLGGLLGVQWHRSDRPDDYPPGGAL
FT                   VLDVLERDGMPLLRVRTLMPSLAALRSGRLDSDALASSTLVLPGCHGQALCPLPVALAW
FT                   LRTRIDPAQVQTALPELRSWPAGS"
FT   sig_peptide     670317..670403
FT                   /gene="appA"
FT                   /locus_tag="XCV0590"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(671657..672220)
FT                   /transl_table=11
FT                   /locus_tag="XCV0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22222"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22222.1"
FT                   /translation="MIVRCASSRKMGCRNRRSGNSRSPGHDQRDTTMTNSPDDRRHRLL
FT                   KATATFALLAASPLAICSGQPEYPTPQQQVASESRLLEIRVRGDLSGRDVALQLAPGEL
FT                   SPGFKLPDRRTYRVKASMIRTDPRFGPIYALVLADVSGNPLNQMNIASNTTATFGKQRV
FT                   QVYLLSLEQAKRVQRASQAQGHDR"
FT   CDS_pept        complement(672224..673009)
FT                   /transl_table=11
FT                   /gene="mxcB"
FT                   /locus_tag="XCV0592"
FT                   /product="iron chelator utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22223"
FT                   /db_xref="GOA:Q3BY40"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22223.1"
FT                   /translation="MAAHTNTQLRRDPRLRSVQVLRCEAITPHMRRIVFGGSDLAGFQS
FT                   DAPDDHVKLFFPNADGAFVLPTMTPEGPRYEEGALPSPARDYTPRDFDPQSGELSIDFV
FT                   LHGEGVASSWAARAQPGDPLKLGGPRGSFLVADDYDHYVLIGDETALPAIGRWLEAMPA
FT                   DMHAQVFIEIADAAERQELLSAAEVRVNWLERNGFDAVSSTLLEDSLRDYEPEDGDTFY
FT                   WIGAESMRARAMRKFLEEHHGVDKDSVRAKGYWKAAPDA"
FT   CDS_pept        complement(673320..673856)
FT                   /transl_table=11
FT                   /locus_tag="XCV0593"
FT                   /product="putative transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22224"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22224.1"
FT                   /translation="MKQRPPVRPTADLDAAPARTRGAGARVRPLEHGDLRLLLLALIAE
FT                   RPCHGYELMRQIAALFKGLYTPSAGAIYPALAQLEAAGWVHTDLDAGRKRYQVTAAGSD
FT                   YVAQQRDALDAALARTHRRARELIKSQTPAPIREAIHRIKHGLFARHGQWSETETARIA
FT                   ALLNAAADGMERDDD"
FT   CDS_pept        674043..675689
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="XCV0594"
FT                   /product="malonate decarboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22225"
FT                   /db_xref="GOA:Q3BY38"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22225.1"
FT                   /translation="MSRQWDTQAESRRQRLQRAAALAPQGRVVAAEDVVALLEAVIEPG
FT                   DRVCLEGNNQKQADFLARCLTEVDPARVHDLHMVQSVLSLAAHLDVFERGIAKRLDFSF
FT                   SGPQAARLAGLVSEGRIEIGAIHTYLELFGRYFIDLTPRIALVTAQAADRHGNLYTGPN
FT                   TEDTPVLVEATAFKGGIVIAQVNEILDTLPRVDIPADWVDFVTQAPKPNYIEPLFTRDP
FT                   AQISEIQVLMAMMAIKGIYAEYGVDRLNHGIGFDTAAIELLLPTYAQSLGLKGKICRHW
FT                   ALNPHPALIPAIESGFVQSVHSFGSELGMENYIAARPDIFFTGADGSMRSNRALSQTAG
FT                   LYACDMFIGSTLQIDLQGNSSTATRDRIAGFGGAPNMGSDARGRRHASAAWLKAGREAA
FT                   TPGEMPRGRKLVVQMVETFREHMAPAFVDKLDAWELAERANMPLPPVMIYGDDVSHVLT
FT                   EEGIANLLLCRTPEEREQAIRGVSGYTAVGLGRDKRMVENLRDRGVIKRPDDLGIRPRD
FT                   ATRDLLAARTVKDLVRWSGGLYDPPKRFRNW"
FT   CDS_pept        675699..676016
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="XCV0595"
FT                   /product="malonate decarboxylase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22226"
FT                   /db_xref="GOA:Q3BY37"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BY37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22226.1"
FT                   /translation="METLRYRFDGQRGARAGLEHALVGVVASGNLEVLVERVPLEGAME
FT                   IEILTAARGFGAIWQAVLDDFAARHPLRDVRISINDVGATPAVVSLRLEQALEVLQGAD
FT                   A"
FT   CDS_pept        676123..677040
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="XCV0596"
FT                   /product="malonate decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22227"
FT                   /db_xref="GOA:Q3BY36"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22227.1"
FT                   /translation="MSTVPMAQRSYYEADARERIEGLLDAGSFREFVGPRRRLISPHLA
FT                   QLETPGAFDDGIVVGEGTLRGRNVLIAAQQGAFMGGGVGEVHGAKLTGLLERAANTQPA
FT                   AVLLLLDTGGVRLHEANAGLIAISEIMRATLGARAAGVPVLALIGSGNGAFGGMGIVAR
FT                   CCSAVIMSEEGRLSLSGPDVIETVRGVEEFDARDRALVWRVTGGKHRYLLGEAHTLVAD
FT                   RIDAFADAALATFDALTEATGEAALQALEHAQQQLTARIDAYGDCRDGLEIWKRQGIVD
FT                   AQRLPLLDTEAFLAATADRSLPWT"
FT   CDS_pept        677031..677735
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="XCV0597"
FT                   /product="malonate decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22228"
FT                   /db_xref="GOA:Q3BY35"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22228.1"
FT                   /translation="MDLSHLLDQLFPLGHAIARNDDVLTGSATTAAGDVTVIGTANKLE
FT                   VGVDHALALAATVLASTRAYPQRPIVMLADTAGQRLARRDELLGINGYFAHLARALELA
FT                   RTRGARLVTLVYGESVSGGFLSFGLMADHIHALPDAQIRVMDLRAMARVTKQSVDTLQA
FT                   LSKSSPVFAPGVENYVRMGAVESLWEGDLAQVLLDALAAPVDGDQRRARGAQRGGRTLA
FT                   RDVASAVAAGEA"
FT   CDS_pept        677738..678379
FT                   /transl_table=11
FT                   /gene="mdcG"
FT                   /locus_tag="XCV0598"
FT                   /product="phosphoribosyl-dephospho-CoA transferase
FT                   (Holo-ACPsynthase)"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22229"
FT                   /db_xref="GOA:Q3BY34"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BY34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22229.1"
FT                   /translation="MAGRHALVWLREDAQWQAVTPGAQPRLRQWFAAGLPAVVARGDGS
FT                   QAPGSVRLGVPLPPSEGKQRLALQAHVADIARCTAPLTLDAVTPQAPVAVQPLLQALLA
FT                   QARAHALRPHVFGSFAWQALTGLTYVHAQSDLDLLWPIETPEQARALVTLLQRWEQQHG
FT                   LRADGELLLPEDNAVNWREYAGTAQQVLVKSNQDCRLLPRAALFPVRSAA"
FT   CDS_pept        678376..679245
FT                   /transl_table=11
FT                   /gene="mdcB"
FT                   /locus_tag="XCV0599"
FT                   /product="Triphosphoribosyl-dephospho-CoA synthase"
FT                   /EC_number="2.7.8.25"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22230"
FT                   /db_xref="GOA:Q3BY33"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22230.1"
FT                   /translation="MSAQLQQTWVAGAPAPPHDAAYQLARLAVGALHAELACAPKPGLV
FT                   TPFDSGSHTDMDAATFMRSLFALRGYFAAIAQAGIDHAPFERLRELGIGAESAMLRATC
FT                   GINTHRGAVFSLGLLTAQAARLWVAQRRRPTAEQVCNGVRAWRDALQAAPLDPHSHGQR
FT                   VRAQYRISGVREHAAAGYPVLREIALPALRTALAGGATREAALAQTLMQLIAQVDDLNL
FT                   LHRGGAEGLAFAKAQAAAFLADGGVAHPQWRVQLHAIGQQFVARRLSPGGSADLLACAW
FT                   FLHRQELA"
FT   CDS_pept        679472..680392
FT                   /transl_table=11
FT                   /gene="mdcH"
FT                   /locus_tag="XCV0600"
FT                   /product="[acyl-carrier protein] S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22231"
FT                   /db_xref="GOA:Q3BY32"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22231.1"
FT                   /translation="MSLAVLCPGQGGQHAEMFARVGDAPAAAAVLASAQRVLGAAPQTL
FT                   AADPGRYANAIAQPLVCAGTLAHWQVLHAQLPTPLMVLGYSVGELAAHAVAGSMSIDTC
FT                   LQLAATRARLMDAASPQQAGLMAVVGVPLRGLETLCQTHGAALAIINGDDHAVLGGPRT
FT                   ALQALGEAASAQGARVTLLPVSVPAHTPWLSAAAEGFAIELATADLVAPKLRVLAGIDA
FT                   RAVGTHALVIDTLSRQIAQTVRWYDVLVQAAERGARVFLELGPGSALARMAREVLPACE
FT                   ARSVDEFHSTQGVLEWVTAACERAA"
FT   CDS_pept        680480..681835
FT                   /transl_table=11
FT                   /gene="matC"
FT                   /locus_tag="XCV0601"
FT                   /product="Dicarboxylate carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22232"
FT                   /db_xref="GOA:Q3BY31"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22232.1"
FT                   /translation="MTPQIATILGLVIMFIVATALPINMGAVAFALAFIIGGVWVGLEG
FT                   KEVLAGFPGDLFLTLVGITYLFAIAQKNGTIDLLVHWAVRAVRGRIVAIPWVMFVITGL
FT                   LTAFGALGPAAVAIIGPVALRFAKQYRINPLMMGLLVIHGAQGGGFSPISVYGGITNKV
FT                   VEKAGLDVSEMAVFLTSLGFNLMMAIICFCAFGGLKLMRRQELSLADAQYVAVAGDQAS
FT                   HRGFAIEGHGALVAPGGGTLSTDPLALEAVFITRDRVITLIGLLGLGVAALIYNLNVGL
FT                   VSITVAVALALISPNAQKGAVDGISWSTVLLISGVVTYIAVLEKSGAVDYIGTGVSHIG
FT                   MPLLGALLVCYVGGIVSAFASSAAVLGATIPLAVPFLMQGQLGAAGVICALAVSSTIVD
FT                   VSPFSTNGALVVASAAKEERDGLFRRFLIYSGLVVLLGPLAAWLVFVVPGWL"
FT   CDS_pept        681881..682633
FT                   /transl_table=11
FT                   /gene="mdcY"
FT                   /locus_tag="XCV0602"
FT                   /product="transcriptional repressor MdcY, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22233"
FT                   /db_xref="GOA:Q3BY30"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22233.1"
FT                   /translation="MPRPDADSLPAMTLAPDSRASKKRVPLYEEVAERLRQKIYDYALP
FT                   PGEWIDEPALAEELGISRTPLRESLKLLAAEGLVQLDAGRGSRVTRLTLEDLNQLFPVM
FT                   AMLEGRCAHDAVKRIDAAGVQRLEELHAAMEAASAAGDVAEYYRNNYLIHETVQQYAGN
FT                   PWLIRVTHDLHRILKMHRGRQLLTPGRMAQSLAEHRQLMDCVRRGDAEGAERTMHGHLL
FT                   SQGQALAAYVAAGGMLNVPAPLPRVGGV"
FT   CDS_pept        complement(682782..683405)
FT                   /transl_table=11
FT                   /locus_tag="XCV0603"
FT                   /product="putative haloacid dehalogenase/epoxide hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22234"
FT                   /db_xref="GOA:Q3BY29"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22234.1"
FT                   /translation="MPALIIFDFDGTLADSFGFFLSTQRLLAERHGFRAAQAHEVDDAR
FT                   RLSTRELLKASGLSAWRVPWVAADFIRLMRAAPPVALFPGIAHTVGALHAGGTRLAVVS
FT                   SNSVENVQRALGAELSATFAVIEGGAHLLGKQRALRRVLRATGHTAAQAVYVGDQVADW
FT                   EAAQLVGLPFAAVAWGYAHPDVFAGLAGTQLIERVEDLLALSGD"
FT   CDS_pept        complement(683627..684046)
FT                   /transl_table=11
FT                   /locus_tag="XCV0604"
FT                   /product="Anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22235"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22235.1"
FT                   /translation="MTTLAIQIDPPQDTRQRVILTGRLDTHTYQDLDAALSPLLGTRIT
FT                   TLVLDLSALEYISSAGIRCIFKARKALATRQGKVLVSNPQPQIRKVFDMVKAVPLSDVF
FT                   ASTEELDAYLAAMQRKVIEQSAQSDTPIVPHFAEA"
FT   CDS_pept        complement(684043..684474)
FT                   /transl_table=11
FT                   /locus_tag="XCV0605"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22236"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22236.1"
FT                   /translation="MKLDLAIAPSLAQLAGANDALEQSLTLEGLHAERIGQVRLIVEEL
FT                   GCNALTHGQCAAQPLRLQLQLDAQALVLEMHDAGSAFDPCAAPMPEVTDELDDRAIGGL
FT                   GLFLVHQFADHIDYRRDGAYNVVRVTLLHPYAPVPEALS"
FT   CDS_pept        complement(684471..686579)
FT                   /transl_table=11
FT                   /locus_tag="XCV0606"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22237"
FT                   /db_xref="GOA:Q3BY26"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22237.1"
FT                   /translation="MRMRLPGRVVRGSKAAMIQRSRCHEECAMRNRPRSLPPQTSVAAR
FT                   MPWRRSLRMRVLLAATAVLVALLTVLGTVFYLGARAELVEAARTEVDGLTEQTARSLAA
FT                   LLDSVQVSGRTLAASSSGVGLQPFNLRALLLATLTGDPDIGAARLIIAPRTQKAGDSGF
FT                   VWYVHRSGTRIAEKSALELGYDYRAMPWYLRTQREGRAWWSEPYLDANGGGLYTSYNLP
FT                   LRRPGDAPDTAPVGMVSVDLPLQHLREIIDQLPRDIGIQTMLLSPEGLLVFSPDPALNL
FT                   RHSLTAYVARSRPDLRPLQRAVAAGQPISFSHTAPDGERFLTHSAAVGRSGWTFVLSAS
FT                   EGYVLAGLNWLAAWVALAALLGALVWWWLMRRITRKLTRPIEELTDTAEHFRRGEFEYP
FT                   LQHIERDDEVGVMARAFDSARDAIRHHIAEIGEMTAARERMHSELQIAREIQQAMLPSG
FT                   RTFDRASSHLETCAWLEPAKAVGGDFYHFVETEPGLLWFVVGDVSDKGVPAALFMARAV
FT                   SVLEIAARRYTRPDAILIAASTRLAENNETCMFATVLCGLINVVSGDYWLASAGHEPPL
FT                   LIDIDGKARPLPLETGAPLGIEPQESYPVLQGRMSAGQTLLGYTDGVTEAMDERGASYG
FT                   LERLLTALHPRRSAAAQCKAVIANIARFTGTADPYDDITLLAIRLRQEHAGRVAHAGRD
FT                   APGKATTA"
FT   CDS_pept        686648..687316
FT                   /transl_table=11
FT                   /locus_tag="XCV0607"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22238"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22238.1"
FT                   /translation="MRQMLTPSLLALLLTACHPPETSMTQTHSPATEATAAADVQAGGR
FT                   GLAKVNPSPRRAYEVTLTVDKAPGAFGLVEAAAQYDVSNEQECGKIQPETGTAGRITSQ
FT                   ENVALKKISETEYRGTVYLDLMQDEDYYGRGVCHWEFSGASVLLKATGAEEDTRFLSFI
FT                   EAKTVTAQQAVTKYYWKDGYPRSESKSFPDTGELSPENFKPEIRDNLFTITLAAKEVAP
FT                   "
FT   sig_peptide     686648..686716
FT                   /locus_tag="XCV0607"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        687313..688635
FT                   /transl_table=11
FT                   /locus_tag="XCV0608"
FT                   /product="putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22239"
FT                   /db_xref="GOA:Q3BY24"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22239.1"
FT                   /translation="MSIPSPQYAGLSEDAYKDRAVGRRAPGHEEIVTIEGERYAVLDHV
FT                   NNQSNGYQGTVYRRETSGEIVVAHRGTEGAVNDVLTDATMVTSRTNPQAADALALTKHA
FT                   MDIAKDVGKRTGHQPEVTVTGHSLGGALAQVSAHHYDLKGETFNAYGAASLSYRIPEGG
FT                   NSVINHVMASDPVSAASPHFGQVRMYAKPDEIATLSGAGYSNSKANFLIPDYPLVAAGG
FT                   SLGAHKLGNFLGEHSALRDPNARPLAEQNKRMIEEYRSDIDGLRTGTTILTRSARGLGQ
FT                   DAIDAIRGPLAPGEPAKRDAREHGNGHTSLRIDQPGHVGNGLFQDAQRGVHAQDARAGR
FT                   TPDQHSAQLSGSLASEMHAAGGQRIDAVMMSPDAARTFAVQGRVDDPAQLRVSVDTMTA
FT                   MNTPLEQSSQRVAENAARQSVALEQQQSQTQQQQQGARAMG"
FT   CDS_pept        688669..689049
FT                   /transl_table=11
FT                   /locus_tag="XCV0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22240"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22240.1"
FT                   /translation="MTHHAAAHAARRPDFTSPPSNIASRRRACPVFLRSFAQSCAPLLL
FT                   HLHNNRPARRVQMQGFPASSYATTPRTYSGLNRAVRPCLNRHGFAAMHGQAHATPRTRT
FT                   RQDRGSSKAPTGATSIDRGSVS"
FT   CDS_pept        689046..690581
FT                   /transl_table=11
FT                   /gene="ganA"
FT                   /locus_tag="XCV0610"
FT                   /product="arabinogalactan endo-1,4-beta-galactosidase
FT                   precursor"
FT                   /EC_number="3.2.1.89"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22241"
FT                   /db_xref="GOA:Q3BY22"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22241.1"
FT                   /translation="MTIFCRHYHRVWLIVLLCLCSAGVSAQGIAKGADVSWLNQQAANN
FT                   PPQVFRDAAGNTTDFIKLFKDVGGNAIRLRVWVNPSGGWNDGRDTLDKAKRAAAQGMRI
FT                   MIDFHYSDSWADPGKQTKPAAWAGHSVAQLNTDVYSHTQGILKYLKDNGITVSWVQVGN
FT                   EINSGMLWNEGKTPNFATLGQFINSGYTATKAVYPNAKVVLHLANGYDNANFRWFFDNL
FT                   RSAGGKWDVIGMSHYPPVGSWQDYNSRLDTNMRDMIARYGSDVVISEVGMDWQQAATTR
FT                   AMLSNLLSRSSSIGARPRRVLLGAQRLPGLAGLHHGRSQQQRPTDRSAASILTSTLPRG
FT                   GARRGAMSWQTQRPRHRVGAPPGATGFTDKAARAQVRSCNRWRPPLGCAGDGTQLHPQT
FT                   RHRVGAHLGARASPRASRAQVRSYGRACTAAHSMRQRPAIACRCPSSFGRTPAAPAAPH
FT                   RRFNRHPGSTQRTTASHSIRTRSEEWQQVRAVHLGVHEFTMSTHPRGVSPRER"
FT   sig_peptide     689046..689123
FT                   /gene="ganA"
FT                   /locus_tag="XCV0610"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        690581..693268
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="XCV0611"
FT                   /product="pyruvate dehydrogenase"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22242"
FT                   /db_xref="GOA:Q3BY21"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22242.1"
FT                   /translation="MNWLNEVLHNDPNPLETQEWLESIKAVIDVEGPERAHQLLEGMVE
FT                   QTRRAGAYLPFSPTTEYVNTISPANEAKHPGDSALEWKIRSIIRWNAMATVVRANRKPG
FT                   DLGGHIASFASSATLYDVGFNHFWRAPSDNHPGDLLFIQGHSAPGIYARAFLEGRISQS
FT                   QLDNFRMEVDGQGISSYPHPWLMPEFWQTPTVSMGLGPLAAIYQAQFMRYLENRGLIEK
FT                   SDRKVWCFIGDGESDEPETLGAIALAGREGLDNLIFVVNCNLQRLDGPVRGNGKIIQEL
FT                   EGVFRGGGWKVIKLLWGGYWDALLAKDSDGVLRKLMMETVDGEYQNCKAFGGAYTRANF
FT                   FGKYPETAAMVAGLSDDDIWRLNRGGHDPHKVYAAYHQAVNTTGMPTVILAKTVKGYGM
FT                   GSAGEALNPTHQTKKLDDAAVKHFRDRFNIPVSDKQLEDGQVPFFHPGEDSPEVQYLKE
FT                   RRSALGGYLPQRRTKASKSFVAPTLDKFDRLLKESGERTYSTTMSFVQSLNIALRDKEL
FT                   GPRIVPIVADEARTFGMEGMFRQIGIYAPFGQKYKPVDADQLMYYREDQTGQVLQQGIS
FT                   EPGAIASWMAAGTSYSVSNVPMLPFYIYYSMFGFQRVGDIAWQAADMRTRGFLLGGTAG
FT                   RTTLNGEGLQHEDGFSQLVAGGIPNVRSYDPTFGYEVTVIMQHGMKAMMEDQIDEYYYI
FT                   TLMNENYVHPGMPDGAAEGIIKGMYLLTDAGKPKKGELRVQLLGSGTILREAIAAAELL
FT                   DKDFGVTADIWSCPSFNELRRDGFDAERWNRLHPEGQQRKPYVTQLLEGRQGPAIAATD
FT                   YVRLFADQIRSFVPMTYSVLGTDGFGRSDTRANLRRFFEVDRYYIAHAAIAALAKDGKM
FT                   TGKDVARAIKQYKIDPEKANPVGV"
FT   CDS_pept        693694..694674
FT                   /transl_table=11
FT                   /locus_tag="XCV0612"
FT                   /product="ATPase of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22243"
FT                   /db_xref="GOA:Q3BY20"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22243.1"
FT                   /translation="MSTAEQLRALVQSHRDGDEAHFYAVALQLAAQEARRGHLKLAEEI
FT                   RQLVDSAKARAKTVALHQPRGELGTLLLASYPATRLSDLVTDPVLERQLQRVIREQRNV
FT                   SRFVAHGLSPRRKLLLVGPPGTGKTLTATALAGELGLPLFLIRLDVLITKFMGETAARL
FT                   RQVFDAIGPTRGIYFFDEFDAIGSQRGTPNDVGEARRILNSFLQMLEHDHSQSLIIAAT
FT                   NHPDILDSALLRRFDDVLHYRLPNAEQIEALLRGRLSNFMPSRVPWKTLIRQAESLSYA
FT                   EIAKAAEDAIKEALMHGDDKVAPKHVGDMLEERKLMRSAWGQLSP"
FT   CDS_pept        694685..695851
FT                   /transl_table=11
FT                   /locus_tag="XCV0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22244"
FT                   /db_xref="GOA:Q3BY19"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22244.1"
FT                   /translation="MPPRNPRPHFVLPESSVSVSPYRAVNAFGRNAIIPAQFRPTHAAT
FT                   LRRDLMELGLVMPGVIDQQRQAGWEEGLGLRVVFASFPDVHLAIDSLDLKSEGIELLNV
FT                   RETLGGTLATVWLPEGKLELFEQKIISYLAAPGTGNPRDGRKLLDAIRQIRAAVIEDLW
FT                   TDDSPIPVVDRVANFEAWIGTPVIQEEARRGRRSALRLTPMQRIARFRAAAELVGLRVG
FT                   QRPLLFPERAVLQVRGTLAQFQQSAPLLGQLAELRFAPEVAEFFMGLDAAEQREWVDEL
FT                   LGRTGFAGPGEDVPHVCVLDTGCAHGHPLLARSISPDDVHAVDPDWGTGDENGHGTGQC
FT                   GLALWGDLTGALGARGCGEFGIALNQSSCCRTGEQTMKITLGLSLRKP"
FT   CDS_pept        695752..697224
FT                   /transl_table=11
FT                   /locus_tag="XCV0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22245"
FT                   /db_xref="GOA:Q3BY18"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22245.1"
FT                   /translation="MWGVRHRLESVKLLPDRGTNNEDHFGPITAQAVSLPEIHAPHRRR
FT                   LFSMAVTSDTHVMTGRPTAWSAEVDALCSDWSGNGESPRLMIVSGGNVSGIRPGTYFAA
FT                   NSAASIEDPANAWNALTVGAITRKTNITEGFAGEYVPVADFGGLSPYSSTSERWQREAP
FT                   FKPEVVFEGGNIGNDGLWCSPLDSLSLLTTHHRPIERQFATTWATSSATAIASRFSAEI
FT                   MAHYPAFWPETVRALMVHSAQWTERLVQQFPGGRDNIERRLRHCGWGEPDLATAINSGA
FT                   DSLTLIAQSELQPYERNAIRRNVTARDMHLHRMPWPRDILQGLLRQDVELRVSLSYFIE
FT                   PNPGERGRSDRFRYASHGLRFAVQRPTETAVQFQSRINALSREDDEAFENFEGADHRWL
FT                   LGPRKRFRGSLHHDRMTCSAPELASREHIAVFPVGGWWKSREALERFERRARYALVVSI
FT                   HAPDLPSHIDLYTSVEQALQAEIQITVPIEGA"
FT   CDS_pept        complement(697322..698020)
FT                   /transl_table=11
FT                   /locus_tag="XCV0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22246"
FT                   /db_xref="GOA:Q3BY17"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22246.1"
FT                   /translation="MARLPRIDLPGIPQHIVQRGNNRLPCFLDDGDRLRYLHLIHEALH
FT                   ATACQLHAYVLMDNHVHLLVTPPDAGRIGQLMQRLGRNYVALFNSRHGRTGTLWEGRYK
FT                   ACLVDSADYVIRCYRYIELNPVRARLTDNPAAYRWSSCAANLGQRRHSALTPHACWLAL
FT                   GSDPIERSNAYRALLDETLSDELLASIRLHLQQQRALGHDTFRAMVEAKTHRFAGVRPA
FT                   HRPRNTNTTD"
FT   CDS_pept        698362..698850
FT                   /transl_table=11
FT                   /locus_tag="XCV0616"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22247"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22247.1"
FT                   /translation="MAEQERSSPRFPVAALVMVMALITSCATSASASKSPSFSGEWAYA
FT                   KKCDLGHYLSLHLQQRGNRVTGDWSEGTNVRGNDGQLQGEVRGDALYLRYCSDDGGTGY
FT                   SACPTFSEREDQFKLEKGQLIRYEKYGSSYRRTVALYPDIAGKDVPYDKDCSDPEDAQ"
FT   sig_peptide     698362..698457
FT                   /locus_tag="XCV0616"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        698847..700490
FT                   /transl_table=11
FT                   /locus_tag="XCV0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22248"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22248.1"
FT                   /translation="MSTLTDKELRATLYFAVGVTSESRYDAYRLVVAGDKASTPTLEPA
FT                   DSSGYSIGTIQTDLGQHFQPNDPNGENVPRDLINAYQDWASAHQPQSVLTGDQATRAIA
FT                   DLGRDGDAIRNDGGRPLDADVKLRLDAFLASDAGITWVHDRDVAQIDKLMDRAIAPLQR
FT                   SNLYQNASLDDQVKLAAMVGKAYNQNEVRAAPMIRKLEGNQYDSVADVSAAIDGFLPKR
FT                   SGRNDYFELGRDDALRGAAVVNALRNANRESPLSTAWTSVLADPLVNPTALNADRAHQN
FT                   LPHEYPVIKNLFIHDDRAGQFIGALDRGGAHQYGSTDRAHPERFNGPGFYAAGNDLVNW
FT                   NKHGQGHAFLNGEWSSVSREDLTRTRNHDGTTDLNKQQGGQTQRLLHVDPHAPELRLAP
FT                   QQNGGRTGPDNPAHPDHAMLLQIREGVQRLGSQTGVPFDENSERVCRSLLAACKDNRDQ
FT                   YQNASNTSLSGNALTRVDHVVAGPERLFAVQGELNDPAHLRAHVPVQQAMQTPVEQSDA
FT                   KLMVANQAIAQEQAMTQQREVSRNQGQSLG"
FT   misc_feature    700531..703016
FT                   /locus_tag="IS_Xcv1_1"
FT                   /note="inactivated IS element Xac3 like,inactivated by IS
FT                   element Xac2 type"
FT   CDS_pept        complement(700576..701277)
FT                   /transl_table=11
FT                   /locus_tag="XCV0618"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22249"
FT                   /db_xref="GOA:Q3BY14"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22249.1"
FT                   /translation="MHLQTYQAYGALRMWQALRQHGETCGRHRVERLRRAHGIRSKRRQ
FT                   RYLRTRSTYQRTMVAPNRLAWPFVSPGRDRVWVADITFVPTRGGWLYLAAILDMHSRHL
FT                   AGWAMGARADQALASAALEMALQRRRPSKGTIHHSDQGSQYTSGAYQRQLQAAGLVASM
FT                   SRKGMPYDNAVMESFFSSLKQELTHHEQFVSLDEARAKLFTYIEVFYNRQRLRSALGYR
FT                   SPVEFERTDVP"
FT   CDS_pept        complement(701430..701723)
FT                   /transl_table=11
FT                   /locus_tag="XCV0619"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22250"
FT                   /db_xref="GOA:Q3BY13"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22250.1"
FT                   /translation="MQKRQQFTAEFKREAVRLLRAGDRPAAVIARELGIPRNRLYKWAT
FT                   DLDAKGASAFAGSGRPKASQDELAVLQRELARLREENEILKKAAAYFARALP"
FT   misc_feature    701725..702919
FT                   /locus_tag="IS_Xac2_2"
FT                   /note="IS element Xac2"
FT   CDS_pept        701794..702060
FT                   /transl_table=11
FT                   /locus_tag="XCV0620"
FT                   /product="ISxac2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22251"
FT                   /db_xref="GOA:Q3BY12"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22251.1"
FT                   /translation="MKKSRFTDSQIIAVLKQAQAGAPVPELCREHGISSATFYKWRGKF
FT                   GGMDVSMVARMKELEEENRRLKKMYAEAQLSTDLLKEALAKKW"
FT   CDS_pept        702054..702881
FT                   /transl_table=11
FT                   /locus_tag="XCV0621"
FT                   /product="ISxac2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22252"
FT                   /db_xref="GOA:Q3BQ20"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BQ20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22252.1"
FT                   /translation="MVRPSQRREMAQSAVTSGRTNIRHACQTFAVSETCFRYQAKASEE
FT                   NARIADWLVRLTTAHRDWGFGLCYLYLRNVKGFGWNHKRIYRIYRELELNLRIKPKKRL
FT                   VRERPEPLAVPEAINQVWSMDFMHDQLADGRSFRLFNVLDDFNREGLGIEVDLSLPSAR
FT                   VIRSLEQIIEWRGKPAVIRCDNGPEYISGALLSWAQRHGIRVEHIQPGKPQQNAYVERY
FT                   NRTIRYAWLARTLFDTIDQVQDKATRWLWTYNHERPNMALGGITPAMKLAMAA"
FT   misc_feature    704648..705805
FT                   /locus_tag="IS_1479_2"
FT                   /note="IS element 1479"
FT   CDS_pept        complement(704762..705742)
FT                   /transl_table=11
FT                   /locus_tag="XCV0622"
FT                   /product="IS1479 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22253"
FT                   /db_xref="GOA:Q3C078"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C078"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22253.1"
FT                   /translation="MQLTFGDAEGLGKRKQTRREIFLAEMEQVVPWQQLLGLVAPHYPV
FT                   SGRPGRQPYALATMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPDETTI
FT                   LNFRRLLETHGLAARMLEAVNAHLARKGQSLRSGTIVDATLIAAPSSTKNADHARDPEM
FT                   HQTKKGNQWYFGMKAHIGVDEFSGLVHHVHCTAANVADVTVTHALLHGKEDSVFGDSGY
FT                   TGADNREELQTCKAAFFIAARRSVLQAIGNKRERAREQRWEHFKASVRAKVEHPFRVIK
FT                   RQFGYTKVRYRGLAKNTAQVLTLFALSNLWMKRKQLLPAMGSVRL"
FT   CDS_pept        705837..706301
FT                   /transl_table=11
FT                   /locus_tag="XCV0623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22254"
FT                   /db_xref="GOA:Q3BY09"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22254.1"
FT                   /translation="MLMDNHVHLLVSADKAGAVFSAMRLSGQLYVQAFNVRHRRSGILW
FT                   QRRFKSCLVQTEWYVHTVMRYIELNPVRACMVALPTEYRWSSVHTQLRRAKSQLIKSHK
FT                   VYLHLGCDAAERVSVYATGFIRIKPERTSIQFATTSRGSAPWATRASRQW"
FT   CDS_pept        complement(707434..707616)
FT                   /transl_table=11
FT                   /locus_tag="XCV0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22255.1"
FT                   /translation="MVQSELLHTVSDPTLRHTLQAQSEASGMPAKAIAHAIAYAIDQPD
FT                   DVEVGSLVIRPTSQA"
FT   misc_feature    707671..708896
FT                   /locus_tag="IS_1477_4"
FT                   /note="IS element 1477"
FT   CDS_pept        complement(707700..708533)
FT                   /transl_table=11
FT                   /locus_tag="XCV0625"
FT                   /product="IS1477 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22256"
FT                   /db_xref="GOA:Q3BZL6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22256.1"
FT                   /translation="MLEHTPLSERRACRLAGLSRDAFRHAPVPTPATQALSARLVELAQ
FT                   THRRFGYRRLHDLLRPEFPSVNHKKIYRLYEEAELKVRKRRKAKRPVGERQKLLASSMP
FT                   NDTWSMDFVFDALANARRIKCLTVVDDFTRESVDIAVDHGISGAYVVRLLDQAACFRGY
FT                   PRAVRTDNGPEFTSRAFIAWTQQHGIEHILIEPGAPTQNAYIESFNGKFRDECLNEHWF
FT                   TSLAQARDVIADWRRHYNQIRPHSSCGRIPPAQFAANYRTQQANNAVPFNPGLYQ"
FT   CDS_pept        complement(708566..708832)
FT                   /transl_table=11
FT                   /locus_tag="XCV0626"
FT                   /product="IS1477 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22257"
FT                   /db_xref="GOA:Q3BZL7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22257.1"
FT                   /translation="MKKSRFSTEQIIGFIKQADAGMAVAELCRRHGFSPASFYQWRAKY
FT                   GGMEADEAKRLKELEVQNTRLKKLLAEAHLDIEALKVGFGVKR"
FT   CDS_pept        complement(708880..709398)
FT                   /transl_table=11
FT                   /locus_tag="XCV0627"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22258"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22258.1"
FT                   /translation="MTIEDKVVVITGAGSGTGRATALHLGALGAKVVLGARRQARIAEV
FT                   AKEIVRSGGRAVYRPTDVTVHQEVLALVDLACSQFGRLDVMVNNAGISPLSRFDALQVD
FT                   AWNAMIDVNLRGVLHGIAAALPVLGRQQSGHVINVVSTAGLRIVPTMGVYAATKNAVRT
FT                   ISEALTCPH"
FT   CDS_pept        709337..710404
FT                   /transl_table=11
FT                   /locus_tag="XCV0628"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22259"
FT                   /db_xref="GOA:Q3BY04"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22259.1"
FT                   /translation="MARPVPLPAPVMTTTLSSIVICVLRDGRATHSSAADWMDYACAAM
FT                   ISSQSSKDDPLSQVLAALGARSAGLNRLEARGDWALSFPEKHRLKLVAAIRGECWIRLP
FT                   RRAPKRVVEGDVLLIGNTPYVVASDPQCVPVDGVLRYAGQESLRLGDGDDTVLLGAGIL
FT                   FSGENSGFLIDALPRLMKIQSVSPSAFAVRTTLDLLDAEMGRHRMGSARVASCLSEVLV
FT                   VEAIRAYMHENKEAHTQAHISWIGALGDRHIGAALALMHGDVAHAWTVAELALRVGMSR
FT                   SAFSSRFSQTVGQAPLHYLTQWRMLLAHRLLAETGLDIAHVAERVGYQSPSAFSHAFKR
FT                   MFGAAPRRLVRPGER"
FT   CDS_pept        710681..711448
FT                   /transl_table=11
FT                   /locus_tag="XCV0629"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22260"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22260.1"
FT                   /translation="MSIEREQAHANHSRRLVLRTALLGSAAMICAGATANDAHPASARR
FT                   DKVASDAAQLTLGMLVFEGFQLLDVFGPLDMFGNLEGKVRIVMLGERVGAVASSAGPTV
FT                   AVEYALDSAPPVDILMVPGGMGTRREVDNAALVAGIARLAHTAPHVASVCTGAALLARA
FT                   GLLDGRRATTNKRAFAWVTSQGPKAEWVKRARWVEDGHLFTSSGVSAGTDMALALIAKI
FT                   FGHDAAKEVASIAEHVWNEDAGDDPFATALAAG"
FT   sig_peptide     710681..710785
FT                   /locus_tag="XCV0629"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        711612..711797
FT                   /transl_table=11
FT                   /locus_tag="XCV0630"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22261.1"
FT                   /translation="MPLAIFRRYLSFAAAVAVATLAGCGMTKPPISKKQFSQNVAALLA
FT                   GKESAVVEAGKLADFA"
FT   sig_peptide     711612..711692
FT                   /locus_tag="XCV0630"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        711828..712025
FT                   /transl_table=11
FT                   /locus_tag="XCV0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22262.1"
FT                   /translation="MLLTFDQGGETSVLPLPYEEFFVDEAHVANSLENSCITPADRILV
FT                   KRKYSGDHGRIEFQKATQEG"
FT   CDS_pept        complement(712084..713619)
FT                   /transl_table=11
FT                   /locus_tag="XCV0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22263"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BY00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22263.1"
FT                   /translation="MVRIVAAPARTLPMSQHAIEDVIERAIYLVDRSTQNAAHQAALIH
FT                   ALLHLQARYDTGLTWLRMHEVLLRHGVLVRTPVEAIDDAALRAQARAAETSCWLESDRG
FT                   TGYLHLDENASVLYQQTGTGHAMPVSALFRDVLTLADQADDGELFTDLHGLLVNGWLDA
FT                   TFTAEDGLASSLDGLVACDDLQAIRGIAARRGLKRRRGVSEDLALPHLSESQEPGEIEQ
FT                   NAGLRFFLQPKRTPTALLAARNRTLRQLARVQELIPMLVEQRLSAALQQAGWSAVAAPP
FT                   EHPWCWTRDRDGSRQCLWAAHDTTCGELIVQAGLQHARLLDWQQRSATTQLHDLHIYDR
FT                   AAPLLGKHALNPKDIGTYGGLRLDPAHSDAQLGNAFDRLAAALPALDVYYFDVIAQQLS
FT                   GPFFDRDLEMVMRTMEEGHSTGAIAQDVLLASPDSTLLAFVFHHLEHGDDVAAAAVVER
FT                   VRARHAARTRLNAWHRAYLSPFLQRWDREQRDMPMPPVQHVLLLNHLRACESV"
FT   CDS_pept        713883..714194
FT                   /transl_table=11
FT                   /locus_tag="XCV0633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22264.1"
FT                   /translation="MNIGNQITARTVTVTSGDTGRAHSKVSVELSARPDPRWQSCFHFV
FT                   VQGRDGFYMEGRPIFDQSNFEAVVPAGQVDAFRHELPEVLALTNTLARAQAIKDADRR"
FT   CDS_pept        714620..715210
FT                   /transl_table=11
FT                   /locus_tag="XCV0634"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22265"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22265.1"
FT                   /translation="MMIRLLVVSLAAACVAPVLAAEQAPAQIDGTGARIRMFGQNGVGI
FT                   VLYKDAVCTATYGEKVRASGSLGSAFGSLMGSVKNQAIGIPETQNTRNLHERKMIGSKP
FT                   FYKEYAIEAGKPVVVEAGASSPAHWTSTPGFKSGWTCWPLLASTFVPEAGADYEVALDL
FT                   DFRNSVCTLAVKRVAVDGQVTPVDVAPVSKDCK"
FT   sig_peptide     714620..714679
FT                   /locus_tag="XCV0634"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(715551..717116)
FT                   /transl_table=11
FT                   /locus_tag="XCV0635"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22266"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22266.1"
FT                   /translation="MPNDELPLTDRLRAALDVLEAIDADRSVLDTLPEADRVRLHQVVA
FT                   KVYHPEPKARRQLLKQRERERHQEKVRKAEALLEQRGIRALRRKPVFSTPNYFPPHAAG
FT                   LHDAHNGENATAAPEPTHSPELRHCYVCKQKFTELHHFYDQMCPTCAELNFFKRTETAD
FT                   LRGRVALLTGGRVKIGYQAGLKLLRAGAELIVTTRFPRDSAARYAQEPDFAQWGHRLQV
FT                   FGLDLRHTPSVEAFCNELLATRERLDFIINNACQTVRRPPQFYAHMMAGETAALHELPE
FT                   TVRNLVGHYEGLRTPELLRDASATALPAVHGRGLDSADGLTRAAELSQIALLDDELVGQ
FT                   QHLFPDGRLDQDLQQVDLRGRNSWRLLMAEVPSVELLETQLVNAIAPFIINARLKPLML
FT                   RTPERDKHIVNVSAMEGQFYRNFKTTRHPHTNMAKAALNMMTRTSAADYQNDGIHMNSV
FT                   DTGWVTDEDPAEIAALKVQQERFHPPLDIVDGAARIVDPIIHGFNTGEHVWGQFLKDYA
FT                   PTDW"
FT   CDS_pept        717486..718277
FT                   /transl_table=11
FT                   /locus_tag="XCV0636"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22267"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22267.1"
FT                   /translation="MKTSMLAIGLAGLLCACTVVSPDPGQQAVLVDKPLFFGKGGIRLD
FT                   DVRDPGRTYTWLTTSASYVDVTPQTVQVAFDDFSSSDNILLDFSTQIQYRITAPALLLS
FT                   RFGQDWFKNNVASQYASIVRDQVKRYDMTKMMSDPDTARKIDDSVTQNVSALVKEQGLP
FT                   IQIQNITLGRARPNPDVLQQMNLTAAQQQRVKTLVEATTAERQREQEQEAKADADNAYR
FT                   NRMGLTPEQYLASQIAELNAEACKKAQACYMVPSGTAVIAR"
FT   sig_peptide     717486..717548
FT                   /locus_tag="XCV0636"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        718440..719414
FT                   /transl_table=11
FT                   /locus_tag="XCV0637"
FT                   /product="putative glutathione transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22268"
FT                   /db_xref="GOA:Q3BXZ5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22268.1"
FT                   /translation="MGLLVDGKWQDRWYDTSKSEGRFERSQSQFRNWVTRDGSAGPHGQ
FT                   GGFKAASGRYHLYVSLACPWAHRTLIFRRLKGLESMIDVSIVHWLMRENGWTFADGPGV
FT                   VGDTESHAQYLYEVYLKADPHYSGRVTVPVLWDRERKTVVSNESADIIRMFNSAFDAIG
FT                   AADGDFYPQPLREQIDAVNARVYDTVNNGVYKAGFATTQAAYDEAVVPLFESLDWLEAR
FT                   LSAQRYLCGDRLTEADWRLFTTLVRFDAVYVGHFKCNLRRIADYPQLSGFLRELYQMPG
FT                   IADTVNFQHIKGHYYQSHDTINPNGIVPMGPLLDLDAPHGRGG"
FT   CDS_pept        719487..719882
FT                   /transl_table=11
FT                   /locus_tag="XCV0638"
FT                   /product="putative glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22269"
FT                   /db_xref="GOA:Q3BXZ4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22269.1"
FT                   /translation="MLNHVMVGTNDIARARAFYDALLGGVFGAPAPFVNQAASGHTRLF
FT                   YRHAGSTFCVSEPINDEPASPGNGATVGFKCDSPEQVQHFHDSAVAAGGISIERPPGLR
FT                   ESSMGPTWLAYVRDPDGNKLCAIYRPA"
FT   CDS_pept        complement(720015..720476)
FT                   /transl_table=11
FT                   /locus_tag="XCV0639"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22270"
FT                   /db_xref="GOA:Q3BXZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22270.1"
FT                   /translation="MSLIHSILMGAVAGMRSMTPLAAVANAARTGKLPADNGAPALLAN
FT                   PLASAGMLALAGGELAGDKMKTAPDRIVLPGMIARIATGVIVGTALAPREQRGIAALLG
FT                   ATTAVAAAYLTFNARMRAIERYGQTSTGVVEDAITVGAATLIMRDAAKR"
FT   sig_peptide     complement(720402..720476)
FT                   /locus_tag="XCV0639"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(720732..721736)
FT                   /transl_table=11
FT                   /locus_tag="XCV0640"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22271"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22271.1"
FT                   /translation="MSPDDSGVTLQETALKNAMLAGLGIALLVGCGKAPAPAKAATPQA
FT                   AVAVRTPAHAPRSQRGEGHPYELADTQVWDVPDPVSGRRYQVFVALPRGYAENPQRRYP
FT                   VLYATDGDYAFALVKQIARRLNGEGPAIEDFILVGLSYAVGEEPMPSRRRDYTPTPEDG
FT                   PTAAPVATHGQSAAYIRYLREQVLPFVANHYRTDEQRRLYLGHSYGGLLGTDILLSSPE
FT                   MFSGYILGSPSYWYGEHAMVAQEKTFAATHRDLPAQVYMYVGEYEQVRYHQTYDMVIDT
FT                   QNMARALRARGYPSLHLTLEVLNDEDHLSIGPRGITHGLKVLLGSKAADRSER"
FT   CDS_pept        complement(721750..722562)
FT                   /transl_table=11
FT                   /locus_tag="XCV0641"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22272"
FT                   /db_xref="GOA:Q3BXZ1"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22272.1"
FT                   /translation="MAAATPAGKASLQSNSTTLRLDGQASACALRPIRVIRAQCPHAFG
FT                   TAAAHPGDNAGSVVLKPRTMRIAPLLFLLVALLPATALALKVRDGDLLFVTAARTGLSG
FT                   AIDDATATQGQPSFDHVALVAHAGDVAVVLHADEHGSREQPLQAFIDEATAKQRQIFVY
FT                   RLTPEHRPAIPDAIAQARRMLGKPYNDTYVQDDNRYYCSDFIERAFRAHHVFALQPMNF
FT                   KNLQTGKISPYWIDFYRSKGMPVPQNMPGTNPNDMATTAALTSMGRLN"
FT   CDS_pept        complement(723335..725917)
FT                   /transl_table=11
FT                   /locus_tag="XCV0642"
FT                   /product="putative dipeptidyl peptidase IV"
FT                   /EC_number="3.4.14.11"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22273"
FT                   /db_xref="GOA:Q3BXZ0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22273.1"
FT                   /translation="MAMAMAIEPAPPRSGGAGPGRSAGQPRDCRSAFSATRRPLRAGCG
FT                   PQRTPPRGHDFWQRRPAHVAGSIGRSRRPHCALLSSRRIFMPTTPLPLRHLCLAVALAA
FT                   LPALAGAQAPAVTEADYARAERLISYAAQPLVDHALTRIDWLDATHVAYVDHDAKGNRL
FT                   LQLDTSTGKTTPLFKQAALVASLNKLLKTGHKPLKANTFAPVVKVTADGRYRLNVRDTA
FT                   VVCDARARCSKLYAKDKPEPGVLSPDKRSEAFIRDWNLWIRDLASGQETQLTRDGVENF
FT                   GYATDNAGWQHTDNAILAWSPDSRKIATFQQDQRKTGDMYLVSTKLGHPELQAWKYPLA
FT                   GDKDVTMIERVIIDVPTGSVLRLKTPPDQHRSTLCDDVSCSPGLWDDVKWAPDSKTLAF
FT                   ASTSRFHKQTWLRIADASTGAVRTAFDETVKTYYESGQVAANWAYLPASNEAVWFSERS
FT                   DWGQLYLYDLATGKPKRAITTGEGNVTELLRVDPVTRTAWLVGVGRSAGVDPYYQQLWK
FT                   VSLDGGEPVLLTPEPANHSIALSPDGARFVDTYSTSVTPPVTLLREAGDGRTVSTLATA
FT                   DITRLKAAGWVPPEPITVKARDGKTTLYGLMFKPANFDPTRKYPVIDYVYPGPQTGSVR
FT                   GRSFLAGHGDNQSLAELGFIVIAIDGMGTPWRSKTFHDTWYADMGDNTLPDQVAGLKEL
FT                   GQRYAWIDLDRVGIWGHSGGGNASTGAMLRYPDFFKVAWSESGNHDNRGYEDDWAEKYH
FT                   GEHIVNTDGTSNYDDQANANHASKLKGKLMLVHGTLDDNVPPYLTLLVADALIKANKNF
FT                   DMLMLPNAKHGYGDLTPYVTRRRWDYFVQYLLGATPPAQYQMQPMPAN"
FT   CDS_pept        726078..727511
FT                   /transl_table=11
FT                   /locus_tag="XCV0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22274"
FT                   /db_xref="InterPro:IPR014983"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22274.1"
FT                   /translation="MSWFRRLALSRFLKAHPPGRTQPAAMDLIAAYAPVLLASLLELWR
FT                   KKGLGHYGRMQLALIDPRHWQPVLDRWIVSPPDAVQRIPIALTPFGALLYYRKLTATDE
FT                   DVVYVDPVSKATGDLSWNLEDFFNQSLCDAAFCDSLIPSARLATARKECGPLAAGEVYQ
FT                   IDQLLLSMQMLRVDKVDALALHTRLRDAVDAPAPVADAPATIADALPAEQRPVFEGIFQ
FT                   QPQASGDLHGLYLSSYIDWHRMLSLEPDGQYRLLFWKIDHRSHARTDVRAYSGRFEVTQ
FT                   TEMGDRYLTLDIRLRRDSSGSDANDAQLLVMRSGTEMFLLRTDELADMATAMEGSKTLG
FT                   RSEYYFRKVRLTDAFVQEPSGGRTAPPLADLPHVLQQQVNAEAIIATITHVDEIDPDAE
FT                   DDGAGTVMCTLDRGQDDGLRMNTPLRSPPGTGRALVGWVWEMDPAACRAGIRYQRGSDG
FT                   KVEDGPVVGDVLTNRLSTE"
FT   CDS_pept        complement(727553..728644)
FT                   /transl_table=11
FT                   /locus_tag="XCV0644"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22275"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22275.1"
FT                   /translation="MISHLPRALTLLAIALLSACATQAPRAPQRSPDAVKADIAQRLPA
FT                   TLPDRAGWANDVYVALSSQALDTSAEHICAVLAVTEQESTYQANPVVPNLGKISRAEID
FT                   RRASAHHIPGFMVDAALRLSSPDGRSYATRIAAARTEQELSRIFEDFTGSVPLGARLFD
FT                   GFNPVHTAGPMQVSIAFAEQHAQRYPYPPGDSIRHEVFSRRGGLWFGTQHLLGYPANYD
FT                   ALLYRFADFNAGWYASRNAAFQAALSRASGIALALDGDLLTPGASLDAPGSTERAARSL
FT                   GSQLAMSDRQLRRALEAGNTADFADSDLYRQVFALAERSAGKPLPRAVLPGITLESPKI
FT                   TRTLTTAWFAQRVNERWKRCMSK"
FT   sig_peptide     complement(728567..728644)
FT                   /locus_tag="XCV0644"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        729149..731023
FT                   /transl_table=11
FT                   /locus_tag="XCV0645"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0645"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22276"
FT                   /db_xref="GOA:Q3BXY7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22276.1"
FT                   /translation="MSMCVVRWRHGLAAFALLLGSGMASAQPQPWKTIEAATIDDPVVA
FT                   LQIAQGALQRASGDHDVEAEFWALLAQARVLISLEDSERRQVALTQARGKLDQLHGSTS
FT                   QAQLWLDIVQALSDVRENPNRVMVARLEALRQRASALGRNDLLCEVEAVDMWSMLASGS
FT                   SDESWSAAQASYQCAAREKLLGLELDALTQLGALASRVGGRPAEDSETEDYLQRALSRL
FT                   HDQPARFQRSLIEYEFGTALATRQPEAALLHFRRALALSRELRDQAGVAAALTSASEAL
FT                   IETGDAASALTMAREALPLMQQQGNIGRVAACHAVLLQALIALKAEGLDAEIVAAKAAD
FT                   DPNLTLNRRAQLVDAIAQALAFRGRHAEAYQELQRANALRAQSLDRQRDTVMLRLQARY
FT                   EDARRGAETAELRRRSETAQLALQAREAGQRTLWIALCAACLLLLGALVVLAFGARHRR
FT                   QLSRLAMRDELTGLPNRRAIRTEAQQQIEQALRSHTPGMLALIDLDHFKQINDVYGHAT
FT                   GDAVLKALASASRLALRAQDRLGRLGGEEFLLVLPGCGEEEIPAVFTRLRSAVAAIDIA
FT                   GLPPDQPVRFCMGAVRIVADTGLDVLLSQADLALYAAKTAGRDQWAVC"
FT   sig_peptide     729149..729226
FT                   /locus_tag="XCV0645"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        731132..731605
FT                   /transl_table=11
FT                   /locus_tag="XCV0646"
FT                   /product="putative transcriptional regulator, Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22277"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22277.1"
FT                   /translation="MRTDSRLSRMLHVLLHMARSPQPMTSEQIASMLSTNAVVVRRTMA
FT                   GLRSAGYVQSSRGHNGGWQIGCDLAQVTLLDVHRAVGGPHLFAIGADHPNPQCGVERVV
FT                   NAAIADALAHAEALLLQRLGTVTLAALASEFDALCSARAPSGGNAAGKRTRQR"
FT   CDS_pept        731708..732607
FT                   /transl_table=11
FT                   /locus_tag="XCV0647"
FT                   /product="putative thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0647"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22278"
FT                   /db_xref="GOA:Q3BXY5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22278.1"
FT                   /translation="MQHEVIIVGGSYAGLSAALQLARARRRVLLVDSGRRCNRFAETSH
FT                   GLLGRDGASPARIADEARAQVLSYSSVQWADGEVVQVRGQAEAFEVVFADGSVHATRRL
FT                   ILAMGVVDRLPALAGLAERWGRQVFVCPYCHGYELQQGRIGVIATSALAAHQAAMLPDW
FT                   GPTWLFLNDTLVPDESQRAQLETRAVHVVTGAVAALQGEGDALELVLHDGQRFALDGVF
FT                   ITTQTEISPLVRQLGCATSEGPFGRLLAVDAMQATTVPGVFACGDIVNPAASVVLAAAS
FT                   GAMAGVATHRSLIFGLGS"
FT   CDS_pept        732783..733163
FT                   /transl_table=11
FT                   /locus_tag="XCV0648"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0648"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22279"
FT                   /db_xref="GOA:Q3BXY4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22279.1"
FT                   /translation="MVGRSEWGARKLRCHVDRNSGLKTPRPSPPPASERKSSRLIDWLV
FT                   RGVVGIAVIACCGRFWLLGEAVFEGRYVSVIRGRPARIFLVDSDPHRFWIAVGWDALLS
FT                   CVPLLIVGGFAYASWRARRHVR"
FT   CDS_pept        complement(732995..733366)
FT                   /transl_table=11
FT                   /locus_tag="XCV0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0649"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22280"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22280.1"
FT                   /translation="MRIRPAFGQRCLPDTPFAPRTSICTLQTIACRRALTAGCRMAATS
FT                   HDRWPRTRRVMQHEDCNRRQPCHHRTWRRARQLAYANPPTISNGTQLSSASQPTAIQKR
FT                   CGSLSTRKIRAGRPRITLT"
FT   CDS_pept        complement(733391..734032)
FT                   /transl_table=11
FT                   /locus_tag="XCV0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0650"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22281"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22281.1"
FT                   /translation="MITRGRHDGYRGGCSVPPAGSAILPRPRHGRCMRAHLIIALLVWL
FT                   LPVTATPTHAQTASASAASQPMSEVTTRYPVTTATMGGRVIRLGEHQGKCAVSRDGDIV
FT                   VLSIGAPCYFSTDRQHAAQVHRFHGSDVVLVQHAHPTSRPDWDVAVYGPICAFEAQAVR
FT                   EIGGVLEPGGVAGSWHCDPTAGADQKQFVYSYDTWPRHGARRPARKQKAH"
FT   CDS_pept        complement(734131..735045)
FT                   /transl_table=11
FT                   /locus_tag="XCV0651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22282"
FT                   /db_xref="GOA:Q3BXY1"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22282.1"
FT                   /translation="MPLPSLQRCGKCRTPHTELSAVPHYSGPLLVLADAQALLAARGSG
FT                   LTHWTGSLDLGRSTDTAQLDAQTWQWRGQGYPYPGKLKERTLYFWDGEDFAPISRYSGA
FT                   LIKLVPTEWGAPTFEIDGIKMLPSAQLSPFEDARRKVALVDPRGKIVLDTCGGLGYFAA
FT                   CCLEAGVAQLFSFEKNADVLWLRTLNPWSPDPQGAAAGGRLQLTHADIAQHIATLADDS
FT                   VDAILHDPPRFGIAGELYSQVFYDQLARVLRRGGRLFHYTGAPNKLTSGRDVPNEVSKR
FT                   LAKAGFTTQLALDGVLASLPARR"
FT   CDS_pept        735211..736086
FT                   /transl_table=11
FT                   /locus_tag="XCV0652"
FT                   /product="drug/metabolite transporter superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22283"
FT                   /db_xref="GOA:Q3BXY0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22283.1"
FT                   /translation="MLKGVLLGFACYAAYSISDAFVKLLEGTLPVYEVLFLGALLMLLA
FT                   VPFLKKPNDQLRELVMAKQPALWLLRALTGAIGNLTSVIAFTTLPMAEAFALIFLMPIF
FT                   VTVLSVIFLKEEVHWRRWSAVIVGFIGVLIVLRPGFRHLTHGHVAAIVCGLVGAISVIA
FT                   LRMAGHSEKRLTLYGAGVIGPLVMGGIMMLPSFVWPTLSQWGLLAGYGLLAGLAAICMM
FT                   YATRMAPVSLVAPTQYSQMLWAIAFGYLLFHDHLDWPMAVGIALILGAGLFTLVREEQV
FT                   SRWWRRTKIV"
FT   CDS_pept        complement(736184..736984)
FT                   /transl_table=11
FT                   /gene="pheC"
FT                   /locus_tag="XCV0653"
FT                   /product="putative carboxycyclohexadienyl dehydratase"
FT                   /EC_number="4.2.1.91"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22284"
FT                   /db_xref="GOA:Q3BXX9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22284.1"
FT                   /translation="MPRPRRDHAMRHRICLALLLSCGTAHAATPASRLDAVLQSGVLRV
FT                   CTTGDYRPYSLLRGDGQFEGSDIDLVQSLAASLDARVRLVRTSWPQLMPDLLADRCDIA
FT                   VGGISVTLQRQRQASFSAVLDVDGKIPLVRCADQARYRSLEQLNRPEVRLIEPPGGTNE
FT                   AFAHRQLPQATLRLFADNTTIFQELLAHRADVMITDASEALYQQARLPGLCAIAPEQPL
FT                   QYSEKAFLLPRDDHAWKAYVDQWLHLSKASGDYQRIVEGWRQPR"
FT   sig_peptide     complement(736904..736984)
FT                   /gene="pheC"
FT                   /locus_tag="XCV0653"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        737256..737471
FT                   /transl_table=11
FT                   /locus_tag="XCV0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22285"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22285.1"
FT                   /translation="MHLNPRTARTMTNADAAVLAHGTPDPDTNEEDTPLEEQPPQRGGL
FT                   NDEVGDPEQEDDGALPGRVGGGLAGG"
FT   CDS_pept        complement(737564..738073)
FT                   /transl_table=11
FT                   /locus_tag="XCV0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22286"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22286.1"
FT                   /translation="MGAVRIGHPGTQSLRIGQLARARLIRQLVPVGTALTDRLPQCPLS
FT                   RGHRRGSKAVHGIDDDANSTTCNRSSLQPRLRSQHGAASAAPLQRSRTRHALAMLPPAF
FT                   PTARVTSNVERTTSSAQDGGRARRDTTPGEKNGQQEAGPNATLTYSSLALLSREQNAVQ
FT                   AWTPVS"
FT   CDS_pept        738257..739633
FT                   /transl_table=11
FT                   /gene="cycA"
FT                   /locus_tag="XCV0656"
FT                   /product="D-serine/D-alanine/glycine:H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22287"
FT                   /db_xref="GOA:Q3BXX6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22287.1"
FT                   /translation="MSDPSAPDHLQRSLSNRHLQLIAIGGAIGTGLFMGSGKTISLAGP
FT                   SILFVYLIIGAMLFFVMRAMGELLLSNLEYKSFIDFSTDLLGPWAGFFCGWTYWFCWII
FT                   TAIADVIAIAAYAQFWFPGLAPWIPAILCVLLLLSLNLVTVKLFGEMEFWFALIKIIAI
FT                   AALIITGAGLVAWGFRSPSGNVASLSNLWNDGGMFPMGIGGFFAGFQIAVFAFVGIELV
FT                   GTTAAETADPRRNLPKAINSIPVRILIFYVLALIAIMAVTPWRQVVADKSPFVELFVLA
FT                   GVPAAASLINFVVLTSATSSANSGIFSTSRMLYGLAEEQHAPKGFAKLSGAAVPARGLL
FT                   FSCLCLLLGAMLVYLIPNLVTAFTLVTTLSAVLFMFVWSLILCAYIAYRRKRPEQHAAS
FT                   AFKMPGGVLMCYVCLAFFAFVIVLLTLQDDTRQALLASPVWFLLLAIGYAVKRRGNRQH
FT                   "
FT   CDS_pept        complement(739720..740706)
FT                   /transl_table=11
FT                   /locus_tag="XCV0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22288"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22288.1"
FT                   /translation="MKISGSASRGLHEPIGHVDPRHAPAVCDDIQIGVHSQLRELPRLR
FT                   RSASAKGRSPAFVAESSHLDTLFGSTQPARGKHLKDGTHRTPIQAQEITEAPEHVKINP
FT                   TRLFVSTGPALKTLHRLDPAKLSNDLGLSEDTIDRIRSTPTFRGQTATDVPPSTPLAQR
FT                   LRLDDLRDKKVEYKWNIASNGSLVIGEGHPGVVLDEPMTSKDARKKKQPYAHGHVTLVG
FT                   GQPWNKTPWQENRRIPEARISGTLYYNTDGELCIDNDSGRFSEYADRTSDHLENVAKLF
FT                   QHYGLPVTPEWKAKKQIPLQRVPAGAAIASPSPAEKGEAAHPDPSGE"
FT   CDS_pept        740896..741855
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="XCV0658"
FT                   /product="Magnesium and cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22289"
FT                   /db_xref="GOA:Q3BXX4"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22289.1"
FT                   /translation="MVDAEDAWALSSHRRCMITIHPIAGTQHTPGCWVDLCQPSPQELA
FT                   QAAEKVGFALPDRAAIGEIEFSSRVRRQGDVLFLNVPRFQDEDGPTAPLGFALSPTMLV
FT                   TLREQRIGSLEALTTRLEHEPCHSSDDLLLRMFDQLVGRLADRLEGLEAAVTETTRLVF
FT                   DSPHKTKGLERMLHQVGDMGRQLGGLHNAGQGMLRLVTYLDGAAPDWFGADAAKRITLL
FT                   HKDLTTLSEFQQHMDDRIEFLLDSVLGMINMDQNNVMKVMAVASVVGIPPTVLVGIWGM
FT                   NFSYMPELKGHDHYFWALGIIALSVVVPLAWFRKRGWV"
FT   CDS_pept        complement(742194..742889)
FT                   /transl_table=11
FT                   /locus_tag="XCV0659"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22290"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22290.1"
FT                   /translation="MAVRTLNEFLAHSKEKDVSPDPFELENPHLLEVRLDGMVWSKAGA
FT                   MVARTGNVKFTREGLLEQGLGNLLKKAVSGEGMQLMKAEGQGRVYLADVGKMITLLRLN
FT                   GEAIFVNGNDVLAFESGIEHKITMMRKVAGMLSGGLFNVRLSGHGIVAITSHYEPLTLP
FT                   VTAASGPVFTDPNATVAWSGTLTPELVTDVSIGTLFGRGSGESLQMRFAGEGWVVVQPY
FT                   EEASFQAKG"
FT   CDS_pept        complement(743315..744988)
FT                   /transl_table=11
FT                   /gene="treA"
FT                   /locus_tag="XCV0660"
FT                   /product="Periplasmatic alpha,alpha-trehalase precursor"
FT                   /EC_number="3.2.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22291"
FT                   /db_xref="GOA:Q3BXX2"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="InterPro:IPR023720"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22291.1"
FT                   /translation="MSSAAPPCCTSLLGLSLSMFVAPGTLTAAPLDPPVVNAPAPTPPT
FT                   PDLAYPELFQAVQRGELFDDQKHFVDFLPLRDPALINADYLAQHDHPGFDLRKFVDANF
FT                   EESPPVQTDAIRQDTALREHIDLLWPKLVRSQNHVPPHSSLLALPHPYVVPGGRFREVY
FT                   YWDSYFTMLGLVKSGETTLSRQMLDNFAYLIDTYGHIPNGNRTYYLSRSQPPFFSYMVE
FT                   LQAGVEGEAVYQRYLPQLQKEYAYWMQGSDDLQPGQAARHVVRLADGSVLNRYWDERDT
FT                   PRPEAWLHDTRTAAEVKDRPAAEVYRDLRAGAESGWDYTSRWLADGQNLRTIRTTAILP
FT                   IDLNSLLYHLERTLAQACAQAGAECTRDYAALAQQRKQAIDAHLWNAAGYYADYDWQTR
FT                   TLSNQVTAAALYPLFAGLASDDHAKRTASTVRKTLLRPGGLATTAVKTGQQWDEPNGWA
FT                   PLQWVAVDGLRRYGEDALARTIGERFLAQVQALFAREHKLVEKYGLETDAAGGGGGEYA
FT                   LQDGFGWTNGVTLMLLNLYPGKDAKAAPAKRVRKPEAAAR"
FT   sig_peptide     complement(744905..744988)
FT                   /gene="treA"
FT                   /locus_tag="XCV0660"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(745261..746031)
FT                   /transl_table=11
FT                   /locus_tag="XCV0661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22292"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22292.1"
FT                   /translation="MPARPSGAIARVRCGCAGWSIPAADRAQFGEGASVLQRYATRFDA
FT                   VEINSSFYRPHRASTYARWADSVPEDFRFSVKLPRSISHDARLHGTGPLLDAFLAQAGA
FT                   LGTRLGCLLLQLPPSAAFDAAVAARFFTMLRRRWDGGVVCEPRHASWFTAPAQALLARH
FT                   RIARCAADPAPVPAASLPSPAAAPLYWRWHGAPRIYYSSYAHTALQALAATVRASHPDS
FT                   TPPPPERWVIFDNTAAGCATSNALELQRLLKNER"
FT   CDS_pept        746061..746888
FT                   /transl_table=11
FT                   /locus_tag="XCV0662"
FT                   /product="putative DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22293"
FT                   /db_xref="GOA:Q3BXX0"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22293.1"
FT                   /translation="MHARASGCRVHRDHGRITQRFDTGRMPEGPSLVILREDTQAFVGR
FT                   KIVRVSGNSKQDIARLDQQKVLALRSWGKHFLIEFAHFSVRIHFLLFGSYRINEDKPNA
FT                   VPRLGLEFSNGQRLNFYACSVQFIERPLDEVYDWTADVMNPLWDPAQARRKLRAAPALL
FT                   AADALLDQTIFAGVGNIIKNEVLHRIRVHPESTVGALPARKLGELVTQARDYSFDFYTW
FT                   KKAFVLKKHYQVHTKTSCPRDGAPLQYRKHLGKAGRRAFFCEVCQRLYRADEA"
FT   CDS_pept        complement(746954..747340)
FT                   /transl_table=11
FT                   /locus_tag="XCV0663"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22294"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22294.1"
FT                   /translation="MRRANLAGAAPARVWNSLFGQAGPAAIHIARQVAQANCQCATGQT
FT                   AGSALSTPTSENRQGTSPAMRCAGQPPAPRKTAHPATSNRAVHLPERCCTGTPALPPKT
FT                   HRRPLIGKPTTGARMCRPVRAGAE"
FT   CDS_pept        747396..748388
FT                   /transl_table=11
FT                   /locus_tag="XCV0664"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22295"
FT                   /db_xref="GOA:Q3BXW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22295.1"
FT                   /translation="MITRRKEALVPHVAAVACTGAILFFLACLLLYMPPPRETAQHEDT
FT                   LQVYFVPRPQQTPPAPQQPPQEPERKPRVASAARATPPATHTPPPPRQPAAATAPASDS
FT                   MSVQLYTRDGRLRMAQVDPMAQTGSAVPPGMADERAQAKARKIMERVNPVQYQQTRFAK
FT                   DWKSDGTLGDVAVQEMNRGMKKFNDMLNGPQTQVAKARPPPDVRFNPALAGNQAEMGSE
FT                   ATGDAYKSAPIAHETLPDLKGEASRRIREALAALEQRSARCDASRRTSLLSPVRTHLSD
FT                   LERAEHALNNGADPVMAAQMLPRQADSAYDLARRALWYADRQLKQCALG"
FT   CDS_pept        complement(748426..749553)
FT                   /transl_table=11
FT                   /locus_tag="XCV0665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22296"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22296.1"
FT                   /translation="MSNTSPVASAPWQPCPLGTQPRHVRSLSACGVGVSRCALRGAAST
FT                   PRYRRCRYACGFRVRACLAYSMKDMPVADESSRQHVLDGYRIVDSLPEDTYQDVVQVAA
FT                   SLCDTPIALMSLVDRDRQWFKARLGLGLQQTERSQAVCDHAIRSPDQLMEVPDLRKDSR
FT                   FADISVVTGDTGARFYAGMPLVTEEGVALGTVCVLDTEPRTLTELQRTGLQALARVAMR
FT                   LLDERKRELQLERDAILQPVVPVASQAVADTGYHLVILEVQELAALAERQSERLLGRNL
FT                   QQLDQAFAALVQGPGNSIDRVTDSAEFIAVLRGPDAERTLQRLREIAQQQHALGLTVLL
FT                   GQAQSTAPDEPIGQVFLRAEVALSAEKDRYRQRLA"
FT   CDS_pept        complement(749919..752798)
FT                   /transl_table=11
FT                   /locus_tag="XCV0666"
FT                   /product="putative zinc metalloprotease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22297"
FT                   /db_xref="GOA:Q3BXW6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22297.1"
FT                   /translation="MLRPLSLLIAGVLGVAAGSVAPAVAAAPASLSKSAASSAIPDIAY
FT                   TRFTLPNGLTVVVHEDHKAPVVAVSIWYHIGSGDEPAGKTGFAHLFEHLMFSGSENNKG
FT                   SFFAPLEKVGTTDMNGTTWFDRTNYFETVPTTALDTALWLESDRMGHLLGAIGQQELDT
FT                   QRGVVQNEKRQGENRPYGRVDQNILSNLFPANHPYQHDTIGSMEDLDAASLADVKQWFN
FT                   DNYGAANTTLVLAGDITVAQARAKALQYFGDIPSGKPVARQQPWVTPLAAQKRGVQHDH
FT                   VSQPRIYRTWAAPQLGTDDLIQLDLATTVLGGGKTSRLYQRLVYQDNLVDDVSASVQPF
FT                   ALSSQVQIQADVKDGVDPAKVEAIIDEELKKFIAQGPTADELQRAQVAYRAGFVRGLEK
FT                   VGGFTGKAVILAEGQVYRGDPGAYKKDLQRAQAATADSVKQASATWFGKGDYLLTVLPA
FT                   GKDFDPAAEDKAVVARGEEPGKPAPKLPAAGTFKVTASTLDRSKGVPQTDRFPDLSFPK
FT                   LQRGKLKNGIEVILAERHTIPVTQVELLFDAGYAADQGHKLGTASFSAALMNESTTALD
FT                   SVEVAQRRQRLGAITAVGCDLDSCSASLDALNDQLQPSLQLFSDIVRNPAFKAADIERV
FT                   RGQWLSGIAQEKTQPNSLALRALPPLLFGNQHPYGIPLTGSGTEAAIKSLNAQDLQNFH
FT                   SQWLRPDNLRILVAGDTTLAQIIPQLDATFGDWKAPTTALPKKNLANVAAQPKPRVYLI
FT                   NRPDAPQSVILAGLLAPSTKAPDNLAIGVANGAFGGTFTSRLNMNLRENKRWAYGAGTR
FT                   MMDAQGQRPYLFSAPVQTDKTAESANEIFKEATAIIGDKPLTSEEIEKIKNQRIRALPG
FT                   SFETTGAVLGAIEGIVQFDRPDDYVQTLKPRLEAIDQPAAQKAIKEIIKPEAMTWVIVG
FT                   DLKKIEAPVRALKLGQVQVLDVDGKPVKR"
FT   sig_peptide     complement(752724..752798)
FT                   /locus_tag="XCV0666"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        753056..755632
FT                   /transl_table=11
FT                   /locus_tag="XCV0667"
FT                   /product="putative sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22298"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22298.1"
FT                   /translation="MTVLLPPVPMPVDDALRVEAVRRLGVLDTEAEAEFDDIAWLAAHV
FT                   SGATMALVSLLDADRQWFKARCGTDLEGTPRSASFCAHAIMGTELMEVPDAEADPRFVN
FT                   NPLVIAAPGVRSYVGVPLIGREGYAYGTLCTLSTQPRMLEDSQKQALVRLARQAVNQLE
FT                   ARRDRLDAQAQRQTLSMLLEAMPDGVVACGTDGLLREFNHAARQWHGTDPRVLPPAQWA
FT                   LHFDLYTADGNSLLPTEEIPLLRAWRGEHVRNAELVIRATNQPPRSVLCNADPVVGDKG
FT                   TALGAVCVMHDITQLKDASAALAGERARLQALVDASQDVAIMAFDVQGRLELFNPGAER
FT                   LLGYRAEEVLGTCPAQFHLPAELERHMATLALSPPSYLKLAAAAAGDVLAEELWTLVRK
FT                   DGDLRRVRLCFNVIHDAQQGLAGYLAMAIDVTAELQAQAAAQLAAERFTGAFETAPQGM
FT                   AIVSLEGEWRDVNPALCGILGYSREQLLRTTFQQITHPDDLQMDLQLVQDLIDGKRDSY
FT                   SLAKRYISQHGAVIWAQLSVSLVRDSSGAPVHFVSQIQDVTERHVAAERLAESEARLRA
FT                   ISDATPTLVAQFDAGQRYLFANEAHRHWLGVEPASLVGRHITQVLGEDLSTAARAALAQ
FT                   VVAGQRASFEHVLGGSTPRDVEVTLVPETQTATPTQGFFLMAHDVTAHKTLHRLMHERA
FT                   TRDALTGLPNRHAWSEALQVAVAQAQQQQRAVAVMFLDLDGFKRINDVHGHRAGDAVLV
FT                   AFGSCLQRAAGERYLVARLAGDEFVVLLDGLEDAQAECAAVAERIRTLAAEGATFGDEH
FT                   LPIQPSIGVAWQHGAQAEASSLMHAADEAMYAAKRARQPEGQAPRS"
FT   CDS_pept        complement(755629..756213)
FT                   /transl_table=11
FT                   /locus_tag="XCV0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22299"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22299.1"
FT                   /translation="MSDIACHAHERSRLCGRRCRWHVQQSRRLMVWDRHKKTAICRASA
FT                   SGFAAIVGRPHHASLREAMVGCCKATDRAPEHQPRRATCRGRSRRALSSVPQARTRIVA
FT                   FLRRGRGVFPARLSHAIARWRVPSVCSASSHSLDAAGNRWLPRRSDAHRHAVRHWLFAV
FT                   CVLRFGFAPNSRSTQFPAVRMSCPAPTPRHA"
FT   CDS_pept        complement(756210..758414)
FT                   /transl_table=11
FT                   /locus_tag="XCV0669"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22300"
FT                   /db_xref="GOA:Q3BXW3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR041395"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22300.1"
FT                   /translation="MPVVSLLRRSVANLPLTRKFVLLCTLLTVGVILLAMAAARLQYLD
FT                   LVEARKLSVKTEVEMGLTVMQHYADKVKAGELSLEQAKEAARTTLADMRTNDGVDYFFI
FT                   VDPQMRILMHPKRPVGTDMTDYKSDAGQYVYRDIKTAIDSGDGFSYYDAPKPGKKEQLP
FT                   KISYAKTFPAWNWVLVMGVYAEDIQVQAWGFTRTLTLIGGALVALVIGLCWLIASAMAA
FT                   PLRAASRTAEAIASGRFDNDIRVESRDETGQLMHSMQQMQTQLQRFNGEMQTMIRLQQG
FT                   ENIAHRIPEDFPGDYGTLAHGVNTVVFEHLDAINEAMDVMSDYGRGDLRRDMRRLPGQR
FT                   AALHQALDTVKENLSAINSDIARLADAAARGDFSARGDQSHYQFAFAEMVQALNRLMQQ
FT                   ADAGLDDVGRIMAAIADGDLSQRVESHYEGAFGRLADAANRTAIQLTSIVQGIQHSAEM
FT                   INTAAGEIASGNADLSTRTEHQAANLEETAASMEELTSTVRQNADNARQANQLVKGTGD
FT                   VAESGGRVVQEVVSTMQAITQSSARISDIIGVIDGIAFQTNILALNAAVEAARAGEQGR
FT                   GFAVVATEVRALAQRSAGAAKEIKQLISDSVEKVAQGSELVQQAGSTMTEVVSSVKRVT
FT                   DIMAEITAASTEQSAGIEQVSTTVMQLDEMTQQNAALVEEATAAARSMEDQAADLTRAV
FT                   AVFRLTSDAGTPPVRGATNALAATKPAAAKHAVHEHRRRA"
FT   CDS_pept        complement(758663..760093)
FT                   /transl_table=11
FT                   /gene="engXCA"
FT                   /locus_tag="XCV0670"
FT                   /product="extracellular endoglucanase precursor"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22301"
FT                   /db_xref="GOA:Q3BXW2"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22301.1"
FT                   /translation="MPIFRTASTLALATMLALTAAPAFSYSVSNNKIVDDNGNVVQLKG
FT                   VNVFGFETGNHVMHGLWARNWKEMINQMQGLGFNAVRLPFCPATLRSGQMPSSIDYSRN
FT                   ADLQGLTSLQILDKVINEFNARGMYVLLDHHTPDCAAISELWYTSSYSEAQWLDDLRFV
FT                   ANRYKNVPRVIGVDLKNEPHGAATWGTGNAATDWNKAAERGSAAVLAVAPKWIIAVEGI
FT                   TDNPVCSTNGGIFWGGSLQPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNM
FT                   PAIWDRHFGQFAGNHALLLGEFGGKYGEGDARDKVWQDALVKYLRGKGINEGFYWSWNP
FT                   NSGDTGGILRDDWISVREDKMTLLRTLWGTVSNSTPTPTPTPTPTPTPTPTPSAGFSTK
FT                   VIPDSRWNGGYCNRVQVTNTGTASGNWSISLTVTGTVNNAWNVTWSQSGTTLQASGVDF
FT                   NRTLAPGATAEFGFCAAG"
FT   sig_peptide     complement(760019..760093)
FT                   /gene="engXCA"
FT                   /locus_tag="XCV0670"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        760306..761793
FT                   /transl_table=11
FT                   /locus_tag="XCV0671"
FT                   /product="sulfate permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22302"
FT                   /db_xref="GOA:Q3BXW1"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22302.1"
FT                   /translation="MSLLRAEMAQWRASPARELMAGAVATFALIPEVIAFAFVAGVDPQ
FT                   VGLFASFVIGIVIAFCGGRPAMISAAAGSVALVAAPLVAAHGLPYLLAAGLLAGMVQIL
FT                   FGLLRLGVLMRFVSSSVRTGFVNALAVLIFAAQLPHLLGANLTTWVMLGAGLAIIYGLP
FT                   RLRLPGLSAIPSPLLCILLLSVAGTALHLPLKTVADLGKLPNALPFLQWPAVPLTLETL
FT                   RIIALPALAIAMVGLLESMMTARVVDELTDTPSNKNRECTGLGIANAAASLFGGIAGCG
FT                   MIGQTVGNVKYGGRGRLSTLFAGVFLLILMVLLKPWVSQVPVVALVAIMVMVSAETFDW
FT                   RSLRTVVTHPRTSSVVMLATVAVTLFTHNLAAGVAVGVLLSGVFFTFKVAGLLQIAHHD
FT                   GTDGVRTYSVRGQVFFASADVFIDAFDAREVPGRAVVIDVGRAHFWDITAVAALDKVVQ
FT                   RLRHHGLDVQVKGLNAGSRRLMQRHALGEDALESALP"
FT   CDS_pept        762031..763011
FT                   /transl_table=11
FT                   /locus_tag="XCV0672"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22303"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22303.1"
FT                   /translation="MTNAPLLERMVDLTAIRDADLLDLSLLRTVREVCAAEELSLLRIA
FT                   PDSNSIAETRLRDDGRLALTVAEIHDARTRIQLAEVHGPGDVVQLHEDGRALLVYPMME
FT                   ARGIRTCLRVGGTRIPGVAEQAMLQGFARFFQNYRSLLDDAQRDALTGLRNRKTFDDVI
FT                   LRLFAGGADSAAEQGVWLGIVDIDHFKRVNDTFGHLYGDEVLLLVAQLMQRAFRQDDLL
FT                   FRFGGEEFVIVLRGVDRDTAVSLFERFRLAVAEHLFPQVGQVTLSTGIVELTHGRLISE
FT                   MLDEADKALYWAKQNGRNRAAVYAELIAGGQLQQVAQPVGSIDLF"
FT   CDS_pept        763179..764828
FT                   /transl_table=11
FT                   /locus_tag="XCV0673"
FT                   /product="putative aminopeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22304"
FT                   /db_xref="GOA:Q3BXV9"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22304.1"
FT                   /translation="MKRVAVGLLAMAVSTALMAATPSFDGARISRDVKELASDAYEGRG
FT                   PATAGEEKTIAYLSEQFAEAGLQPGGDLANGKRGWTQAVPLRRADIVGTPTIAVQNAGK
FT                   PQTLTQGKQIAIRAALDGSSKVEIANAPLVFVGYGVKAPERNWDDFKGVDLKGKIAVVL
FT                   INDPDFETGKGDFDGTGMTYYGRWTYKYEEGARQGALGVLVVHETAPASYGWDTVASSN
FT                   TNTMFDVVRDNPRSAHPTLEGWIQRDLATELFKHTGLDFETLKKQAQTRGFKPVELKDQ
FT                   RLSASYQVKSDVITSHNVVARLEGSKHPDETLIYSAHWDHIGVGKPDARGDTIFNGALD
FT                   NASGTAALLELARGFAQGPTPERSVVFLAVTAEEKGLLGSEFYASKPLYPLDTTVAVIN
FT                   MDGMNPFVPSRDFGIYGTAKLELLDQLKSVAAQSKLRYTPDPKPQAGYFFRSDHFSFAK
FT                   RGVPALSYAAGQDWEVGGVAAGKAAADDYTAKRYHQQGDEWKPDWTFAGAARDLGVLYA
FT                   LGQQLADSRQWPNWSQDSEFRATRDASAAARK"
FT   sig_peptide     763179..763235
FT                   /locus_tag="XCV0673"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(764843..765130)
FT                   /transl_table=11
FT                   /locus_tag="XCV0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22305"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22305.1"
FT                   /translation="MIEASMTSASARRSSGPACRVRSALAARRTRRESILGRDGGIHAA
FT                   SSEGVAQNVRRLLTDNSKHKPHGRQGLFKRGISIWHMRHRARAAALVLTQ"
FT   CDS_pept        765756..767693
FT                   /transl_table=11
FT                   /gene="opgH"
FT                   /locus_tag="XCV0675"
FT                   /product="glucans biosynthesis glucosyltransferase H"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0675"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22306"
FT                   /db_xref="GOA:Q3BXV7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023725"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BXV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22306.1"
FT                   /translation="MDGTVTPSPTTTAMPPVSALDAGTPTLPPEAPLAMPEQNLREGSL
FT                   QVRHQRTSPPGIGVRRFYLIGGTFATTAIAVWVMLSVLWPDGISVLEGCLLGLFVLLFA
FT                   WIAMSFASAVAGFVTVVARAGRKLGIDPEQPLPTLRSRTALLMPTYNEDPRRLLAGLQA
FT                   IYESVAETGQLEHFDFFVLSDTTREHIGRAEELVYNELCDRVDGHGRIFYRRRADNAAR
FT                   KAGNVADWVRRFGGSYPQMLILDADSVMTGDTIVRLVAGMENNPDVGLIQTLPAVVNGQ
FT                   TLFARMQQFGGRVYGPIIAFGVAWWHGAESNYWGHNAIIRTQAFADHAGLPSLRGRKPF
FT                   GGHVLSHDFVEAALMRRGGWAMHMVPYLQGSYEEGPPTLTDLLIRDRRWCQGNLQHAKV
FT                   VSAKGLHWISRMHMLIGIGHYFTAPMWGLLMLIGIGIPLAGGGIDLAGDLPFSPARYWH
FT                   GSSQGNAIWIFICTMFVLLAPKLLGYIALLLNPRELRACGGAFRAAVSILLETVLAALM
FT                   APVVMYLQSRGVFEVLAGKDSGWDAQVRDDGKLSWPALFRSYGGLTVFGLFMGAVAYAV
FT                   SPALAAWMGPVIVGMALSIPVVALTSLRRTGMALRRAGIFCIPEELDPPKVLVRASELR
FT                   RAAALEPSLI"
FT   CDS_pept        767844..768512
FT                   /transl_table=11
FT                   /locus_tag="XCV0676"
FT                   /product="carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0676"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22307"
FT                   /db_xref="GOA:Q3BXV6"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22307.1"
FT                   /translation="MMLEVIERETGPNPQWSVLWLHGLGADGSDFAPMVPELVRPQWPA
FT                   LRFVFPHAPIRPITINNGVRMRGWYDIVGMDFAQRADKAGIAESVTQVEALIAHEQSRG
FT                   IAPERILLAGFSQGGAVTLAVGLQRSVPLAGLIAMSTYLPDPAAAASQLQPAALRQPLF
FT                   MAHGTADPVVPFAAGQASMQTLRTLGFALDWHTYPMGHQVCLEEIEALRDWMQARFTAA
FT                   "
FT   CDS_pept        768517..769566
FT                   /transl_table=11
FT                   /locus_tag="XCV0677"
FT                   /product="two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0677"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22308"
FT                   /db_xref="GOA:Q3BXV5"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22308.1"
FT                   /translation="MAQRAPQIAWMPDLCRLPRLGAMLGLAELVVLVVTLVPDAGARNI
FT                   TLSRFLSASGLALWLALAVTVLLCVLRPTLSRLPPRLGGLSALLIAAVVAMLGAGIVHG
FT                   LYAVLGQVPLGAQVGFWRFTLGSAATVVLITALALRYFYVSDRWEAQVQANARAEADAL
FT                   QARIRPHFLFNSMNLIVSLLRRDPVVAEQAVLDLSDLFRAALGAGEGVSTLRAECELAE
FT                   RYLAIESLRLGERLQVRWHRQEPLPWELPMPRLVLQPLVENAVLHGVSRMPEGGTLYLS
FT                   LRQRGNQLQIRIVNPAPQPGTQLPLLAGAGHAQASISHRLAFQFGAGARMAASWAEGYY
FT                   ACEITLPLP"
FT   CDS_pept        769597..770334
FT                   /transl_table=11
FT                   /gene="algR"
FT                   /locus_tag="XCV0678"
FT                   /product="two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0678"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22309"
FT                   /db_xref="GOA:Q3BXV4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22309.1"
FT                   /translation="MTATQVRVLIADDEPLARERLRMLLGEHPQVEVIGEAENGQQVLQ
FT                   QCEQLRPDLVLLDIAMPGVDGLETARLLRQGQPPPAVVFCTAYDQHALSAFDAAALDYL
FT                   MKPVRPERLASALEKVATFLAGRVPGTAARPLRTHLCARLRGSLRLIAIGDIRYLQAEE
FT                   KYVIVHHTRGEDLIEESLKSLEDEFANRLVRIHRNCLVARDELVELRRSGDGQVHAVLR
FT                   NVPQTLEVSRRCVASLRDQLRQL"
FT   CDS_pept        770365..771279
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="XCV0679"
FT                   /product="hydroxymethylbilane synthase HemC"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0679"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22310"
FT                   /db_xref="GOA:Q3BXV3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3BXV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22310.1"
FT                   /translation="MTTLRIATRKSPLALWQSEHVAAALRQHHPGLEVVLVPMSTRGDE
FT                   MLDRSLAAIGGKGLFLKELELAMLRGEADCAVHSLKDVPMELDAPFVLPAILERGDPAD
FT                   ALVSNLYASLQALPLGARVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYD
FT                   AIVLACAGLQRLGLEARISARLDAPEWLPAPAQGAVAVECRGDDARIYSLLAVLDAGRT
FT                   RACVEAERAMNRALHGSCHVPVAAFARWEGQGLFLQGMVGSASDGRLIHADAHGSAEDT
FT                   EALGRRVAQGLFDKGAAQLLAEL"
FT   CDS_pept        complement(771471..772271)
FT                   /transl_table=11
FT                   /locus_tag="XCV0680"
FT                   /product="putative salt-induced outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0680"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22311"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22311.1"
FT                   /translation="MSRRVPLSALLPLLLITPSVWAQAVAPVPADPAAVVLPSPWSGSS
FT                   GELGYAAAHGNSTTDSLNGRVRLRYTDGDWIHSLDATALRSSSEYTNTNDDGSTTRERQ
FT                   TTAERYTGSVGSALQLGEHRQLTATGRYEHDDFATYDRLATFGIGYGTRLIDADRFYLD
FT                   AQVGPGVRRAHNSDEDRNETGLIGRGLFDLKYTVTDNTDLINTLLVESGEYNTYAQNDF
FT                   GVQVSMNLHFALKAAWQMRHNSDVSDGDKKTDTLTTVNLVYTFK"
FT   sig_peptide     complement(772206..772271)
FT                   /locus_tag="XCV0680"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        772663..773805
FT                   /transl_table=11
FT                   /locus_tag="XCV0681"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0681"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22312"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ22312.1"
FT                   /translation="MPATRACATARTTPPRSGCATDPTDQAAASHILRALAAVCLPSHR
FT                   DAHPAAQRLGHNRRMDRYERINSLHRLLKSARYPVTVARLQDELSCSRATVYRDLAFLR
FT                   DALMAPVEGDGESGFRYLSGESDRFELPGLWLSSEELHALLASQQLLARTGGGVLSSML
FT                   APLQQRIEGLLAAQAGVSQWPVDRVRVIPHRGRKLDEASFRTVASGVLERKQLSFDYRA
FT                   RSTDESTKRTVSPQRITHYRDNWYLDAWDHGRDGVRSFAVDRINHARLLDAAPRDVPDS
FT                   ELDEQLAASYGIFSGAPKGWATTVFSSKAARWVADEHWHSKQQGRFLPDGRYELKLPYS
FT                   NSRELLMDVLHYGSDAEIVEPMSLREQAKALLSLALSNYD"
FT   CDS_pept        complement(773963..774241)
FT                   /transl_table=11
FT                   /locus_tag="XCV0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCV0682"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ22313"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BXV0"
FT                   /inference=