(data stored in ACNUC7421 zone)

EMBL: AM167904

ID   AM167904; SV 1; circular; genomic DNA; STD; PRO; 3732255 BP.
XX
AC   AM167904;
XX
PR   Project:PRJNA27;
XX
DT   01-FEB-2006 (Rel. 86, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 13)
XX
DE   Bordetella avium 197N complete genome
XX
KW   complete genome.
XX
OS   Bordetella avium 197N
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Bordetella.
XX
RN   [1]
RP   1-3732255
RA   Sebaihia M.;
RT   ;
RL   Submitted (30-NOV-2005) to the INSDC.
RL   Sebaihia M., Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
RL   Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1128/JB.01927-05.
RX   PUBMED; 16885469.
RA   Sebaihia M., Preston A., Maskell D.J., Kuzmiak H., Connell T.D., King N.D.,
RA   Orndorff P.E., Miyamoto D.M., Thomson N.R., Harris D., Goble A., Lord A.,
RA   Murphy L., Quail M.A., Rutter S., Squares R., Squares S., Woodward J.,
RA   Parkhill J., Temple L.M.;
RT   "Comparison of the genome sequence of the poultry pathogen Bordetella avium
RT   with those of B. bronchiseptica, B. pertussis, and B. parapertussis reveals
RT   extensive diversity in surface structures associated with host
RT   interaction";
RL   J. Bacteriol. 188(16):6002-6015(2006).
XX
DR   MD5; 0b1b095d82d8575084ee2526e15baa99.
DR   BioSample; SAMEA1705952.
DR   EnsemblGenomes-Gn; BAV0346.
DR   EnsemblGenomes-Gn; BAV0375.
DR   EnsemblGenomes-Gn; BAV0379.
DR   EnsemblGenomes-Gn; BAV0389.
DR   EnsemblGenomes-Gn; BAV0464.
DR   EnsemblGenomes-Gn; BAV0582.
DR   EnsemblGenomes-Gn; BAV0759.
DR   EnsemblGenomes-Gn; BAV0802.
DR   EnsemblGenomes-Gn; BAV0870.
DR   EnsemblGenomes-Gn; BAV0897.
DR   EnsemblGenomes-Gn; BAV0937.
DR   EnsemblGenomes-Gn; BAV1257.
DR   EnsemblGenomes-Gn; BAV1547.
DR   EnsemblGenomes-Gn; BAV1569.
DR   EnsemblGenomes-Gn; BAV1640.
DR   EnsemblGenomes-Gn; BAV1856.
DR   EnsemblGenomes-Gn; BAV1877.
DR   EnsemblGenomes-Gn; BAV1938.
DR   EnsemblGenomes-Gn; BAV2146.
DR   EnsemblGenomes-Gn; BAV2159.
DR   EnsemblGenomes-Gn; BAV2222.
DR   EnsemblGenomes-Gn; BAV2440.
DR   EnsemblGenomes-Gn; BAV2452.
DR   EnsemblGenomes-Gn; BAV2513.
DR   EnsemblGenomes-Gn; BAV2522.
DR   EnsemblGenomes-Gn; BAV2529.
DR   EnsemblGenomes-Gn; BAV2537.
DR   EnsemblGenomes-Gn; BAV2571.
DR   EnsemblGenomes-Gn; BAV2572.
DR   EnsemblGenomes-Gn; BAV2573.
DR   EnsemblGenomes-Gn; BAV2576.
DR   EnsemblGenomes-Gn; BAV2597.
DR   EnsemblGenomes-Gn; BAV2601.
DR   EnsemblGenomes-Gn; BAV2602.
DR   EnsemblGenomes-Gn; BAV2618.
DR   EnsemblGenomes-Gn; BAV2621.
DR   EnsemblGenomes-Gn; BAV2691.
DR   EnsemblGenomes-Gn; BAV2814.
DR   EnsemblGenomes-Gn; BAV2902.
DR   EnsemblGenomes-Gn; BAV3385.
DR   EnsemblGenomes-Gn; EBG00000637957.
DR   EnsemblGenomes-Gn; EBG00000637958.
DR   EnsemblGenomes-Gn; EBG00000637959.
DR   EnsemblGenomes-Gn; EBG00000637960.
DR   EnsemblGenomes-Gn; EBG00000637961.
DR   EnsemblGenomes-Gn; EBG00000637962.
DR   EnsemblGenomes-Gn; EBG00000637963.
DR   EnsemblGenomes-Gn; EBG00000637964.
DR   EnsemblGenomes-Gn; EBG00000637965.
DR   EnsemblGenomes-Gn; EBG00000637966.
DR   EnsemblGenomes-Gn; EBG00000637967.
DR   EnsemblGenomes-Gn; EBG00000637968.
DR   EnsemblGenomes-Gn; EBG00000637969.
DR   EnsemblGenomes-Gn; EBG00000637970.
DR   EnsemblGenomes-Gn; EBG00000637971.
DR   EnsemblGenomes-Gn; EBG00000637972.
DR   EnsemblGenomes-Gn; EBG00000637973.
DR   EnsemblGenomes-Gn; EBG00000637974.
DR   EnsemblGenomes-Gn; EBG00000637975.
DR   EnsemblGenomes-Gn; EBG00000637976.
DR   EnsemblGenomes-Gn; EBG00000637977.
DR   EnsemblGenomes-Gn; EBG00000637978.
DR   EnsemblGenomes-Gn; EBG00000637979.
DR   EnsemblGenomes-Gn; EBG00000637980.
DR   EnsemblGenomes-Gn; EBG00000637981.
DR   EnsemblGenomes-Gn; EBG00000637982.
DR   EnsemblGenomes-Gn; EBG00000637983.
DR   EnsemblGenomes-Gn; EBG00000637984.
DR   EnsemblGenomes-Gn; EBG00000637985.
DR   EnsemblGenomes-Gn; EBG00000637986.
DR   EnsemblGenomes-Gn; EBG00000637987.
DR   EnsemblGenomes-Gn; EBG00000637988.
DR   EnsemblGenomes-Gn; EBG00000637989.
DR   EnsemblGenomes-Gn; EBG00000637990.
DR   EnsemblGenomes-Gn; EBG00000637991.
DR   EnsemblGenomes-Gn; EBG00000637992.
DR   EnsemblGenomes-Gn; EBG00000637993.
DR   EnsemblGenomes-Gn; EBG00000637994.
DR   EnsemblGenomes-Gn; EBG00000637995.
DR   EnsemblGenomes-Gn; EBG00000637996.
DR   EnsemblGenomes-Gn; EBG00000637997.
DR   EnsemblGenomes-Gn; EBG00000637998.
DR   EnsemblGenomes-Gn; EBG00000637999.
DR   EnsemblGenomes-Gn; EBG00000638000.
DR   EnsemblGenomes-Gn; EBG00000638001.
DR   EnsemblGenomes-Gn; EBG00000638002.
DR   EnsemblGenomes-Gn; EBG00000638003.
DR   EnsemblGenomes-Gn; EBG00000638004.
DR   EnsemblGenomes-Gn; EBG00000638005.
DR   EnsemblGenomes-Gn; EBG00000638006.
DR   EnsemblGenomes-Gn; EBG00000638007.
DR   EnsemblGenomes-Gn; EBG00000638008.
DR   EnsemblGenomes-Gn; EBG00000638009.
DR   EnsemblGenomes-Gn; EBG00000638010.
DR   EnsemblGenomes-Gn; EBG00000638011.
DR   EnsemblGenomes-Gn; EBG00000638012.
DR   EnsemblGenomes-Gn; EBG00000638013.
DR   EnsemblGenomes-Gn; EBG00000638014.
DR   EnsemblGenomes-Gn; EBG00000638015.
DR   EnsemblGenomes-Gn; EBG00000638016.
DR   EnsemblGenomes-Gn; EBG00000638017.
DR   EnsemblGenomes-Gn; EBG00000638018.
DR   EnsemblGenomes-Gn; EBG00000638019.
DR   EnsemblGenomes-Gn; EBG00000638020.
DR   EnsemblGenomes-Gn; EBG00000638021.
DR   EnsemblGenomes-Gn; EBG00000638022.
DR   EnsemblGenomes-Gn; EBG00000638023.
DR   EnsemblGenomes-Gn; EBG00000638024.
DR   EnsemblGenomes-Gn; EBG00000638025.
DR   EnsemblGenomes-Gn; EBG00000638026.
DR   EnsemblGenomes-Gn; EBG00001439142.
DR   EnsemblGenomes-Gn; EBG00001439143.
DR   EnsemblGenomes-Gn; EBG00001439144.
DR   EnsemblGenomes-Gn; EBG00001439145.
DR   EnsemblGenomes-Gn; EBG00001439146.
DR   EnsemblGenomes-Gn; EBG00001439147.
DR   EnsemblGenomes-Gn; EBG00001439148.
DR   EnsemblGenomes-Gn; EBG00001439149.
DR   EnsemblGenomes-Gn; EBG00001439150.
DR   EnsemblGenomes-Gn; EBG00001439151.
DR   EnsemblGenomes-Gn; EBG00001439152.
DR   EnsemblGenomes-Gn; EBG00001439153.
DR   EnsemblGenomes-Gn; EBG00001439154.
DR   EnsemblGenomes-Gn; EBG00001439155.
DR   EnsemblGenomes-Gn; EBG00001439156.
DR   EnsemblGenomes-Gn; EBG00001439157.
DR   EnsemblGenomes-Gn; EBG00001439158.
DR   EnsemblGenomes-Gn; EBG00001439159.
DR   EnsemblGenomes-Gn; EBG00001439160.
DR   EnsemblGenomes-Gn; EBG00001439161.
DR   EnsemblGenomes-Gn; EBG00001439162.
DR   EnsemblGenomes-Gn; EBG00001439163.
DR   EnsemblGenomes-Gn; EBG00001439164.
DR   EnsemblGenomes-Gn; EBG00001439165.
DR   EnsemblGenomes-Gn; EBG00001439166.
DR   EnsemblGenomes-Gn; EBG00001439167.
DR   EnsemblGenomes-Gn; EBG00001439168.
DR   EnsemblGenomes-Gn; EBG00001439169.
DR   EnsemblGenomes-Gn; EBG00001439170.
DR   EnsemblGenomes-Gn; EBG00001439171.
DR   EnsemblGenomes-Gn; EBG00001439172.
DR   EnsemblGenomes-Gn; EBG00001439173.
DR   EnsemblGenomes-Gn; EBG00001439174.
DR   EnsemblGenomes-Gn; EBG00001439175.
DR   EnsemblGenomes-Gn; EBG00001439176.
DR   EnsemblGenomes-Gn; EBG00001439177.
DR   EnsemblGenomes-Gn; EBG00001439178.
DR   EnsemblGenomes-Gn; EBG00001439179.
DR   EnsemblGenomes-Gn; EBG00001439180.
DR   EnsemblGenomes-Gn; EBG00001439181.
DR   EnsemblGenomes-Gn; EBG00001439182.
DR   EnsemblGenomes-Gn; EBG00001439183.
DR   EnsemblGenomes-Gn; EBG00001439184.
DR   EnsemblGenomes-Gn; EBG00001439185.
DR   EnsemblGenomes-Gn; EBG00001439186.
DR   EnsemblGenomes-Gn; EBG00001439187.
DR   EnsemblGenomes-Gn; EBG00001439188.
DR   EnsemblGenomes-Gn; EBG00001439189.
DR   EnsemblGenomes-Gn; EBG00001439190.
DR   EnsemblGenomes-Gn; EBG00001439191.
DR   EnsemblGenomes-Gn; EBG00001439192.
DR   EnsemblGenomes-Gn; EBG00001439193.
DR   EnsemblGenomes-Gn; EBG00001439194.
DR   EnsemblGenomes-Gn; EBG00001439195.
DR   EnsemblGenomes-Gn; EBG00001439196.
DR   EnsemblGenomes-Gn; EBG00001439197.
DR   EnsemblGenomes-Gn; EBG00001439198.
DR   EnsemblGenomes-Gn; EBG00001439199.
DR   EnsemblGenomes-Gn; EBG00001439200.
DR   EnsemblGenomes-Gn; EBG00001439201.
DR   EnsemblGenomes-Gn; EBG00001439202.
DR   EnsemblGenomes-Gn; EBG00001439203.
DR   EnsemblGenomes-Gn; EBG00001439204.
DR   EnsemblGenomes-Gn; EBG00001439205.
DR   EnsemblGenomes-Gn; EBG00001439206.
DR   EnsemblGenomes-Gn; EBG00001439207.
DR   EnsemblGenomes-Gn; EBG00001439208.
DR   EnsemblGenomes-Gn; EBG00001439209.
DR   EnsemblGenomes-Gn; EBG00001439210.
DR   EnsemblGenomes-Gn; EBG00001439211.
DR   EnsemblGenomes-Gn; EBG00001439212.
DR   EnsemblGenomes-Gn; EBG00001439213.
DR   EnsemblGenomes-Gn; EBG00001439214.
DR   EnsemblGenomes-Gn; EBG00001439215.
DR   EnsemblGenomes-Gn; EBG00001439216.
DR   EnsemblGenomes-Gn; EBG00001439217.
DR   EnsemblGenomes-Gn; EBG00001439218.
DR   EnsemblGenomes-Gn; EBG00001439219.
DR   EnsemblGenomes-Gn; EBG00001439220.
DR   EnsemblGenomes-Gn; EBG00001439221.
DR   EnsemblGenomes-Gn; EBG00001439222.
DR   EnsemblGenomes-Gn; EBG00001439223.
DR   EnsemblGenomes-Gn; EBG00001439224.
DR   EnsemblGenomes-Gn; EBG00001439225.
DR   EnsemblGenomes-Gn; EBG00001439226.
DR   EnsemblGenomes-Gn; EBG00001439227.
DR   EnsemblGenomes-Tr; BAV0346.
DR   EnsemblGenomes-Tr; BAV0375.
DR   EnsemblGenomes-Tr; BAV0379.
DR   EnsemblGenomes-Tr; BAV0389.
DR   EnsemblGenomes-Tr; BAV0464.
DR   EnsemblGenomes-Tr; BAV0582.
DR   EnsemblGenomes-Tr; BAV0759.
DR   EnsemblGenomes-Tr; BAV0802.
DR   EnsemblGenomes-Tr; BAV0870.
DR   EnsemblGenomes-Tr; BAV0897.
DR   EnsemblGenomes-Tr; BAV0937.
DR   EnsemblGenomes-Tr; BAV1257.
DR   EnsemblGenomes-Tr; BAV1547.
DR   EnsemblGenomes-Tr; BAV1569.
DR   EnsemblGenomes-Tr; BAV1640.
DR   EnsemblGenomes-Tr; BAV1856.
DR   EnsemblGenomes-Tr; BAV1877.
DR   EnsemblGenomes-Tr; BAV1938.
DR   EnsemblGenomes-Tr; BAV2146.
DR   EnsemblGenomes-Tr; BAV2159.
DR   EnsemblGenomes-Tr; BAV2222.
DR   EnsemblGenomes-Tr; BAV2440.
DR   EnsemblGenomes-Tr; BAV2452.
DR   EnsemblGenomes-Tr; BAV2513.
DR   EnsemblGenomes-Tr; BAV2522.
DR   EnsemblGenomes-Tr; BAV2529.
DR   EnsemblGenomes-Tr; BAV2537.
DR   EnsemblGenomes-Tr; BAV2571.
DR   EnsemblGenomes-Tr; BAV2572.
DR   EnsemblGenomes-Tr; BAV2576.
DR   EnsemblGenomes-Tr; BAV2597.
DR   EnsemblGenomes-Tr; BAV2601.
DR   EnsemblGenomes-Tr; BAV2602.
DR   EnsemblGenomes-Tr; BAV2618.
DR   EnsemblGenomes-Tr; BAV2621.
DR   EnsemblGenomes-Tr; BAV2691.
DR   EnsemblGenomes-Tr; BAV2814.
DR   EnsemblGenomes-Tr; BAV2902.
DR   EnsemblGenomes-Tr; BAV3385.
DR   EnsemblGenomes-Tr; EBG00000637957-1.
DR   EnsemblGenomes-Tr; EBG00000637958-1.
DR   EnsemblGenomes-Tr; EBG00000637959-1.
DR   EnsemblGenomes-Tr; EBG00000637960-1.
DR   EnsemblGenomes-Tr; EBG00000637961-1.
DR   EnsemblGenomes-Tr; EBG00000637962-1.
DR   EnsemblGenomes-Tr; EBG00000637963-1.
DR   EnsemblGenomes-Tr; EBG00000637964-1.
DR   EnsemblGenomes-Tr; EBG00000637965-1.
DR   EnsemblGenomes-Tr; EBG00000637966-1.
DR   EnsemblGenomes-Tr; EBG00000637967-1.
DR   EnsemblGenomes-Tr; EBG00000637968-1.
DR   EnsemblGenomes-Tr; EBG00000637969-1.
DR   EnsemblGenomes-Tr; EBG00000637970-1.
DR   EnsemblGenomes-Tr; EBG00000637971-1.
DR   EnsemblGenomes-Tr; EBG00000637972-1.
DR   EnsemblGenomes-Tr; EBG00000637973-1.
DR   EnsemblGenomes-Tr; EBG00000637974-1.
DR   EnsemblGenomes-Tr; EBG00000637975-1.
DR   EnsemblGenomes-Tr; EBG00000637976-1.
DR   EnsemblGenomes-Tr; EBG00000637977-1.
DR   EnsemblGenomes-Tr; EBG00000637978-1.
DR   EnsemblGenomes-Tr; EBG00000637979-1.
DR   EnsemblGenomes-Tr; EBG00000637980-1.
DR   EnsemblGenomes-Tr; EBG00000637981-1.
DR   EnsemblGenomes-Tr; EBG00000637982-1.
DR   EnsemblGenomes-Tr; EBG00000637983-1.
DR   EnsemblGenomes-Tr; EBG00000637984-1.
DR   EnsemblGenomes-Tr; EBG00000637985-1.
DR   EnsemblGenomes-Tr; EBG00000637986-1.
DR   EnsemblGenomes-Tr; EBG00000637987-1.
DR   EnsemblGenomes-Tr; EBG00000637988-1.
DR   EnsemblGenomes-Tr; EBG00000637989-1.
DR   EnsemblGenomes-Tr; EBG00000637990-1.
DR   EnsemblGenomes-Tr; EBG00000637991-1.
DR   EnsemblGenomes-Tr; EBG00000637992-1.
DR   EnsemblGenomes-Tr; EBG00000637993-1.
DR   EnsemblGenomes-Tr; EBG00000637994-1.
DR   EnsemblGenomes-Tr; EBG00000637995-1.
DR   EnsemblGenomes-Tr; EBG00000637996-1.
DR   EnsemblGenomes-Tr; EBG00000637997-1.
DR   EnsemblGenomes-Tr; EBG00000637998-1.
DR   EnsemblGenomes-Tr; EBG00000637999-1.
DR   EnsemblGenomes-Tr; EBG00000638000-1.
DR   EnsemblGenomes-Tr; EBG00000638001-1.
DR   EnsemblGenomes-Tr; EBG00000638002-1.
DR   EnsemblGenomes-Tr; EBG00000638003-1.
DR   EnsemblGenomes-Tr; EBG00000638004-1.
DR   EnsemblGenomes-Tr; EBG00000638005-1.
DR   EnsemblGenomes-Tr; EBG00000638006-1.
DR   EnsemblGenomes-Tr; EBG00000638007-1.
DR   EnsemblGenomes-Tr; EBG00000638008-1.
DR   EnsemblGenomes-Tr; EBG00000638009-1.
DR   EnsemblGenomes-Tr; EBG00000638010-1.
DR   EnsemblGenomes-Tr; EBG00000638011-1.
DR   EnsemblGenomes-Tr; EBG00000638012-1.
DR   EnsemblGenomes-Tr; EBG00000638013-1.
DR   EnsemblGenomes-Tr; EBG00000638014-1.
DR   EnsemblGenomes-Tr; EBG00000638015-1.
DR   EnsemblGenomes-Tr; EBG00000638016-1.
DR   EnsemblGenomes-Tr; EBG00000638017-1.
DR   EnsemblGenomes-Tr; EBG00000638018-1.
DR   EnsemblGenomes-Tr; EBG00000638019-1.
DR   EnsemblGenomes-Tr; EBG00000638020-1.
DR   EnsemblGenomes-Tr; EBG00000638021-1.
DR   EnsemblGenomes-Tr; EBG00000638022-1.
DR   EnsemblGenomes-Tr; EBG00000638023-1.
DR   EnsemblGenomes-Tr; EBG00000638024-1.
DR   EnsemblGenomes-Tr; EBG00000638025-1.
DR   EnsemblGenomes-Tr; EBG00000638026-1.
DR   EnsemblGenomes-Tr; EBT00001497989.
DR   EnsemblGenomes-Tr; EBT00001497991.
DR   EnsemblGenomes-Tr; EBT00001817091.
DR   EnsemblGenomes-Tr; EBT00001817093.
DR   EnsemblGenomes-Tr; EBT00001817094.
DR   EnsemblGenomes-Tr; EBT00001817097.
DR   EnsemblGenomes-Tr; EBT00001817099.
DR   EnsemblGenomes-Tr; EBT00001817101.
DR   EnsemblGenomes-Tr; EBT00001817103.
DR   EnsemblGenomes-Tr; EBT00001817105.
DR   EnsemblGenomes-Tr; EBT00001817107.
DR   EnsemblGenomes-Tr; EBT00001817108.
DR   EnsemblGenomes-Tr; EBT00001817112.
DR   EnsemblGenomes-Tr; EBT00001817115.
DR   EnsemblGenomes-Tr; EBT00001817116.
DR   EnsemblGenomes-Tr; EBT00001817119.
DR   EnsemblGenomes-Tr; EBT00001817122.
DR   EnsemblGenomes-Tr; EBT00001817124.
DR   EnsemblGenomes-Tr; EBT00001817127.
DR   EnsemblGenomes-Tr; EBT00001817129.
DR   EnsemblGenomes-Tr; EBT00001817131.
DR   EnsemblGenomes-Tr; EBT00001817134.
DR   EnsemblGenomes-Tr; EBT00001817137.
DR   EnsemblGenomes-Tr; EBT00001817139.
DR   EnsemblGenomes-Tr; EBT00001817141.
DR   EnsemblGenomes-Tr; EBT00001817143.
DR   EnsemblGenomes-Tr; EBT00001817144.
DR   EnsemblGenomes-Tr; EBT00001817147.
DR   EnsemblGenomes-Tr; EBT00001817149.
DR   EnsemblGenomes-Tr; EBT00001817151.
DR   EnsemblGenomes-Tr; EBT00001817153.
DR   EnsemblGenomes-Tr; EBT00001817158.
DR   EnsemblGenomes-Tr; EBT00001817161.
DR   EnsemblGenomes-Tr; EBT00001817164.
DR   EnsemblGenomes-Tr; EBT00001817166.
DR   EnsemblGenomes-Tr; EBT00001817169.
DR   EnsemblGenomes-Tr; EBT00001817172.
DR   EnsemblGenomes-Tr; EBT00001817174.
DR   EnsemblGenomes-Tr; EBT00001817177.
DR   EnsemblGenomes-Tr; EBT00001817179.
DR   EnsemblGenomes-Tr; EBT00001817181.
DR   EnsemblGenomes-Tr; EBT00001817182.
DR   EnsemblGenomes-Tr; EBT00001817185.
DR   EnsemblGenomes-Tr; EBT00001817187.
DR   EnsemblGenomes-Tr; EBT00001817190.
DR   EnsemblGenomes-Tr; EBT00001817192.
DR   EnsemblGenomes-Tr; EBT00001817194.
DR   EnsemblGenomes-Tr; EBT00001817196.
DR   EnsemblGenomes-Tr; EBT00001817199.
DR   EnsemblGenomes-Tr; EBT00001817201.
DR   EnsemblGenomes-Tr; EBT00001817203.
DR   EnsemblGenomes-Tr; EBT00001817206.
DR   EnsemblGenomes-Tr; EBT00001817208.
DR   EnsemblGenomes-Tr; EBT00001817209.
DR   EnsemblGenomes-Tr; EBT00001817210.
DR   EnsemblGenomes-Tr; EBT00001817213.
DR   EnsemblGenomes-Tr; EBT00001817214.
DR   EnsemblGenomes-Tr; EBT00001817216.
DR   EnsemblGenomes-Tr; EBT00001817218.
DR   EnsemblGenomes-Tr; EBT00001817220.
DR   EnsemblGenomes-Tr; EBT00001817222.
DR   EnsemblGenomes-Tr; EBT00001817224.
DR   EnsemblGenomes-Tr; EBT00001817226.
DR   EnsemblGenomes-Tr; EBT00001817229.
DR   EnsemblGenomes-Tr; EBT00001817232.
DR   EnsemblGenomes-Tr; EBT00001817234.
DR   EnsemblGenomes-Tr; EBT00001817238.
DR   EnsemblGenomes-Tr; EBT00001817240.
DR   EnsemblGenomes-Tr; EBT00001817241.
DR   EnsemblGenomes-Tr; EBT00001817244.
DR   EnsemblGenomes-Tr; EBT00001817246.
DR   EnsemblGenomes-Tr; EBT00001817248.
DR   EnsemblGenomes-Tr; EBT00001817249.
DR   EnsemblGenomes-Tr; EBT00001817252.
DR   EnsemblGenomes-Tr; EBT00001817255.
DR   EnsemblGenomes-Tr; EBT00001817259.
DR   EnsemblGenomes-Tr; EBT00001817260.
DR   EnsemblGenomes-Tr; EBT00001817263.
DR   EnsemblGenomes-Tr; EBT00001817265.
DR   EnsemblGenomes-Tr; EBT00001817267.
DR   EnsemblGenomes-Tr; EBT00001817268.
DR   EnsemblGenomes-Tr; EBT00001817269.
DR   EnsemblGenomes-Tr; EBT00001817270.
DR   EnsemblGenomes-Tr; EBT00001817271.
DR   EnsemblGenomes-Tr; EBT00001817272.
DR   EnsemblGenomes-Tr; EBT00001817273.
DR   EnsemblGenomes-Tr; EBT00001817274.
DR   EnsemblGenomes-Tr; EBT00001817275.
DR   EuropePMC; PMC1540077; 16885469.
DR   EuropePMC; PMC2572626; 18826580.
DR   EuropePMC; PMC2876549; 20351141.
DR   EuropePMC; PMC4340388; 25477516.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; AM167904.
DR   SILVA-SSU; AM167904.
DR   StrainInfo; 692383; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3732255
FT                   /organism="Bordetella avium 197N"
FT                   /strain="197N"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:360910"
FT   CDS_pept        1..1914
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="BAV0001"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47585"
FT                   /db_xref="GOA:Q2L2T3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2T3"
FT                   /inference="similar to sequence:UniProtKB:P17112"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF01134"
FT                   /protein_id="CAJ47585.1"
FT                   /translation="MNYPHEFDVIVVGGGHAGTEAALAAARSGAKTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRVLY
FT                   RKAIRHRLENQENLWLFQQSVEDLIVEGDKVVGAVTQIGLKFRGRAVVLTAGTFLNGLI
FT                   HVGLQHYSGGRAGDPPANSLGQRLKELKLPQGRLKTGTPPRIDGRTINYSVLEEQPGDL
FT                   DPIPVFSFMGSAALHPRQLPCWITHTNERTHDIIRGGLDRSPMYSGVIEGIGPRYCPSI
FT                   EDKIHRFADKPSHQIFLEPEGLDTHEVYPNGVSTSLPFDVQYELIHSLPGLEHAHILRP
FT                   GYAIEYDYFDPRGLKSSLETKAISGLFFAGQINGTTGYEEAAAQGLLAGINAARYASDR
FT                   EAWVPRRDEAYLGVLVDDLVTRGVTEPYRMFTSRAEYRLSLREDNADLRLTEIGRELGL
FT                   VDDIRWDVFNRKRDAIQAEVQRLQSTWVNPRLLPEEPAQALLGKAIEREYALADLLKRP
FT                   NISYEALMQARNGAGELLAGPGLLGDDVLAEQVEIQIKYAGYIERQRDEVQKHVVHEQQ
FT                   AIPADIDYDAVSSLSFEVRQKLKTHRPETVGQAARISGVTPAAVSLLLIHLKRLHYGKR
FT                   AI"
FT   misc_feature    820..864
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01280"
FT   misc_feature    1105..1176
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01281"
FT   CDS_pept        1911..2585
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="BAV0002"
FT                   /product="glucose inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47586"
FT                   /db_xref="GOA:Q2L2S3"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2S3"
FT                   /inference="similar to sequence:UniProtKB:P17113"
FT                   /inference="profile:HMMPfam:PF02527"
FT                   /protein_id="CAJ47586.1"
FT                   /translation="MSTMPEDIAAAQRLEQACQSLGLAAGAEQQEKLLRYMAQMQRWNR
FT                   TYNLTAIRDPEQMLIQHLFDSLSVVQPLVRALQAGQPAKVYDVGSGGGLPGVVLAIVQP
FT                   EWDITCVDAVEKKTAFVQQMAGTLMLPNLHAMHARIERVAPADCDVVISRAFASLHDFA
FT                   NLAGRHVRPGGTLVAMKGKVPAEEIEGLPAAWQVERIEPLQVPELDAERCLIWMRRSQG
FT                   TL"
FT   CDS_pept        2582..3379
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /gene_synonym="soj"
FT                   /locus_tag="BAV0003"
FT                   /product="chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47587"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2S1"
FT                   /inference="similar to sequence:UniProtKB:O05189"
FT                   /inference="profile:HMMPfam:PF01656"
FT                   /protein_id="CAJ47587.1"
FT                   /translation="MNNIPPTKSARVFCIANQKGGVGKTTTAINLAAGLATHQQRVLLV
FT                   DLDPQGNATMGSGIDKNSLESNLYQVLIGEATIETARVRSESGGYDVLPANRELSGAEI
FT                   DLVQMEEREQQLKLAIETVADQYDFVLIDCPPTLSLLTLNGLAAADGVIIPMQCEYFAL
FT                   EGLSDLVNTIKRVHRNINNDLRVIGLLRVMFDPRMTLQQQVSAQLEAHFGDKVFKTVVP
FT                   RNVRLAEAPSYGMPGVVYDRASRGAQAYISFGAEMIERVKEMQ"
FT   CDS_pept        3448..4353
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="BAV0004"
FT                   /product="chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47588"
FT                   /db_xref="GOA:Q2L2R6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2R6"
FT                   /inference="similar to sequence:UniProtKB:O05190"
FT                   /inference="profile:HMMPfam:PF02195"
FT                   /protein_id="CAJ47588.1"
FT                   /translation="MATKKPKGLGRGLDALLGADVPAIDNIGKAVEPESALPTTLPIDR
FT                   LRAGKYQPRTRMDEGALNELAESVRTQGIMQPILVRGLAIPGQYEIIAGERRFRAAQLA
FT                   GLKEVPVLVRDVADENAAIMALIENIQREDLNPLEEAQGVRRLLDEFGLTHEQAAQAIG
FT                   RSRSATSNLLRLLNLAVPVQTMLLAGDIDMGHARALLAVDAATQIQLANLIIARRLSVR
FT                   EAEKIVAKTVKEGEATSPKKKGPSRDVTRLEEALSDHLGTRVVLKVGARDKGQLVIDFH
FT                   GWDHLNSLLERQGLAGVIDA"
FT   CDS_pept        4346..5353
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /locus_tag="BAV0005"
FT                   /product="L-asparaginase II"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47589"
FT                   /db_xref="GOA:Q2L2R3"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2R3"
FT                   /inference="similar to sequence:UniProtKB:P00805"
FT                   /inference="profile:HMMPfam:PF00710"
FT                   /protein_id="CAJ47589.1"
FT                   /translation="MPDRALARVALLATGGTIAGAQDSAESAAYRAGALSIDALLQAVP
FT                   GLARAANVQAEQLANVGSQNMTYDVWRALAARVAELCADASIDGIVITHGTDTIEETAY
FT                   FLSLVLPFDKPVVLVGAMRPSTALSADGPRNLLNAVTIAAHPQSRGRGPLVTMNDDIHY
FT                   ARSVQKTACGGVAAFTSPNSGRAGWVRGGQVGFYGTSNIASAAAKQVFSMPLPPVRSWP
FT                   RVDIAYACVDMDGALIDFIAAHAQGIILAGVGDGNATDDAIAAIDRAVAKGVVVVRSTR
FT                   TGSGSVMRNIEINDDGHGTIAAGELNPQKARVLLTLGLMRSHEPVALQRLFDLY"
FT   sig_peptide     4346..>4406
FT                   /gene="ansB"
FT                   /locus_tag="BAV0005"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    4376..4402
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00144"
FT   misc_feature    4610..4642
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00917"
FT   tRNA            5439..5522
FT                   /gene="tRNA-Tyr (GTA)"
FT                   /product="transfer RNA-Tyr (GTA)"
FT                   /anticodon="(pos:5473..5475,aa:Tyr)"
FT                   /inference="profile:tRNAscan-SE"
FT   tRNA            5642..5712
FT                   /gene="tRNA-Gly (TCC)"
FT                   /product="transfer RNA-Gly (TCC)"
FT                   /anticodon="(pos:5674..5676,aa:Gly)"
FT                   /inference="profile:tRNAscan-SE"
FT   tRNA            5719..5790
FT                   /gene="tRNA-Thr (GGT)"
FT                   /product="transfer RNA-Thr (GGT)"
FT                   /anticodon="(pos:5751..5753,aa:Thr)"
FT                   /inference="profile:tRNAscan-SE"
FT   CDS_pept        5849..7039
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /gene_synonym="tufA"
FT                   /gene_synonym="tufB"
FT                   /locus_tag="BAV0006"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47590"
FT                   /db_xref="GOA:Q2L2G6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2G6"
FT                   /inference="similar to sequence:UniProtKB:P02990"
FT                   /inference="profile:HMMPfam:PF00009"
FT                   /inference="profile:HMMPfam:PF03144"
FT                   /inference="profile:HMMPfam:PF03143"
FT                   /protein_id="CAJ47590.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSTKFGGEAR
FT                   GYDQIDAAPEEKARGITINTAHVEYETESRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIVKGSAKLALEGDKGELGEQAILSLAAALDTYIPTPERAVDGSFLMPVEDVFS
FT                   ISGRGTVVTGRIERGVVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLAKPGSINPHTDFTAEVYILSKEEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGTIDLPQDKEMVLPGDNVTMTVKLLAPIAMEEGLRFAIREGGRTVGAGVVAKILK"
FT   misc_feature    5903..5926
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    5999..6046
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00301"
FT   tRNA            7199..7271
FT                   /gene="tRNA-Trp (CCA)"
FT                   /product="transfer RNA-Trp (CCA)"
FT                   /anticodon="(pos:7232..7234,aa:Trp)"
FT                   /inference="profile:tRNAscan-SE"
FT   CDS_pept        7330..7710
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /gene_synonym="prlG"
FT                   /locus_tag="BAV0007"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47591"
FT                   /db_xref="GOA:Q2L2P8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2P8"
FT                   /inference="similar to sequence:UniProtKB:Q9ZNE7"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00584"
FT                   /protein_id="CAJ47591.1"
FT                   /translation="MSNTSVETITSTADRIKLGLAVLVVIAGIVGFSVLSAQPIAARIG
FT                   VFVGGLVIAAIIVWFSEPGRRLISYAQESYNEVKRVSWPTRKETVQMTGIVFAFVAVMG
FT                   IFMWVLDKGIEWILYGLLLGWK"
FT   sig_peptide     7330..>7435
FT                   /gene="secE"
FT                   /gene_synonym="prlG"
FT                   /locus_tag="BAV0007"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        7719..8252
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BAV0008"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47592"
FT                   /db_xref="GOA:Q2L2P3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2P3"
FT                   /inference="similar to sequence:UniProtKB:P16921"
FT                   /inference="profile:HMMPfam:PF02357"
FT                   /inference="profile:HMMPfam:PF00467"
FT                   /protein_id="CAJ47592.1"
FT                   /translation="MSKRWYVVHVYSGMEKSVQKALNERIERAELQTSFGRILVPSEEV
FT                   VEVKGGQKSITERRIFPGYVLVEMDLTDETWHLVKNTNRVTGFLGGSGNRPTPISEREV
FT                   EKILSQMEEGVEKPRPKILFEVGEMVRVKEGPFADFNGNVEEVNYEKSKVRVSVTIFGR
FT                   ATPVELDFSQVEKT"
FT   misc_feature    8196..8225
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01014"
FT   CDS_pept        8309..8740
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /gene_synonym="relC"
FT                   /locus_tag="BAV0009"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47593"
FT                   /db_xref="GOA:Q2L2N9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2N9"
FT                   /inference="similar to sequence:UniProtKB:P02409"
FT                   /inference="profile:HMMPfam:PF03946"
FT                   /inference="profile:HMMPfam:PF00298"
FT                   /protein_id="CAJ47593.1"
FT                   /translation="MAKKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAK
FT                   TQGMEPGLPIPVVITAFADKSFTFIMKTPPATVLIKKAAGVQKGSPKPHTDKVGTLTRA
FT                   QAEEIAKTKQPDLTAADLDAAVRTIAGSARSMGITVEGI"
FT   misc_feature    8687..8734
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00359"
FT   CDS_pept        8743..9438
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BAV0010"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47594"
FT                   /db_xref="GOA:Q2L2N3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2N3"
FT                   /inference="similar to sequence:UniProtKB:P02384"
FT                   /inference="profile:HMMPfam:PF00687"
FT                   /protein_id="CAJ47594.1"
FT                   /translation="MAKLSKRAAAIAQKIDRTKLYPVAEALTLVKETATAKFDESIDVA
FT                   VQLGIDPKKSDQLVRGSVVLPAGTGKSVRVAVFAQGEKAEAARAAGAEVVGLDDLAEQI
FT                   KAGQMDFDVVIASPDTMRVVGALGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQY
FT                   RTDKAGIIHATIGRASFGIEQLQTNLAALVDALQKARPAAAKGIYLRKIAVSSTMGGGA
FT                   RVEIASLSA"
FT   misc_feature    9103..9159
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01199"
FT   CDS_pept        <9682..10206
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BAV0011"
FT                   /product="50S ribosomal protein L10"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47595"
FT                   /db_xref="GOA:Q2L2M9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2M9"
FT                   /inference="similar to sequence:UniProtKB:P02408"
FT                   /inference="profile:HMMPfam:PF00466"
FT                   /protein_id="CAJ47595.1"
FT                   /translation="VSLNRQEKAVVIEEVSAEVAKAQSIVIAEYRGLDVASVTVLRKTA
FT                   RESGVYLRVLKNSLARRAVAGTAFEPLAEQLTGPLIYGISADPVAAAKVLAGFAKSNDK
FT                   LVIKAGSLPNNLLNQEGVKALATMPSREELLSKLLGTMQAPIAQFVRTLNEVPTKFARG
FT                   LAAVRDQKAAA"
FT   CDS_pept        10291..10671
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BAV0012"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47596"
FT                   /db_xref="GOA:Q2L2M6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2M6"
FT                   /inference="similar to sequence:UniProtKB:P02392"
FT                   /inference="profile:HMMPfam:PF00542"
FT                   /protein_id="CAJ47596.1"
FT                   /translation="MALNKAEILDAIAGMTVLELSELIKEMEEKFGVSAAAAAVAVAAP
FT                   AAGGAAAAAEEQTEFTVVLVEAGANKVSVIKAVRELTGLGLKEAKDLVDGAPKPVKEAL
FT                   PKADAEAAKKKLEEAGAKVEVK"
FT   CDS_pept        10808..14944
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /gene_synonym="groN"
FT                   /gene_synonym="nitB"
FT                   /gene_synonym="rif"
FT                   /gene_synonym="ron"
FT                   /gene_synonym="stl"
FT                   /gene_synonym="stv"
FT                   /gene_synonym="tabD"
FT                   /locus_tag="BAV0013"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47597"
FT                   /db_xref="GOA:Q2L2M3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2M3"
FT                   /inference="similar to sequence:UniProtKB:P00575"
FT                   /inference="profile:HMMPfam:PF04563"
FT                   /inference="profile:HMMPfam:PF04561"
FT                   /inference="profile:HMMPfam:PF04565"
FT                   /inference="profile:HMMPfam:PF00562"
FT                   /inference="profile:HMMPfam:PF04560"
FT                   /protein_id="CAJ47597.1"
FT                   /translation="MQPRVGVLMPYSYTEKKRIRKSFAKREDVQNVPFLLATQLQSYLT
FT                   FLQAETATADRVNEGLQAAFTSIFPIVSHNGMARLEFVSYALGEPVFDVKECQQRGLTY
FT                   ASPLRAKVRLVLLDREVSKPTIKEVKEQEVYMGEIPLMTTTGSFVINGTERVIVSQLHR
FT                   SPGVFFEHDRGKTHSSGKLLFSARVIPYRGSWLDFEFDPKDVLFFRVDRRRKMPVTILL
FT                   KAIGMTPESILAHFFDFDNFELKSEGAMMEFVPERWKGEMARFDITDRAGKVIVEKDKR
FT                   INAKHLRDLANGGIQRISVPEDFLYGRVLAKNVVDPDTGEVIALANDEITESVLDAMRA
FT                   AKVLDLQTLYTNDLDRGPYISQTLRTDETVDQTAARVAIYRMMRPGEPPTEEAVEALFQ
FT                   RLFYSEETYDLSRVGRMKVNSRLGRGDDANGPMTLTDEDILETIKVLVELRNGRGQIDD
FT                   IDHLGNRRVRCVGELAENQFRAGLVRVERAVKERLGQAETENLMPHDLINSKPISAAIK
FT                   EFFGSSQLSQFMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIE
FT                   TPEGPNIGLINSMALYARLNEYGFLETPYRKIIDGRVSDQIDYLSAIEESHYVIAQANA
FT                   ALDAEGRFVDDLVACREAGETMLTSPVNVHYMDVAPSQIVSVAASLIPFLEHDDANRAL
FT                   MGANMQRQAVPCLRPEKPLVGTGIERTVAVDSGTTVQALRGGLVDHVDAERVVIRVNDE
FT                   ENVAGEVGVDIYNLIKYTRSNQNTNINQRPIVKRGDRVAKGDVLADGASTDLGELALGQ
FT                   NMLIAFMPWNGYNFEDSILISERVVADDRYTSVHIEELTVVARDTKLGPEEITRDISNL
FT                   AETQLNRLDESGIVYIGAEVSADDVLVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDT
FT                   SLRVPSGMTGTVIDVQVFTREGIVRDKRAQSIIDDELRRYRQDLNDQLRIVENDQFDRI
FT                   EKLLVGKTVNGGPRKLAKGATVTKAYLADLDRWQWFDIRLSDEPHAVVLEQAKESLEQK
FT                   RHQFDLAFEEKRKKLTQGDELPPGVLKMIKVYLAVKRRLQPGDKMAGRHGNKGVVSRIT
FT                   PVEDMPHMADGTTADIVLNPLGVPSRMNVGQVLEVHLGWAAKGVGQRIADMLQDERTAQ
FT                   VKNIRAYLEKVYNTTGTGARISELSDEEVIELANNLKRGVPFATPVFDGATEDEITMML
FT                   ELAYPDDVAKRMQLTPSRAQAWLFDGRTGEKFERPVTIGYMHYLKLHHLVDDKMHARST
FT                   GPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEMLTVKSDDITGRTKVYEN
FT                   IVKGDHVIDAGMPESFNVLVKEIRSLALDMDLERN"
FT   misc_feature    14075..14113
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01166"
FT   CDS_pept        14944..19185
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /gene_synonym="tabB"
FT                   /locus_tag="BAV0014"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47598"
FT                   /db_xref="GOA:Q2L2L3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2L3"
FT                   /inference="similar to sequence:UniProtKB:P00577"
FT                   /inference="profile:HMMPfam:PF04997"
FT                   /inference="profile:HMMPfam:PF00623"
FT                   /inference="profile:HMMPfam:PF04983"
FT                   /inference="profile:HMMPfam:PF05000"
FT                   /inference="profile:HMMPfam:PF04998"
FT                   /protein_id="CAJ47598.1"
FT                   /translation="MKALLDLFKQVSQDEQFDAIKIGLASPEKIRSWSYGEVRKPETIN
FT                   YRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTVAKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAWCVIEPGMTPLKRGQIMSDD
FT                   DFLAKTEEYGDDFRALMGAEAVRELLRTIDIDREVETLRGELKATSSEAKIKKISKRLK
FT                   VLEGFQKSGIKPDWMVMEVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLELKAPEIILRNEKRMLQEAVDSLLDNGRRGKAMTGANKRQLKSLADMIKGKSGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFIFNRLEMMGLATTIKAAKK
FT                   LVESQEPVVWDILEEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHVPLSLEAQLEARTLMLASNNVLFPANGEPSIVPSQDIVLGLYYTTRER
FT                   INGRGEGIFFADVAEVQRAYDNGEVELQTRITVRLKEHERDEQGEWQPVIRRHETTVGR
FT                   ALLSEILPRGLPFTVLNKALKKKEISRLINQSFRRCGLRDTVIFADKLMQSGFRLATRG
FT                   GISIAMEDMLIPAAKEVILAEAGREVKEIDKQYSSGLVTSQERYNNVVDIWGKAGDKVG
FT                   KAMMEQLATEPVVNRHGENVRQESFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDLVITEV
FT                   DCGTSHGYSMKALVEGGEVIEPLRDRILGRVAAVDIVNPDTQETEITAGTLLDEDLVDL
FT                   IDRVGVDEVKVRTPLTCETRHGLCAHCYGRDLGRGSHVNVGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRSALASAVETKSNGTVGFASTMRYVTNAKGERVAISRSGELAIYDDN
FT                   GRERERHKIPYGATVLVGDGDAVKAGTRLATWDPLTRPIVSEYGGAVRFENIEEGVTVA
FT                   KQVDEVTGLSTLVVITPKTRGGKVVMRPQIKLVNDNGEDVRIAGTDHAVNISFPVGALI
FT                   TVRDGQQVAVGEVLARIPQESQKTRDITGGLPRVAELFEARSPKDAGMLAEVTGTVSFG
FT                   KDTKGKQRLVITDLEGISHEFLIPKEKQVLVHDGQVVNKGEMIVDGPADPHDILRLQGI
FT                   EKLATYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRVNITDPGDADFIPGEQVERSEL
FT                   LNENDRVIAEDKRPAQYDNVLLGITKASLSTDSFISAASFQETTRVLTEAAIMGKRDDL
FT                   RGLKENVIVGRLIPAGTGLAYHLARKDKEALEAAEREAARQQANPFEEMPVAADIEVDV
FT                   SLPFEGETPAE"
FT   misc_feature    15925..15948
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        20028..21122
FT                   /transl_table=11
FT                   /locus_tag="BAV0015"
FT                   /product="putative membrane protein"
FT                   /note="Weakly similar to Chromobacterium violaceum probable
FT                   serine/threonine kinase SWALL:Q7NRD4 (EMBL:AE016923)"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47599"
FT                   /db_xref="GOA:Q2L2J3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2J3"
FT                   /inference="similar to DNA sequence:INSDC:AE016923.1"
FT                   /protein_id="CAJ47599.1"
FT                   /translation="MSRSPFAGAAPLAHRPLNAIAATAGGGVPEARIKRLLKELIAPLQ
FT                   ALHDRGRICGDVSTSSIGLDEGGRAHLMAVDTQPRQSESPGPVVVAGFAPYEFYVQSMQ
FT                   WPRGPWSDIYSLCAVVHSLVTGTLPAPSADRFEQDNYVPLAQRELPRYSQEFLRSIDAG
FT                   LALCPQDRPQSMADFAASLAFMPAIDQAALVTIPPIELHAEEPRMLPLLHVASRRGSLA
FT                   LVCLSLLAMLAMAVYCWDRLANAAPPVIAASQTVPVAFVPKKSPVLLASAAQLLVPQAA
FT                   AGPAPGLATEVKADNQAGIAVPLNIQPWGEVWINGVNRGVSPPLRELKLVPGKYSVMVR
FT                   HGDWQPYMAALEVKAGAAISHIFR"
FT   sig_peptide     20028..>20088
FT                   /locus_tag="BAV0015"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(21129..23432)
FT                   /transl_table=11
FT                   /locus_tag="BAV0016"
FT                   /product="probable two-component sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47600"
FT                   /db_xref="GOA:Q2L2J1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR017181"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2J1"
FT                   /inference="similar to DNA sequence:INSDC:AE004820.1"
FT                   /inference="profile:HMMPfam:PF02518"
FT                   /inference="profile:HMMPfam:PF00512"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF05226"
FT                   /protein_id="CAJ47600.1"
FT                   /translation="MAADPRAFRPRSGFFLTALLTLFAAFLGAFSGLGRIDQTLYDRAI
FT                   SLIGRPAQTDIVLVTIDDDSIAKMGRWPWKRQVHAALLDQLHEARAVGLDLILSEPDRN
FT                   DPSADEALAKAMRAHGRVVLPLVLDDLNTPTAAQTPEPKLADAAAALGFINIPVDADGV
FT                   VRHSAWERTVGDERWKHFSLALLQAANEPSDHFMGKAQDKGETLIPFTGPPGHIKMVPY
FT                   LDVLEGRLAPEWFRDKYVIVGSWATGLTDTFPTPVSHRSSGMAGMEILADMLQAERQHW
FT                   SLRTASALENMLASALPVLLLCLVMRHGSPKLSLALNLILLLLVLPGAVLMLRFGQLWF
FT                   PPSAALFSLALCYPLWSWRSQEAVLRYMDSELKRLRHEYAPVLDGARPAASLLGRRSVE
FT                   DRLSQFRRALALVRNLRQFLTDGLNGMPDATLVFDQAGRLQFRNRAAVFFFRRIRTRPP
FT                   HIGQQASDVLATLLPTNAMLEAITASIQEAAGKPPRSGWSADLETRVQGGRDVIFKCAP
FT                   IHSGEGEFVGTILTLIDISTIRHAERQREEMLRFISHDMRAPQNSILALVALHEKEAHS
FT                   QDQTETLQRIAQLATRTLHLVDGFVQLTRAESMKINKVPLDLVDLLREVCDDFWAVSQT
FT                   RHITVVLDDALPSAFVMGDQALLRRALANLLDNAIKYSPRDSRIQCSVGQDDLYWVIRI
FT                   QDEGPGIAAEDMERVFQPFSRMGAAIDADAGGAGLGLAFVRTVAERHQGRAWVTSAPGQ
FT                   GSTFLFKLPRSEEH"
FT   sig_peptide     complement(23336..23432)
FT                   /locus_tag="BAV0016"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(23444..24547)
FT                   /transl_table=11
FT                   /locus_tag="BAV0017"
FT                   /product="putative peptidoglycan binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47601"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR016930"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2I8"
FT                   /inference="similar to DNA sequence:INSDC:AE005994.1"
FT                   /inference="profile:HMMPfam:PF01476"
FT                   /protein_id="CAJ47601.1"
FT                   /translation="MHRSFRRAPLMLSVALATTAVHAQPAGTLNEDFIHRVRPGDTLSG
FT                   LAASYTGKESHWQVLQQLNAIGDTHALPVARELRIPLAMIPEVASSAQVTSLTGKAGLD
FT                   GQELKEGSAVSEGGLLTTGPNSFMTLRLSDDSEIALPPNSAVSLQRLRRFKHMPITDTV
FT                   LSVERGAMESKVAPDGGGVGRFEIRSPVAVTGVRGTRFRVEASSNGASQAVLEGNVRVQ
FT                   AHAPGQKPEAPITVHQGQGARIGSDGSVLGLRPLLPAPALGTPRRAEGGWTALVTPVAG
FT                   AQAYNVRVSRDSDGMQVIAAKQYNTPDIRFAAPGPGTYYVNVSAIDEFGLAGYEARQTF
FT                   EGTLALLSTDDKPVLSGTGEIIALQTY"
FT   sig_peptide     complement(<24475..24547)
FT                   /locus_tag="BAV0017"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(24586..25305)
FT                   /transl_table=11
FT                   /locus_tag="BAV0018"
FT                   /product="probable two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47602"
FT                   /db_xref="GOA:Q2L2I4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2I4"
FT                   /inference="similar to sequence:UniProtKB:Q11156"
FT                   /inference="profile:HMMPfam:PF00486"
FT                   /inference="profile:HMMPfam:PF00072"
FT                   /protein_id="CAJ47602.1"
FT                   /translation="MTGPMKIASLEDDLDQARHIQQLLQQAHYECRSFQQSQDLLAAMR
FT                   VESFDLILVDWQLPDMDGDEVVRHLRARYGIGLPIIFLTSRNQEEDLVEGLNAGADDYI
FT                   VKPLRAAELLARVAALLRRTQATASLENPAFDLGPYHVDPARRVIELHGEAIPLAPKEY
FT                   ELALLFLRNIGRLLSRDLLAESVWNREIPPTSRTLDTHLSNIRQKLQLRPENGLRLTSS
FT                   YALGYRLETVAGKETPN"
FT   CDS_pept        25555..26268
FT                   /transl_table=11
FT                   /locus_tag="BAV0019"
FT                   /product="Two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47603"
FT                   /db_xref="GOA:Q2L2I1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2I1"
FT                   /inference="similar to DNA sequence:INSDC:D89075.1"
FT                   /inference="profile:HMMPfam:PF00486"
FT                   /protein_id="CAJ47603.1"
FT                   /translation="MKHLSTLIMVPDSASRARIIAVLLQAGISTKGCSTPLELFGMLNE
FT                   EHYDIVVLDCSDLGELGFSLIARLRGSAELGIVVKASEMPMEMRLRCLQSGADAALTEP
FT                   LDDRELAGVLLALARRLPAWREDASDSLAGTLSGPGKWELRDQDWTLAAPLGATLSLSV
FT                   NERSIVRVLLQAGGNAVSRELLAEELSADGASSRMTGTRSIDVVISRLRRKAELAGLNL
FT                   PIRTVYGSGYLFAQV"
FT   CDS_pept        26703..27080
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BAV0020"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47604"
FT                   /db_xref="GOA:Q2L2H8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2H8"
FT                   /inference="similar to sequence:UniProtKB:P02367"
FT                   /inference="profile:HMMPfam:PF00164"
FT                   /protein_id="CAJ47604.1"
FT                   /translation="MPTISQLVRKPREVSIIKSKSPALENCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGYEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
FT                   QGVKDRKQARSKYGAKRPKKA"
FT   misc_feature    26829..26852
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00055"
FT   CDS_pept        27249..27719
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BAV0021"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47605"
FT                   /db_xref="GOA:Q2L2H3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2H3"
FT                   /inference="similar to sequence:UniProtKB:P02359"
FT                   /inference="profile:HMMPfam:PF00177"
FT                   /protein_id="CAJ47605.1"
FT                   /translation="MPRRREVPKREILPDPKFGSVELAKFMNVVMLDGKKAVAERIVYG
FT                   ALAQVQTKTGKEPIEVFTLAINNIKPIVEVKSRRVGGANYQVPVEVRPVRRLALAMRWL
FT                   REAAKKRGEKSMDLRLAGELIDASEGRGAAMKKREDTHKMAEANKAFSHFRW"
FT   misc_feature    27306..27386
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00052"
FT   CDS_pept        27738..29840
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /gene_synonym="fus"
FT                   /gene_synonym="far1"
FT                   /locus_tag="BAV0022"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47606"
FT                   /db_xref="GOA:Q2L2H1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2H1"
FT                   /inference="similar to sequence:UniProtKB:P02996"
FT                   /inference="profile:HMMPfam:PF00009"
FT                   /inference="profile:HMMPfam:PF03144"
FT                   /inference="profile:HMMPfam:PF03764"
FT                   /inference="profile:HMMPfam:PF00679"
FT                   /protein_id="CAJ47606.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWRGMAGNFPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYGVPRLAFVNKMDRTGANFFKVYEQLRTRLR
FT                   ANPVPIVIPIGAEDTFTGVIDLVKMKAIIWDEASQGTKFEYADIPAELQASAEEWREKL
FT                   VEAAAESSEELMNKYLETGTLEEAEINAAIRQRTIAGEIHPMLCGTAFKNKGVQRMLDA
FT                   VIEYLPSPIDIPPVDGTDDDGNEVQRRADDSEKFSALAFKLMSDPFVGQLTFVRVYSGV
FT                   LKSGDTVYNPIKGKKERIGRILQMHANNREEIKEVLAGDIAAVVGLKDVTTGETLCDID
FT                   AHVTLERMEFPEPVISQAVEPKSKADQEKMGLALSRLAQEDPSFRVRSDEESGQTIISG
FT                   MGELHLEILVDRMKREFGVEANVGKPQVAYRETIRKTCDEVEGKFVKQSGGRGQYGHVV
FT                   LKVEPLAPGGGYEFVDAIKGGVVPREYIPAVDKGIQETLPAGILAGYPVVDVKVTLFFG
FT                   SYHDVDSNENAFKMAGSMAFKEGMRKASPVLLEPMMAVEVETPEDYAGGVMGDLSSRRG
FT                   MVQGMDDMVGGGKIIKAEVPLAEMFGYATNLRSLTQGRATYTMEFKHYSEAPKNVADEV
FT                   IAARGK"
FT   misc_feature    27786..27809
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    27888..27935
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00301"
FT   CDS_pept        29917..31107
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /gene_synonym="tufA"
FT                   /gene_synonym="tufB"
FT                   /locus_tag="BAV0023"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47607"
FT                   /db_xref="GOA:Q2L2G6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2G6"
FT                   /inference="similar to sequence:UniProtKB:P02990"
FT                   /inference="profile:HMMPfam:PF00009"
FT                   /inference="profile:HMMPfam:PF03144"
FT                   /inference="profile:HMMPfam:PF03143"
FT                   /protein_id="CAJ47607.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSTKFGGEAR
FT                   GYDQIDAAPEEKARGITINTAHVEYETESRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIVKGSAKLALEGDKGELGEQAILSLAAALDTYIPTPERAVDGSFLMPVEDVFS
FT                   ISGRGTVVTGRIERGVVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLAKPGSINPHTDFTAEVYILSKEEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGTIDLPQDKEMVLPGDNVTMTVKLLAPIAMEEGLRFAIREGGRTVGAGVVAKILK"
FT   misc_feature    29971..29994
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    30067..30114
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00301"
FT   CDS_pept        31171..31482
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /gene_synonym="nusE"
FT                   /locus_tag="BAV0024"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47608"
FT                   /db_xref="GOA:Q2L2G3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2G3"
FT                   /inference="similar to sequence:UniProtKB:P02364"
FT                   /inference="profile:HMMPfam:PF00338"
FT                   /protein_id="CAJ47608.1"
FT                   /translation="MKNQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAVVRGPVPLPTR
FT                   IRRYDVLRSPHVNKTSRDQFEIRTHQRLMDIVDPTDKTVDALMRLDLPAGVDVEIALQ"
FT   misc_feature    31255..31302
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00361"
FT   CDS_pept        31950..32651
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BAV0025"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47609"
FT                   /db_xref="GOA:Q2L2G0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2G0"
FT                   /inference="similar to sequence:UniProtKB:P60438"
FT                   /inference="profile:HMMPfam:PF00297"
FT                   /protein_id="CAJ47609.1"
FT                   /translation="MEKTMSNTTPTPAAHRLGLVGRKVGMTRIFTEEGESIPVTVLDVS
FT                   NNRVTQVKSLESDGYAAIQVTYGNRRASRVTKAEAGHFAKAGAEAGSILKEFRLDPTRA
FT                   AEFTAGSVIAVESVFEAGQQVDVTGTTIGKGFAGTIKRHNFGSQRASHGNSRSHRVPGS
FT                   IGQAQDPGRIFPGKRMAGHLGDVTRTVQNLDVVRVDVERGLLLVKGAVPGHAGGDVIVR
FT                   PAVKAPAKKGA"
FT   misc_feature    32304..32375
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00474"
FT   CDS_pept        32656..33273
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BAV0026"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47610"
FT                   /db_xref="GOA:Q2L2F7"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2F7"
FT                   /inference="similar to sequence:UniProtKB:P60723"
FT                   /inference="profile:HMMPfam:PF00573"
FT                   /protein_id="CAJ47610.1"
FT                   /translation="MDLKLLNDQGQAATFSAPDTIFGRDFNEALVHQIVVAYQANARSG
FT                   NRAQKDRAEVKHSTKKPWRQKGTGRARAGMTSSPLWRGGGRAFPNSPEENFSQKVNKKM
FT                   YRAGIRSILSQLAREDRIAVVDTFSLESPKTKLAAEKLKALGLDSVLIITDTVDENVYL
FT                   ATRNLPHVAVVEPRYADPLSLIHYKKVLITKPAIAQLEEMLG"
FT   CDS_pept        33270..33566
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BAV0027"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47611"
FT                   /db_xref="GOA:Q2L2F4"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2F4"
FT                   /inference="similar to sequence:UniProtKB:P02424"
FT                   /inference="profile:HMMPfam:PF00276"
FT                   /protein_id="CAJ47611.1"
FT                   /translation="MNAERLMQVLLAPVVTEKATFVAEKHQQIAFRVVADATKPEIKAA
FT                   VELLFKVQVEAVQVLNRKGKVKRFGRFVGRRRNERKAYVSLKEGQEIDFAEVK"
FT   CDS_pept        33567..34394
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BAV0028"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47612"
FT                   /db_xref="GOA:Q2L2F1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2F1"
FT                   /inference="similar to sequence:UniProtKB:P60422"
FT                   /inference="profile:HMMPfam:PF00181"
FT                   /inference="profile:HMMPfam:PF03947"
FT                   /protein_id="CAJ47612.1"
FT                   /translation="MALVKVKPTSAGRRGMVKVVSPNLHKGAPHAALLEKKIRGSGRNN
FT                   NGHITIRHRGGGHKQHYRVVDFRRNKDGIPAKVERLEYDPNRTAHIALLCYADGERRYI
FT                   IAPRGLEVGATLISGIEAPIRAGNTLPIRNIPVGTTIHCIEMIPGKGAQMARSAGASAV
FT                   LMAREGTYAQVRLRSGEVRRVHIECRATIGEVGNEEHSLRQIGKAGAMRWRGIRPTVRG
FT                   VAMNPIDHPHGGGEGRTGEAREPVSPWGTPSKGYKTRRNKRTNNMIVQRRKRK"
FT   misc_feature    34218..34253
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00467"
FT   CDS_pept        34407..34682
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BAV0029"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47613"
FT                   /db_xref="GOA:Q2L2E7"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2E7"
FT                   /inference="similar to sequence:UniProtKB:P02375"
FT                   /inference="profile:HMMPfam:PF00203"
FT                   /protein_id="CAJ47613.1"
FT                   /translation="MSRSIKKGPFVDAHLTKKVEAAVAGKDKKPIKTWSRRSTILPEFI
FT                   GLTIAVHNGRQHVPVYINENMVGHKLGEFALTRTFKGHAADKKAKR"
FT   misc_feature    34563..34637
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00323"
FT   CDS_pept        34686..35015
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BAV0030"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47614"
FT                   /db_xref="GOA:Q2L2E3"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2E3"
FT                   /inference="similar to sequence:UniProtKB:P61175"
FT                   /inference="profile:HMMPfam:PF00237"
FT                   /protein_id="CAJ47614.1"
FT                   /translation="METTAIIRGVHISAQKTRLVADLIRGKSVAQALNILTFSPKKAAV
FT                   ILKKAVESAIANAEHNDGADIDELKVTTIFVDKAQSMKRFSARAKGRGNRIEKQTCHIT
FT                   VKVGA"
FT   misc_feature    34746..34769
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    34932..35006
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00464"
FT   CDS_pept        35025..35819
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BAV0031"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47615"
FT                   /db_xref="GOA:Q2L2C0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2C0"
FT                   /inference="similar to sequence:UniProtKB:P02352"
FT                   /inference="profile:HMMPfam:PF00417"
FT                   /inference="profile:HMMPfam:PF07650"
FT                   /inference="profile:HMMPfam:PF00189"
FT                   /protein_id="CAJ47615.1"
FT                   /translation="MGQKIHPTGFRLAVTRNWSSRWYADDKDFGGMLAEDIRVREYLKK
FT                   KLKSASVGRVVIERPAKNARITVYSARPGVVIGKRGEDIESLKADLQRLMGVPVHVNIE
FT                   EIRKPETDAQLIADSISQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIA
FT                   RTEWYREGRVPLHTLKANIDYGTSEAHTTYGVIGIKVWVYKGDMLANGELPVETAAPRE
FT                   EERRPRRAPRGDRPDGARNGRPGGGRGRAPRKADAAPAPEGE"
FT   misc_feature    35511..35615
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00548"
FT   CDS_pept        35822..36238
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BAV0032"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47616"
FT                   /db_xref="GOA:Q2L2B8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2B8"
FT                   /inference="similar to sequence:UniProtKB:P02414"
FT                   /inference="profile:HMMPfam:PF00252"
FT                   /protein_id="CAJ47616.1"
FT                   /translation="MLQPSRRKYRKEQKGRNTGLATRGAQVSFGEFGLKATGRGRLTAR
FT                   QIEAARRAINRHIKRGGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYWVAEIQPGKVLY
FT                   EMEGVSEELAREAFRLAAAKLPISTTFVARHIGA"
FT   misc_feature    35996..36031
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00586"
FT   misc_feature    36065..36100
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00701"
FT   CDS_pept        36250..36441
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BAV0033"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47617"
FT                   /db_xref="GOA:Q2L2B5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2B5"
FT                   /inference="similar to sequence:UniProtKB:P02429"
FT                   /inference="profile:HMMPfam:PF00831"
FT                   /protein_id="CAJ47617.1"
FT                   /translation="MKASELRSKDAAELGKELESLLKAQFGLRMQKATQQLANTSQLRN
FT                   VRRDIARVRTLLTQKAGK"
FT   misc_feature    36364..36408
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00579"
FT   CDS_pept        36444..36725
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BAV0034"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47618"
FT                   /db_xref="GOA:Q2L2B2"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L2B2"
FT                   /inference="similar to sequence:UniProtKB:P02373"
FT                   /inference="profile:HMMPfam:PF00366"
FT                   /protein_id="CAJ47618.1"
FT                   /translation="MSETQNTQVTKRQRTLVGKVVSNKMDKTVVVLVERRVKHPIYGKI
FT                   VMRSAKYKAHDESNQYNEGDTVEIAEGRPISRSKAWRVVRLVEAARII"
FT   misc_feature    36633..36671
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00056"
FT   CDS_pept        37375..37959
FT                   /transl_table=11
FT                   /locus_tag="BAV0035"
FT                   /product="putative dioxygenase"
FT                   /note="Weakly similar to Rhodococcus globerulus
FT                   biphenyl-2,3-diol 1,2-dioxygenase ii bphc2 SWALL:BHC2_RHOGO
FT                   (SWALL:P47232)"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47619"
FT                   /db_xref="GOA:Q2L2A9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2A9"
FT                   /inference="similar to sequence:UniProtKB:P47232"
FT                   /inference="profile:HMMPfam:PF00903"
FT                   /protein_id="CAJ47619.1"
FT                   /translation="MMVFYQMIGTKTLEVKFSHFGFHVYDLEAMADFYKAVLQFTETDR
FT                   GALGAIQLIFLSRDPDTHHQLALLTGRPEDVHTFNPINQISFQVPDLANLRQVHERALA
FT                   AGANDMQATTHGNAVSLYFRDPEGNRIEVFMDTPWYCYQPLREAIDFDTSDEHVMAQAE
FT                   AIAKRTPRFMPREEWRAKIQARMDRDQGRTD"
FT   misc_feature    37711..37770
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00082"
FT   CDS_pept        38013..38861
FT                   /transl_table=11
FT                   /locus_tag="BAV0036"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47620"
FT                   /db_xref="GOA:Q2L2A6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2A6"
FT                   /inference="similar to DNA sequence:INSDC:AF169302.2"
FT                   /inference="profile:HMMPfam:PF01557"
FT                   /protein_id="CAJ47620.1"
FT                   /translation="MKLISFEHQGRATYGAVVGNDVWDLGQTFGEKAPDLKSLIACNMQ
FT                   ADAAQVLASQAASLKFDQLTLLPVVPNPGKILCIGLNYGEHVRETGKTITESPVIFMRL
FT                   NESQVAHGQDIVRPPESSRLDYEGEIAIVIGQGGRRISEADAWNHIAGYSCYNDGSIRD
FT                   WQVATSQWGPGKNFWRTGGFGPWMVTSDEIAPNQKMTLTTRLNGQVMQQATTDMMIHSI
FT                   PRQIAYISTFIPLEAGDVIVTGTPGGVGNKRTPPVFMQPGDIVEIEVDAVGILRNGIRD
FT                   E"
FT   CDS_pept        38942..39931
FT                   /transl_table=11
FT                   /locus_tag="BAV0037"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47621"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2A3"
FT                   /inference="similar to DNA sequence:INSDC:AE016770.1"
FT                   /inference="profile:HMMPfam:PF03401"
FT                   /protein_id="CAJ47621.1"
FT                   /translation="MGKKLSAVHAKNKFRFFCGIALGCLASNANADPSYPSHPVQLLVP
FT                   FAPGGGLDSNARRFAQEFSEQLGQPVVVVNRDGAAGTIGMQQLARSTPDGYNLAFSPAV
FT                   PLTSEPHRIAKLSYKLQDFQPICQIFDNIFGVVVHKKSADKSINDLLAHARKSPNGVSY
FT                   GTSGTGSIPHLGIADVEANTGTTFTHIPYKGDGPMLQDLLAERLEFGAMLVSSATAHIN
FT                   NGNLKLIAVFSNKRHPAFPDVPTLLELSVPVEQASFGGLFAPANTPKAVLQHLEEACQK
FT                   ATQSTAYQEWAGKNNQVLDYQGANDFQSRLLRDFELKRNTLQRLSLSN"
FT   sig_peptide     38942..>39032
FT                   /locus_tag="BAV0037"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        39939..40496
FT                   /transl_table=11
FT                   /locus_tag="BAV0038"
FT                   /product="putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47622"
FT                   /db_xref="GOA:Q2L2A1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L2A1"
FT                   /inference="similar to DNA sequence:INSDC:AY026363.3"
FT                   /inference="similar to DNA sequence:INSDC:AF164961.1"
FT                   /inference="profile:HMMPfam:PF03358"
FT                   /protein_id="CAJ47622.1"
FT                   /translation="MTELRIITASTRPGRVGPAVSAWLEALCASLPSIQARVLDLAAYD
FT                   FPIFDEPKHPRLGQYEHALTRRWANDIASADAFVFVLPEYDHMPPASLINAITYLSKEW
FT                   QYKPAGLVSYGGLSAGLRAAQALKPMLAALKMVPLVESVAIPMIADKVSNGVLENTQPL
FT                   QQAAEQMLIELQRWSGALKTLR"
FT   CDS_pept        40518..41507
FT                   /transl_table=11
FT                   /locus_tag="BAV0039"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47623"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L299"
FT                   /inference="similar to DNA sequence:INSDC:AB024335.1"
FT                   /inference="profile:HMMPfam:PF03401"
FT                   /protein_id="CAJ47623.1"
FT                   /translation="MNLLSSLSRRLLMCALVTGVISTSAVAETPAWPVKPISLVVPYAA
FT                   GGLTDQLAREVATYMSNELKQAVVVDNRPGGAAQIGMNVIKTAPADGYAVFFGDVPSLA
FT                   TNLGLFKKLSYDPRKDLQAVTQLVVAPALVVVPTNSPYRSFEDLVTAAKASPDAISYAS
FT                   QGVGTGGHLFGTLMAKHIDATMTHVAYRGSLPGLSDLMGGQVNFMYDAIPTSGSYVYAN
FT                   KLRALAIGSDQRAPSLPDVPTLKELGYGSIVPTFWWGVAVKAGTPQPVVDRLNQVITAA
FT                   MHDPVISKKITEKGVQIKTSNPEEFGRFINDEIAYWTPVMRAANMSAD"
FT   sig_peptide     40518..>40596
FT                   /locus_tag="BAV0039"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        41592..42320
FT                   /transl_table=11
FT                   /locus_tag="BAV0040"
FT                   /product="probable short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47624"
FT                   /db_xref="GOA:Q2L297"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L297"
FT                   /inference="similar to DNA sequence:INSDC:AY267012.1"
FT                   /inference="profile:HMMPfam:PF00106"
FT                   /protein_id="CAJ47624.1"
FT                   /translation="MGMSIAHRFTQEGAIVVLADLIAPDTERLQRIFGDLPYPHWVQLD
FT                   VTQAASWEQAVAYVVEQYQHLDVLVNNAGVVMRGSHPIDELPLDDWQRLFSINVDGTLL
FT                   GLQAAIRVMKQQSQGGSIVNLGSVAGQVGSRDAGAYGASKAAVTNLTKQAALSAARFGY
FT                   KVRVNAVHPGYVWTPLVEAKLIQQFGSLEAAQQAVRAMNPMGDIVTTEDVAASVAFLAS
FT                   RDARMITGADLVIDGGRLIQ"
FT   misc_feature    41970..42056
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        <42353..43150
FT                   /transl_table=11
FT                   /locus_tag="BAV0041"
FT                   /product="IclR-family transcriptional regulator"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47625"
FT                   /db_xref="GOA:Q2L294"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L294"
FT                   /inference="similar to sequence:UniProtKB:P42968"
FT                   /inference="profile:HMMPfam:PF01614"
FT                   /protein_id="CAJ47625.1"
FT                   /translation="VDRCGGFAFLYDMSSLTRMLSVLDLFTQDRATWSAEEVAQQLDCS
FT                   IPTAYRYLRELTEAQLLRAASTGRYALGNRIVELDYQLRSGDPLIQASAGPMKDLAQQV
FT                   DCDVALVMLSGDHVLTIQYESHGVQMRASYGRGRRMPTFKGAMSLAVLSSLSKPRLRKL
FT                   MQKNAAELDGSATNDALETLSQTLKLVRKQGYATSLGALDPHNAGIAIALEVPDQSIYA
FT                   GLGLVMSSERFRLLETEKAAEWLKQCSKQICHRLEIPPARYIA"
FT   CDS_pept        complement(43486..44913)
FT                   /transl_table=11
FT                   /locus_tag="BAV0042"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47626"
FT                   /db_xref="GOA:Q2L290"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L290"
FT                   /inference="similar to sequence:UniProtKB:P25526"
FT                   /inference="profile:HMMPfam:PF00171"
FT                   /protein_id="CAJ47626.1"
FT                   /translation="MYEQLALYIDGEFLAGDGRKTQDVINPATREVLGQLPHATQSDLD
FT                   RALEAAARAFETWKRTSPMERAAILRKVGALSREHAKDIGRNMTLDQGKPLAEAVGEVM
FT                   GCSEHADWHAEECRRIYGRIVPPRNPDARQLVVREPIGVCAAFTPWNFPYNQAIRKICA
FT                   ALGAGCTMVLKGPEDSPSAVMAIARLFHEAGLPKGCLNIVWGEPAKISDYLIRSPIVRK
FT                   VSFTGSVPVGKHLAALAGAHMKRVTMELGGHSPVLVFDDADVNRAAELLARFKVRNAGQ
FT                   VCVSPTRFYVQEGAYDQFVARFTEVLAGIKVGNGLDEGVEMGPLAHERRVSTMTQFVDD
FT                   ARKHGGKVLLGGDAPSDQGFFFSPTVITDLPDHAMLMTEEPFGPLAPVVRFKDTDEVIK
FT                   RANSLPFGLSSYVFTESLKTATKVSNALEAGMVNINHFGSALAETPFGGVKDSGIGSEG
FT                   GQETFDGYLVTKYITHV"
FT   CDS_pept        <45218..45973
FT                   /transl_table=11
FT                   /locus_tag="BAV0043"
FT                   /product="putative asparaginyl beta-hydroxylase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47627"
FT                   /db_xref="GOA:Q2L287"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L287"
FT                   /inference="similar to DNA sequence:INSDC:AE016912.1"
FT                   /inference="profile:HMMPfam:PF05118"
FT                   /protein_id="CAJ47627.1"
FT                   /translation="VQPASQSSQSFFSRILFRFIDYLRVRIARASKVGDRPIFDNRQFP
FT                   WVSALEAQTPAIQAELDALLTERDRLPAFHEISPDVGMITDDDQWKTFVFMGYGMRSAR
FT                   NLARCPATAKALQGIPGIRTAFFSILEAGKRIPLHKGPYNGVLRLHLGLRVPEPREHCW
FT                   IEVDGQRYVWREGEAVVFDDLYPHQVHNDTQGLRAVLFVDFERPCRAPVSWLNRLVLAV
FT                   APMSDEIRRGKANHDAWEQTYYAKKRGRT"
FT   CDS_pept        46388..46756
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BAV0044"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47628"
FT                   /db_xref="GOA:Q2L284"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L284"
FT                   /inference="similar to sequence:UniProtKB:P02411"
FT                   /inference="profile:HMMPfam:PF00238"
FT                   /protein_id="CAJ47628.1"
FT                   /translation="MIQMQTTLDVADNTGARAVMCIKVLGGSKRRYAGIGDIIKVSVKD
FT                   AAPRGRVKKGEIYNAVVVRTAKGVRRKDGSLIRFGGNAAVLLNAKLEPIGTRIFGPVTR
FT                   ELRTEKFMKIVSLAPEVL"
FT   misc_feature    46565..46645
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00049"
FT   CDS_pept        46767..47087
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BAV0045"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47629"
FT                   /db_xref="GOA:Q2L282"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L282"
FT                   /inference="similar to sequence:UniProtKB:P60624"
FT                   /inference="profile:HMMPfam:PF00467"
FT                   /protein_id="CAJ47629.1"
FT                   /translation="MNKILKGDEVIVLTGRDKKRRGVVLARVDADHVLVEGVNVVKKHQ
FT                   KANPMANNPGGIVEKTLPIHISNVALFNPATGKADRVGFKEEDGRKVRVFRSNGAAVGA
FT                   KA"
FT   CDS_pept        47100..47639
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BAV0046"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47630"
FT                   /db_xref="GOA:Q2L279"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L279"
FT                   /inference="similar to sequence:UniProtKB:P62399"
FT                   /inference="profile:HMMPfam:PF00281"
FT                   /inference="profile:HMMPfam:PF00673"
FT                   /protein_id="CAJ47630.1"
FT                   /translation="MSRLQDFYKSKVAVDLQAKFGYKSVMEVPRITKITLNMGVSEAVA
FT                   DKKVIEHAVSDLTKIAGQKPVITKTRKAIAGFKIRENYPIGCMVTLRGQRMYEFLDRLV
FT                   AIALPRVRDFRGISGRAFDGRGNYNIGVKEQIIFPEIEYDKIDALRGLNISITTSAKTD
FT                   EEAKALLTAFSFPFRN"
FT   misc_feature    47268..47318
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00358"
FT   CDS_pept        <47649..47954
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BAV0047"
FT                   /product="30S ribosomal protein S14"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47631"
FT                   /db_xref="GOA:Q2L277"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L277"
FT                   /inference="similar to sequence:UniProtKB:P02370"
FT                   /inference="profile:HMMPfam:PF00253"
FT                   /protein_id="CAJ47631.1"
FT                   /translation="VAKLSLINRDIKRAKLADKFAARRAELKAIIDDQSKTDEERYQAR
FT                   LKLQQLPRNANPTRQRNRCVVTGRSRGVFRKFGLTRHKLREMAMKGEVPGMTKASW"
FT   CDS_pept        47965..48360
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BAV0048"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47632"
FT                   /db_xref="GOA:Q2L273"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L273"
FT                   /inference="similar to sequence:UniProtKB:P02361"
FT                   /inference="profile:HMMPfam:PF00410"
FT                   /protein_id="CAJ47632.1"
FT                   /translation="MSMSDPIADMLTRIRNAQQVDKTTVNMPSSKLKVAIATVLKDEGY
FT                   IDSFEVKGSQAKPELEITLKYYAGRPVIERIERVSRPGLRIYKGRSNIPQVMNGLGVAI
FT                   VSTSRGVMTDRKARANGVGGEVLCYVA"
FT   misc_feature    47965..48126
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00430"
FT   misc_feature    48265..48318
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00053"
FT   misc_feature    48346..48357
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00294"
FT   CDS_pept        48371..48904
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BAV0049"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47633"
FT                   /db_xref="GOA:Q2L270"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L270"
FT                   /inference="similar to sequence:UniProtKB:P02390"
FT                   /inference="profile:HMMPfam:PF00347"
FT                   /protein_id="CAJ47633.1"
FT                   /translation="MSRIAKYPVELPKGVEASIQQDQITVKGPLGTLVQALTGDVNIVE
FT                   DAGKLTFAAANDSRHANAMSGTVRALVANMVTGVSKGFERKLTLVGVGYRASVQGEAVK
FT                   LQLGFSHDILHKLPAGIKAECPTQTEIVIKGANKQVVGQVAAEIRAYREPEPYKGKGVR
FT                   YADERVVIKETKKK"
FT   misc_feature    48830..48856
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00525"
FT   CDS_pept        48923..49288
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BAV0050"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47634"
FT                   /db_xref="GOA:Q2L268"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L268"
FT                   /inference="similar to sequence:UniProtKB:P02419"
FT                   /inference="profile:HMMPfam:PF00861"
FT                   /protein_id="CAJ47634.1"
FT                   /translation="MDKKVTRLRRAVPTRRKITQLGVHRLSVFRSNQHIYANIISPEGD
FT                   RVVVSASTLEAEVRTQLAGQSGAGGNAAAAALIGKRVAEKAKAAGIELVAFDRSGFRYH
FT                   GRVKALADAAREAGLKF"
FT   CDS_pept        49304..49825
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BAV0051"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47635"
FT                   /db_xref="GOA:Q2L266"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L266"
FT                   /inference="similar to sequence:UniProtKB:P02356"
FT                   /inference="profile:HMMPfam:PF00333"
FT                   /inference="profile:HMMPfam:PF03719"
FT                   /protein_id="CAJ47635.1"
FT                   /translation="MAKVQGKNAAEKENDDGLREKMIAVNRVSKVVKGGRTMSFAALTV
FT                   VGDGDGRIGMGKGKAREVPVSVQKAMEQARRGMFKVALKNGTLYHTVVGKHGASTVLIS
FT                   PAAEGTGVIAGGPMRAIFEVMGVRNVVAKSLGSSNPYNMVRATLNGLRNSLTPSEVAAK
FT                   RGKSVEEILG"
FT   CDS_pept        49829..50014
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BAV0052"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47636"
FT                   /db_xref="GOA:Q2L263"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L263"
FT                   /inference="similar to sequence:UniProtKB:P02430"
FT                   /inference="profile:HMMPfam:PF00327"
FT                   /protein_id="CAJ47636.1"
FT                   /translation="MAQKQIKVTLVRSVIGTKQSHRDTVRGLGLRGLNSSRVLIDTPEV
FT                   RGMLRKVDYLVTVSEA"
FT   CDS_pept        50024..50464
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BAV0053"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47637"
FT                   /db_xref="GOA:Q2L260"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L260"
FT                   /inference="similar to sequence:UniProtKB:Q8XFN6"
FT                   /inference="profile:HMMPfam:PF01305"
FT                   /inference="profile:HMMPfam:PF00256"
FT                   /protein_id="CAJ47637.1"
FT                   /translation="MSDIQLNSLKPAEGAKHAKRRVGRGIGSGLGKTAGRGHKGQKSRS
FT                   GGFHKVGFEGGQMPLQRRLPKRGFTPLGQHLYAEVRLSDLQRLDVEEIDVQALKAAGVV
FT                   GQGVRYAKVIKSGELSRKVVLRGITATAGARAAVEAAGGSLA"
FT   CDS_pept        <50479..51804
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /gene_synonym="prlA"
FT                   /locus_tag="BAV0054"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47638"
FT                   /db_xref="GOA:Q2L257"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L257"
FT                   /inference="similar to sequence:UniProtKB:P03844"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00344"
FT                   /protein_id="CAJ47638.1"
FT                   /translation="VAKAQALGKTGSRYGDLKRRLVFLVLALVVYRLGTHIPVPGINPD
FT                   ALADLFRQNQGGILGLFNMFSGGALSRFSIFALGIMPYISASIIMQLMSVVVPSLEALK
FT                   KEGEAGRRKITQYTRYGTLVLALVQAVGISVALESQPGLVVDPGMLFRFTTLVTLVTGT
FT                   MFVMWLGEQITERGLGNGISILIFTGIVAGLPSALAGLLDLVRTNSMSVVSALFILALV
FT                   VLVTAFVVFVERGQRKITVNYAKRQVGNKVYGGQSSHLPLKLNMAGVIPPIFASSIILF
FT                   PATITSWFSTGERMVWLRDLAAALEPRQPLYITLYAAAIIFFCFFYTALVFNSRETADN
FT                   LKKSGAFVPGIRPGEQTARYIDKILMRLTLAGALYITLVCLLPEFLVMRWNVPFYFGGT
FT                   SLLIIVVVTMDFMAQVQAYMMSHQYDSLLKKANFKGSSLPMR"
FT   misc_feature    50698..50757
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00755"
FT   misc_feature    50980..51036
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00756"
FT   misc_feature    51004..51060
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00095"
FT   misc_feature    51298..51369
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00027"
FT   CDS_pept        51814..52032
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BAV0055"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47639"
FT                   /db_xref="GOA:Q2L254"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L254"
FT                   /inference="similar to sequence:UniProtKB:P02998"
FT                   /inference="profile:HMMPfam:PF00575"
FT                   /protein_id="CAJ47639.1"
FT                   /translation="MSKDDVIQMQGEVLENLPNATFRVKLENGHVVLGHISGKMRMHYI
FT                   RILPGDKVTVELTPYDLTRARIVFRSK"
FT   misc_feature    51988..52017
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00215"
FT   CDS_pept        52068..52181
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BAV0056"
FT                   /product="50S ribosomal protein l36"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47640"
FT                   /db_xref="GOA:Q2L250"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L250"
FT                   /inference="similar to sequence:UniProtKB:P21194"
FT                   /inference="profile:HMMPfam:PF00444"
FT                   /protein_id="CAJ47640.1"
FT                   /translation="MKVMASVKRICRNCKVIKRHGVVRVICTDPRHKQRQG"
FT   misc_feature    52098..52175
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00828"
FT   CDS_pept        52224..52589
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BAV0057"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47641"
FT                   /db_xref="GOA:Q2L248"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L248"
FT                   /inference="similar to sequence:UniProtKB:P02369"
FT                   /inference="profile:HMMPfam:PF00416"
FT                   /protein_id="CAJ47641.1"
FT                   /translation="MARIAGINIPPQQHAEIGLTAIFGVGRTRARKICEAAGVPVTKKV
FT                   KDLTDAELERIREHLGVFTVEGDLRREVQLSIKRLIDLGTYRGMRHKRGLPVRGQRTRT
FT                   NARTRKGPRRAAASLKK"
FT   misc_feature    52482..52523
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00646"
FT   CDS_pept        52605..53006
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BAV0058"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47642"
FT                   /db_xref="GOA:Q2L245"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L245"
FT                   /inference="similar to sequence:UniProtKB:P02366"
FT                   /inference="profile:HMMPfam:PF00411"
FT                   /protein_id="CAJ47642.1"
FT                   /translation="MAKASTSGASRVRKKVKKNVSDGIAHVHASFNNTIITITDRQGNA
FT                   LSWATSGGAGFKGSRKSTPFAAQVAAETAGRVAMEYGIKTLEVRIKGPGPGRESSVRAL
FT                   NALGIKISSIADITPVPHNGCRPPKRRRI"
FT   misc_feature    52905..52973
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00054"
FT   CDS_pept        53018..53641
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /gene_synonym="ramA"
FT                   /locus_tag="BAV0059"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47643"
FT                   /db_xref="GOA:Q2L242"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L242"
FT                   /inference="similar to sequence:UniProtKB:P02354"
FT                   /inference="profile:HMMPfam:PF00163"
FT                   /inference="profile:HMMPfam:PF01479"
FT                   /protein_id="CAJ47643.1"
FT                   /translation="MARYTGPKCKLSRREGTDLFLKSARRSLDSKCKLDSKPGQHGRTS
FT                   GARTSDYGLQLREKQKLKRMYGVLEKQFRKYFAEAERRRGNTGETLIQLLESRLDNVVY
FT                   RMGFGSTRAEARQLVSHRAIELNGHTADIASMLVKAGDVITVREGAKKQARIRESLDLA
FT                   ASIGIPQWVEVDSNKMTGTFKSPPDRADVARDVNESMVVELYSR"
FT   misc_feature    53300..53374
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00632"
FT   CDS_pept        53814..54800
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BAV0060"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47644"
FT                   /db_xref="GOA:Q2L238"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L238"
FT                   /inference="similar to sequence:UniProtKB:P00574"
FT                   /inference="profile:HMMPfam:PF01193"
FT                   /inference="profile:HMMPfam:PF01000"
FT                   /inference="profile:HMMPfam:PF03118"
FT                   /protein_id="CAJ47644.1"
FT                   /translation="MSTQGFLKPRSIEVEPVGPNHAKIVMEPFERGYGHTLGNALRRIL
FT                   LSSMTGYAPTEVQMTGVVHEYSTIPGVREDVVDILLNLKGVVFKLHNRDEVTLILRKNG
FT                   SGLVLASDIELPHDVEIVNPEHPICNLTDAGKLEMQIKVEKGRGYVPGNVRALSEDRTH
FT                   TIGRIILDASFSPVRRVSYAVESARVEQRTDLDKLVLDIETNGVISPEEAVRQSARILM
FT                   DQISVFAALEGAGDSYEAPVRGTPQIDPVLLRPVDDLELTVRSANCLKAENIYYIGDLI
FT                   QRTENELLKTPNLGRKSLNEIKEVLAARGLTLGMKLENWPPLGLERP"
FT   CDS_pept        54963..55358
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BAV0061"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47645"
FT                   /db_xref="GOA:Q2L235"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L235"
FT                   /inference="similar to sequence:UniProtKB:P02416"
FT                   /inference="profile:HMMPfam:PF01196"
FT                   /protein_id="CAJ47645.1"
FT                   /translation="MRHGNGLRKLNRTSSHRLAMFRNMAVSLITHEAIKTTLPKAKELR
FT                   RVIEPLITLGKEPTLANKRLAFARLRDRDAVVKLFAEIGPRFANRNGGYTRVLKMGFRQ
FT                   GDNAPMAYMELVDRPEVDASEADGAAE"
FT   misc_feature    55062..55130
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01167"
FT   CDS_pept        complement(55406..55840)
FT                   /transl_table=11
FT                   /locus_tag="BAV0062"
FT                   /product="histidine triad protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47646"
FT                   /db_xref="GOA:Q2L232"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L232"
FT                   /inference="similar to sequence:UniProtKB:Q04344"
FT                   /inference="profile:HMMPfam:PF01230"
FT                   /protein_id="CAJ47646.1"
FT                   /translation="MPDHCLFCRIARHELPAHAIYEDLRIFAFLDIHPVRRGHVLIIPK
FT                   QHYPYFEDMPVDLVGRITHIGQRLARYMKPLYGVERVGFAFTGIHVAHAHAHIVPMHHT
FT                   QDITSTQYIAEKDLTFIMPPQASDEALRATAQELRQGLNS"
FT   CDS_pept        55931..56266
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="BAV0063"
FT                   /product="putative periplasmic divalent cation tolerance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47647"
FT                   /db_xref="GOA:Q2L229"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L229"
FT                   /inference="similar to sequence:UniProtKB:P36654"
FT                   /inference="profile:HMMPfam:PF03091"
FT                   /protein_id="CAJ47647.1"
FT                   /translation="MLRDDDVVLIISNAPDMLLAKRIAHELVKDGMAACVNLGQPALSV
FT                   YRWKDEIESAEEIPLTIKTTCGRQSAVVSTLQRLHPYEVPEIIMVPVIGGASSYLDWVR
FT                   EQVSVQD"
FT   CDS_pept        56278..58167
FT                   /transl_table=11
FT                   /locus_tag="BAV0064"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47648"
FT                   /db_xref="GOA:Q2L226"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L226"
FT                   /inference="similar to sequence:UniProtKB:P36655"
FT                   /inference="profile:HMMPfam:PF02683"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00085"
FT                   /protein_id="CAJ47648.1"
FT                   /translation="MQAMNRIQRTEVLLWGLLFSLCLLLSFGRAAQAASEADFLAPERA
FT                   FQFSATQPEPDWLDLHFKVAPGYYMYRERFELVGQPGIDTAAAVFPAGEVKYDPTFEKD
FT                   MEVYHNDVLIRVPLKLTGEPARMRVTSQGCADAGLCYPPMSHLVTLTPQAGAYAITSSL
FT                   IEPGQEEAALASAVSTAPATPAKGSLSALLDAGDLGLAGAIGSLGIAGTAGVFFLLGLL
FT                   LAFTPCVLPMIPILSSIIVGRGEAPSRGRGLRLALAYVLGMSVVYTALGVAAGLSGAGL
FT                   SAWLQTPWVLTLFAVLLALLALAMFDAYTLQLPASWQAGLSARSNRIPGGRYTGAWLMG
FT                   AISALIVGPCVAAPLAGALLYISQTGDVLLGGSALFSMAWGMGVPLLVVGASSGALLPK
FT                   AGPWMDGVKRLFGMLLLATAWWMLIPILPVWVLMLGWAFLALVAAVMLCAFEPLPAAAG
FT                   AVRMFAKGLGLLLALGALVWVVGVASGGRDAFAPLAHLAARGQAAPAATPHEPFTRIRS
FT                   IAELDAALAASTRPVMLDFYADWCVSCREMERFTFTDPAVAQRMAGMLLLQVDVTQNNA
FT                   EDRALLKRFNLFGPPGIMFFAPGGRLLEQPRVVGFQDAARFSASLDEALAEAR"
FT   sig_peptide     56278..>56374
FT                   /locus_tag="BAV0064"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    57874..57930
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS_pept        complement(58249..59265)
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="BAV0065"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47649"
FT                   /db_xref="GOA:Q2L223"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L223"
FT                   /inference="similar to sequence:UniProtKB:Q59643"
FT                   /inference="profile:HMMPfam:PF00490"
FT                   /protein_id="CAJ47649.1"
FT                   /translation="MTPHIISPAFPASRPRRLRRDDFTRRLVRENALTVNDLIYPVFVA
FT                   EGKGLQQAVPSLPGVVRYSPDTLLAVAERCVQLGIPVMALFPVIDPSLKTPDGIEATNP
FT                   DGLIPRVVAELKSRFPELGVLTDVALDPYTSHGQDGLIDEDGYVLNEPTVEILTRQALV
FT                   QAQAGVDIVAPSDMMDGRIGAVRQALEDTGHIHTRIMAYSAKYASAFYGPFRDAVGSAS
FT                   NLGKSNKMAYQMDPANLDEALREVAGDLAEGADMVMVKPGMPYLDVLRRVKDAFRVPTF
FT                   AYQVSGEYAMIKAAAANGWLDHDKVMMEALLAFKRAGADGILTYFAIEAAELLNTTR"
FT   misc_feature    complement(58471..58509)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00169"
FT   CDS_pept        complement(59262..>59885)
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="BAV0066"
FT                   /product="probable GTP-binding protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47650"
FT                   /db_xref="GOA:Q2L218"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L218"
FT                   /inference="similar to sequence:UniProtKB:P24253"
FT                   /protein_id="CAJ47650.1"
FT                   /translation="VSLLHRASFFVSAARLDQLPPAGAPEVAFVGRSNAGKSSSINVLC
FT                   NQRRLAFSSKTPGRTRLINMFGLPDPLNPQQPLGFLVDLPGYGYASVAHREKEKWADIL
FT                   GGYLRDRSSLVGIVLMIDIRRGVTELDRRLADFIAPTGRPVLALLTKADKLPYGHRVRT
FT                   VFEVRKQLADIGALNTVPFSATERIGLEDATAQIENWISPKVVP"
FT   misc_feature    complement(59772..59795)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        60069..60743
FT                   /transl_table=11
FT                   /locus_tag="BAV0067"
FT                   /product="putative cytochrome C"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47651"
FT                   /db_xref="GOA:Q2L214"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L214"
FT                   /inference="similar to sequence:UniProtKB:Q52369"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00034"
FT                   /protein_id="CAJ47651.1"
FT                   /translation="MSWLVNGLLGLLLVIATSAFAAAPAKPDMERGARLFDQGDPSRGI
FT                   VACASCHGAGGNSEIPVYPNLAAQPHEYLARQLHDFQIRPGATQPRRMAADSEVSVMTP
FT                   MVEALTPADIQDIALYLAQQALSAPASAALPELFEPGQRLWRAGAADRGVPACAACHGP
FT                   NGAGLPAQYPRLAGQFSDYLKEQLTLLRSGARSNSPVMQDIAGRLTDDDIKAVADYGAG
FT                   LR"
FT   misc_feature    60210..60227
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    60537..60554
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        60826..62907
FT                   /transl_table=11
FT                   /locus_tag="BAV0068"
FT                   /product="putative C-type cytochrome bigenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47652"
FT                   /db_xref="GOA:Q2L211"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L211"
FT                   /inference="similar to DNA sequence:INSDC:AY095304.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF05140"
FT                   /protein_id="CAJ47652.1"
FT                   /translation="MTATATRTASPSLLRDLFELLGSMRFAISLLVFICIASLVGTVLP
FT                   QNRPANTYIDQFGPFWYEVFDKFSLWHVYNSWWFPLTMAFLVLSTSICLIRNTPKMLRD
FT                   AASFREHVRESSLRAFPERVQQITEESPQAALTRVRALLRGQGYAVRERQDAGGVLLAA
FT                   KKGSSNRLGYVCAHAALIIICIGGLLDSELPVRLQVMFGGKQPIIENMLIAQVPPSGRL
FT                   SPSNPSFRANVLVPEGAERNTALVMVGDGALVQPLPFTIKLKKFDVEYYSTGMPSRFAS
FT                   HVEVTDPETGKTFERLIEVNEPLRYKGVTVYQANLADGGSKVTLTGYPLRGAANDTFTV
FT                   HGTVDEGNDLKASIAGHQTDSYKLNITALRPINVEDIGNGDPQPTQQSFMDHVASVTGS
FT                   AAGRKNERLRNLGPVVEYQLVDEAGQSRDFRVYMAPVELNGLPVILAGVRDNPSQNYAY
FT                   LRIPADADGTPGEFMKLRAALADPQVRAEAVRRFVERNLPAGTDRQALTIAASRGLDTF
FT                   AAGGLRAVSELLQTGAGQADAERAAGVVLRLLNSTLYDVHAIMREREHLPPLPDSGPQA
FT                   EAAAAWQQAAMGALSDLSLYPAPVLLTLSDFQQIQASGFQVARTPGKNAVYLGCLLLIL
FT                   GIFAMFYIRDRRIWVWIKPHGSGSEIQAAMTSQKRTLDFFQEFERFRAMLIGPTRGER"
FT   CDS_pept        62904..64232
FT                   /transl_table=11
FT                   /locus_tag="BAV0069"
FT                   /product="putative cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47653"
FT                   /db_xref="GOA:Q2L207"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L207"
FT                   /inference="similar to sequence:UniProtKB:P48257"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF01578"
FT                   /protein_id="CAJ47653.1"
FT                   /translation="MNTTTRGQMWQDGFSQTGDSRKVRGRPDWTDMVFFLLLAAGAGYA
FT                   LVQFSQSMDYYEQIILCGTVPALTWLGWLWRPLRRLMIACALAAGLAILLYQQDLGRAE
FT                   QVFFLKYLFSSQSAILWMSALFLLATACYWIGIVSPTAAWLGTALTWGAVFAGLTGLLV
FT                   RWREGHLMGPDLGHIPVSNLYEVFVLFALITALFYLYYERKYATRALGGFVLLVISSAT
FT                   VFLLWYAFTRDAGQIQPLVPALKSWWMKLHVPANFIGYGTFSLAAMVGFAYLVKQHGQT
FT                   ASWARLAPLFVLGVLLCIEPMVFRTDGLSATWMIYGGVSVVVVGAILLARRPIAQALPS
FT                   LEVLDDIMYRAIAIGFAFFTVATVLGALWAADAWGAYWQWDPKETWALIVWLNYAAWLH
FT                   MRLIKGLRGTMAAYWALIGLLITGFAFLGVNMFLSGLHSYGEL"
FT   CDS_pept        complement(64273..65562)
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="BAV0070"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47654"
FT                   /db_xref="GOA:Q2L205"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L205"
FT                   /inference="similar to sequence:UniProtKB:P19572"
FT                   /inference="profile:HMMPfam:PF00278"
FT                   /inference="profile:HMMPfam:PF02784"
FT                   /protein_id="CAJ47654.1"
FT                   /translation="MTAPSSQPQLAGHPHFHYKHGVLHAEDVALDILAAKLGTPLYVYS
FT                   RAALRAAYDSYRLAIGERPVLVCYGMKANSNLAVLKEFARMGAGFDIVSGGELKRVLAV
FT                   GGDPAKIVFSGVGKQAWEMREALEAGVKCFNVESTAELHRLSKVAQATGKVARVSLRVN
FT                   PDVDAQTHPYISTGLKENKFGIAIEEALAAYQTAASLPGLQVVGVDCHIGSQLTDISPY
FT                   FDALDKLLDLIDRMAETGIRIEHLDLGGGLGIRYTDEVPPSPKALLDEVFNRLQARGYG
FT                   HLHLVLEPGRSLVGNAGLLLTTVQFLKHNDARNFAIVDAAMNDLLRPTLYQAYHGVRPV
FT                   VPRAGEARVYDVVGPVCESGDWLAKERALAIEQDDVLALESAGAYGMVMAGNYNTRARA
FT                   AEVMVDGAQYHVVRQRESLDDLLRGESTLP"
FT   misc_feature    complement(64804..64845)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00879"
FT   CDS_pept        65785..66114
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="BAV0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47656"
FT                   /db_xref="GOA:Q2L201"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L201"
FT                   /inference="similar to sequence:UniProtKB:P27838"
FT                   /inference="profile:HMMPfam:PF01491"
FT                   /protein_id="CAJ47656.1"
FT                   /translation="MTETEFLALVEQVLDSVERMADDWAAEQDLDIEANRSGNVLTLVF
FT                   EDGTHVVINSQAAMQELWLASRSGGFHYRFDGQRWNDTRGGPGFVDALSQVCSAAAGVP
FT                   LTVRL"
FT   CDS_pept        complement(66125..68569)
FT                   /transl_table=11
FT                   /locus_tag="BAV0072"
FT                   /product="penicillin-binding protein 1A"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47658"
FT                   /db_xref="GOA:Q2L1Z7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1Z7"
FT                   /inference="similar to sequence:UniProtKB:P02918"
FT                   /inference="profile:HMMPfam:PF00905"
FT                   /inference="profile:HMMPfam:PF00912"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47658.1"
FT                   /translation="MSKRPNSSKQDQPAPGGSMFLRFLVKTSILLGGLALCGLVLAGMA
FT                   LALAWPNLPDLHAMTDYRPRVPLRVYTADKVLIGEFGEERRNVLRFNEIPDVMKSAVLA
FT                   AEDDRFYQHGGIDWIGVARAGLTNLVKMSKTQGASTITMQVARNFYLSSEKTYSRKFYE
FT                   LLLTFKIESELTKDQILELYMNQIYLGHRAYGFAAAARTYFGKPLSQVTPAEAAMLAGI
FT                   PKAPSRFNPLSNRPRAELRQRYVLGRMYSLGYLTEPEYKAAMAQNLVLKSAEGTPAGGY
FT                   AVHGEYVAELARQLLYGVYQDDLYSRGINVYTTVLSKDQEAAYRAVRDGVLEYTRRAPY
FT                   PGPEDQLDMPAGIENSPQALDDFLDGVFDKYADSGDLLTGLVLSASPNEIKVARSSREI
FT                   ITINDKKALGVVARALNDKAKPEQRLQRGSVVYLHKLGDGNWEVINMPAVQAAFVALSP
FT                   QDGAIRAMVGGFDFYRGNFNRVTQAWRQPGSNIKPFIYAASLERGLTPGTQISDQPFEL
FT                   TAAQTGSKAWNPKNYGNQYEPMLTMRQGLYKSKNMVSIRILQAIGPQYAQDYLTRFGFD
FT                   KSRQPAVLPLALGAGSVTPMQLAGAYAVFANGGYRITPFLIDRVTDSNGKVLMQARPMV
FT                   AGDEAARAIDPRTAWVMDDMLRGVVTSGTAARARATLKRNDLAGKTGTTNESVDAWFSG
FT                   YTPSLVATAWLGFDQPKSLGSRETGGGVAMPIWLDYMQDVLKGVPEGKQRPKPEGLLAE
FT                   NGDYYFSEFPPGQAIASLGLQTPPQSGNDALGDFLNGLDGPRVSPDAKRNSQQPWTQNI
FT                   QF"
FT   sig_peptide     complement(<68425..68569)
FT                   /locus_tag="BAV0072"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        68684..69313
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="BAV0073"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47661"
FT                   /db_xref="GOA:Q2L1Z2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L1Z2"
FT                   /inference="similar to sequence:UniProtKB:P24167"
FT                   /inference="profile:HMMPfam:PF01202"
FT                   /protein_id="CAJ47661.1"
FT                   /translation="MTLSVNLCSGAEALPTEQEAASLAVECIEPLAQLPHDLPIFLVGM
FT                   MGAGKTTIGRGLARALGREFIDLDHELEARCGVRVPVIFEIEGEAGFRKRESTALQECT
FT                   QRRGIILATGGGAVLAEENRRLLRERGIVLYLRASVDELFRRTSRDRNRPLLATADPRG
FT                   TLNDLMIKREPLYKEVADLVIETGAMPITTLIKAILPKLQAYEKKL"
FT   misc_feature    68813..68836
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    68960..69037
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01128"
FT   CDS_pept        69310..70392
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="BAV0074"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47663"
FT                   /db_xref="GOA:Q2L1Y8"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1Y8"
FT                   /inference="similar to sequence:UniProtKB:P07639"
FT                   /inference="profile:HMMPfam:PF01761"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47663.1"
FT                   /translation="MNVVEVDTPGGRYPIRIAPGRLDRLDESIPADATAIAIVTNPTVG
FT                   ALYAERAEAALARTGLKVLRIELPDGEVYKDWQTLNLIFDALLEHRLDRRAVLVALGGG
FT                   VVGDMTGFAAAVYMRGIRFVQVPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQPVAVE
FT                   IDTDVLATLPAREVSAGLAEVIKYGLILDAAFWEWCESHVGELRALQPEALTYAIRRSC
FT                   ELKAQVVGKDERESGLRAILNLGHTFGHAIESGLGYGEWLHGEAVGCGLVQAAELSAET
FT                   DGFARADVVRVRQLVAAIGCPVVAPDLGFERWISLMMVDKKSEAGEIRFVLMPHIGRAG
FT                   MRTAPQEAIRAALDRTVQAS"
FT   misc_feature    69787..69807
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00307"
FT   CDS_pept        <70412..71545
FT                   /transl_table=11
FT                   /locus_tag="BAV0075"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47664"
FT                   /db_xref="GOA:Q2L1Y4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1Y4"
FT                   /inference="similar to sequence:UniProtKB:P15723"
FT                   /inference="profile:HMMPfam:PF01966"
FT                   /protein_id="CAJ47664.1"
FT                   /translation="VQMRGLASYACDPAQTRGRQYIEPAAGNRSEFQRDRDRIIHCSAF
FT                   RRLEYKTQVFVNHEGDLFRTRLTHSLEVAQIARTLARSLRLSEDLTEAISLAHDLGHTP
FT                   FGHAGQDELNACMRELAPQAGGFEHNLQSLRVVDELEERYADFNGLNLCFETREGILKH
FT                   CSVAHARQLGDVGARFLSRTQPSLEAQVANLADEIAYNNHDIDDGLRSGLLTLEQMGEV
FT                   AFFARHYHEVRARYPDLAPRRATAETVRRMINTLIMDLTATSQARIQDVAPASVDDVRQ
FT                   ASPLAAFSDPVRREAEALKKFLFDNLYRHYKVMRMTTKARRIVRELFEAFLGDPRLLPP
FT                   DYRRDDDREQARAISDYIAGMTDRYAISEHRRLFEMG"
FT   CDS_pept        complement(71689..72762)
FT                   /transl_table=11
FT                   /locus_tag="BAV0076"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47666"
FT                   /db_xref="GOA:Q2L1Y2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1Y2"
FT                   /inference="similar to DNA sequence:INSDC:AY363220.1"
FT                   /protein_id="CAJ47666.1"
FT                   /translation="MDADQELHIASALYAGIADTEQWHKALNLAAQAVDTDRCAVLARS
FT                   VSTDAIMVVDNAGLESDTVDEYEKYYHSVDNVMQAARAVQTGASMLDHRAIDASTIRHS
FT                   PFYNDFLYRHDIGSLMLTQALREPDMEWTIAFQRSPDRGLFDTEHEQKLQRLTPHLQKS
FT                   LQLRLRLRELERRACLGSAVLDTFGTPLLFIGSSGRLLLANLAGESWYARHGAELGRSA
FT                   QWARVLAVATGGIGPAMAEGLRLADGSHIVALPAPPAYRSTHGEGLALVLVHTHLNATP
FT                   PAKSMLKSLFGLSTAEYRLLEVLMTGSTLPQAARHLGIALETVRSQSKALLQKTGTPRQ
FT                   ASLMLLVSALENPMPAK"
FT   CDS_pept        complement(72890..73549)
FT                   /transl_table=11
FT                   /locus_tag="BAV0077"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47668"
FT                   /db_xref="GOA:Q2L1X8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1X8"
FT                   /inference="similar to DNA sequence:INSDC:AL646057.1"
FT                   /inference="profile:HMMPfam:PF02798"
FT                   /protein_id="CAJ47668.1"
FT                   /translation="MYTLWIGNKNYSSWSLRAWLALRVAGIAFQEQKLALFTDSFSQHL
FT                   GSLTPAGLVPVLRDGDLVIWDSLAICEYAAEQHPDRHLWPACSRARARARSLASQMHSG
FT                   FTTLRTLLPMNIEAHLPNIDIEAAKPEIARVQTLWQNTRAEFGDGGPFLFGRFSIADAF
FT                   FAPVVSRFTTYGVAANGPVRNYMDAIQALPAMREWTRDALAEATFVAQDEPYRSHR"
FT   CDS_pept        complement(73573..76431)
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="BAV0078"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47670"
FT                   /db_xref="GOA:Q2L1X6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1X6"
FT                   /inference="similar to sequence:UniProtKB:P07671"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ47670.1"
FT                   /translation="MDEIRIRGARTHNLKNVSLNLPRHRLVVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMDKPDVDLIEGLSPAISIEQKAAGHNPRSTVGTITEI
FT                   HDYLRLLFARVGTPYCPEHGLPLQAQSVSQMVDAVLGWPADTRLAVLAPIARARKGGFE
FT                   DECASLQAQGYVRLRVDGKLVEIDQMAPLKKTEKHDIDVVIDRLRARPESKQRLAESFE
FT                   TALQLAEGRALALDLDSGREQVFSSRYACPVCSHSLPELEPRLFSFNNPMGACPSCDGI
FT                   GQVGFFDPKRVVAFPELSLAAGAIRGWDKRNAFTHSLLTSLATHYEFDIDTPFEALSQE
FT                   IRDKVLYGSGEEDISFFYLNEKGRSNVKRHPFEGVIPNLERRWRETDSATVREELSKYR
FT                   NIKTCPDCNGSRLRAEARHVLIGDEPGRGQEQGRAIYEVEAMPLSACLAWFQALSLTGA
FT                   KQEIAQRIVREIEARLSFLNNVGLTYLSLDRSADTISGGEAQRIRLASQIGSGLTGVMY
FT                   VLDEPSIGLHQRDNDRLIATLQHLRDLGNSVIVVEHDEDMIRLADWVVDMGPGAGEHGG
FT                   QVMAQGTPAAVQADPASLTGQYLSGRRAIAIPERRPVSLEQPWLELKGATGNNLRSVDL
FT                   RIPAGRLVCVTGVSGSGKSTLVNDTLAVALARQLNHAQGDAAPYESLSGLEHFDKIISV
FT                   DQSPIGRTPRSNPATYTGLFTPIRELFAGVPEARTRGYDPGRFSFNVKGGRCEACQGDG
FT                   VVKVEMHFLPDMYVPCDVCHGKRYNRETLEIRYRGRNISEVLDLTVEQALTYFEAVPAI
FT                   ARKLQTLIDVGLSYIRLGQSATTLSGGEAQRVKLSLELSRRSTGRTLYILDEPTTGLHF
FT                   RDIELLLAVLNQLVESGNTVLIIEHNLDVIKTADWLIDMGPEGGDGGGRVIAQGTPETV
FT                   AASPESHTGHYLAQVLARHRNP"
FT   misc_feature    complement(73882..73926)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(74110..74127)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    complement(74470..74493)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(74908..74952)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(76318..76341)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        76612..77790
FT                   /transl_table=11
FT                   /locus_tag="BAV0079"
FT                   /product="Putative MFS family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47672"
FT                   /db_xref="GOA:Q2L1X2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1X2"
FT                   /inference="similar to DNA sequence:INSDC:AL646059.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF07690"
FT                   /inference="profile:HMMPfam:PF00083"
FT                   /protein_id="CAJ47672.1"
FT                   /translation="MAQKLKLTSPERRASIALAGLFACRMLGLFLLLPVFAVAAQGLPG
FT                   GDDPTRVGLALGMYGLTQAVMQIPFGLASDRWGRRPVVILGLLLFIAGSIVCAQADDVF
FT                   WITIGRAIQGAGAISAAVTAWLADATRDEVRTRAMAMVGASIGLSFALSLVLAPVLVGW
FT                   WGLHGLFWTIACLGLASLAVARWVVPVVPRTGARSMQPARAGEVLKHVELLRLNFGVFV
FT                   LHLTQVALFVVLPAMLARLGGLDIRALWHVYLPVILVSFVCMVPVIFLAEKRRAHRAAL
FT                   RAAVAGLVLVCGLLPLASQSFFPLTLALTGFFVAFNILEALQPSLVSRVAPQEYKGLAL
FT                   GFYNTAQAAGLFTGGALGGWLASRGGPDGVFLAAAALCLVWLVLTRGMKPLR"
FT   misc_feature    76651..76683
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        78045..78545
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="BAV0080"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47674"
FT                   /db_xref="GOA:Q2L1W7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1W7"
FT                   /inference="similar to sequence:UniProtKB:P25762"
FT                   /inference="profile:HMMPfam:PF00436"
FT                   /protein_id="CAJ47674.1"
FT                   /translation="MASVNKVILVGNLGRDPEVRYSPDGAAICNLSLATTSQWKDKASG
FT                   ERREETEWHRVVMYNRLAEIAGEYLKKGRSVYIEGRLKTRKWQDKDTGADRYSTEIVAD
FT                   QMQMLGGRDGGEGGGFGGGGYDEAPRQQRAPAQRPAPQQQRPAAPMGGGAANLADMDDD
FT                   IPF"
FT   misc_feature    78054..78092
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00735"
FT   misc_feature    78195..78224
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00736"
FT   misc_feature    78771..89672
FT                   /note="putative LPS biosynthesis genes"
FT   CDS_pept        78771..80240
FT                   /transl_table=11
FT                   /locus_tag="BAV0081"
FT                   /product="putative O-antigen translocase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47676"
FT                   /db_xref="GOA:Q2L1W4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1W4"
FT                   /inference="similar to DNA sequence:INSDC:AF498408.1"
FT                   /inference="similar to DNA sequence:INSDC:U73374.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47676.1"
FT                   /translation="MAAGLLKSIVTLAGVTAASQAMAILLSPVLSRLYTPAQFGAYGAI
FT                   IAAGTLLSIVASLRFEMAIVMPEDELAAQSIATDTAYLSSLLCLVLALLWWATDGLAAW
FT                   VPGDPFPLWVGYCAILFAWLTNFLQIGNLYASRQRRYGRLAVSNVVQQAGTALCSILLG
FT                   MVTLPLNGLVWARMVTQALAAGLFILSPRAIVASIRRVGALPWSVRAATLWRYRGFAFY
FT                   TTPATLLIALSREFLILIFTGFGLPAAAGAYALTRMALLASPQFLSAAIGQVFYREAIA
FT                   RKEDVQFQQLTIYFFQALATLICPFLVLLMLWGPTLFGFVFGVQWREAGLYAAWMAPSA
FT                   LFAILNSWSGRMFEACGQQRLAFKIQVAFDVLSMLVVIIALFQGADAVLVVALYATFQL
FT                   FYQLTLTDAILRLVRPDRGAFAGVLLRILGLAGLMLPVHFLADKLTAFSLLMRLGLDFG
FT                   LALVLTSVLLPSLYRQARHLLDSRQRFTTGS"
FT   sig_peptide     78771..>78837
FT                   /locus_tag="BAV0081"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        <80356..81672
FT                   /transl_table=11
FT                   /locus_tag="BAV0082"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47678"
FT                   /db_xref="GOA:Q2L1W0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1W0"
FT                   /inference="similar to sequence:UniProtKB:Q9HUG6"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47678.1"
FT                   /translation="VLSTAVLTTICYLCGLVSVAGLALFPHRSDLFYLGLQFAVALLIF
FT                   WAARRLPGAARVGPTWFVQHGPWRRLDILLAALVFTVALVLVAMAVLLPLSSNDPLEYA
FT                   LVGREMYSLRALADYPLLNTDTPSGMYAPWTHPPLYIGLIFLANVISGGAELPGLMRLV
FT                   APMLTVMSTALIYWLGCAGGRRVGLLSALIFITTPFIFAQAMYGAIDALVISALLLGMA
FT                   AVFACQPETLRGRLTIGVVMGLGLWSHSQAILFPFLLGGSFLVVCGGLNKRMLTTALVV
FT                   VLVGGAIGCWPYLRNVLIFGSPISDNNLVFALSSLDWQGYFRLSRGYALMADRLQYGLF
FT                   KGWFTLHLYGLTWWWMLLGLIFLPRRGSPSPAWRQITHLCVAIIAIYLAGMGLSLFAGT
FT                   DLMIRNDRYMLVLMPYVSLLAGWGVFRLAGNRQVTAEAA"
FT   sig_peptide     80356..>80413
FT                   /locus_tag="BAV0082"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        81669..82697
FT                   /transl_table=11
FT                   /locus_tag="BAV0083"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47680"
FT                   /db_xref="GOA:Q2L1V7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1V7"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47680.1"
FT                   /translation="MTRRISPKGCWNGLIMVCLIAAVMLPLAWFVKNSTFIYFSAVQRN
FT                   QGSAPVLVPSTICRFGLVDYLSHLPPGETVLALRPSDMYYAKQRMISYLDPRLIPFYEA
FT                   DSKQEGLRILRALGIRYVQGIAYSLPVDYHSVLKDILADPEMASVVISTGREMLYELAP
FT                   AAPMQFGPPEQVGPTVQTWSEGFALSLAPGVVVMRDEHEMAADFSPSGPVYPVFVRAQE
FT                   FFQHNDGFIKIDPDYEYLITFKVEGTGFGSLMAVEYKEGRPPGDDPDRRVRLKVTLAQT
FT                   HADNDSQTVTVRLTPFAGVNEIELGLLQLGGSRLRVLEVSMRKALRKMPLPPMHIDVAK
FT                   AC"
FT   sig_peptide     81669..>81786
FT                   /locus_tag="BAV0083"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        82707..84026
FT                   /transl_table=11
FT                   /locus_tag="BAV0084"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47682"
FT                   /db_xref="GOA:Q2L1V5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1V5"
FT                   /inference="similar to DNA sequence:INSDC:AF189282.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47682.1"
FT                   /translation="MLVRIKQLVGRVASGKLSLDIAWNLGSFAILALSGVIINFIIAAV
FT                   WGPQALGVFNLVFAVYIVLSQVFTLGVHYSVLRHSAHYAQQGRELAQMTGSAVVLGIVA
FT                   GALAAAVAYAGAPLAQKLFSSARVAEGLQWAAGGLLLFPLNKILLGMANGLRLMRFFAV
FT                   AQAARYLAILAWVGIVAAAGMDPQRMAAAFAIAELFVLLLCFAYLPGRLPFGRPSAQWY
FT                   RLHLSFGIRGMPAGMFVELNSRVDVLVLGLFMSETEVGIYSFAAMLVDGYYAILTVIRN
FT                   NLNPLLVHCLRDNDQTGLQGLICGTRRLVYPVMLLLGLVLLAGLAILVHGFLPERGLSQ
FT                   SVPVLALLLSGIWLCSAFIPLDNLLMQSGQPGWQTVQHGTLVISNLAFNLLLIPVLGLY
FT                   GAALGTTLAYVAGTAMLFFLARNRLGIDILRSRFIDRPLS"
FT   CDS_pept        84023..84634
FT                   /transl_table=11
FT                   /locus_tag="BAV0085"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47686"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1U7"
FT                   /inference="similar to DNA sequence:INSDC:AE016872.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47686.1"
FT                   /translation="MRRVFAAGITLALLSVLAAGVLLGWSDREDAGHRLGPLDQASAAI
FT                   VFYTPDEAVRATYVRRAHDLYRAGQVGMIVCVGGARPGRNYFGSAVMADELERSGVPAG
FT                   ALHCGDRVSDDSRSNIQAAWAVLNARDFQDAVLVADRLHGFRLRYLAHMLTGQSPRWAA
FT                   APDYLSWEQALLRAYWELLAWAVDVMPQPLRRWAISSSRG"
FT   sig_peptide     84023..>84074
FT                   /locus_tag="BAV0085"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        84883..85833
FT                   /transl_table=11
FT                   /locus_tag="BAV0086"
FT                   /product="Putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47688"
FT                   /db_xref="GOA:Q2L1U4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1U4"
FT                   /inference="similar to DNA sequence:INSDC:AE010196.1"
FT                   /inference="profile:HMMPfam:PF00535"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47688.1"
FT                   /translation="MYRNNRISVVVPAYNEETQISRVILTMPDFVDDIVIVDDCSPDKT
FT                   CEVIESYQREHPRVVLLRHKKNQGVGGAIATGYEWARDNGTDIAVVMAGDGQMNPADLP
FT                   GLLDPVVEGVADYTKGNRLVSGDAFRKIPKIRYFGNAALSLLTKIASGYWKVADSQTGY
FT                   TAINRAALTAIDWQTMYKRYGQPNDLLVKLNVFGFRVKDVPVEPVYNIGEKSGIRVRKV
FT                   IFTIGWLIVKLFFWRMKQKYIIRDFHPLVIFYAAGFLLAGLSVLMFVRLLVLWGTHGTV
FT                   PEITLLFWFFLTSMGFQSTVFAMWLDYEDNKKLNT"
FT   CDS_pept        85913..87856
FT                   /transl_table=11
FT                   /locus_tag="BAV0087"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47689"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1U1"
FT                   /inference="similar to DNA sequence:INSDC:AY034084.1"
FT                   /inference="similar to sequence:UniProtKB:Q8FBT4"
FT                   /inference="profile:HMMPfam:PF00310"
FT                   /protein_id="CAJ47689.1"
FT                   /translation="MCGIFGLVVARQSTLKTDDISKLLKRLFLLSESRGKEAAGLAAAA
FT                   GQTLRVLKYPVPASELLKMQEYKRQVEQAVSQRDQTGLGIVGHARLVTNGQQGVDANNQ
FT                   PVVRDSVVVVHNGIIVNEAEIWAAEPRLKKLAQVDTEVVAALMNDRLARGAPIEQVCRE
FT                   VFGKIYGEASLGVLFADRDDLLLATNTGSLNYLHAPKQGVFVFVSEYVIAKRIREEMKE
FT                   HIEFGDPQPVRAGQAMTIRIESAQPGPLFSLGLPYSPAETAAPILAAPAPVLRKVVSNV
FT                   EEQQRRYAGLRRCSKCVLPETMPFIEFDEQGVCNYCNNYKPAKLKGRKELDKLLEKYRS
FT                   NNGSADCLVGFSGGRDSSYGLHLLKTELGMNPIAYTYDWGMVTDLARRNQARLCGKLGV
FT                   EHIWVSADIKQKRANVGVNVNAWLKNPDLGMIPLFMAGDKQFMYHANRLMKETGIKLMV
FT                   YSTNHLERTDFKVGFCGVRPASAGVQLNKVSSMQKAQLALYYMKNYLVNPGYINQSLLD
FT                   TFTAFLSYYFVNQDFLYLFDYLEWDEATINKVLIETYDWELAPDTPTTWRIGDGTAPFY
FT                   NYIYQTVAGFTEYETFRSNQIREGVITREEAFMLIEKENIARIDAIQDYCRLIGVDFDK
FT                   AMRVINSIPKLY"
FT   misc_feature    85913..85930
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00443"
FT   CDS_pept        87862..88629
FT                   /transl_table=11
FT                   /locus_tag="BAV0088"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47691"
FT                   /db_xref="GOA:Q2L1T9"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1T9"
FT                   /inference="similar to DNA sequence:INSDC:AE010773.1"
FT                   /protein_id="CAJ47691.1"
FT                   /translation="MPNRDFTLQSYMSVIQALQGRGIPIFGVREWLERAPLTGAVIRHD
FT                   VDRKPRNALRMAQAEAAAGVSATYYFRVVGSAYDKGIMREVEALGHEVGYHYEDLALTK
FT                   GDVQAALKSFETNLADLRQAVSVATVAMHGSPMSRHNNLDLWKHADVASFGLSGEAFLT
FT                   VDYTGTYYFTDTGRSWGAIATNLRDRPPGILVPEEMPQSSKQLIEFIEKTHFEKIALSA
FT                   HPERWDSSLRGWMVQGMKDQLINCAKIAVNMVR"
FT   CDS_pept        88632..89672
FT                   /transl_table=11
FT                   /locus_tag="BAV0089"
FT                   /product="Putative lipid A biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47692"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1T7"
FT                   /inference="similar to sequence:UniProtKB:Q9KPW2"
FT                   /inference="profile:HMMPfam:PF00132"
FT                   /protein_id="CAJ47692.1"
FT                   /translation="MAIPMIKMAVIGILPSRLKVAFYRLRGARIGKGVKIGLFSVLLAD
FT                   DIEIGDGAKIGALSFVRCRKLRLGNRSKIGSMVAIDTGEVKLGHDSVIMEQVVIGGMQT
FT                   PRSRIDIGARVKIFPYCFLNPTEPIVIEDEVGVGGANYLFTHGSWQSVLDGYPVGFGPI
FT                   TIRKGVWLPWRVFILPNVEIGEYCTIGAGAIINKSIAAHSLAVGAPAKVIAENGAYRKL
FT                   KSREEQIALVRTILKEMAEFLQYEGKPTLYEERPDSVVLRVQVAGKNSEIVFVEQAAHS
FT                   SPRPNGVLIAFDAIPADVRQQLGAQPWFDLQSKDCAFGNGLLFDEVRNFFSRYGIRFAI
FT                   AGERDI"
FT   misc_feature    complement(89625..100139)
FT                   /note="LPS biosynthesis locus"
FT   CDS_pept        complement(89625..91553)
FT                   /transl_table=11
FT                   /gene="wlbL"
FT                   /gene_synonym="bplL"
FT                   /locus_tag="BAV0090"
FT                   /product="putative sugar epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47695"
FT                   /db_xref="GOA:Q2L1T4"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1T4"
FT                   /inference="similar to DNA sequence (same
FT                   species):INSDC:AJ427964.1"
FT                   /inference="similar to DNA sequence:INSDC:AB025970.1"
FT                   /inference="profile:HMMPfam:PF02719"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47695.1"
FT                   /translation="MIKHLLLKSSLLNLPRSAKQALNMVLDALVLLLAFQLALWFRFEL
FT                   FYLTSPYLILSVLACAGGLFTLALLGTYKYVLRYMDEHVVLRILIGVAGSVMLVTAINT
FT                   FMQLVGLSRAVLAIYALLALSGLLGLRWLGRRLLFSFDPKSETTGTPVIIYGGGGAGSQ
FT                   LAAALRAGPYYRPVAMIDDDRRKQGLRVAGLRIYPVSALDHLIKQYDVRQLLIAMPNIP
FT                   RSRLREIVETVEHYRLRIRLVPSLRELVDQNGPRLRDIRVEDLLGRDAVAPIPSLLGRC
FT                   VTGRNVMVSGAGGSIGSELCRQILAQKPRSLVLLEISEPALYAIERELSALGRQQGIHI
FT                   AGVLGSVRDAELCTTQMRKHHIHTVYHAAAYKHVPIVEENITEGLRTNTFGTRTFAQCA
FT                   IDSGVSDFVLISTDKAVRPTNVMGASKRMAELVLQAYAKTQTGTRFSMVRFGNVLGSSG
FT                   SVVPLFHAQIMAGGPITLTHEKITRYFMTIPEAAQLVLQAGSMGESGAVFVLDMGEPVH
FT                   IRDLALRMIRLYGLTLRSAEQPDGDIEIKITGLRPGEKLYEELLIAGNTVTTEHPRIMQ
FT                   AHEIDLPPAVLNARLETLASMLNVAEHRDILQHIKQIVPEYQPYDAAPDQGSDITLSGD
FT                   RKTNPVA"
FT   misc_feature    complement(90327..90362)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00141"
FT   CDS_pept        complement(91619..92977)
FT                   /transl_table=11
FT                   /gene="wlbJK"
FT                   /gene_synonym="bplJ"
FT                   /gene_synonym="bplK"
FT                   /locus_tag="BAV0091"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47697"
FT                   /db_xref="GOA:Q2L1S8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1S8"
FT                   /inference="similar to DNA sequence:INSDC:X90711.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47697.1"
FT                   /translation="MTQPASRSAAHTAALIAFALALAGSSIYIIPPLRPFHVGLCFLAF
FT                   ALWRGPDLRTTLRQTFALKCTGGVVLLMALQALWAVNLNRYFSYSVILAIGLAYMMLGE
FT                   TLARSRSRFLAVLPPLIGFWFILALFPIFDVWTGSQRFRATYILTGGPWDNINDMATVL
FT                   TLVTLIFTLVKRQVSLPLLAITCFYCVALNRRADLLGLIVFVGGYLLISRDQHRLKLLL
FT                   RLGSTVIVSTAFALMLHTGPFQGFSLPAISETPTQVSPPPATNPLATSSAQADSATPAP
FT                   QAAPPAQPAPAVGLAAEAAPLPAPSLAPSASVRPPNESQTMPLQITLQNGDGSSATRLQ
FT                   LLAEMYVQARHMPWWQWIAGKGVGQLNLTWPDTGAAWASPHMFWLEMLFYFGIGWLLLL
FT                   GYLFLRLDNLGRICLVSAGIAGCAPSSIIYLQPFWLFLGVLMAQLPRRQPLLT"
FT   sig_peptide     complement(<92905..92977)
FT                   /gene="wlbJK"
FT                   /gene_synonym="bplK"
FT                   /gene_synonym="bplJ"
FT                   /locus_tag="BAV0091"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(92974..94182)
FT                   /transl_table=11
FT                   /gene="wlbH"
FT                   /gene_synonym="bplH"
FT                   /locus_tag="BAV0092"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47698"
FT                   /db_xref="GOA:Q2L1S6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1S6"
FT                   /inference="similar to DNA sequence:INSDC:X90711.1"
FT                   /inference="profile:HMMPfam:PF00534"
FT                   /protein_id="CAJ47698.1"
FT                   /translation="MTHNNQRIERASQASLHVPPGSRLSVALLSDAGSIHTMRWVHGLH
FT                   QRGLKVHLISIKPPNSPLADGIEFHRLPWKAPHGYRLNARYLRQLLKRLQPDLLNAHYA
FT                   TGYGLLARLSRFSPVLLSAWGSDIYEFPTRSSWHRKLLRKNLESATCLAATSHAMAARM
FT                   QELSPLPVTITPFGIDTELFSPGTLTERHVDKALRIGTVKSLEDTYGIDTLLEAYARLY
FT                   RRIKAEDAALAQRLQLLIYGRGSRLDALSQQARDLAIDHCTTFAGHIEHHAVPDALRSM
FT                   DIFAALSRADSFGVAILEASACRLPVVVSDADGPAEIVEDQHTGFIVPRENAEAAAQCL
FT                   YTLVMDSALRERMGRAGRQLVDARYSWNHSVDIMLAAYRATIENAGLGQHSGRAPTPPS
FT                   ARS"
FT   CDS_pept        complement(94272..>94871)
FT                   /transl_table=11
FT                   /gene="wlbG"
FT                   /gene_synonym="bplG"
FT                   /locus_tag="BAV0093"
FT                   /product="probable sugar transferase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47699"
FT                   /db_xref="GOA:Q2L1S2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1S2"
FT                   /inference="similar to DNA sequence (same
FT                   species):INSDC:AF248036.1"
FT                   /inference="similar to DNA sequence:INSDC:AF285970.1"
FT                   /inference="profile:HMMPfam:PF02397"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47699.1"
FT                   /translation="VIKRLFDIAVSGIGLLLCLPLFLILAIAIKLESPGPVFFRQERVG
FT                   RHGRVFRIHKFRSMRSDAGTGPQITVGGDRRITRVGEYIRRWKLDETAQLIDVLEGTMS
FT                   LVGPRPEVPRYVAQYPDAMRRTILSIRPGITDLASIVFRNENDILAAAADPERAYVEEV
FT                   LPRKLALQAQYVRERSFTGDLVILARTVAAVVGKSA"
FT   sig_peptide     complement(<94784..94871)
FT                   /gene="wlbG"
FT                   /gene_synonym="bplG"
FT                   /locus_tag="BAV0093"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(94868..96046)
FT                   /transl_table=11
FT                   /gene="wlbF"
FT                   /gene_synonym="bplF"
FT                   /locus_tag="BAV0094"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47700"
FT                   /db_xref="GOA:Q2L1R9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1R9"
FT                   /inference="similar to DNA sequence:INSDC:X90711.1"
FT                   /inference="similar to DNA sequence:INSDC:AF285970.1"
FT                   /inference="profile:HMMPfam:PF01041"
FT                   /protein_id="CAJ47700.1"
FT                   /translation="MAFLPFAQPDIGEAEIDAAVQAMRSGWLTTGPNARAFEQEFSAFL
FT                   GEGLEAIAVNSATAGLHLALEAIGIGAGDEVITTTHTFTASAEVVRYLGGEPVLVDIDP
FT                   ATFCISPSAIEAAITPRTKAIIPVHYGGLSCDMSAILAIAAKHSLRVIEDAAHALPCTW
FT                   NGQLIGQLGSDATVYSFYATKTLATGEGGMVVTRNAQLSKRCRVMRLHGIDRDAFDRFT
FT                   SSKPAWYYEIVAPGFKYNLPDPAAAIGRVQLQRVRAMRDRRADIAARYDSAFADLPVQL
FT                   PPCPAKLAAGGVYQASDLHSWHLYVLRLTPDAPCARDDFIAGMSERGIGCSVHYVPLHL
FT                   QPYWRDRYSLRADMFPASQTTYERMVSLPIYSKMNDADVDRVIEAVRSLLQS"
FT   CDS_pept        complement(96191..97387)
FT                   /transl_table=11
FT                   /gene="wlbE"
FT                   /gene_synonym="bplE"
FT                   /locus_tag="BAV0095"
FT                   /product="probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47701"
FT                   /db_xref="GOA:Q2L1R6"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1R6"
FT                   /inference="similar to DNA sequence:INSDC:X90711.1"
FT                   /inference="similar to DNA sequence:INSDC:U50396.1"
FT                   /protein_id="CAJ47701.1"
FT                   /translation="MKILLINHYAGRPDLGMEFRPYFLAREWARSGHEVRILASNYSHL
FT                   RYRQPQSAQEDVDGVTYQWVPTRPYQGNGAARLWNMAQFIGGVYRRGPALAAWRPHMVI
FT                   ASSTYPYDIWPAARIARKAGAVLVHEIHDLWPLTPRLLGDFSAAHPMIASMQWAENYAC
FT                   RNADRIVSILPGTKAYLQQHGMPAQHFVHIPNGIDPEAPQETIKPELREQILDFKARYR
FT                   STCIYAGGHAVSNALDVLLEVAARPEMQSTGFILLGAGAEKSALQTRARDMQNILFLDP
FT                   VPKAEVGSALALADMAYLGWRHSPLYDHGISPNKLFDYMLAGLPVIHATDTPYDLVRDA
FT                   GCGLSVASNDIAGISQAVQRLQETPEAERQALGAKGRDFVFKHHNYSVLAQRFLEIAT"
FT   CDS_pept        complement(97405..98505)
FT                   /transl_table=11
FT                   /gene="wlbC"
FT                   /gene_synonym="bplC"
FT                   /locus_tag="BAV0096"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47702"
FT                   /db_xref="GOA:Q2L1R3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1R3"
FT                   /inference="similar to DNA sequence:INSDC:X90711.1"
FT                   /inference="similar to DNA sequence:INSDC:U50396.1"
FT                   /inference="profile:HMMPfam:PF01041"
FT                   /protein_id="CAJ47702.1"
FT                   /translation="MQFIDLKKQYQALRDPINTRIQQVLDHGQYIMGPEVKELETALSA
FT                   YTGAKHCITVASGTEALLIALMALGIKAGDEVITTSFTFVATAEVIALLGAVPVFVDVE
FT                   PDTCNIRVDEIEARITPRTKAIIPVSLYGQCGDMDEVNAIADKYGITVIEDAAQSFGAT
FT                   YKGKKSCNLSTIGCTSFFPSKPLGCYGDGGALFTNDDALAQAMREIRVHGQSARYYHTR
FT                   IGVGGRMDTLQCAVVLGKLERFDWEVEQRLRIGARYQALLADLPAGARTVTVRPDRDSV
FT                   WAQFTVIVPNRAAVVEQLKAAGIPTAIHYPRPIHKQPAYEHFASEHGTPNSDLLADQVL
FT                   SLPMHPDLDEATQDKIVAVLREALAG"
FT   CDS_pept        complement(98516..99085)
FT                   /transl_table=11
FT                   /gene="wlbB"
FT                   /gene_synonym="bplB"
FT                   /locus_tag="BAV0097"
FT                   /product="probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47703"
FT                   /db_xref="GOA:Q2L1R1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1R1"
FT                   /inference="similar to DNA sequence:INSDC:U50396.1"
FT                   /inference="profile:HMMPfam:PF00132"
FT                   /protein_id="CAJ47703.1"
FT                   /translation="MSIHSSAIVDAGAQIGAGTRIWHWVHVCGGAEIGENCSLGQNVFV
FT                   GNRVRIGNRVKIQNNVSVYDNVFIEDDVFCGPSMVFTNVYNPRAAIERKNEYRDTLVKQ
FT                   GATLGANCTIVCGATIGRYAFIGAGAVVNKDVPDFALMVGVPARQIGWMSRHGEQLDLP
FT                   LTGDAETVCPNTGDRYLLKNGICQLA"
FT   misc_feature    complement(98585..98602)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        complement(99093..100139)
FT                   /transl_table=11
FT                   /gene="wlbA"
FT                   /gene_synonym="bplA"
FT                   /locus_tag="BAV0098"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47704"
FT                   /db_xref="GOA:Q2L1Q8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1Q8"
FT                   /inference="similar to DNA sequence:INSDC:AE016924.1"
FT                   /inference="profile:HMMPfam:PF02894"
FT                   /inference="profile:HMMPfam:PF01408"
FT                   /protein_id="CAJ47704.1"
FT                   /translation="MTPIFDRKIRFALVGCGRISKNHIAAIAQHHERAELVEVCDTDPA
FT                   ALRAAAKATGAKPYSSLSEMLAASTADAVILATPSGLHPWQAIEVAQSGRHVVSEKPMA
FT                   TRWEDGKRMVKACDDAGVHLFVVKQNRRNATLQLLKHAVEQNRFGRIYMVTVNVFWTRP
FT                   QEYYDAARWRGKWEWDGGAFMNQASHYVDLLDWLIGPVESVYAYTATLARRIEAEDTGV
FT                   AAVRWRHGAMGSINVTMLTYPQNLEGSITILGEKGTVRIGGVAVNRIDEWKFAEPHPDD
FT                   EKIKDASYETTSVYGFGHPLYYDNVIRTLRGECSPETDGREGLQSLALLTAMYRSARDG
FT                   VRVPLPLD"
FT   CDS_pept        100501..101172
FT                   /transl_table=11
FT                   /locus_tag="BAV0099"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47705"
FT                   /db_xref="GOA:Q2L1Q6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1Q6"
FT                   /inference="similar to sequence:UniProtKB:Q8XBS3"
FT                   /inference="profile:HMMPfam:PF00072"
FT                   /inference="profile:HMMPfam:PF00486"
FT                   /protein_id="CAJ47705.1"
FT                   /translation="MRILLVEDNPDLGDAVESKLRNAGHSVQWVRDGLAAVQWGQAEPW
FT                   DALLLDISLPGKDGDAVLRELRAAGMESPVLVMTARAEIEDKVDMLDLGADDYLVKPFD
FT                   LRELEARLRALMRRPGGQTSSVAMFGNLTLDSANRGVWVNGQPLELGRREFRLLEILLT
FT                   RQGQTVAKERLMAQVFDADDVSLNALELLISRLRRKLADASVDIVTVRGVGYQVRQDGA
FT                   A"
FT   CDS_pept        <101195..103633
FT                   /transl_table=11
FT                   /locus_tag="BAV0100"
FT                   /product="putative bifunctional protein: two-component
FT                   system sensor protein and solute-binding protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47706"
FT                   /db_xref="GOA:Q2L1Q3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1Q3"
FT                   /inference="similar to DNA sequence:INSDC:AE012453.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00672"
FT                   /inference="profile:HMMPfam:PF00512"
FT                   /inference="profile:HMMPfam:PF02518"
FT                   /protein_id="CAJ47706.1"
FT                   /translation="VFILAVVSLACASIALFFFLRAYAHRAAEQAFDRLLAASALTIAG
FT                   SVQIDDGGVTVEPPYSSLAMLPPQERVFYQVLNSAGRVITGYRDLALSQPLADSAVPRF
FT                   VYERYHDEPIRVASVGRLVSASQHAGWVTVRVAETLGSRQALAAEILNRSLWPLIVVVG
FT                   VALALLWFGIQRAFAPLAVVERELRNREPDDLAPLRAPVPREVRRLSEALNAFMQRLST
FT                   MMDSLNTLVADAAHQVRTPLASLRAQAEVALEEPSPERLRERVARIHQNATQASQLINQ
FT                   LLMDATIAHRLGRGERLAVGVAETVNETRRRIGPLDAQRLSISIVPELRRARVMGDRVA
FT                   LREMLRNLVDNALRHAPDSLVEIQVTPVAGYRVALTVLDRGPGIAAGDKERVQQRFERG
FT                   SSPQSGSGLGLAIVRAVAQAHGGALALLDRPGGGLLARIVLPLARPAGRGRLAVLLLAG
FT                   ASLFPALWPSPAPAARLIQESRYPAPRPSGRVLTVAGPTDTPVFAPLVAGFQQQRPDVT
FT                   VVYREMGSLELYEAAVAGQLKDVDVLISSAPDLQVRLANDGYALSYASPYLSQLPTWAV
FT                   WRNEVFGFTFEPAVIVYNPRRFTQESAPHSRQALLRLLEREGASLRGRVATYDIVASNV
FT                   GYMLAEQDELVSSNFWGLANALGQVGVRLSPSTNAMLDAIANDELDLGYNLLGSYALAR
FT                   QAAGDQIGVILPRDYMLVLSRSALIARSAPNPDLGRALVDWLLSPAGQQVAASHAGLGA
FT                   LIPGTPGPWSADSLQALARGIVQPIVLSPALLVGLDQQRQSRFVQNWMRLVTDTPAVPK
FT                   "
FT   sig_peptide     101195..>101270
FT                   /locus_tag="BAV0100"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    101195..101227
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        103759..104850
FT                   /transl_table=11
FT                   /locus_tag="BAV0101"
FT                   /product="putative solute-binding periplasmic component of
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47707"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1P9"
FT                   /inference="similar to DNA sequence:INSDC:AE017137.1"
FT                   /inference="profile:HMMPfam:PF01547"
FT                   /protein_id="CAJ47707.1"
FT                   /translation="MFAKSCAATAVALTLVSGAAFAQKVPEGYPADYQKIIDGAKKEGK
FT                   VVIYSTTDTKAAAPLVAGFEAAFPGVKVEYNDMNSTELYNRYISEQASGSASSDVVWSS
FT                   SMDSALKLAVDYAMQYKSAEARYLPSWAIWKDSAYGTTFEPAVFIYNKRLIDAADVPTT
FT                   HTALATLISGNPERFKNKVTTYDIEKSAVGFMLAVQDKAHQPDYFKNLSEIAKGGLVVQ
FT                   SSTGTMMERVSSGENLLGYNILGSYAETRAKNDPSLGISYPTDYTLVLSRVIFLSKKSK
FT                   NKNAAKLWLDYVLSKPGQEILANKSDLASIRDDIEGDNDVDGMTKKLGKALQPIPVNET
FT                   LLEYLEQKPRLEFIKEWRAAAAK"
FT   sig_peptide     103759..>103822
FT                   /locus_tag="BAV0101"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    104065..104088
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00501"
FT   CDS_pept        104941..106719
FT                   /transl_table=11
FT                   /locus_tag="BAV0102"
FT                   /product="ABC transporter, solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47708"
FT                   /db_xref="GOA:Q2L1P7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1P7"
FT                   /inference="similar to DNA sequence:INSDC:AJ414155.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00528"
FT                   /protein_id="CAJ47708.1"
FT                   /translation="MQSLRRKWQSLPRGIVVLLTALAIYVPLSFIIVQSFLSAPFFAPS
FT                   KYFSLDAFRFIFDDPDFYKALRTGFILAFGLAIISIPLGGMLAFLMIRTDLPGRRWIEP
FT                   LILVPIFVSPMVLGFGYVVAAGPVGFFSLWAEHLLGFVPWNVYSLTSIVIIAGLTHVPH
FT                   AYLYISSALRSMGSDVEEAARVAGASPLRVMMSVSLPMVRPAMLYATVLLFFLGLEVFG
FT                   LVLVLGDPEGNLVLATYLYKLTNKLGIPSYHLMAAVAVVLIAMTIPLVMLQRRLMRTAN
FT                   RFVTMKGKASRARPLPLGRWRWVAGGVVAFWLLVTIVVPLIGVLLRAFVSNWGMGVSLL
FT                   DVLSLDAFRTVFSQTNLIRAIVNSVAIGVFGGALAVFCYLFIGLAMHRKPDNVTRFLDY
FT                   SVLVPRAVPGLLAGLAFLWVFLFVPMWLENALDPDMGGWLSGLPFADWARENVVEWLRA
FT                   LRSTIFSVWLAYTVVWMAYGLRLISSTLLQVGPELEEAARSTGATRGQVTRHVTVPLAK
FT                   YGLIGSWLLMFLIFEREYSTGVYLLSPGTETIGSMLVSLWASGAIDIVAALSFINIVLV
FT                   VVGLGIALRFGVKLHD"
FT   sig_peptide     104941..>105067
FT                   /locus_tag="BAV0102"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    105454..105540
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00402"
FT   misc_feature    106396..106482
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        106712..107779
FT                   /transl_table=11
FT                   /locus_tag="BAV0103"
FT                   /product="probable ABC-transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47709"
FT                   /db_xref="GOA:Q2L1P2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1P2"
FT                   /inference="similar to DNA sequence:INSDC:AJ414155.1"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ47709.1"
FT                   /translation="MIELSVEDLHLDYGDNPVLKGVSMELRQGEVVSLLGPSGSGKTTL
FT                   LRAVAGLEGPKAGRINIGERVVFDGANRKEVPAEDRNLGLVFQSYALWPHKTVFDNVAY
FT                   PLKLRGVPGAEVRQRVQDVLDQLGLGKLGQRHPHQLSGGQQQRVAIGRALVYSPPVILL
FT                   DEPLSNLDAKLREEARAFLRELIVRLGLSALMVTHDQSEAMAISDRILLLNNGKIEQQG
FT                   TPQEMYGSPATLFTAEFMGSNNRLDGRITEVRDGRARIEGNGWVLWGHAAEGVAAGKDG
FT                   TAVIRVEQVRLQDDPDGNHLDLPLITCMYLGDRWEYLFRAQDGLSLRAYGPQGRQPGTC
FT                   RLSMPASNVWVFPRD"
FT   misc_feature    106817..106840
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    107129..107173
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        107991..108449
FT                   /transl_table=11
FT                   /locus_tag="BAV0104"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1P0"
FT                   /protein_id="CAJ47710.1"
FT                   /translation="MPSYLLRHHDRHGLPGYLPGTMESSQWFEQLDCGNVFRNAFSADC
FT                   WILQNNQRPVRQAGYYASDVVLQQYALMSTRHGFAGCPPRQLRLQTVVNGSALRLLGCP
FT                   GVRLSDFLSDCELGRFTARVLQGAGLVADGMEWRPDQRDLLLWLSVRP"
FT   CDS_pept        complement(108433..110589)
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /locus_tag="BAV0105"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47711"
FT                   /db_xref="GOA:Q2L1N7"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1N7"
FT                   /inference="similar to sequence:UniProtKB:P37330"
FT                   /inference="profile:HMMPfam:PF01274"
FT                   /protein_id="CAJ47711.1"
FT                   /translation="MTTRIAGLQVANSLYQFIENEALPGSGLDSQTFWEGFAAIIHELG
FT                   PRNRELLAERDRLQAELDSWHRSHPGPVRDPAAYRAFLRDIGYLQAPPADVRARTENVD
FT                   HEIARQAGPQLVVPMSNARYALNAVNARWGSLYDALYGTDAIPGSAGPDYNPQRGQAVI
FT                   ERARDFLDSAAPLEQGSHRQAIAYFVRDARLVIATAEGETTLKQAAQFRGYQGSAATPQ
FT                   AILLAHNGLHFELQIDRQHLIGATDPAGVKDLLMESALTTIMDCEDSVAAVDAQDKTHI
FT                   YRNWLGLMRGDLTESVTKNGKTFTRRMNADRSYTAADGQSLTLPGRSLLFVRNVGHLMS
FT                   NPAILDRDGREVPEGIMDAVITTLAAKVDLAQRRNSRTGSIYIVKPKMHGPAETAFADS
FT                   LFTRVEDLLRLPRHTIKMGIMDEERRTSLNLKACIAAAADRVAFINTGFLDRTGDEMHS
FT                   VMQAGPMLRKGDMKSSAWIAAYERNNVLVGLNCGLRGRAQIGKGMWAMPDLMAAMLEQK
FT                   AAHPKAGANTAWVPSPTAATLHALHYHQVDVPAVQRSLEQTRLTEVADELLDGLLTIPV
FT                   GDPADWSAQDIQHELDNNVQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQ
FT                   HIANWLLHGVVSPDQVRLTFERMAAVVDQQNAGDPGYLPMAGHFTTSYAYRAATALVFE
FT                   GLSQPNGYTEPLLHQYRLAFKAAH"
FT   CDS_pept        complement(111030..111410)
FT                   /transl_table=11
FT                   /locus_tag="BAV0106"
FT                   /product="Putative exported protein"
FT                   /note="Similar to several exported proteins from
FT                   bordetellae. It appears to be unique to the bordetellae.
FT                   There are no similarities to protein from other organisms."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47712"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1N3"
FT                   /inference="similar to DNA sequence:INSDC:BX640437.1"
FT                   /protein_id="CAJ47712.1"
FT                   /translation="MKLLATAVVLSLGVMAGAQAADIEPTRAQVQAELAQAKASGQYTF
FT                   GEEAYPAAIVQHGELSSAQVRQELAQAEQAGLVTTADGDYPPAAQAGDSTLTRAQVRAD
FT                   LAHAKAEGLVTYGNLDYPPHHG"
FT   sig_peptide     complement(<111347..111410)
FT                   /locus_tag="BAV0106"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(111640..112623)
FT                   /transl_table=11
FT                   /locus_tag="BAV0107"
FT                   /product="putative 4-hydroxybenzoate--polyprenyl
FT                   transferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47713"
FT                   /db_xref="GOA:Q2L1N0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1N0"
FT                   /inference="similar to sequence:UniProtKB:P32378"
FT                   /inference="similar to RNA sequence, mRNA:INSDC:AB055079.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF01040"
FT                   /protein_id="CAJ47713.1"
FT                   /translation="MRYSRARRHMPPRPLFLTVLPTVTATSHPDLSDIVFDDWVERWLP
FT                   RSWRPYARLCRLDRPIGTWLTLLPCIAALVQAAGGWPDVWRLIIFSLGALLMRGIGCTV
FT                   NDMWDRDIDKHVERTRFRPLTSGQLSMRQAVWFLLGQLLVCASLLFFINDLSRWWALGV
FT                   LPFVFIYPFCKRVTYWPQAVLGVCFNWGMLMAWTDTQNHLPLAGVAMWLGAVLWQIGYD
FT                   SIYAYVDVRDDRKLGLHSTAMRFADQGKRWIGGFYLASALLWAWAGYAMGMGWTYFVGM
FT                   ALVALHLTWQLLVFDLRRPDRNFMLFRANLWTGVLLIASALAGTLL"
FT   misc_feature    complement(112243..112311)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00943"
FT   sig_peptide     complement(<112524..112623)
FT                   /locus_tag="BAV0107"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(112641..113840)
FT                   /transl_table=11
FT                   /locus_tag="BAV0108"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47714"
FT                   /db_xref="GOA:Q2L1M6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1M6"
FT                   /inference="similar to DNA sequence:INSDC:AE011819.1"
FT                   /protein_id="CAJ47714.1"
FT                   /translation="MDKPFEPTCTFSERAQQLTSSAIRELLKITERPEVISFAGGLPAP
FT                   GGFPIEVVRAAFDKVLSTNGRAALQYGPTEGYAPLRQWLADDLSRTGAHVTADQILIVS
FT                   GSQQALDLLGKVLIDKDSKVLVEDPTYLGALQSFSLYQPRYVPVPTDDGGLIPELITPE
FT                   LADGARFLYALPNFQNPTGRTMNRERRVALVQRAAALGLPIIEDDPYGELRYAGEPQPG
FT                   LQALGEEFGATVIRLGTFSKVLAPGLRLGYIAGPRKIINKLTQAKQATDLHTPTLTQMA
FT                   VYEIIKDGFLDEHLPNVREIYRRQGSCMLEAVTREFPASVHWTKPEGGMFLWVTLPEHV
FT                   DSTKLLAQAIEQNVAFVPGGPFYTGTPRSNTLRLSFATVPEDKINTGIAILGKLLHKHV
FT                   "
FT   CDS_pept        113981..114469
FT                   /transl_table=11
FT                   /locus_tag="BAV0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47715"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1M3"
FT                   /inference="similar to sequence:UniProtKB:P76270"
FT                   /protein_id="CAJ47715.1"
FT                   /translation="MFQASTLSTDFKPQFYQELAAQARALLDGEHDRIANAANFAALIW
FT                   QSVPDINWSGFYFFDGQELVLGPFQGKPACVRIALARGVCGAAASLRQTQVVPDVHAFP
FT                   GHIACDAASRSEIVVPLLRDGQLLGVWDVDSPTPGRFDDADREGMEALCQVFLHSLAR"
FT   misc_feature    114275..114328
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01320"
FT   CDS_pept        114744..115673
FT                   /transl_table=11
FT                   /gene="dapA1"
FT                   /locus_tag="BAV0110"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47716"
FT                   /db_xref="GOA:Q2L1M0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1M0"
FT                   /inference="similar to sequence:UniProtKB:P05640"
FT                   /inference="profile:HMMPfam:PF00701"
FT                   /protein_id="CAJ47716.1"
FT                   /translation="MSSITEVEPLNTASRTASFQGVWVPLVTPFDEEGPDLFSLRRLMR
FT                   QYRDAGVDGVVVCGSTGEAAAMDEYEQLAVLDTVLDEAGALPVVMGLAGNHQRDVLRRQ
FT                   AVFNTRGLAGLLTPAPYYVRPGQAGLADYFRALADASAVPLILYDIPYRTGAHIDIDTL
FT                   LVLAEHPNIRAVKDCGGSLDKTQALIAHGGLQVLAGEDMQMLGTLAMGGSGLIAASAHV
FT                   RADLFVAMYQAMQAQQVALARQIYHALAPVMRLLFAEPNPAPLKGLLARQGVLREHLRA
FT                   PMAPASLALISQLEAAVAELDRRYPRAL"
FT   misc_feature    114744..114794
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00358"
FT   misc_feature    114903..114956
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00665"
FT   misc_feature    115185..115277
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00666"
FT   CDS_pept        116123..117745
FT                   /transl_table=11
FT                   /locus_tag="BAV0111"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47717"
FT                   /db_xref="GOA:Q2L1L7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1L7"
FT                   /inference="similar to DNA sequence:INSDC:AE016774.1"
FT                   /inference="profile:HMMPfam:PF00732"
FT                   /inference="profile:HMMPfam:PF05199"
FT                   /protein_id="CAJ47717.1"
FT                   /translation="MTASVGTNDLVFDYIIVGAGSAGCLLANRLSADPALRVLLIEAGG
FT                   EDNWHWIHIPVGYLYCIGNPRTDWCYRTQADPGLNGRSLVYPRGRVLGGSSAINGMIYM
FT                   RGQQADYDGWAALGNTGWAWDDVLPYFKSCEDHHAGASAFHGAGGEWRVERQRLSWDLL
FT                   QAFRLAAAQTGIASVQDFNQGDNEGCDYFEVNQCRGVRWTAAKAFLHPVRRRPNLTVMT
FT                   GARAERIVFEQRRAVGLQFLNDGGQRRLAQARVEVVLSAGAIGSAQLLQLSGVGPGVHL
FT                   QSLGLPLVHDAPGVGGNLQDHLQLRLIYRVSNARTLNTMAGSWWGKAAMAAQYLWSRSG
FT                   PLSMAPSQLGAFARSSAEQSRANVQYHVQPLSLDRFGEALHGFPAFTASVCNLRPTSRG
FT                   RVRIVAADAQTPPEILCNYLSTEEDCQVAADSIRLTRRIVAQPALRAYQPQEYKPGIQA
FT                   QSAEDLVNAAREIGTTIFHPVGTCRMGVDEAAVVDPQLRVKGVSGLRVIDASIMPLITS
FT                   GNTNSPTIMIAEKGAALLRRAYP"
FT   misc_feature    116162..116194
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    116387..116458
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00623"
FT   CDS_pept        117839..119101
FT                   /transl_table=11
FT                   /locus_tag="BAV0112"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47718"
FT                   /db_xref="GOA:Q2L1L5"
FT                   /db_xref="InterPro:IPR009978"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1L5"
FT                   /inference="similar to DNA sequence:INSDC:AB028938.1"
FT                   /inference="profile:HMMPfam:PF07399"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47718.1"
FT                   /translation="MTQPIEIIATLLFALAVLHTFSVPVFARLAHRNGPHAGIWHLLSE
FT                   VEAVFGVWAFALIAVMAALQGSHAAVAYMDTRNFTEPLFVFVIMVVASSRPILELVNML
FT                   VKVIARALPVRRELATFFVVMSVVPLGGSFITEPAAMTLAALLLRDGYFRVQGRAGFKY
FT                   LALGVLFVNVSIGGVLTSYAAPPVLMVASTFEWNTAFMAANFGWRAAIAVFLNAAVLTL
FT                   VCCEALLAGDAKAPDGEARAPVPWPVMLVHVLFLVGVVLTAHHPAVFLGLMMMFIGFAE
FT                   AYKRHQSRLLVKEGLMVGFFLAGLVVLGGLQKWWLQDLLGGLEPWVLFWGATVLTAITD
FT                   NAALTYLGSLVEGSSASWRYMLVAGAVTGGGLTVIANAPNPAGFAILKSHFPDGSISSG
FT                   KLFLAALVPTCVAAALFLLPT"
FT   sig_peptide     117839..>117917
FT                   /locus_tag="BAV0112"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        119274..119582
FT                   /transl_table=11
FT                   /locus_tag="BAV0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47719"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1L1"
FT                   /inference="similar to DNA sequence:INSDC:BX321864.1"
FT                   /protein_id="CAJ47719.1"
FT                   /translation="MPIYAYKCSSCGYAKDVLQKMSDAPLTVCPECGHNTFNKQVTAAG
FT                   FQLKGSGWYVTDFRNNSASNAATGKAAPAETASAPSSGDAAVSASPPASPPTSSTSD"
FT   CDS_pept        <119585..120220
FT                   /transl_table=11
FT                   /locus_tag="BAV0114"
FT                   /product="putative membrane protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47720"
FT                   /db_xref="GOA:Q2L1K9"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1K9"
FT                   /inference="similar to DNA sequence:INSDC:AL646059.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF04367"
FT                   /protein_id="CAJ47720.1"
FT                   /translation="VFKKYFIAGLLIWVPLAITIWVLGLLVATLEGFVPGFLSSESLFG
FT                   VEIPGFGFVLVIVVVLLTGVLAANLIGRSLFDQWERILGRIPLVRSIYNSVKQVSDTVL
FT                   APNGRAFRQAVLIQYPRAGSWTIAFLTGAPSGEVAQHLPGEHLSVYVPTTPNPTSGFFL
FT                   MMPRSEVVDLDMSVDAALKYIVSMGVVAPPDHSGMHPHPPAEAHRAEP"
FT   sig_peptide     119585..>119663
FT                   /locus_tag="BAV0114"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        120260..122050
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /gene_synonym="tls"
FT                   /locus_tag="BAV0115"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47721"
FT                   /db_xref="GOA:Q2L1K6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L1K6"
FT                   /inference="similar to sequence:UniProtKB:P21889"
FT                   /inference="profile:HMMPfam:PF01336"
FT                   /inference="profile:HMMPfam:PF00152"
FT                   /inference="profile:HMMPfam:PF02938"
FT                   /protein_id="CAJ47721.1"
FT                   /translation="MRTCYTGQVCRDHLGQTVTLYGWVNRRRDHGGVIFIDLRDRTGLA
FT                   QIVFDPDNAGAFGTAERLRNEFCVRVTGLVRERPQGTTNAELASGEVEVLCRDVEILNP
FT                   SVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQRNLMLRYRVSIEVRKFLDQLGFIDIET
FT                   PMLTKSTPEGARDYLVPSRVNAGHFFALPQSPQLFKQMLMVSGFDRYYQITKCFRDEDL
FT                   RADRQPEFTQIDCETSFLTETEIRAVFESMIRHVFKVVQNVDLPDPFPIMTWTEAMARF
FT                   GSDKPDMRVNLEFTDVADIMRDVDFKVFASAATTQGSRVVALRVPGGGELSRSEIDAYT
FT                   QFVGIYGAKGLAYIKVNDVAKGREGLQSPIVKNLHDAALAELVKRTGAQDGDIIFFGAD
FT                   RAKVVNDALGALRVKIGHSEFGKKTGLFSGGWRPLWVVDFPMFEYDEEEGRYTAAHHPF
FT                   TSPKDGHEDFLETDPSQAFAKAYDMVLNGWEIGGGSVRIHREEVQSKVFRALKIGPDEA
FT                   REKFGFLLDALQYGAPPHGGIAFGLDRIVTMMTGADSIRDVIAFPKTQRAQDLLTQAPS
FT                   SVDDKQLRELHIRLRNTEVK"
FT   misc_feature    120908..120961
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00179"
FT   misc_feature    121874..121903
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        122153..123013
FT                   /transl_table=11
FT                   /locus_tag="BAV0116"
FT                   /product="putative endonuclease/exonuclease/phosphatase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47722"
FT                   /db_xref="GOA:Q2L1K3"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1K3"
FT                   /inference="similar to DNA sequence:INSDC:AL646059.1"
FT                   /inference="profile:HMMPfam:PF03372"
FT                   /protein_id="CAJ47722.1"
FT                   /translation="MSLIRVVSYNIHKGRSSLGRHESLNDLRLGLYGLRPDLVFLQEVQ
FT                   GRNETTSMLHAQHESLAAALRLNVAYGCNAVRAATDHGNALLSRYDIVDHVNQDISDHR
FT                   LEQRGLLHARIDVGGTEVHCLVVHLGLFASSRQRQIQALTERIRAEVPDGAPLIIAGDF
FT                   NDWGDKLAPQFVQQLGLYEVFSHAPRTSGGELPRLRDSLRRLTAALRGVPGNTVVLERG
FT                   NQLGMDGTYCPLPPPRTFPAVFPWFRLDRIYQRGFAVRSARVLRGRQWAKLSDHAPLLT
FT                   ELELP"
FT   CDS_pept        <123010..124203
FT                   /transl_table=11
FT                   /gene="ybhO"
FT                   /locus_tag="BAV0117"
FT                   /product="putative cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47723"
FT                   /db_xref="GOA:Q2L1K1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1K1"
FT                   /inference="similar to sequence:UniProtKB:P75771"
FT                   /inference="profile:HMMPfam:PF00614"
FT                   /protein_id="CAJ47723.1"
FT                   /translation="VRVGRLSWTDGNTIRLLQTGAEFFPALCAAIDQAKQSVHLETYIF
FT                   VLDRTGERVLDCLERAARRGVRVRLVLDGFGSASEIPDIARRIQEAGGLCRIYRPEPRF
FT                   RLAFSRSRLRRLHRKVAVVDDDSAFVGGINIVDDYDDLDPTDDLSGPRFDFAVRVEGPL
FT                   VQQIRAMQDLLWLRLNLSSLRRHPEALRQLRLRRPRYAPTGGGLRAALVLRDNLRFRQT
FT                   FERAYLHCIEQARHEVLIANAYFFPGRRFRQTLAQAAARGVRVRLLLQGKPDHYLQYFA
FT                   TRALYDQLLRDGIEIYEYMPAYLHAKVAVMDGIAAVGSSNLDPFSLLLAREANVLVDDA
FT                   AFAGDLQARLESAIAEGGHGIRPLDYQRRGWGRRLLDALAYTALRVGVALTGRSDKY"
FT   CDS_pept        complement(124210..125097)
FT                   /transl_table=11
FT                   /locus_tag="BAV0118"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47724"
FT                   /db_xref="GOA:Q2L1J7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1J7"
FT                   /inference="similar to DNA sequence:INSDC:AL646070.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00892"
FT                   /protein_id="CAJ47724.1"
FT                   /translation="MQRQDFSQLLVLAAVWGGSFMFMKIAVPEFGPAALIELRVGLAAL
FT                   MLLPLVIARGRLGIMLRHWKAILLVGVFNAALPFLMYAYAASSLGAGFLSVSNAVTPVW
FT                   GAVFGWIWFRDKLPFMRTLGLMISFLGIVVLAWDKLDFQQGGTGPAVLAAISAPLFYGI
FT                   AANATKRYLSGVDALSNATGSMLAAALVLLPLAIAHWPEQAISLQAWSATILLAVLCTG
FT                   IAYVVFFRLIATIGPTAAVSVTFLVPLFGMLWGVTLLGEALTANMMGGAGIILAGTALA
FT                   LGLIGPKPPLAKAR"
FT   CDS_pept        complement(125109..126512)
FT                   /transl_table=11
FT                   /locus_tag="BAV0119"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47725"
FT                   /db_xref="GOA:Q2L1J5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1J5"
FT                   /inference="similar to DNA sequence:INSDC:AF080235.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF07690"
FT                   /inference="profile:HMMPfam:PF00083"
FT                   /protein_id="CAJ47725.1"
FT                   /translation="MTSPTKESASSPSSRHELLMAMVGVSATVVLAAFDSTIVSTTLPR
FT                   VAQALNGMALYAWVGTGYLLATAVSIIIFGRLGDMFGRKPLMLLSVSLVALGSIACGLA
FT                   QSMEQLIAFRTLQGVGGGMMIATAFAAPADLFPDARERVRWMALVSAAFAMASGIGPAL
FT                   GGIATQALGWRAAFFIAPIAAAIALFLLARYFPRIKPAQSGKVDWIGSILLIIIVGAPL
FT                   AAMELAFAPGDDARPGLAAVLAIAAVIAACCLPRYERRLASPIFPMRILAGPEPRLLNL
FT                   AAVMVGATMFILVFYSPLILQQELGYSPSEAGLLLTPLVAAISLGSIINGHMFPKQNEP
FT                   QRLMVFGGLLLAAGSAMVLGFSQGTSPWWIISAFAVNGVALGFLLPNLTLFMQMLSERR
FT                   DVGVASALVQTTRAVGSAAGTALVGIAISHTSVATGVRIGLTLCVVLSLFAAVIAHRVK
FT                   MKNAVTRRS"
FT   sig_peptide     complement(<126368..126512)
FT                   /locus_tag="BAV0119"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(126543..127106)
FT                   /transl_table=11
FT                   /locus_tag="BAV0120"
FT                   /product="putative carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47726"
FT                   /db_xref="GOA:Q2L1J2"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1J2"
FT                   /inference="similar to DNA sequence:INSDC:X82447.4"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF06240"
FT                   /protein_id="CAJ47726.1"
FT                   /translation="MRIADAQWIPSPPHQTWDALFDPEVLQRCLPGCIRVIRLTDTEYA
FT                   ITVRAKVGGIDAEYEGELLVSDITPSESCSLAFDGKGAAAGLAIGTAQINLSPKENGTR
FT                   LSYTVAAMTGGKLAALGEPAILKAGGKIVEKFFGGFIDYMAGQPRLAPPAPAPEPRALA
FT                   TSRWSWALAIAVIAVLVGYHTLFK"
FT   CDS_pept        127293..129035
FT                   /transl_table=11
FT                   /locus_tag="BAV0121"
FT                   /product="Putative filamentous surface protein"
FT                   /note="Similar to the N-terminus of fhaS in B.
FT                   bronchiseptica"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47727"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1J0"
FT                   /inference="similar to DNA sequence:INSDC:BX640444.1"
FT                   /inference="similar to DNA sequence:INSDC:AE005304.1"
FT                   /inference="profile:HMMPfam:PF05860"
FT                   /inference="profile:HMMPfam:PF05594"
FT                   /protein_id="CAJ47727.1"
FT                   /translation="MSQIMKPFSLARLKRLSCALSIGAYVLSGAGLGLAAMPVQAADVI
FT                   NIAAPNQHGLSINKVGSFNVGAAGTVLNNSTVAGQSQLAGHLQANPNLAGGQAAKNILI
FT                   QSQGIGQSRLNGALESFGGNAGVIIANPNGISVNGLRPININSLTLTTGDYQAGQAGDA
FT                   VFDVKRGTISVGRRGVDTSGLGYFDLVADTISLNGVIGAPNKGKSTNITLLGGQNRYHV
FT                   QDDLAGKGRKRSYTALNGNKRERVVVMGTAAGSMYGSNISLLASGRGVGVKMQGLISSA
FT                   NDIQIDASGDVSLNKVAADGSAIVNGGKLVSIKHGVAEGDFLVTGKGDIQLDSLRTDNR
FT                   LVATAGGDLDAGDVKGSQLVLTAKNLRGDTLESEGDVTISARHDAELSHVQADGMVTAS
FT                   VGDNVTIADALRATGDVTINAGHTVRNQGVLLGDNLSISAKDIHNADGAQITADRNISL
FT                   VAGRNVSNGRGAKIAAGNDLDIVAGKEIRNVGGWLTAGGQRNLVAPIVIDQPPGSQAAV
FT                   KRGKSGSDQSNRGGSTSNNGAGTGNVGSFNHYASGYGDSYGNYGYGSAGWGQPSYSSYY
FT                   GGWY"
FT   sig_peptide     127293..>127413
FT                   /locus_tag="BAV0121"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    127893..127916
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    128835..128858
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(129071..130333)
FT                   /transl_table=11
FT                   /locus_tag="BAV0122"
FT                   /product="putative O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47728"
FT                   /db_xref="GOA:Q2L1I7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1I7"
FT                   /inference="similar to DNA sequence:INSDC:AF443424.1"
FT                   /inference="similar to DNA sequence:INSDC:U52844.3"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF04932"
FT                   /protein_id="CAJ47728.1"
FT                   /translation="MLKRLPSWLLVAVLAATPTLLLITASGGSTAFYLTLLLSIAALGC
FT                   REQALDLSAYRKLIVAACLPLAAMLLIAVLHGSLSSINLERGLRLALGMPLLLAGLQAT
FT                   GPQRLKHVLWGTLAAGWVAIVSLIALIGTHLSERPLTPEYNAVSYGNLLLLFGVINLFS
FT                   LSWPLTRYRRSEIAFKLLTTLVTFAGFIITQTRSGWLALPIFVALALLVYARFRHPLRL
FT                   FAALIVVLAGLIAVGSLSPALVKRVELGRQQLTECEANPLVNSSICVRLQLWRAAWGMM
FT                   LDNPIKGVGASGFSPALQKMAAEGKVSPYVAEDFGEPHNDMLDALALYGIPGGLALLLL
FT                   YAIPAVFFLRRLAYDLPQQVRAAAAMGASTSLGFAAFGLTELMFRGMRTLGLYVILIAL
FT                   FAVLSSAANGARASKKNSPGS"
FT   misc_feature    129078..134451
FT                   /note="LPS biosynthesis genes"
FT   misc_feature    complement(130199..130231)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(<130237..130333)
FT                   /locus_tag="BAV0122"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        130553..131428
FT                   /transl_table=11
FT                   /gene="rmlD"
FT                   /gene_synonym="rfbD"
FT                   /locus_tag="BAV0123"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47729"
FT                   /db_xref="GOA:Q2L1I5"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1I5"
FT                   /inference="similar to DNA sequence:INSDC:AF279623.1"
FT                   /inference="similar to sequence:UniProtKB:P26392"
FT                   /inference="profile:HMMPfam:PF04321"
FT                   /protein_id="CAJ47729.1"
FT                   /translation="MKILLLGKDGQVGRTLCRALAPLGELLALGRRPQPQGHVDLSDLA
FT                   SLSRLVREVNPDVIVNAAAFTAVDQAEREPDLAFRINAEAPEILARAMRERQGWLVHYS
FT                   SEYVYDGSGSEFRTEDSPTAPLNVYGLSKRAGDEAICRSGAHHLLLRTSWVYGSRGEGF
FT                   PQTVLRLAAASGTLRMVDDQVGAPTGADLLADVSALALWQACRRPAVSGLYHVAAAGAV
FT                   SRADYARHVLNQARLACATAPIASVDYPTPAQRPLNSRLDCTRLQRVFGLRLPDWRDGL
FT                   DRALASMRVN"
FT   CDS_pept        131458..132030
FT                   /transl_table=11
FT                   /gene="rmlC"
FT                   /gene_synonym="rfbC"
FT                   /locus_tag="BAV0124"
FT                   /product="dTDP-6-deoxy-D-glucose-3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47730"
FT                   /db_xref="GOA:Q2L1I1"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1I1"
FT                   /inference="similar to DNA sequence:INSDC:AF279625.1"
FT                   /inference="similar to DNA sequence:INSDC:AY529126.1"
FT                   /inference="profile:HMMPfam:PF00908"
FT                   /protein_id="CAJ47730.1"
FT                   /translation="MNFSPTTLPGVVLLDPKVFADARGWFAERFRQDVFEAGLRALGLP
FT                   VPAPFVQENHSCSRQGVLRGLHYQLAPHAQGKLVSVAVGEIFDVTVDIRPDSPTFGRWQ
FT                   GVTLSAVNRRSLWIPAGYAHGFLSLSGPSEVHYKTTAYYSPAHERSLRWNDPFMGIVWP
FT                   AEVSLLSERDERAPGLQEALASGQLDG"
FT   CDS_pept        132146..133153
FT                   /transl_table=11
FT                   /gene="waaC"
FT                   /gene_synonym="rfaC"
FT                   /locus_tag="BAV0125"
FT                   /product="lipopolysaccharide heptosyltransferase-1"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47731"
FT                   /db_xref="GOA:Q2L1H8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1H8"
FT                   /inference="similar to sequence:UniProtKB:P24173"
FT                   /inference="profile:HMMPfam:PF01075"
FT                   /protein_id="CAJ47731.1"
FT                   /translation="MPTRILIVRTSSLGDLVHMLPAISDIARHVPDAQIDWIAEEAFAE
FT                   IPGWHPAVRTVIKVAHRRWRKAWWSDQVRQERRALADRLRNEPYDIVLDMQGLLKSAWL
FT                   VRQTQGMRHGLDWRSAREPLASLFYNVRHRVEFWQPAVIRQRKLAAQTFGYSYSGAPDF
FT                   GLQAFSRPAEAEHPLVEEGRRLHHLNTDRGYAVIMPSASREDKLWPEEDWRAVFRRLQD
FT                   AGCALRLLAGNEQEAARARLLVAGMEGVEVLPRMDLTSVARVLAGARLMVGLDSGLTHL
FT                   SAALGRPTIGIYRASTPVRTPLVGSNYTASLGDRGASPSREAVMASVEQALAAH"
FT   CDS_pept        133163..134434
FT                   /transl_table=11
FT                   /gene="waaA"
FT                   /gene_synonym="kdtA"
FT                   /locus_tag="BAV0126"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47732"
FT                   /db_xref="GOA:Q2L1H4"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1H4"
FT                   /inference="similar to DNA sequence:INSDC:AF019747.1"
FT                   /inference="similar to DNA sequence:INSDC:AF026386.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF04413"
FT                   /protein_id="CAJ47732.1"
FT                   /translation="MRRSLYTVLLYTLAPLFWLGLWRRARRVPGQWDVLARTRFGHPEA
FT                   DPLRGAIWMHAVSLGETRAAQPLIDALLAQGLPILLTHMTATGRAEGARLFGDAIGRGQ
FT                   LRQVWLPYDFPGAVGRFFDAYEPRCGLIVEREIWPNLLAAANARGLPLALVNARFSASS
FT                   LRTSLRLGRVMREAMSGLDLVLAQSEADAQRLREAGARNVQVTGNLKFDVSLPEALLRE
FT                   GRAWREAVGRPVVAIASTREGEDLMFLQALGELPTPRPLYLLIPRHPQRFDEAWAQAEA
FT                   TGLRVGRRSAGAAGAELDILVGDSLGEMPFYYAAADVAVIGGSFAPLGGQNLIEACAAG
FT                   TPVITGPHTFNFEPATSDAIEAGAAQRVETARQALQLADQWLADPELLRQRAQAALAWT
FT                   TTHKGAVARSIDALAHRLKVGRQV"
FT   CDS_pept        complement(134431..134607)
FT                   /transl_table=11
FT                   /locus_tag="BAV0127"
FT                   /product="putative exported protein"
FT                   /note="Unique to Bordetellae"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47733"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1H1"
FT                   /inference="similar to DNA sequence:INSDC:BX640411.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ007747.1"
FT                   /protein_id="CAJ47733.1"
FT                   /translation="MRILFLVILLANIWAYSLGQGWLGPRPDDEGRDPRQLNRELNAGQ
FT                   ITLKPATKPGLPG"
FT   sig_peptide     complement(<134547..134607)
FT                   /locus_tag="BAV0127"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(134622..135401)
FT                   /transl_table=11
FT                   /gene="baf"
FT                   /locus_tag="BAV0128"
FT                   /product="Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47734"
FT                   /db_xref="GOA:Q2L1G9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L1G9"
FT                   /inference="similar to sequence:UniProtKB:Q45338"
FT                   /inference="profile:HMMPfam:PF03309"
FT                   /protein_id="CAJ47734.1"
FT                   /translation="MMLLIDSGNSRLKLGWLRSGAREPEPAAFDNLDLQALASWLQTLR
FT                   PRPTRAIGVNVAGQARGEAIAAILAQCGCSIEWMRPRREVLGMTNAYRNQAQLGADRWA
FT                   AMLGLRMRLPEGHPPALLASFGTATTLDTLGPDNEFAGGLILPGPTMMRGALVHGTANL
FT                   PLAEGPVTLYPTETHEAIATGIAAAQAGALARQWLAGQERYGQPPEVYVAGGGWTEVRP
FT                   EIERLLQLVGAPFGVAPVPVILQTPVLDGLAALASAL"
FT   CDS_pept        complement(135398..136225)
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="BAV0129"
FT                   /product="BirA bifunctional protein [includes: biotin
FT                   operon repressor; biotin--[acetyl-CoA-carboxylase]
FT                   synthetase"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47735"
FT                   /db_xref="GOA:Q2L1G6"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1G6"
FT                   /inference="similar to sequence:UniProtKB:P06709"
FT                   /inference="profile:HMMPfam:PF02237"
FT                   /inference="profile:HMMPfam:PF03099"
FT                   /protein_id="CAJ47735.1"
FT                   /translation="MSAQAIALPAPEALERAVQARLPSFTHVQWVASTGSTNADLLARA
FT                   RQTCAPKPWLLGAHLQEAGRGRAGRPWKNRSGATLMFSCAFNVRLPAAQLPAISPLAGL
FT                   AACEALRSLCGHDGVCVKWPNDVQWHDAKLAGVLAETTRNPDSDGYTVVIGMGLNLRDA
FT                   DTLSATLGRAIADWSQIEGSAAVEDAADIVRASALAWQTAIADLERDGFAAFVARFAQA
FT                   DALAERAVNVIDRGQIIHSGQAAGLDALGRLQVHTDAGLVAVSAGEISVRAHP"
FT   CDS_pept        136315..137448
FT                   /transl_table=11
FT                   /locus_tag="BAV0130"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47736"
FT                   /db_xref="GOA:Q2L1G3"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1G3"
FT                   /inference="similar to DNA sequence:INSDC:AL646058.1"
FT                   /inference="profile:HMMPfam:PF02405"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47736.1"
FT                   /translation="MHQQPLPDRDSQAPLIQRDGDVVYLGGDWSLQALAVRGQVQARRD
FT                   ALAQTHAHTRWDLRGIQRLDTIGANLLWRLWGERLPERVRLTDGQREVFNALAVNPGAV
FT                   APAPPVTDRLSWVRAIGQAIFDAAHNGIMLLRMLGQLVLDFIGLLLRPSRGPWREISAQ
FT                   IYRTGAQALGITALVGFLIGVVLSYLSAQQLQMFGADRFIVRLLGVSIVRELGPVLAAI
FT                   LVAGRSGSAITAQIGVMRVTQELDAMSVMGISQSQRLILPRVVALAITMPLLVLWTDAM
FT                   ALLGGMLAAQMQLGISAQWFLESLPNAVTITNYWIGMVKGVSFGVLIALVACHFGLRIK
FT                   PDTESLGRGTTTSVVTSITGVILVDALYAVILSGMGI"
FT   CDS_pept        137448..138272
FT                   /transl_table=11
FT                   /locus_tag="BAV0131"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47737"
FT                   /db_xref="GOA:Q2L1G1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1G1"
FT                   /inference="similar to DNA sequence:INSDC:BX321856.1"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ47737.1"
FT                   /translation="MAATLNDDGLTLTPVISVSGLRTAFGDHVVHDNLNLTVYPGEILV
FT                   LVGGSGSGKTVLLRQIIGLTRPARGEVRILGHDITKLTGAERRRLSERWGMLFQSGALF
FT                   SALTVFDNIALPLRELRTLPEDFIQDVVMCRLDMVGLNAKDALKSPSDLSGGMVKRVAL
FT                   ARALALDPELLFLDEPTAGLDPLRSDDFVDLVQSLHRQLGFTVVMVTHDLDTLLALATR
FT                   VAVLADKRVIACDTVPEILKINHPFIKSFFLGERGRRALGDLAPKEAGNGKS"
FT   misc_feature    137589..137612
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        138259..139185
FT                   /transl_table=11
FT                   /locus_tag="BAV0132"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47738"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1F9"
FT                   /inference="similar to DNA sequence:INSDC:AL646058.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF02470"
FT                   /protein_id="CAJ47738.1"
FT                   /translation="MENRSHALLAGVFTLVLLVAAALVAVWVGRDRTAFKFYDIVSSTP
FT                   VSGLTAQSAVRYQGVPVGKVQSLVLNPHKPGEVRIRIGVAPTTPITASTWAEIGVQGVT
FT                   GQANIELRDNGSSKELLVARGDQLPDIPLRPGFFDRLEQRGNALMAKFEDTAEELRKLM
FT                   SHSNVEALGVTLKNTAEISTQLNQVSRDLAPALRKVGPLVDSLDRASADAAQLMQAASQ
FT                   SLARLNAPDGPLANAGRSLQDIARAAARLNQDTLPAMTGMANSVSGAARDAQTVLRNLG
FT                   DSPQSLLFGPAPVEPGPGEPGFAGFRR"
FT   sig_peptide     138259..>138331
FT                   /locus_tag="BAV0132"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        139190..139780
FT                   /transl_table=11
FT                   /locus_tag="BAV0133"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47739"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1F7"
FT                   /inference="similar to DNA sequence:INSDC:AL646058.1"
FT                   /protein_id="CAJ47739.1"
FT                   /translation="MKKSYIAMAVVLTLAGCSVGRVAPQAARFDLGLEAPAQRQLPARV
FT                   PITLSYSAVPTLNDTGVIWRVADSTAPKAYAGFRWNEAPASLVRQRLQERLSREGAVLS
FT                   DSASPGAPQLRVELTRFEQVFAPDGRSSQGQVVLQALVLQNGKLLGQRRFARQADAPTQ
FT                   DAAGGVTALRQATDGAAEDLAAWLADLLPQAAG"
FT   sig_peptide     139190..>139256
FT                   /locus_tag="BAV0133"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    139208..139240
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        139813..140460
FT                   /transl_table=11
FT                   /locus_tag="BAV0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47740"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1F4"
FT                   /inference="similar to DNA sequence:INSDC:AL646058.1"
FT                   /protein_id="CAJ47740.1"
FT                   /translation="MSARTEILAFSGAAGRIDCAFDYPDGEPIGWALVLHPHPLHGGAR
FT                   DNKVVTTIARACANAGLIVVRPNFRGVGDSEGGFDRAVGETEDMLGLIPQIRQTLPELA
FT                   DAPWVLGGFSFGTAVAAQVYAMLAEQGAAPQALMLMGPAVARFQFRAVELPEDTLVVHG
FT                   EVDEVVPLAEAMDWARPLKLPVVVIPGASHFFHGKLLSLRNLVAQRLKLALG"
FT   CDS_pept        140593..141852
FT                   /transl_table=11
FT                   /gene="dacC"
FT                   /locus_tag="BAV0135"
FT                   /product="penicillin-binding protein"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47741"
FT                   /db_xref="GOA:Q2L1F2"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1F2"
FT                   /inference="similar to sequence:UniProtKB:P08506"
FT                   /inference="similar to DNA sequence:INSDC:AL646058.1"
FT                   /inference="profile:HMMPfam:PF00768"
FT                   /protein_id="CAJ47741.1"
FT                   /translation="MKTLSQSAFAPSVFSRRVISSAVLAVMLAASLPAAAQQQAPAAAA
FT                   PATSTPAPATAAVATVGELAAVPAPTIAARAWIAIDVNSGQVLAASNPDQKVEPASLTK
FT                   VMTAYVVFNALDEKRLTLDQQVPVSQHAWRTGGSRMFIEPRKPVTVDELIQGMIVQSGN
FT                   DASVALAEAVGGSETAFAALMNEQAERLGMKGTHFMNATGLPDPQHITTVRDLATLATH
FT                   LVSDHPEYYHYYKQKGFTYNKITQPNRNRLLWADPSVDGMKTGHTDSAGYCLISTALRG
FT                   DRRVLTVLVGADSEATRAEESLKLLNWSFQNFDTVKLYDKSQPGLDARVWEGKAENVKL
FT                   GPPNPVWLAVPRGKGNEIKPIAQRTDPLVAPLAKGQQVGTLEFTLDGKVLRTEPLVVQE
FT                   DVERAGFFGRMTDTVKRWFH"
FT   sig_peptide     140593..>140698
FT                   /gene="dacC"
FT                   /locus_tag="BAV0135"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        142004..142870
FT                   /transl_table=11
FT                   /gene="dat"
FT                   /locus_tag="BAV0136"
FT                   /product="D-alanine aminotransferase"
FT                   /EC_number="2.6.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47742"
FT                   /db_xref="GOA:Q2L1E9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1E9"
FT                   /inference="similar to sequence:UniProtKB:P54694"
FT                   /inference="profile:HMMPfam:PF01063"
FT                   /protein_id="CAJ47742.1"
FT                   /translation="MIPGMPGDSLVYLNGEYTRADQAKISVLDRGFIFGDGIYEVVPAY
FT                   RGKAFRITEHLNRLERSLAAIRIAMPMDRAALTALIERLIAGATTPECMVYLQVTRGVY
FT                   KRDHAFPAEAIAPTVFGMVTPMTPPSALQREQGVSVVSIKDERWLHCDIKSVSLLGNVL
FT                   ARQQAVEADADEVIQYRDGYLTEGSSSNIWIVRDGKLLAPPKNNLILEGIRYGLMAELA
FT                   QEGGVVFEARPISRAEVETADEILITSATKEVLPVLKRDGQVVGDGKPGPVYRLLRAGY
FT                   DARIAAL"
FT   CDS_pept        142922..143194
FT                   /transl_table=11
FT                   /locus_tag="BAV0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47743"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1E4"
FT                   /inference="similar to sequence:UniProtKB:Q8Y2K9"
FT                   /inference="profile:HMMPfam:PF04359"
FT                   /protein_id="CAJ47743.1"
FT                   /translation="MQIPPEDSLIEYPSDFPIKVMGKQHPEFAQTLTEVVLQFDPDFDP
FT                   AKLEMRPSKGGNYLGLTFTVRATSREQLDALYRALHGHPMVSIVL"
FT   CDS_pept        143198..143851
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="BAV0138"
FT                   /product="lipoyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47744"
FT                   /db_xref="GOA:Q2L1E2"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L1E2"
FT                   /inference="similar to sequence:UniProtKB:P60720"
FT                   /inference="profile:HMMPfam:PF03099"
FT                   /protein_id="CAJ47744.1"
FT                   /translation="MSMNVAWLSPGAAYADVWEAMKAFTASRGPATPDEIWLCEHAPVY
FT                   TLGQAGLPQHVLNPADIAVVRSDRGGQVTYHGPGQIVVYCLFDLRRAGMYVRDYVALLE
FT                   ETAIAVLGRAGIVAQRKPGAPGVYVEQPGQTLAKIAALGIKIRKGCAYHGLSLNVAMDL
FT                   TPFHGINPCGYEGLQTTDMASCGLSCSVHEVGQALADELVRRLSAYQGSLSSGE"
FT   misc_feature    143402..143449
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01313"
FT   CDS_pept        143905..144900
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="BAV0139"
FT                   /product="lipoyl synthase"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47745"
FT                   /db_xref="GOA:Q2L1D8"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L1D8"
FT                   /inference="similar to sequence:UniProtKB:P60716"
FT                   /inference="profile:HMMPfam:PF04055"
FT                   /protein_id="CAJ47745.1"
FT                   /translation="MSTQLDASQPSNDVASPAAYDPTQKQKSQAKTARIPIKVIPAERL
FT                   KKPEWIRVRAAAPGSRFYDIKRILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKC
FT                   TRRCPFCDVGHGRPDPLDAQEPENLARTIAALKLSYVVITSVDRDDLRDGGAAHFVECI
FT                   TKIRELSPITRIEVLVPDFRGRLDRALAILNAGPPDVMNHNLETVPRLYKQARPGSDYL
FT                   HSLKLLAEFKALHPDVPTKSGLMLGLGETDEEILEVMRDMRAHNVDMITIGQYLQPSEH
FT                   HLPVLRYVHPDTFAMFEREAYAMGFSHAAVGAMVRSSYHADEQAHAAGVN"
FT   CDS_pept        complement(144961..145524)
FT                   /transl_table=11
FT                   /gene="meaD"
FT                   /locus_tag="BAV0140"
FT                   /product="putative ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47746"
FT                   /db_xref="GOA:Q2L1D5"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1D5"
FT                   /inference="similar to DNA sequence:INSDC:AY388648.1"
FT                   /inference="profile:HMMPfam:PF01923"
FT                   /protein_id="CAJ47746.1"
FT                   /translation="MANRLSVITTRTGDDGSTGLGDGSRVPKDDPRIMALGDVDEFNST
FT                   LGLLRCEALPDEVSADLLTIQHDLFDMGAELCIPGHAALSDEQVAYLDARLAFYNAALP
FT                   PLREFILPGGTRAAALAHLARTAARRAERSVIALAAQAAVNAPLCQYLNRSSDLMFVLA
FT                   RYLNQSQGQADIYWSSRHSRVSGA"
FT   CDS_pept        145647..145952
FT                   /transl_table=11
FT                   /locus_tag="BAV0141"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47747"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1D2"
FT                   /inference="similar to sequence:UniProtKB:P77214"
FT                   /protein_id="CAJ47747.1"
FT                   /translation="MAFLRKHTMPAVMATAAAFVSLASPQVLAQTAQASGEVRRIDATA
FT                   GTVTLKHDAIAALDLPAMTLVYQAAPALLTNIKPGDKVRFTATRQDGRYVVTAISK"
FT   sig_peptide     145647..>145731
FT                   /locus_tag="BAV0141"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(146060..147394)
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /gene_synonym="htpI"
FT                   /locus_tag="BAV0142"
FT                   /product="ATP-dependent Hsl protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47748"
FT                   /db_xref="GOA:Q2L1D0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L1D0"
FT                   /inference="similar to sequence:UniProtKB:P32168"
FT                   /inference="profile:HMMPfam:PF00004"
FT                   /protein_id="CAJ47748.1"
FT                   /translation="MSASTMTPGEIVSELDKYIIGQNRAKRAVAVALRNRWRRQQVADP
FT                   LRHEIHPKNILMIGPTGVGKTEIARRLAKLANAPFIKIEATKFTEVGYVGRDVDTIIRD
FT                   LTEFSIKQTRELEMRRVRSHAEDAAEDRILDVLVPPARNAMGEPQRDDGNTTRQTFRKR
FT                   LREGSLDDLEIEIDIAQATPQLDVMTPPGMEEMAEQLRGMFAGLARDKTKPKKIKVKEA
FT                   FKLIIEEEAAKRVNEDDLRAAAIANVEQNGIVFLDEIDKIAARQESGGADVSRQGVQRD
FT                   LLPLVEGTTVNTRYGMVRTDHILFIASGAFHLSRPSDLIPELQGRFPIRVELDSLSADD
FT                   FVRILSETDASLVKQYTALLATEDVQLAFTEDGIKRLAELAFSVNERTENIGARRLYTV
FT                   MEKLLEELSFDAGASSGQSVTIDAAYVDAQLSEAASSQDLARYVL"
FT   misc_feature    complement(147197..147220)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(147421..147960)
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /gene_synonym="htpO"
FT                   /locus_tag="BAV0143"
FT                   /product="ATP-dependent protease heat shock protein"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47749"
FT                   /db_xref="GOA:Q2L1C6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L1C6"
FT                   /inference="similar to sequence:UniProtKB:P31059"
FT                   /inference="profile:HMMPfam:PF00227"
FT                   /protein_id="CAJ47749.1"
FT                   /translation="MEQFHATTIVCVRRGNRVALGGDGQVTLGNIVIKGTARKIRRLYH
FT                   DKVLAGFAGATADAFTLQERFEAKLEKHQGHLMRAAVELTRDWRTDRVLRRLEAMLIVA
FT                   DAEHTLVLTGNGDVLEPEHGLAAIGSGGAYAQSAALALLRNTELPPETIVKQSLEIAGD
FT                   LCIYTNQNHVIETLGG"
FT   CDS_pept        complement(148333..148797)
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="BAV0144"
FT                   /product="putative dnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47750"
FT                   /db_xref="GOA:Q2L356"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L356"
FT                   /inference="similar to sequence:UniProtKB:P18274"
FT                   /inference="profile:HMMPfam:PF01258"
FT                   /protein_id="CAJ47750.1"
FT                   /translation="MATKAVTKKSSKSTSDTAIDLPSEEELLAMPESDYMNERQLAFFK
FT                   ERLKQLEQDILANAGETTEHLRETQFVPDPADRATIEEEHALELRTRDRERKLLKKVQQ
FT                   AIVRIDSGEYGWCEETGEPIGVPRLLARPTATLSLEAQERREMRQKLYGD"
FT   CDS_pept        complement(148916..150013)
FT                   /transl_table=11
FT                   /locus_tag="BAV0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47751"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L355"
FT                   /inference="similar to DNA sequence:INSDC:AL646057.1"
FT                   /inference="profile:HMMPfam:PF07683"
FT                   /inference="profile:HMMPfam:PF02492"
FT                   /protein_id="CAJ47751.1"
FT                   /translation="MNTPRSLDKMVPVTILTGFLGAGKTTLLKRILTEFHGRRVAVIEN
FT                   EFGPESIDNDLLVQDSDEEIIELSNGCVCCTVRGDLMRTLNELRVKREAGQLSFERVII
FT                   ETTGMANPGPVCQTFFMDDDIADYYRLDAVVTVVDAKHGMATLDAQEEAQKQVGFADRI
FT                   LVSKRDLVNDADYEALRARLLRINPRAPITPVHFGEVELKSIIDISGFNLNSILDIDPD
FT                   FLADEHPDAKHAHDHDHDHHDHEHAGECGAHCDHAHHHHHHQHNDEIGAFVFRSNKPFD
FT                   PARLEEFLGGVVQVYGPDLMRYKGILYMKGINRRMLFQGVHMMMGAEPGKPWTAAEKPS
FT                   TKMVFIGRKLPQEIFTRGLEQCLVG"
FT   misc_feature    complement(148919..148930)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00294"
FT   misc_feature    complement(149939..149962)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(150354..150845)
FT                   /transl_table=11
FT                   /locus_tag="BAV0146"
FT                   /product="putative cation uptake regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47752"
FT                   /db_xref="GOA:Q2L354"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L354"
FT                   /inference="similar to sequence:UniProtKB:P32692"
FT                   /inference="profile:HMMPfam:PF01475"
FT                   /protein_id="CAJ47752.1"
FT                   /translation="MSAPARTSRADAVGEQLRLAESLCAERGRRLTPIRRKVLELLLTH
FT                   GRSLKAYELLDAMRAVHPGAAPPTVYRALDFLMDEGLIHRLDAVNAWTACHDAAGAPHD
FT                   LLVVCTGCGAVAEISDPAMSRLLAERVAQTGFALATHETEIRALCPQCQKNAPAAHHHH
FT                   "
FT   CDS_pept        151069..151782
FT                   /transl_table=11
FT                   /locus_tag="BAV0147"
FT                   /product="putative cation ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47753"
FT                   /db_xref="GOA:Q2L353"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L353"
FT                   /inference="similar to sequence:UniProtKB:O34338"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ47753.1"
FT                   /translation="MGHVVTPAAIELESVTFGWRGQPAVRDVSGRFAPGCMTAIIGPNG
FT                   AGKSTLVKGLAGVLAPMSGRLHRDSTSVAWLPQAAELDRDFPICVLDAVVLGGWRRIGA
FT                   LRAVDGDETARARLALRRVGLEQLAERPLQALSGGQLQRVLFARLLMQDAPVLVLDEPF
FT                   AAVDGQTTRVLMALLCALQAEGRSIIAVLHDMALVKEYFAQALLLSGRVLAWGPTADVL
FT                   SPERLAHGQLHLGYA"
FT   misc_feature    151192..151215
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    151474..151518
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        151779..152660
FT                   /transl_table=11
FT                   /locus_tag="BAV0148"
FT                   /product="putative cation ABC transporter, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47754"
FT                   /db_xref="GOA:Q2L352"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L352"
FT                   /inference="similar to sequence:UniProtKB:O35024"
FT                   /inference="profile:HMMPfam:PF00950"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47754.1"
FT                   /translation="MTLWQALCAPFFDFSFMRRALAGAVALAFGAAPLGVFLVLRRMSL
FT                   MGDAMSHAILPGVAAGYLLAGLSLGAMMAGGIVTGLVVALLSGLVTRLTSLREDASFAA
FT                   FYLISLALGVLLVSLRGSNVDLLHVLFGTVLGLGDDALLLAGLVSTLTLFSLALIYRLL
FT                   VAECFDPGFLRAAGGRGWLAHFGFLALVVINLVAGFQILGTLMVVGMMMLPALAARFWA
FT                   RRVAAQLPLAVVLAALASWCGLLASFHFDLAASPAIILAAGLIYLLSMVLGPQGGLRTR
FT                   LRWPRPALSKEV"
FT   sig_peptide     151779..>151842
FT                   /locus_tag="BAV0148"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        <152657..153589
FT                   /transl_table=11
FT                   /locus_tag="BAV0149"
FT                   /product="putative cation ABC transporter,substrate-binding
FT                   protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47755"
FT                   /db_xref="GOA:Q2L351"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L351"
FT                   /inference="similar to sequence:UniProtKB:Q9A157"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF01297"
FT                   /protein_id="CAJ47755.1"
FT                   /translation="VNMKLVWARCAAIAVLSILPAVAVWASPVKVVTSFSILQDMAREI
FT                   GGPDVEVQTLVGPDGDAHGFEPSAADSRKLAGADLLVINGLGFEPWLPRLVEASGFKGR
FT                   EVRASDGVKPRAFAEALDHEDHDHGHDHHHDVQDPHAWQDLRNGMIYAQNIGRALEQLD
FT                   PAHAAQYQQRTRAYVAKLEALQAKVEKTFAAIPAERRKVVSTHDAFAYFGEAYGVRFIP
FT                   VAGLSTLSEPSASGFAEVVKRVKREHVPALFIENIGNPRLAEQIARETGAKVGGTLYSD
FT                   ALSAPGKPGATYLGMFEWNVQQLAAALQP"
FT   sig_peptide     152657..>152732
FT                   /locus_tag="BAV0149"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        <153595..154215
FT                   /transl_table=11
FT                   /locus_tag="BAV0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47756"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L350"
FT                   /inference="similar to DNA sequence:INSDC:AJ414154.1"
FT                   /inference="profile:HMMPfam:PF06226"
FT                   /protein_id="CAJ47756.1"
FT                   /translation="VILPISALAHPHMWVDAQAEVMFDDQGRVAALRQVWLFDEMFGAY
FT                   ATQGLPRAADGGLAEDTRKTMAIDWMKALGEPISHYFTRVTREGATLAFGAPRDAQVQW
FT                   DGQRLSLAFTLPLAQPVAPGPQGLAIDVFDPTYFVAYAFDAPKAWRLSNAPANCRQTYR
FT                   PPQPLDWKTMQQLAAIPSNVDTLPDELFAITKGLTHRNELRCP"
FT   CDS_pept        154212..155129
FT                   /transl_table=11
FT                   /locus_tag="BAV0151"
FT                   /product="putative high-affinity nickel-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47757"
FT                   /db_xref="GOA:Q2L1C1"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1C1"
FT                   /inference="similar to DNA sequence:INSDC:AE009378.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF03824"
FT                   /protein_id="CAJ47757.1"
FT                   /translation="MRSAARIVPWMLVFALALAAGQVWAQSHPFAVPEAGGSPWLAQIS
FT                   VWQSHFYRQLTGAVRAWRDDGSWLLVGLSFAYGVFHALGPGHGKAVISAFVLANHQSAR
FT                   NGAVLALLSALVQALVAIALVALLAAVFNVTAQVMNAGTRWLEMASYLMIVALGVWLLW
FT                   TKALRPWLRPGRRHLHHAACGCGHVPPLSLMSGRLDWRRAWTAVVAVGLRPCSGALIVL
FT                   VFALSQGLFAAGVVATLAMGLGTGLTVALLAMTAVWTRNALTNSSYLSPKWAARLRYGI
FT                   ESVAALAVLLLGLLLLGGQVAGAA"
FT   sig_peptide     154212..>154284
FT                   /locus_tag="BAV0151"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        155225..157255
FT                   /transl_table=11
FT                   /locus_tag="BAV0152"
FT                   /product="TonB-dependent receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47758"
FT                   /db_xref="GOA:Q2L1B3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1B3"
FT                   /inference="similar to sequence:UniProtKB:P37409"
FT                   /inference="similar to DNA sequence:INSDC:AY271621.1"
FT                   /inference="profile:HMMPfam:PF00593"
FT                   /protein_id="CAJ47758.1"
FT                   /translation="MRFTSRPSHAALAMAFAAAPVFAAEPEAVTLTPITISADPLGQNQ
FT                   NSTASPVTVLDGQALVERRQGTLGDTLNGLPGVHSDTFGAGASRPVIRGQTSPRVSVLS
FT                   DGSSLLDASAISPDHAITIEPLLADRIEVLRGPATLRFGGGSIGGVVNVLDKRIPTEKP
FT                   EGGLAAEAELRGATGTKERAGIIGITAGTDSFVVRVEGLKRRSSDYAVPHWSSGKLAGS
FT                   YSESTQGSVGMSWIGPRGYIGLAFTHIESEYGLPGHNHEYEGCHPHGTHLHCGHHDHDH
FT                   DHDDHAHEEGQVPYVRLRSNRTDLRAEYSDPLPGFSKLRLRGGFTDYQHDEIEGGQVGT
FT                   TFKNQGFDTRLELEHKPWMGLRGVIGLQTAFSDFRAQGEEAFLPRSKTRSNGLFLLEEY
FT                   RLNDWRFEAGARQDWQSISPEGGLKKSRLSGTSLSAAAIWDFAPSYSVALSLSRSQRMP
FT                   SAQELYADGVHLATNTYEIGNAGLTRETSRNIDLTLRKHEGDTTFSLSAFHNRVNNYIY
FT                   ANTLDRFEDFRLIEYTQKDAEFVGIEGELKHQFTPILSAGVFGDYVRGKLTGGQGNLPR
FT                   IPAARLGARANFKWQAWSGGLEYAYVFRQKDIASYESETPGYALVNAVLSYRFKAAGAQ
FT                   YDVYVRGNNLLDKLAYNHASFLSSVAPLPGRSVMLGVRMSY"
FT   CDS_pept        complement(157249..158226)
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="BAV0153"
FT                   /product="tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47759"
FT                   /db_xref="GOA:Q2L1B0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1B0"
FT                   /inference="similar to sequence:UniProtKB:P22885"
FT                   /inference="profile:HMMPfam:PF00589"
FT                   /inference="profile:HMMPfam:PF02899"
FT                   /protein_id="CAJ47759.1"
FT                   /translation="MSLLAPPLEDWLQHLQTQRRYSSHTLAAYRHDLESLAALATQAGL
FT                   ALQDLSVSHIRQQIARLHAQGLGPRSLARRLAAWRGFYQWWAPHIGLARNPVAGVRAPK
FT                   APRALPKALSVDQAQAMLDHAPAQLSTDPVSLRDHAISELLYSSGLRLSELVSLDTHYH
FT                   RHTGSEEPAGWLNRAEAEVVVLGKGGKRRIVPVGSAALAALDKWLQARPTLLSAATPAA
FT                   DSYALFLGARGARISPRVVQLQLARLAQQAGVPAHVHPHVLRHSFASHVLQSAQDLRAV
FT                   QELLGHANIATTQVYTRLDFQHLAKVYDQAHPRANRKPEDNSDQ"
FT   CDS_pept        complement(158226..158900)
FT                   /transl_table=11
FT                   /locus_tag="BAV0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47760"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1A5"
FT                   /inference="similar to DNA sequence:INSDC:AL646057.1"
FT                   /inference="profile:HMMPfam:PF04340"
FT                   /protein_id="CAJ47760.1"
FT                   /translation="MTTIDPSAEDIARYLQEHPSFFDEHAAIFSNLHIPNPHGGRAISL
FT                   AERQILTLRERNRSLEWRLNELVRNAGDNEKISQQITLWSERLLRETDTTRLPGEIALG
FT                   LAEQFNLDHTGLRLWNLAGLPRTGEHAYGADVSDDVRTFADSLKTPYCGNDTGFEAVRW
FT                   LDSTPKSLALIALRLAPELPSIGLLVLGSDDAARFTPEMGTAFLETIGRLASAALGRLA
FT                   TA"
FT   CDS_pept        complement(158933..159829)
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="BAV0155"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47761"
FT                   /db_xref="GOA:Q2L1A2"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1A2"
FT                   /inference="similar to sequence:UniProtKB:P08885"
FT                   /inference="profile:HMMPfam:PF01678"
FT                   /protein_id="CAJ47761.1"
FT                   /translation="MGDNPCMIWNFTKMHGAGNDFVVLDGVRQTIDMTPERARALGDRH
FT                   FGVGADQILLVEPATRPDADFRYRIFNNDGSEVEHCGNGARCFVRFVHEQGLSSKNPLR
FT                   AEIVSGLIVLDEGDDEQVTVEMGTTRFDPAALPFDVSGLAQRQQGQDTLYVLPLPGGEI
FT                   ELSAVAISNPHAVQVVADVDQAPVSEVGAHIESHPRFARRVNAGFMQIQDRHNIRLRVY
FT                   ERGAGETLACGTGACAAVAAGIRRGLLDSPVRVQTRGGALTIAWNGEQLRMTGPAESVF
FT                   SGQVDIDKLVLSLALNR"
FT   misc_feature    complement(159572..159616)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01326"
FT   CDS_pept        complement(159868..160761)
FT                   /transl_table=11
FT                   /gene="htrB1"
FT                   /locus_tag="BAV0156"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47762"
FT                   /db_xref="GOA:Q2L198"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L198"
FT                   /inference="similar to sequence:UniProtKB:P24187"
FT                   /inference="profile:HMMPfam:PF03279"
FT                   /protein_id="CAJ47762.1"
FT                   /translation="MKKDYKTRALTGLLSWFGRMSPRARQRAGAVVGWLALHLAKSRAR
FT                   IVRRNLEICFPGESPQTREKWTREHFRALGQSIVDRGVLWYGSAEAIREMASVSGADTI
FT                   NALAASGRPVILLAPHFIGLDVAATRLTMEVPSGATMYTPQRDPAVDAIVRAGRARFNE
FT                   VFLVSRKDGVRDLIRHFRAARPVYYLPDMDFGRNGSVFVPFFGVPAATLVATAQLARKW
FT                   NAAVLPILDFWNPTTGRYHVEVLPPLADFPGEESLEDATARLNRELEGWIRRCPSQYYW
FT                   VHRRFKTRPEGSPKLY"
FT   CDS_pept        complement(160758..161600)
FT                   /transl_table=11
FT                   /gene="htrB2"
FT                   /locus_tag="BAV0157"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47763"
FT                   /db_xref="GOA:Q2L195"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L195"
FT                   /inference="similar to sequence:UniProtKB:P24187"
FT                   /inference="profile:HMMPfam:PF03279"
FT                   /protein_id="CAJ47763.1"
FT                   /translation="MLLAFFRLLAFLPLSVLQTLGQVLGRLAYALPGKYGRRLRANATQ
FT                   AGYPEAAFARRSAGQIGAMILETPKVWFHEDASLEKLDPGQDTDVVDAAIAEKRGVVFL
FT                   TPHLGCYEVVARYLARKIPLTVMFRPPRKAILAPLLESARNNAKVRAVPATMQGVREFV
FT                   RALRRGEAVGLLPDQAPGEGEGVWAPYFGRMAYTVTLPGKLAGQTGVPVILCAAQRLPM
FT                   GRGWKLHFTRVPDPLPADAQAQAALLNACMETLIRRFPEQYLWGYNRYKTPRGAPPAP"
FT   CDS_pept        <161863..163026
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="BAV0158"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47764"
FT                   /db_xref="GOA:Q2L190"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L190"
FT                   /inference="similar to sequence:UniProtKB:P04384"
FT                   /inference="profile:HMMPfam:PF00438"
FT                   /inference="profile:HMMPfam:PF02772"
FT                   /inference="profile:HMMPfam:PF02773"
FT                   /protein_id="CAJ47764.1"
FT                   /translation="VANNDFLFTSESVSEGHPDKVADQISDAILDAIFTQDPNARVAAE
FT                   TLCNTGLVVLAGEITTSANVDYIQVARDTIRRIGYDNTEYGIDYKGCAVLVAYDKQSPD
FT                   IAQGVDRSSEDYLNQGAGDQGLMFGYACDETPDLMPAPIWYAHRLVQRQSELRKDGRLP
FT                   WLRPDAKSQVTFRYVDGRPVEVDTVVLSTQHAPEISQSAIREAVIEDIIKPCFPEGLIT
FT                   PQTKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPSKVDRSAAY
FT                   AARYVAKNIVAAGLARQCQVQVSYAIGVAEPINITVYTEGTGVIPDDQLAKLVREHFDL
FT                   RPKGIVNMLDLLRPIYTKTAAYGHFGRSEPEFSWEATDKVQALKKAV"
FT   misc_feature    162220..162252
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00376"
FT   misc_feature    162649..162675
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00377"
FT   CDS_pept        163224..163448
FT                   /transl_table=11
FT                   /locus_tag="BAV0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47765"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L184"
FT                   /inference="similar to DNA sequence:INSDC:AL646064.1"
FT                   /inference="profile:HMMPfam:PF06945"
FT                   /protein_id="CAJ47765.1"
FT                   /translation="MSTRDPSAEPAAPGAFTASDSPCVAVCSTLFDDICRGCGRTAIEV
FT                   ANWVFMNEEEKREVWVRIRAQGYPRRNNP"
FT   CDS_pept        163525..164562
FT                   /transl_table=11
FT                   /locus_tag="BAV0160"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47766"
FT                   /db_xref="GOA:Q2L179"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L179"
FT                   /inference="similar to DNA sequence:INSDC:U45308.2"
FT                   /inference="profile:HMMPfam:PF00534"
FT                   /protein_id="CAJ47766.1"
FT                   /translation="MRIALVTDAWHPQVNGVVRTWTAMCRLLTQWGHEVRVISPEGSRT
FT                   VPAPSEPALRLCFTPRRHLRQLMGDWVPDALHIATEGPLGWAARSMALRRGWQFTTSFH
FT                   TLFPDYLRARMGIPAGLPWRYMRWFHQPAQRVLVPTPTVASILARRGLVNLKVWSRGVD
FT                   ASLFQPLSTEMLAHLPRPIWLSVGRVAREKNLDAFLALDLPGSKVVAGAGPDLPRLRHA
FT                   FPEAYFLGAQDDGKLPALYSAADAFVFPSLTDTFGLVMLEAMACGTPVAAFRSEAPMAV
FT                   VRAGETGALDDDLGRACLAARQLDRRAVRDWALTRSWDAVAQDLLAALVPIGGMAPARS
FT                   QALSV"
FT   CDS_pept        <164810..166231
FT                   /transl_table=11
FT                   /gene="acyH"
FT                   /locus_tag="BAV0161"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47767"
FT                   /db_xref="GOA:Q2L174"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L174"
FT                   /inference="similar to sequence:UniProtKB:Q01781"
FT                   /inference="profile:HMMPfam:PF05221"
FT                   /inference="profile:HMMPfam:PF00670"
FT                   /protein_id="CAJ47767.1"
FT                   /translation="VNAVSDNAFSDYIVADMSLAGWGRRELAIAETEMPGLMAIRDEYA
FT                   AAQPLKGARIAGSLHMTIQTGVLIETLVALGAEVRWASCNIFSTQDHAAAAIAATGTPV
FT                   FAVKGETLEEYWQYTHKIFEWPQDRHANMILDDGGDATLLLHLGTKAESDPSVLANPGS
FT                   EEERVLFAAIKETLARDPKWYSTRLSQIKGVTEETTTGVHRLYQMSQKGELAFAAINVN
FT                   DSVTKSKFDNLYGCRESLVDGIKRATDVMVAGKIAVVAGYGDVGKGCAQALSALRAQVW
FT                   VTEIDPICALQASMEGYKVVTMEEAAAHADIFVTATGNYHVITREHMNAMKDQAIVCNI
FT                   GHFDNEIDVASLEKDCQWEEIKPQVDHVIFPDGKRIILLAKGRLVNLGCATGHPSFVMS
FT                   SSFANQTIAQIELFTRNGDYTRGQVYVLPKHLDEKVARLHLKKLGVKLTTLSAAQAQYI
FT                   GVPVEGPFKPGHYRY"
FT   misc_feature    165056..165100
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00738"
FT   misc_feature    165569..165619
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00739"
FT   CDS_pept        166292..166627
FT                   /transl_table=11
FT                   /locus_tag="BAV0162"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47768"
FT                   /db_xref="GOA:Q2L163"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L163"
FT                   /inference="similar to DNA sequence:INSDC:AY593479.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF04020"
FT                   /protein_id="CAJ47768.1"
FT                   /translation="MALILVWILNAVALLAVAYILPGITVASFGSALAAALILGLLNML
FT                   VKPVLVLLTLPITIVTLGLFLIILNGLLFWLAGSILRGFQVNGFWWAVAGAIFYSIISG
FT                   LLSKLIP"
FT   sig_peptide     166292..>166391
FT                   /locus_tag="BAV0162"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        166627..167469
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="BAV0163"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="deleted EC_number 1.7.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47769"
FT                   /db_xref="GOA:Q2L158"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L158"
FT                   /inference="similar to sequence:UniProtKB:P00394"
FT                   /inference="profile:HMMPfam:PF02219"
FT                   /protein_id="CAJ47769.1"
FT                   /translation="MTDSTSPAISLEFFPPRDIAAQERLVRAAKQMLAVQPSYVSVTFG
FT                   AGGSTRAGTEETVRTLTNLGCDAAPHLSCIGSSREQLRSILDHYREAGVRRVVALRGDL
FT                   PSGMGGDAGELRHAVDLVRFIREETGDWFHIEVAAYPEMHPQATSPTADLGHFVSKVQA
FT                   GANAAITQYFFNADAYFDFVDRAQARGVTIPIVPGIMPITNYSQLSRFSEMCGAELPRW
FT                   IRLRLAEFGDDKASIRAFGVDVVTKLCQTLLDHGVPGLHFYTLNQSEATLSIWKNLQR"
FT   CDS_pept        <167910..168719
FT                   /transl_table=11
FT                   /locus_tag="BAV0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47770"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L149"
FT                   /inference="similar to sequence:UniProtKB:Q9JXB0"
FT                   /inference="profile:HMMPfam:PF05114"
FT                   /protein_id="CAJ47770.1"
FT                   /translation="VRQAISGLGLGYRREMAAWDMSKINAGFFEVAPENWLRRDRTPLH
FT                   RLRALGRSIALHGVSLNLGGEAPLDAAFLRSVGALMRELGSHCYSDHLAASGDAHQLYD
FT                   LFPIPFTSAQVLRVAGRICRAQDILGQRISIENSTWYTNIGDMREADFLAEIAERADCG
FT                   VLLDLNNIDVNHKNHGGDDIPGYLARLDLARVCYLHVAGHEFDPRFGLYIDTHSRPVAG
FT                   VTARWTRHLQAEHGLAVLLEWDNDIPSPELINRELSCLQTFMTTSEA"
FT   CDS_pept        <168716..168955
FT                   /transl_table=11
FT                   /locus_tag="BAV0165"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47771"
FT                   /db_xref="InterPro:IPR018640"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L143"
FT                   /inference="similar to DNA sequence:INSDC:AE015643.1"
FT                   /inference="similar to DNA sequence:INSDC:AE004750.1"
FT                   /protein_id="CAJ47771.1"
FT                   /translation="VSERMPAGYSAAGMRVYRHLVYLGASQMIEAGFPQLREGMGEQAW
FT                   RVLIEGFVRQSAWTSPFYGDLQNEFRLFLARESA"
FT   CDS_pept        <168942..169391
FT                   /transl_table=11
FT                   /locus_tag="BAV0166"
FT                   /product="putative membrane protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47772"
FT                   /db_xref="GOA:Q2L138"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L138"
FT                   /inference="similar to sequence:UniProtKB:P44270"
FT                   /inference="profile:HMMPfam:PF07681"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47772.1"
FT                   /translation="VRAHEPALALLLLRLWAGWEFARAGWIKLSGGWQAPQWFSGLDMP
FT                   VPQAWLPADLNWIAAGGLELFCGLALLLGVFTRWASAILIYVTIVAVYAVHFDLGWAGW
FT                   NQIDTADGLGFKVPLMLGLMLFVLFACGPGDYALDRVANRAGKRA"
FT   CDS_pept        complement(169388..170053)
FT                   /transl_table=11
FT                   /locus_tag="BAV0167"
FT                   /product="putative 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47773"
FT                   /db_xref="GOA:Q2L135"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L135"
FT                   /inference="similar to DNA sequence:INSDC:AL646057.1"
FT                   /inference="profile:HMMPfam:PF01812"
FT                   /protein_id="CAJ47773.1"
FT                   /translation="MQTPYTGQNTAVALRARLRLERAELPENQRSRGALLMRGRLFTWL
FT                   NMARERGQPLRSVAGFWPLEGEPDLLPLLRQWAEADIIVCLPHVRERGAPLEFHRWTPE
FT                   TPMQTGAYGIPEPQDSERITPDVLLVPTLGYTAQADRLGYGGGYYDRTLAALTAAGHPH
FT                   TAIGVAWDEGLLPEDYKAAAHDMRLAAILTPSGWTPTAPLETGGTTAGRGSVFSHTLS"
FT   CDS_pept        170098..172179
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="BAV0168"
FT                   /product="soluble lytic murein transglycosylase precursor"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47774"
FT                   /db_xref="GOA:Q2L111"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L111"
FT                   /inference="similar to sequence:UniProtKB:P03810"
FT                   /inference="profile:HMMPfam:PF01464"
FT                   /protein_id="CAJ47774.1"
FT                   /translation="MKPTVFAGRQSQRYQNSLAAGLRRLLPLLAMWVAACAPVDAQQRA
FT                   AEALPSAPAAPVQRALQTGLPASPDSVARQAVVSARDAMNAKQWSVLGALAPQAQTDML
FT                   GIYPQYWLLRYQLSAPPNGVRPDAELKQFLAANAGSYLEDRLRADWILAAARSGDFETV
FT                   RRLAPVKAANAQVNCAVLNARHMTGKRATAQEALSVFAAGGACWSLYDQLVADHTLGWD
FT                   ELLPQLRDAIEANRTADARRLVQYIFEPRDLKTYDLMMRDPMKWLVRQDKSPVGRNEKE
FT                   LVTLALARLARADVNVANSYLEREWAQHLPPSHLAWVRGQYALAAALALNPQANDWYRA
FT                   AGHIRMTDYNHSWKVRAALRQQKVDWKWVVASIDEMPPAQRAEEVWVYWKARGQAAQGQ
FT                   TAEAQRAYASIADQFNFYGQLATEELGRRISLPAQAPAVTQAEMIEARANPGLVRAVHL
FT                   FRLGWRAEAVPEWNFALRGMSDRQLLAAAELARAEGIYDRVVHTSERTAREFDFTQRFI
FT                   APFEGRVSARARALEVDPAWVYGLIRQESRFIMDARSHVGASGLMQLMPATAKWVAGKI
FT                   GMTDFTPARVNDFEVNTELGTQYLNMVLRDLDGSQMLASAGYNAGPGRPRNWRSTFNFP
FT                   VEGAVFAETIPFTETRLYVKHVMSNAVYYAAMFSGQPQSLKERLGTVMPSAAVAAKSP"
FT   CDS_pept        172176..173243
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="BAV0169"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.25"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47775"
FT                   /db_xref="GOA:Q2L101"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L101"
FT                   /inference="similar to sequence:UniProtKB:P06961"
FT                   /inference="profile:HMMPfam:PF01743"
FT                   /protein_id="CAJ47775.1"
FT                   /translation="MSADAAVAGLNAYIVGGAVRDALLGLPAGDRDWVVVGATPEEMAR
FT                   RGFIPVGGDFPVFLHPRTKEEYALARTERKSGRGYKGFTFYTGSDVTLEQDLRRRDFTV
FT                   NAIARAPGGELIDPLGGQADLRARCFRHVGEAFAEDPVRILRLGRFAARFTDFDIAPET
FT                   LALCRQMVEQGEVDALVPERVWKELSRGLMETMPSRMLSVWARCGALARVMPQLRQWET
FT                   VAPDLDEAARRGLALPGRYALLSRLSTEPLALRVPADCADMARLLPEWLRALPAPLPAQ
FT                   RLDLIERCDGLRKPERFMALAEAVAVVAEVDAQAWRRDLDAVRGVDAAAVARQCAGDPA
FT                   RIKPALRQVRLDTLV"
FT   CDS_pept        complement(173240..>174442)
FT                   /transl_table=11
FT                   /locus_tag="BAV0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47776"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0Z5"
FT                   /inference="similar to DNA sequence:INSDC:AL646057.1"
FT                   /inference="profile:HMMPfam:PF02636"
FT                   /protein_id="CAJ47776.1"
FT                   /translation="VPAWENNAMQSTLASSLPELDATAQAHSAALIEHLRDRIAAADGW
FT                   LSFEQWMAQALYAPGLGYYTAGAVKLASDPGQAGLAAGDFITAPELSPLFAHTLARQAA
FT                   QWLQATQTHRVLEFGAGTGALAEGVMAELGRLGLSVEYAIVEVSADLRARQQARLAPLG
FT                   SRVQWLDHLPQAFEGVVLANEVLDAMPVRLFRYDENGQVQERGVSWDQGFVWRDRPADA
FT                   TLAEAVHARLPALPGYMSEINLQAEAWVREMGRWLKRGAALLIDYGFPRREYYHPQRAG
FT                   GSLMCHLRHHAHADPFVAPGIQDITAHVDFTAIADAALEGGLDVLGYTSQARFLMNAGL
FT                   LDLLGQLDPSDVKTYAQATAPVQKLLSEAEMGELFKVIAIGRDLPCLSQGFARGDRRAY
FT                   L"
FT   CDS_pept        complement(174494..176272)
FT                   /transl_table=11
FT                   /gene="rhlE"
FT                   /locus_tag="BAV0171"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47777"
FT                   /db_xref="GOA:Q2L0Z2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012969"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0Z2"
FT                   /inference="similar to sequence:UniProtKB:P25888"
FT                   /inference="profile:HMMPfam:PF00271"
FT                   /inference="profile:HMMPfam:PF00270"
FT                   /protein_id="CAJ47777.1"
FT                   /translation="MSFADLGLSPTILSAIEATGFSEPTPVQAAAIPRAMAGADLMVSS
FT                   QTGSGKTAAFMLPALNRVAGQSPNKGVGVQILVLTPTRELALQVADATATYGANLPGLR
FT                   TTTVVGGVPYGAQLKALSRRVDVLVATPGRLIDHLKAGRVKLNTVHTLVLDEADRMLDM
FT                   GFIEDIETIIERLPQSRQTLLFSATLDGSVARLAEKMMREPERIEIAGHRDKHANITQS
FT                   LLYADDASHKMRLLDHLLRDTRLDQAIVFTATKRGADDLADRLSEQGFSAAALHGDMNQ
FT                   RQRTRTLTQLQRGQVRVLVATDVAARGIDVQGISHAVNFDLPLQAEDYVHRIGRTGRAG
FT                   RDGLAYTLAVHSERHKVRRIEHYIGQTITPETIAGLEPQRSPRPSSGGPRGNGGKRPDG
FT                   RRFGGDRPQRSFGDRPQGDRPPRDFGDRPQRSFGDRPQGDRPQRDFGDRPQRSFGDRPQ
FT                   RSFGDRPQRDFGDRPQRSFGDRPQRDFGDRPQRSFGDRPQRDFGDRPQRSFGDRPQRDF
FT                   GDRPQRSFGDRPQRDFGDRPQRSFGDRPQGDRPQRDFGDRPQRSFGDRPQRSFGDRPQR
FT                   AAPGKRFSKPAGDRRG"
FT   misc_feature    complement(175790..175816)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00039"
FT   CDS_pept        complement(176533..177291)
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="BAV0172"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47778"
FT                   /db_xref="GOA:Q2L0Y2"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L0Y2"
FT                   /inference="similar to sequence:UniProtKB:P12295"
FT                   /inference="profile:HMMPfam:PF03167"
FT                   /protein_id="CAJ47778.1"
FT                   /translation="MAIDNRLLPNTLAAQAAALPSAWSQALAAPGVAQALDHIINHVEA
FT                   RLAAGATVYPATPLRALSSLAPSEVRVVILGQDPYHGPGQAQGLAFSVPDDCKCPPSLR
FT                   NIFKEIGRDYALDGKPGHDLTPWVKQGVLLLNTALTVEDGQPASHAKRGWETVTDALFT
FT                   QVAQDPTPKVFLLWGAHAQAKAALLPPGHAHLVLSANHPSPLSATRAPTPFIGCGHFRL
FT                   TNEWLEKQGQTLIDWTATFKKIPAQAEFRL"
FT   misc_feature    complement(177052..177081)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00130"
FT   sig_peptide     complement(<177204..177291)
FT                   /gene="ung"
FT                   /locus_tag="BAV0172"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(177334..178107)
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /gene_synonym="mtnN"
FT                   /locus_tag="BAV0173"
FT                   /product="mta/sah nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47779"
FT                   /db_xref="GOA:Q2L0X9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0X9"
FT                   /inference="similar to sequence:UniProtKB:P24247"
FT                   /inference="profile:HMMPfam:PF01048"
FT                   /protein_id="CAJ47779.1"
FT                   /translation="MGATTGRRITAPRLKESIIAIGILAALADEIRDLIDAMEPGARVH
FT                   RIGMRDYHEGVLYGHECVIALTRVGKAAAAATTATLLQRFAITRVIFTGVAGGIHAGVK
FT                   VGDVVIGSETLQHDMDARPLFPRYEVPLLGVSRLTADPELSQQLEHCALRFLAERDSQV
FT                   HRGLIATGDQFVGNTETGHDLRARLPDALCVEMEGAAVAQVCHEFGIPWAVLRTISDHA
FT                   DSHADIDFLRFLREVASVYSSGILRHYLQTWPLAR"
FT   CDS_pept        complement(178065..178916)
FT                   /transl_table=11
FT                   /locus_tag="BAV0174"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47780"
FT                   /db_xref="GOA:Q2L0X0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0X0"
FT                   /inference="similar to DNA sequence:INSDC:AE004911.1"
FT                   /inference="profile:HMMPfam:PF03466"
FT                   /inference="profile:HMMPfam:PF00126"
FT                   /protein_id="CAJ47780.1"
FT                   /translation="MRHFIAAAETGSFSAAARQLGRAQSAVSTAIGLLEADLGVELFDR
FT                   SKRSPVLTEAGEVLLLEAQQLLRQAAHLQQRALSFSAGEQARLVLAVDEALPDLVMDAM
FT                   LNELSRRFPALELTLLSGTAAEVAAYVESGRAAMGIHFDRAELPATLVYRHLGSVRQGI
FT                   YVSHRHPLAAQTDISTQDLARHRQLVMHMEDRVDMILSPYIWRADSFYNIAAMVADNLG
FT                   WAILPLNIAEYHGYRSHLVQAPCRDLSLPPAGLRALWRQGSVPGPVAVWAQRRVEELLH
FT                   PD"
FT   misc_feature    complement(178791..178883)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00044"
FT   CDS_pept        179025..180500
FT                   /transl_table=11
FT                   /locus_tag="BAV0175"
FT                   /product="probable MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47781"
FT                   /db_xref="GOA:Q2L0W4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0W4"
FT                   /inference="similar to sequence:UniProtKB:P37594"
FT                   /inference="similar to DNA sequence:INSDC:AB019519.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF07690"
FT                   /protein_id="CAJ47781.1"
FT                   /translation="MLSHNQSLDSRRWLVLGVVSTALLLIVVDMTVLYTALPRLTHDLA
FT                   VSASAKLWIVNIYGLVVAGLLPGMGTLGDRLGHKRLFMSGLAVFGLASLAAAYAPGAGA
FT                   LIAARVLLALGAAMMMPATLSIIRLTFTDSRERALAIGVWASIASGGAAVGPVLGGFLL
FT                   EHFWWGSVFLVNVPIVLLALPLAWRLIPRGEPSVGKPWDLRGSLQVMAGLVLSAYALKE
FT                   LGKPAPSLTEAALAAVAGLGLLWVFMRRQRRLHYPLIDFSLFRNATFCAAVAAAVFAAA
FT                   ALLGMELVFIQRLQLVLTFSPLEAAIFILPLPIAAFLAGPLAGWALPRVGERRMLAGAL
FT                   LISGLGAGGLLWGYDGALVWQISTLAVMGIGIGATMTAASSTIMQSAPADRAGMAASIE
FT                   EVSYELGGALGVTLMGSLLSAVYTRSLPTDIPQAARGSLDDALVQADQLPMEMGRHLAA
FT                   LAKQAFDSGFIAVMLAVTALLLGTALLVALYRR"
FT   CDS_pept        complement(180677..>181849)
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="BAV0176"
FT                   /product="Na+/H+ antiporter protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47782"
FT                   /db_xref="GOA:Q2L0W0"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0W0"
FT                   /inference="similar to sequence:UniProtKB:P13738"
FT                   /inference="profile:HMMPfam:PF06965"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47782.1"
FT                   /translation="VSPAAPQAKSFLHAFFASEALGGYILMFAALLALGVANSPWAPVY
FT                   FDVLGSKVGFHAGPIALRETVQHWINDGLMAVFFLLVGLEIKREMLDGQLRGLSRIALP
FT                   GIAALGGMVAPALIYLAINSGNPEGLRGWAIPAATDIAFALGILALLGSRAPASLKVFL
FT                   TALAILDDLGAIIIIALFYTAQLNGAALAAAGLLLLGLILLNRLGVTALSPYLILGALL
FT                   WYFVLKSGVHATLAGVALALTIPLRRHASPLHKLEHALHRPVAFLIIPVFGFANAGVSF
FT                   AGLGLDALTSPVPLGIALGLFLGKQLGVFGLSWLAIKAGIARLPHQASYRQLYGVALLC
FT                   GIGFTMSLFIGALAFDKPQIIDATKIGVLAGTLCSAVAGYLLLRFSRPAQ"
FT   CDS_pept        complement(182009..182473)
FT                   /transl_table=11
FT                   /locus_tag="BAV0177"
FT                   /product="putative nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47783"
FT                   /db_xref="GOA:Q2L0V3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0V3"
FT                   /inference="similar to DNA sequence:INSDC:AL646059.1"
FT                   /inference="profile:HMMPfam:PF01230"
FT                   /protein_id="CAJ47783.1"
FT                   /translation="MSARDPNCPLCQTDGGELIWQGAHLRVIDAQDPDYPGFTRIIWTA
FT                   HLPEMTSLSTRGRDLLMRAVYAVEQAQHDILQPDKINLAALGNMVPHLHWHIIPRWRED
FT                   RHFPGAVWAAPRFATGQEPADFLARRAALASRRQRYHDRLIENMNALLWH"
FT   CDS_pept        complement(182470..182919)
FT                   /transl_table=11
FT                   /locus_tag="BAV0178"
FT                   /product="putative histone acetyltransferase"
FT                   /EC_number="2.3.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47784"
FT                   /db_xref="GOA:Q2L0U8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0U8"
FT                   /inference="similar to sequence:UniProtKB:Q06592"
FT                   /inference="profile:HMMPfam:PF00583"
FT                   /protein_id="CAJ47784.1"
FT                   /translation="MSSIDIRCAGAADFDLWLPLWKGYQDFYKVSIADEVTRLTWERLL
FT                   DPAEPMHVALAFDQGRAIGLVHWIYHRSTWTAGPYVYLQDLFVSQNVRGQGAGRALIEH
FT                   VYRDAAANQAARVYWLTHESNQDAMQLYDRIADRSGFIQYRKVLA"
FT   CDS_pept        complement(182916..184418)
FT                   /transl_table=11
FT                   /locus_tag="BAV0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47785"
FT                   /db_xref="GOA:Q2L0U3"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR022489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0U3"
FT                   /inference="similar to DNA sequence:INSDC:AE016924.1"
FT                   /inference="profile:HMMPfam:PF03976"
FT                   /protein_id="CAJ47785.1"
FT                   /translation="MFIEAQSDPVYPKEDYKAREHQLRTALLKAQYERLNRADRSLLIV
FT                   VAGIDGAGKGQTINQLNDWMDPRHIHTAAFGEPDEIEAQFPPLWRYWNAIPAKGQTGIV
FT                   FGSWYSQLLRECYRKKTRPDRIEGIGAQIRRFEAMLTAEGVQIVKLWYHLSAKAQVERI
FT                   ERLTSSPETSWQVSPDDYRVAKRYDRLCDAANIALALTDQDHAPWVVIPSADDNMRVIR
FT                   TAETVLATMKRRAIPIVARAAMDRPRLGPVPDRLGDLDYDAHEDKHDYERELGLLQGRL
FT                   AQAVRSEKFQKRSLILAFEGQDAAGKGGAIQRIVQALDARRYDITPVAAPAPYEQARPY
FT                   LWRFWRQVPRRSRIAIFDRTWYGRVLVERVEKLTPPGLWRRAYGEINDFERQLVENGAI
FT                   VLKFWLAITQDVQLERFKERENTPFKRYKITPEDWRNREKWQDYAQATNEMLARTDLPH
FT                   APWYPIPANDKRYARLQVLRHIVDALEKDDAEAIGLARRRSL"
FT   CDS_pept        complement(184498..185340)
FT                   /transl_table=11
FT                   /locus_tag="BAV0180"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47786"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0T9"
FT                   /inference="similar to DNA sequence:INSDC:AE016910.1"
FT                   /inference="profile:HMMPfam:PF00753"
FT                   /protein_id="CAJ47786.1"
FT                   /translation="MQPAAFFDPVTGTVSYVVHDGRDCALIDPVLDFDARSGRSSTAGA
FT                   DAIAAFVRAQGLRCQWILETHAHADHLSAAPYLQRQLGGKLAIGQAIREVQTVFKPIFN
FT                   LALETDGSQFDHLFTPDERFMIGSLQAQAIHVPGHTPADMAYRIGDAVFVGDTLFMPDV
FT                   GTARCDFPGGDATQLYRSIRRLLDLPPATRLFVCHDYPPEGRQPAWETTVAAERQANIH
FT                   VRDGVSEAEFVAMRRQRDAGLAMPTLMLPAIQVNIQAGALPEPEDNGTRYLKIPLDRL"
FT   CDS_pept        complement(185415..186680)
FT                   /transl_table=11
FT                   /gene="paaK"
FT                   /locus_tag="BAV0181"
FT                   /product="phenylacetate-coenzyme A ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47787"
FT                   /db_xref="GOA:Q2L0T5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0T5"
FT                   /inference="similar to sequence:UniProtKB:P76085"
FT                   /inference="profile:HMMPfam:PF00501"
FT                   /protein_id="CAJ47787.1"
FT                   /translation="MSEFFDTLETRDPAARERALMQALPDAIAHAQARSAAIAEQLRGV
FT                   DAASITSRAALATLPVLRKHELLALQQQRRDSAEPAGALKAFGGFSAVGWSEIARVFAS
FT                   PGPIYEPETPRPDYWRFARALYAAGFRAGELAYNCFSYHFTPAGSMMETAAHAVGCAVF
FT                   PGGTGQTEQQVRAIQDLAPSGYTGTPSFLKIILEKADELGIPLTSLKRALVSGEAFPPS
FT                   LRDWLAARGIAGYQAYGSADLGMIAFETPAREGLVLGEDLILEIVRPGTGLPLPDGEVG
FT                   EVVITTLNPDYPLVRFGTGDLSAVLPGRSPCGRSNTRIRGWLGRADQTTKVRGMFVHPS
FT                   QVAEVLRRHPEAGRARLVISGTTGAEQMMLHVEAAALPADLARRLVETVRDITKLRADV
FT                   RRAEPGSLPNDGKVIEDVRRYD"
FT   CDS_pept        complement(186706..187578)
FT                   /transl_table=11
FT                   /locus_tag="BAV0182"
FT                   /product="putative high-affinity branched-chain amino acid
FT                   ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47788"
FT                   /db_xref="GOA:Q2L0S9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0S9"
FT                   /inference="similar to sequence:UniProtKB:P21630"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ47788.1"
FT                   /translation="MPRPPAAVGGLFPGNAMTVSSTAPKALLDVNGIEVIYNHVILVLK
FT                   GVSLRVPEGSIVALLGANGAGKTTTLRAVSNLLKGERGDVTKGYIQYRDERIEKLSPAE
FT                   LVKRGVVQVMEGRHCFAHLTIEENLLTGAYTRKLSRGDVSAALDRVYQYFPRLKQRRGS
FT                   QAGYTSGGEQQMTAIGRALMASPNMILLDEPSMGLAPQIVEEIFEIVRDLNQRERVSFL
FT                   LAEQNTNIALRYADYGYILENGRVMMDGAAAGLAQNEDVKEFYLGISSGERKSFRDQKF
FT                   YRRRKRWLA"
FT   misc_feature    complement(187375..187398)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(187578..188909)
FT                   /transl_table=11
FT                   /locus_tag="BAV0183"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, periplasmic amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47789"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0S6"
FT                   /inference="similar to DNA sequence:INSDC:AE016784.1"
FT                   /protein_id="CAJ47789.1"
FT                   /translation="MEMKRLNLKLAAALIAASGSIIATPASAAEEQFVPLLVYRTGSFA
FT                   PLGIPWADGKLDYLKLVNERDGGVNGVKIAYEECETAYATDRGVECYERLKRKGTGASG
FT                   FDTQSTGITFAVTDKAMVDKVPVETMGYGLSQSVDGRVFEWNFPLLGTYWTAADVMIQD
FT                   IAKKEGGIDKLKGKKIALVYHDSPYGKEPIPLLQKRAAQAGFELLLYPVTAPGVEQKST
FT                   WLQIRQQRPAYVLLWSAGIMTPTAIREAQASGYPRDKMYAIWWAGSEGDVKDLGDVAKG
FT                   YNAITIHNSAATGKVYDDLKKYVYDKGQGADKSGNTTLGTIAHTRGMMISMLQVEAIRA
FT                   AQEKFGKGKALTPEQVRWGFENLNLTQDRLNELGFGEIMRPVKTSCANHMGDDWARIVQ
FT                   WDGKQFKVVSDWYQADKSLVDPLVKEGAAKYAQEKKITPRNCEG"
FT   sig_peptide     complement(<188822..188909)
FT                   /locus_tag="BAV0183"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(188975..190039)
FT                   /transl_table=11
FT                   /locus_tag="BAV0184"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47790"
FT                   /db_xref="GOA:Q2L0S2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0S2"
FT                   /inference="similar to DNA sequence:INSDC:AE016866.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF02653"
FT                   /protein_id="CAJ47790.1"
FT                   /translation="MLYRENGQFKTSYRADQQIFPIRQDRLFFLLLMAVAFVAVPALAS
FT                   DYLLRAILIPFLILALAAVGLNILVGYCGQISLGTGAFMAVGAYAAWNIGVRFPGAPLL
FT                   LQILIGGGFATLVGIVFGIPSLRIRGLYLAVTTLAAQFFIDWAFLRIPFFTNYSSSGNV
FT                   SVPPLTAFGIPVQSALEKYLFVLILVVVFTLLAKNLVRGAIGRQWMAIRDMDVAAAVIG
FT                   IRPVYAKLSAFAVSSFIVGVAGALWGFIHLGSWEPLAFDLNRSFQLLFMIIIGGLGSII
FT                   GSFFGAAFIVLVPVALTNVPHLLGLTLSVDTAAHIEHMVFGALIVFFLIAEPHGLARLW
FT                   SIGKEKLRIWPFPH"
FT   sig_peptide     complement(<189904..190039)
FT                   /locus_tag="BAV0184"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(190052..190981)
FT                   /transl_table=11
FT                   /locus_tag="BAV0185"
FT                   /product="putative branched-chain amino acid transport
FT                   system permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47791"
FT                   /db_xref="GOA:Q2L0R8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0R8"
FT                   /inference="similar to sequence:UniProtKB:P30295"
FT                   /inference="profile:HMMPfam:PF02653"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47791.1"
FT                   /translation="MGFFLETFLGGLMSGMLYSLIGLGFVLIFKASGVFNFAQGAMVLV
FT                   AALSMARFSEWIPRWLGFESMLLANVLAFIVSAAIMFLLAVLIEKLVLRHLVNQDLTTL
FT                   LMATLGISYFLDGLGQITFGSSVYSINVGMPKEPWLVLDSVFDGGVLINLEDLSAALIA
FT                   ALLVAALALFFQFTSTGRALRAVADDHQAAQSIGIPLNRIWVIVWSVAGLVALVAGIIW
FT                   GSKFGVQFTLSTAALRALPVVILGGLTSVPGAIIGGLIIGVGEKLSEVYLGSLVGGGIE
FT                   IWFAYVLALVFLLFRPQGLFGEKIIDRV"
FT   CDS_pept        complement(190999..191799)
FT                   /transl_table=11
FT                   /locus_tag="BAV0186"
FT                   /product="putative high-affinity branched-chain amino acid
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47792"
FT                   /db_xref="GOA:Q2L0R3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0R3"
FT                   /inference="similar to sequence:UniProtKB:P21629"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ47792.1"
FT                   /translation="MTTTTREQQIGEVMLDMQDISLSFGGVKALTRISFNVREHEIRAI
FT                   IGPNGAGKSSMLNVINGVYTPQEGAILLRGERFSRMNPRRAAEMGIARTFQNLALFKGM
FT                   SVLDNIMTGRNLRMKSGLLAQAFRLGAAEREEIANREFVENIIDFLEIQAYRKVPVGRL
FT                   PYGLQKRVDLGRALAMEPRLLLLDEPMAGMNIEEKQDMSRFILDVNDEFGTTIVLIEHD
FT                   MGVVMDISDRVVVLDYGKKIGDGTPSEVRSNPDVIRAYLGVTND"
FT   misc_feature    complement(191638..191661)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(191802..>193766)
FT                   /transl_table=11
FT                   /locus_tag="BAV0187"
FT                   /product="putative AMP-binding enzyme"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47793"
FT                   /db_xref="GOA:Q2L0R1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0R1"
FT                   /inference="similar to DNA sequence:INSDC:AE017301.1"
FT                   /inference="profile:HMMPfam:PF00501"
FT                   /protein_id="CAJ47793.1"
FT                   /translation="VAHSPPSARQPQTFPALLLDHARLRPSQAAIREKNLGIWQTLSWS
FT                   EVAEHVRLTAHGLTVLGIGPGDHIAVIGENRPRLYIAMMAAQALGAIPVPLYQDAVAQE
FT                   MAYVLQDAAIRVAVVEDQEQVDKMLEISEQCPALQHVIYDDTRGMRNYHDAMLQSFEAL
FT                   EDAGREHTGQHPDFYLTAAQAVQPQDTAAMFYTSGTTGKPKGVVLTHHALIDRARAVAT
FT                   MEGLTDKEDVLAYLPPAWIGQNMFSYTQLLVSGFTVNHPESPDTVSIDMRDIGPTYYFA
FT                   PPRVLEGLLTHVMIRMEDAGYLKRKLFHACMNLARRVGTRILDGAAVSAWDRLRYKLGD
FT                   IMIYGPLRNALGMSRVRVAYTAGEAIGPDLFVFYRSIGINLKQLYGSTETSVFVCVQAD
FT                   GQVRDDTVGPPVDGVEIRVADNGEILVKSPGLFKEYYRNPAATAEARDADGWFRTGDAG
FT                   YLDKDGQLKIIDRAKDVGKLADGSLFAPKYIENKLKFFPYIKEAVAFGADQAEACAFIN
FT                   IDLEAVGNWAERRGLPYAGYTDLASKDEVYALIRDCVQKINADLASDPRLAASQIHRFL
FT                   ILHKELDPDDDELTRTRKVRRAFIAQKYAVLIDALYSGRDSQFIETEVKFEDGRVGRIS
FT                   ADLRISPADTYPAISARAA"
FT   misc_feature    complement(193155..193190)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00455"
FT   misc_feature    complement(193575..193607)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00639"
FT   CDS_pept        193934..194632
FT                   /transl_table=11
FT                   /locus_tag="BAV0188"
FT                   /product="cyclic nucleotide-binding regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47794"
FT                   /db_xref="GOA:Q2L0Q9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0Q9"
FT                   /inference="similar to sequence:UniProtKB:O05689"
FT                   /inference="profile:HMMPfam:PF00027"
FT                   /protein_id="CAJ47794.1"
FT                   /translation="MQLADSLHLAAAWFRVLDAEQRERVERDVSVQHAQAGTIIERKGE
FT                   LAQAWIGVLAGLVKVSVGNADGKLASLTGVPAGGWIGEGSLLKREIRKYDVVALRDSVV
FT                   ARLPAPTFEWLLDSSIPFNRYLLHQLNERVAQFIGKAEHDRLLDPDARVARCLAELFNP
FT                   LLYPGMGMRLAITQEEVGYLARVSRQRANQALRKLEEAGLLKVEYGAVRVMDLDGLKSY
FT                   GADAVCADED"
FT   CDS_pept        complement(194909..195547)
FT                   /transl_table=11
FT                   /locus_tag="BAV0189"
FT                   /product="putative lysine exporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47795"
FT                   /db_xref="GOA:Q2L0Q7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0Q7"
FT                   /inference="similar to sequence:UniProtKB:P94633"
FT                   /inference="profile:HMMPfam:PF01810"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47795.1"
FT                   /translation="MFTLTSPAFFTAWVSGTATGMGLFAVVGAQSAFILRQGLMRAHLL
FT                   TVLATCALIDAVFIFGSVLGLQTLLTWLPGLTTAILWFGVTFLVWYGLQSARRAWRGGS
FT                   LAHCREAAPSRRAALLGALGFSLLNPHFWLDMVVVGSLANGFSDARLAFAAGALTASLI
FT                   WLAVLGLGSRLFAPLFSDARAWRVLDGLIALVMLGLAWSLAAGSMGSGA"
FT   sig_peptide     complement(<195457..195547)
FT                   /locus_tag="BAV0189"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        195669..196583
FT                   /transl_table=11
FT                   /gene="lysG"
FT                   /locus_tag="BAV0190"
FT                   /product="putative lysine export transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47796"
FT                   /db_xref="GOA:Q2L0Q2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0Q2"
FT                   /inference="similar to sequence:UniProtKB:P94632"
FT                   /inference="profile:HMMPfam:PF00126"
FT                   /inference="profile:HMMPfam:PF03466"
FT                   /protein_id="CAJ47796.1"
FT                   /translation="MKLDHDHLRALAAVVREGSFERAAAALHVTPSAVSQRIKALEDRS
FT                   GRLLVMRTMPARATPDGQVLVQLAEQTALMEHDALLRLGVAEDELTQASIAVAVNHDSL
FT                   ETWFVDAAVRFAARSRATLDMQSEDQDHTAALLRNGAVLGAVTALAEPVQGCRIHPLGG
FT                   MRYVATCSPAFQARYFSQGVNARSLAQAPVLAFNRKDDLQGRFARRIMGREPWQPPVWW
FT                   VPSSRAFVQATLNGLGWAMNPLPLIKEELDSGRLVPLRARAWEDVPLFWQHWRVNSQAM
FT                   LILTDSVLAAARTLVRKRQGAQA"
FT   CDS_pept        196871..199096
FT                   /transl_table=11
FT                   /locus_tag="BAV0191"
FT                   /product="putative transferrin/hemoglobin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47797"
FT                   /db_xref="GOA:Q2L0Q0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0Q0"
FT                   /inference="similar to DNA sequence:INSDC:AY184230.1"
FT                   /inference="similar to sequence:UniProtKB:P96949"
FT                   /inference="profile:HMMPfam:PF00593"
FT                   /protein_id="CAJ47797.1"
FT                   /translation="MSARFAFSTLLLATPALADEPSPQAWELETIQVEGQAEDPSTNVR
FT                   DAAQMSRDNVFDARDLVRHMPGISVSEGGRAGSNGYAMRGVDRDRIAVTVDGMPQAEYF
FT                   LPEVYLGYGYLNGNRNSVELEHMKRVTLHKGADSYSSGSGGIGGSVQFVTKDIDDYVAP
FT                   GRVAGAVGKLAYASRSREWLGMAGTGVRLGTLGSSFFLQYTRRSGHEIKHYGGGADIRG
FT                   GERGRPDPVDASTQAWLSKLDLCVVRGHCLQLSHDERAERRMTDERSYSAIFGQTRVAW
FT                   DHSPYKRQAVIYRWTPADGPIEFLSAGLHRQQVTQRALTENRDRDDGFLEQRYDRRTRQ
FT                   RDRRWRLETVARPWLSAWGSHQFSGELAWAQRQLVNDNIDRLFFKRGPGGERSYGIIDP
FT                   VRTRSLSFKLMDAFQLGPDWSGEAGWRFDHYGHRPKPGAAASASRSFSASTLSGQLSYR
FT                   LTGDMRLSYAVAQGFRAPSAQELYFQFRRGLSAFVANPDLKAERALNQQITLASGGRAG
FT                   AWALSVFQTQYRDFIAERHSQREVPNVYYDPDRPGSGKPTLIEDVFRSENIDRAKVWGI
FT                   ELKGELDAHGAFGAPRGLGADVRASFMRGRTGQGDGMRALQPAQLVTGVFFDSPRWGAR
FT                   ADLVYHGAKRARDTLQTTYSHRGAVRRPARYLSPAVYLVDLSAYVRMGKHITLSGGVYN
FT                   LFDRRYHSWDTLRSLAEFGTTGRVRGDGLNRYTAPGRNVSLSLALRY"
FT   sig_peptide     196871..>196922
FT                   /locus_tag="BAV0191"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    196871..196978
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00430"
FT   CDS_pept        complement(199101..200066)
FT                   /transl_table=11
FT                   /locus_tag="BAV0192"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47798"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0P6"
FT                   /inference="similar to DNA sequence:INSDC:AY305378.1"
FT                   /inference="profile:HMMPfam:PF03401"
FT                   /protein_id="CAJ47798.1"
FT                   /translation="MHKHAKRLLAFAALSFAATAAAQTWPTQPLRWIVPYPAGGGADVV
FT                   ARTVANGLEKPLGQTIIVENRPGAATIIGATAIAQSEPNGYTIGTADSGTLAFNPSLYA
FT                   KLAYDPSKFTYIGGIARFPLLLAVNANSPFKTVDDVVQAARKEPGKLSAASAGAGSPHH
FT                   LALELFKQRANVNILHVPYKGAAPAIQDLLGGQVDVMFIDLAAGLPNVKAGKLRVLASA
FT                   TPARLTALPDAPTMAEQGVADFTAYAWQGLVGPGGIPKPIVDKLSADLEQTIKSAAVTQ
FT                   KLADMGVEPMPMSPADFKAFAERERATWAEVIKKADIRLE"
FT   sig_peptide     complement(<199997..200066)
FT                   /locus_tag="BAV0192"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(200167..200865)
FT                   /transl_table=11
FT                   /locus_tag="BAV0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47799"
FT                   /db_xref="GOA:Q2L0P3"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0P3"
FT                   /inference="similar to DNA sequence:INSDC:BX572602.1"
FT                   /inference="profile:HMMPfam:PF01168"
FT                   /protein_id="CAJ47799.1"
FT                   /translation="MTDSMSARLAAIEHRIAQACERAARPAGSVTLLPVSKTFSAEAVR
FT                   EAAALGLRRFGENKTQEIRQKADPLADLGLSWVMIGHLQTNKVKDVARDVAEVQSLDRL
FT                   ELADALQRRLETAGRELDVLIQVKTSPEPSKFGLPPETLPAMLTHLRQACPALRVQGLM
FT                   TMAINSEDHAAVRACFRRLRELRDQHASSAVPLARLSMGMSGDFEIAIEEGSTEVRIGS
FT                   ALFGARNYPV"
FT   CDS_pept        201085..202317
FT                   /transl_table=11
FT                   /locus_tag="BAV0194"
FT                   /product="probable aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47800"
FT                   /db_xref="GOA:Q2L0P1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0P1"
FT                   /inference="similar to DNA sequence:INSDC:AL939116.1"
FT                   /inference="profile:HMMPfam:PF00155"
FT                   /protein_id="CAJ47800.1"
FT                   /translation="MSTEYLFAPPFQTPYIPPIRSLMPYALRPGTISMAGGYPAQELFD
FT                   VDGLSAASTQVLGRLGSCLQYSNIDGQASLRQQLARLSAERGVQCNPDTELAVTGGSQQ
FT                   ALALLTRVMLQKGDSAIIESPSFPNSVQAMRYTGATVHTVASGPQGIDLDALDALAAQV
FT                   KPKMVCVVASFSNPCGATLTRERRVRLLELAVKHRFLIVEDDPYGELRFSGDTVPPIAA
FT                   LAEGEQRQWAVYISSMSKTMAPGLRIGWLVAPAEVRRRCVSAKAADDMACSAWIQEIVA
FT                   QYLADGHYAEHVPRIRAAYGLRCDALAAALTRELPGRVTFAKPEGGMFFWARLSGDIDA
FT                   TRLLPYAIEKEVVYVPGKAFYADESQADLHAMRMSFATMNEEKIALGVKRLALALDACQ
FT                   ANAPVSVSLEG"
FT   CDS_pept        202454..203470
FT                   /transl_table=11
FT                   /locus_tag="BAV0195"
FT                   /product="amino acid-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47801"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0N6"
FT                   /inference="similar to sequence:UniProtKB:Q52812"
FT                   /protein_id="CAJ47801.1"
FT                   /translation="MKIASLVALAALSLTGLQSAQAGTLDVVKNRDAVVCGTTTGFAGF
FT                   SAPDAQGVWRGLDVDLCRAVAAAVLGDANKIKIVPLNSQQRFTALQSGEVDVLTRNTSV
FT                   TQQRDTALGIIHAGINFYDGQGFLVPKKLGVKSAKELNGATICLQQGTSNENTLADWAR
FT                   ANNVQYTPVVIETFNEVVNAFAAGRCDVFSTDASGLASIRISKLEKPDDYIVLPEVISK
FT                   EPLGPFVRQGDDNWLNIVYWTLTAMIEAEEYGLTSANVDEQLKSENPNVRRILGVVPGA
FT                   GPNMGLNDKWAYNIVKQVGNYGESFDRNVGKGSPLKIDRGLNAQWTKGGLMYALPIR"
FT   sig_peptide     202454..>202517
FT                   /locus_tag="BAV0195"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    202619..202660
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01039"
FT   misc_feature    202967..202996
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00659"
FT   CDS_pept        complement(203549..204004)
FT                   /transl_table=11
FT                   /locus_tag="BAV0196"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47802"
FT                   /db_xref="GOA:Q2L0N3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0N3"
FT                   /inference="similar to DNA sequence:INSDC:AL939124.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47802.1"
FT                   /translation="MMAPENQAALLREIGPLPLSAQAWTDGVRILTWIILAIAGAQLAF
FT                   EAIQADPLSPVLVVGIVLCFLVLITLAWYMQVSITTIDEQGLRQSWIKRREVAWQDIRC
FT                   ARYLSLPLSKRLLIITRQGRALVFQGGTRELRHAFEKIAQLYRDRAE"
FT   CDS_pept        complement(204015..204923)
FT                   /transl_table=11
FT                   /gene="hmgcL"
FT                   /locus_tag="BAV0197"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47803"
FT                   /db_xref="GOA:Q2L0M9"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0M9"
FT                   /inference="similar to sequence:UniProtKB:P97519"
FT                   /inference="profile:HMMPfam:PF00682"
FT                   /protein_id="CAJ47803.1"
FT                   /translation="MSLPSRVKIVEVSPRDGLQNEKDFVPTDIKVELINRLSAAGFPNI
FT                   EAASFVSPKWVPQMADGAEVMARIQRRPQTLYSVLTPNLKGLEGALAAHADEIVIFGAA
FT                   SEAFSQKNINCSIAESIARFEPVAEAARAAGLRLRGSISCSLGCPYQGDVPVASVVDVA
FT                   RRFQALGCDEIDIADTIGVGTPRQVRDVMAAVSALIDPARLSGHFHDTYGQALANILAA
FT                   MEAGIAIFHSSVAGLGGCPYAKGATGNVATEDVLYMLRGLDIDTGIDFDAVVDIGQWMA
FT                   AQLQRKGSSRAGNAIAAKRDA"
FT   misc_feature    complement(204198..204227)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01062"
FT   CDS_pept        complement(204963..206084)
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="BAV0198"
FT                   /product="Smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47804"
FT                   /db_xref="GOA:Q2L0M5"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0M5"
FT                   /inference="similar to sequence:UniProtKB:P30852"
FT                   /inference="profile:HMMPfam:PF02481"
FT                   /protein_id="CAJ47804.1"
FT                   /translation="MPLQHDPEELAAWLRLSLEPGVGPVTACGLLRAFGLPQALYAQRA
FT                   SALMRQVPQALASQLAAPAPPDMADRIARALEWAEAADHHLLTLADPGYPQALLSINDP
FT                   PVLLYLKGRPDLLNRPALAVVGARNATPMGAQNARAFARHLAAHGWCVVSGLAQGIDAA
FT                   AHEGALAAGSSGGGTIAVLGTGLDRVYPASNRQLAHAIAANGALLSEFPLGTGAQAHHF
FT                   PQRNRLVAGLARGVLVVEAARQSGSLITARLASESGREVFAIPGSIHSPLSRGCHALIR
FT                   QGAKLVETAQDITDELSSPRQPAPSPPAQPRAEPPPGTQALLTALGHDPQHADSLAAAS
FT                   GLDAATLGAQLTELEVAGWIARLDDGRYQLIYT"
FT   CDS_pept        complement(206160..206783)
FT                   /transl_table=11
FT                   /locus_tag="BAV0199"
FT                   /product="putative two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47805"
FT                   /db_xref="GOA:Q2L0M1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0M1"
FT                   /inference="similar to sequence:UniProtKB:P10940"
FT                   /inference="profile:HMMPfam:PF00196"
FT                   /inference="profile:HMMPfam:PF00072"
FT                   /protein_id="CAJ47805.1"
FT                   /translation="MRLTRLLLIDDHALVRDGLKLHLQSIPSLTVMGETESARATLDLL
FT                   ARGQPEEWPDLVLLDLSLQDADGLELAKILHERYPRIAVLILSMHDNVESMRQAIAAGV
FT                   RGYVLKTEATADLLTAIKRVAAGKTGFSPQVSLKLTQNHAPLLTQRERDILQGIGMGMT
FT                   NRQIAQTLDLSVRTVETYRHTLKRKLNIGGRADLIKYAIEHRRP"
FT   CDS_pept        complement(206954..207445)
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /gene_synonym="alsB"
FT                   /gene_synonym="livR"
FT                   /gene_synonym="ihb"
FT                   /gene_synonym="oppI"
FT                   /locus_tag="BAV0200"
FT                   /product="leucine-responsive regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47806"
FT                   /db_xref="GOA:Q2L0M0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0M0"
FT                   /inference="similar to sequence:UniProtKB:P19494"
FT                   /inference="profile:HMMPfam:PF01037"
FT                   /protein_id="CAJ47806.1"
FT                   /translation="MTLDTIDCRILALLQKEGRISNQLLAERVALSPSACLRRLRALED
FT                   GGVILGYQAVIDPARLGLGFEALVHVSLDQSQPGWHEAFVACLAQWPEVHEASIVTGAS
FT                   NYVLQVRTSDLAAFSNFVVDKLNRVHGVREICSHIVMRKVKAPGIAPAADPINQAGSNR
FT                   "
FT   CDS_pept        207584..208834
FT                   /transl_table=11
FT                   /locus_tag="BAV0201"
FT                   /product="kynureninase"
FT                   /EC_number="3.7.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47684"
FT                   /db_xref="GOA:Q2L1V2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L1V2"
FT                   /inference="similar to sequence:UniProtKB:P83788"
FT                   /protein_id="CAJ47684.1"
FT                   /translation="MQTREDCLAADRADPLASIKAEFDLPAGVLYLDGNSLGAKPRAAA
FT                   ARAQAVVQEEWGQGLIRSWNTAGWFDLPARLGAKLAPLLGVAGEEVVVTDSTSLNLFKA
FT                   LAAALRIQGRDAPARRVIVSERDNFPTDLYMIEGMMDFLDKGYELRLIDEHLPLEAALD
FT                   DNVAVLALSHVNYRSGAMYDMAAVSALAHEHGALVIWDLAHAAGAVPLSLSADGADFAV
FT                   GCTYKYLNGGPGSPAFIWVAPRHQDAFWQPLSGWWSHSQPFAMSDRYAPAAGIRRYLCG
FT                   TQPVTSLALVECGLDIAAQADMSEVRRKSLALGDLFIALVRDRCASHPLTLITPEAHAR
FT                   RGSHISFRHPEGYAVMQALIARGVIGDYREPEVLRFGLTPLYLGYADVWDAVEILRDVL
FT                   DTRAWSRPEFQTRSAVT"
FT   CDS_pept        208938..209450
FT                   /transl_table=11
FT                   /gene="def"
FT                   /gene_synonym="fms"
FT                   /locus_tag="BAV0202"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47807"
FT                   /db_xref="GOA:Q2L0L3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0L3"
FT                   /inference="similar to sequence:UniProtKB:P27251"
FT                   /inference="profile:HMMPfam:PF01327"
FT                   /protein_id="CAJ47807.1"
FT                   /translation="MALLPILRYPDPRLHKVAKPVAVVDDRIRQLVKDMAETMYDAPGV
FT                   GLAATQVDVHERVIVIDVSEDGNELRALINPEITWMSEELQVYEEGCLSVPGIYDEVKR
FT                   AARIRCKALDTDGKVFEFEAEGLLAVCVQHEIDHLDGKVFVEYLSVLKQNRIKTRLKKA
FT                   EREAQRA"
FT   CDS_pept        209568..210503
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BAV0203"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47808"
FT                   /db_xref="GOA:Q2L0K7"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L0K7"
FT                   /inference="similar to sequence:UniProtKB:P23882"
FT                   /inference="profile:HMMPfam:PF00551"
FT                   /inference="profile:HMMPfam:PF02911"
FT                   /protein_id="CAJ47808.1"
FT                   /translation="MRLVFAGTPEFARLALEALLAAGHEIPLVLTQPDRPAGRGLKLTP
FT                   SPVKEAALAAGIEVAQPRSLRLDGRYPDEALAAQARLVAVAPEVMVVAAYGLILPRWTL
FT                   ALPARGCLNIHASLLPRWRGAAPIQRAIEAGDARTGVTIMQMDDGLDTGDMLLERTVPI
FT                   GAETTAAVLHDELARVGAEAIVAALADLPALAPRKQPEQGVTYAAKLDKAEAALKLDES
FT                   AELLARRIRAFNPVPGASLRLPGLNEPVKVWQAEALPESSPAAPGTVLRASAQGVDIAT
FT                   GQGVLRLLELQKAGGKRQSAEVFVRGWQPA"
FT   misc_feature    209985..210056
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00373"
FT   CDS_pept        complement(210500..211126)
FT                   /transl_table=11
FT                   /locus_tag="BAV0204"
FT                   /product="putative pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47809"
FT                   /db_xref="GOA:Q2L0K3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024029"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0K3"
FT                   /inference="similar to DNA sequence:INSDC:AP002995.2"
FT                   /inference="profile:HMMPfam:PF01243"
FT                   /protein_id="CAJ47809.1"
FT                   /translation="MTPDPRYLITDTQALAELYGEPGQASLAKELDYVHPHYRAFIEAS
FT                   PFATLATSGAQGLDASPRGDPAGFVVVENDRTLLLPDRRGNNRIDSLRNVLEDPRVALL
FT                   FLIPGVGETLRVNGRAEISVDPALLARFAMDGKPARSVLILHVEKVYFQCARAIVRSGL
FT                   WDPAKQVARDSLPSTGRMLADVSAGEIDGAAYDRDLPERMKKTLY"
FT   CDS_pept        complement(211138..211773)
FT                   /transl_table=11
FT                   /locus_tag="BAV0205"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47810"
FT                   /db_xref="GOA:Q2L0J9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0J9"
FT                   /inference="similar to sequence:UniProtKB:Q9JMQ2"
FT                   /inference="similar to DNA sequence:INSDC:AF242881.1"
FT                   /inference="similar to sequence:UniProtKB:Q9EYY5"
FT                   /inference="profile:HMMPfam:PF00702"
FT                   /protein_id="CAJ47810.1"
FT                   /translation="MKYALIAFDFDGTLADTLPWMESILHDVAEKFGFRKPDAQERAQL
FT                   RQHNAFDIMKQLGIPIWKAPAILGFVRQSMEEAVPKVALFPGIDAMLRALHASGARLAV
FT                   VSSNSTANVQRVLGPELSALIHDFACGSDLFGKPAKLEHLLRATQTEAAQAILIGDEIR
FT                   DIEAARKVGVASGIVAWGYNREQVLREQAPDFVFTDVQDLARTLLPSA"
FT   CDS_pept        complement(211837..212412)
FT                   /transl_table=11
FT                   /locus_tag="BAV0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47811"
FT                   /db_xref="GOA:Q2L0J6"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0J6"
FT                   /inference="similar to DNA sequence:INSDC:AE016792.1"
FT                   /inference="profile:HMMPfam:PF03641"
FT                   /protein_id="CAJ47811.1"
FT                   /translation="MSLNQICVYCGSNNGRQPEYIEQARAFGRELVKRDIGLVYGGAAV
FT                   GLMGAVADAVIEAGGRAIGIIPERLMQKELAHRGLTELHVVQTMHERKSMMAEKADGFV
FT                   ALPGGAGTLEELFEAWTWAQLGMHQKPCGLLNIAGYYDALATFLDHVADEAFMQPQHRA
FT                   MLSIEADPALLLDRFANYVAPTVPKWIK"
FT   CDS_pept        complement(212757..213947)
FT                   /transl_table=11
FT                   /locus_tag="BAV0207"
FT                   /product="putative CoA-transferase family III"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47812"
FT                   /db_xref="GOA:Q2L0J2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0J2"
FT                   /inference="similar to DNA sequence:INSDC:AE016870.1"
FT                   /inference="profile:HMMPfam:PF02515"
FT                   /protein_id="CAJ47812.1"
FT                   /translation="MSSKALSGIRVLELGQLIAGPFAAKMLGEFGAEIIKIEPPGKGDP
FT                   LRNWRLLHEGTSVWWQVQSRNKKSVSLDLRQPEAQDLIRKLVAEVDVVIENFKPGTMEG
FT                   WGLGWEDLRAINPRLVMLRVSGYGQTGPYRDLPGFGAIGEAMGGLRHLSGEPGRTPVRV
FT                   GISIGDSLSALHGVIGILMALRSRDATGQGQMIDVALYESVFNMMESLLPEYAVFQEVR
FT                   EPAGSSLPGIAPSNAYRCADNKYVLIAGNGDSIFKRLMAVIGRPDLAELPELASNSGRV
FT                   KHVDMLDAAISDWAGRHSQEAVLAALNQGQIPAGKIYDVADIAADPHYRARGMIVDTTL
FT                   PDGTAIQVPGIVPKLSGTPGEIASPAPALGQHTDEVLESLGVNAEQRAQWRARGLI"
FT   CDS_pept        complement(214072..>215400)
FT                   /transl_table=11
FT                   /locus_tag="BAV0208"
FT                   /product="putative radical SAM protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47813"
FT                   /db_xref="GOA:Q2L0J0"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0J0"
FT                   /inference="similar to DNA sequence:INSDC:AE004525.1"
FT                   /inference="profile:HMMPfam:PF04055"
FT                   /inference="profile:HMMPfam:PF00919"
FT                   /protein_id="CAJ47813.1"
FT                   /translation="VSKTSRAPRVGFVSLGCPKALVDSERILTQLRTEGYEVTPEYNDA
FT                   DVVVVNTCGFIDSAKAESLDAIGEALAENGKVIVTGCMGVEESAIRSVHPSVLAVTGPQ
FT                   QYEQVVQAVHSAAPPRQDHNPYVDLVPPQGVKLTPRHYAYLKISEGCNHRCSFCIIPSM
FT                   RGNLVSRPVGDVLNEAERLVKAGVKELLVISQDTSAYGVDLKYRSGFWNGRPVKTRMTE
FT                   LCDALSELGVWTRLHYVYPYPSVDDIIPLMAEGKVLPYLDIPFQHASPRILKAMKRPAF
FT                   EDKTLARIHQWRAACPDLTIRSTFIVGFPGETEEDFQYLLDWMSEAQLDRVGCFQYSPV
FT                   EGAPANALAGIVPDEVKQERWERFMEHQQAISAARLQTRIGREIDVLIDEVDEDGAVGR
FT                   SSADAPEIDGCVYVSSDTPVKPGDMVRVRVTDADEYDLWADRL"
FT   misc_feature    complement(214906..214968)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01278"
FT   CDS_pept        complement(215548..215787)
FT                   /transl_table=11
FT                   /locus_tag="BAV0209"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47814"
FT                   /db_xref="GOA:Q2L0I8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0I8"
FT                   /inference="similar to DNA sequence:INSDC:AE016858.1"
FT                   /inference="profile:HMMPfam:PF01381"
FT                   /protein_id="CAJ47814.1"
FT                   /translation="MKTAALPARRWPASRISEARNRVGLPQAEFADLLGVSVRTLQDWE
FT                   QGRRNPSGAAQTLLRVAILHPETLRDLPPMDEPA"
FT   CDS_pept        216265..217614
FT                   /transl_table=11
FT                   /locus_tag="BAV0210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47815"
FT                   /db_xref="GOA:Q2L0I7"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0I7"
FT                   /inference="similar to DNA sequence:INSDC:AE009266.1"
FT                   /inference="profile:HMMPfam:PF03972"
FT                   /protein_id="CAJ47815.1"
FT                   /translation="MSAVSTIPLARQYVDQAYSWRFADAPEPVRQALRNCLLYNLTMGL
FT                   AVDPADDPLGDILAGLAQESGGSSLLGGRGRRSPRDAAFINAGLITARGQNDTHPEVVT
FT                   HIGCVVIPAVLALAEACAPEDLWDALLLGYELIPRLALGLADETSRRGFRATPLYGVLG
FT                   AAVACARVLRLPASQAVSALAIAAQHASGTLQPWADGSQEWRLQVAKASRDAVVSALLA
FT                   RAGMQGAPACLEGASGFSRAYAGRSAMAQGAGLQDWQLPRMTFKPYPGCAFNQSPVHAL
FT                   RALLERIPADQVVALEVAMNPQDAAYPGIDAYGPFASPSGAIMSAPFMLAATLQDGQPG
FT                   MAHFTRQFAAGPLHARSAMVRVRACATLDRWACRLSLTLASGAVYAGAHDGNFVLDRKQ
FT                   TLALCQGLAREWPERRVSVEALAAAVERDAWQAWRIAAYDHDVIIPSPLS"
FT   CDS_pept        217611..218381
FT                   /transl_table=11
FT                   /locus_tag="BAV0211"
FT                   /product="IclR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47816"
FT                   /db_xref="GOA:Q2L0I4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0I4"
FT                   /inference="similar to DNA sequence:INSDC:AL591788.1"
FT                   /inference="profile:HMMPfam:PF01614"
FT                   /protein_id="CAJ47816.1"
FT                   /translation="MTASTKGAQAVFRALSLLRLISRCHPQGIGIAELAAEAGLDRSTA
FT                   YRLASSLVEFGLAERDPMRNYRLGVEAMQLGLAAMRSAPVVERLRPIMRRLAQRTEDTV
FT                   FLVVRNGDYGHCLHCEEGSYPVKALVLRVGGMRVLGIGSAGITLLSNLPDDEIAALYQR
FT                   HQDEFDPRGLSLGDLRKLVQQTRRRGHADTADLVADGVSGVGMRFEFASGSQAAISVAA
FT                   IRSRMSAERKSWIAQLIAEELQQGDFIPTFVHRD"
FT   CDS_pept        218522..219271
FT                   /transl_table=11
FT                   /locus_tag="BAV0212"
FT                   /product="probable short chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47817"
FT                   /db_xref="GOA:Q2L0I2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0I2"
FT                   /inference="similar to DNA sequence:INSDC:AF173961.1"
FT                   /inference="similar to sequence:UniProtKB:P28643"
FT                   /inference="profile:HMMPfam:PF00106"
FT                   /protein_id="CAJ47817.1"
FT                   /translation="MDLGIENQVALVTGAGNGIGLACARALAREGCRVVVADIDAAAAG
FT                   SAAQDITRARGQALALALDVSRPEPVRQAVAEVLAHWGGIDILVNNAGFSRDGPIGVMS
FT                   DAQWADVMNVNLTGQFHCIREIAPHMAARGYGRIVNMASRAHFGDVNKANYAASKAGVI
FT                   GLTRALAIELGQSGVTVNAVAPGIIQTERLSRLPQFADIRARSLAGMPIKRMGQPEEVA
FT                   DAVVFLASARSGFITGEVLHISGGRYG"
FT   misc_feature    218945..219031
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        219309..220277
FT                   /transl_table=11
FT                   /locus_tag="BAV0213"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47818"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0I1"
FT                   /inference="similar to DNA sequence:INSDC:AY305378.1"
FT                   /inference="profile:HMMPfam:PF03401"
FT                   /protein_id="CAJ47818.1"
FT                   /translation="MIKALGAVLGTAALLLGAAQASAADWPSQPIRMVIPFAPGGTTDI
FT                   LGRMMAEGLGKELGVTVIAENIAGANGNLGAQTVLRAKPDGNTLMLGTPGPMIVNKYVY
FT                   KNLSFDPKTAFAPVILVAALPNVLMVGPKSGIKSVAELIEQARAKPAGLTFGSPSVGSS
FT                   GHVSTELFKLKSQIDAVHVPYKGSSPMLVDLMSGNTDFTIDQISSALAFIQAGKLNALA
FT                   VTSRQRSPQLPDVPTLREAGFPDYEVSVWFSVAAPAETHKDRVSKLNAALNKVLADPAV
FT                   KARIVALGAQPLGGSPDDLKAQILAEEKNIQAVTQVVNFEN"
FT   sig_peptide     219309..219377
FT                   /locus_tag="BAV0213"
FT   CDS_pept        220291..221130
FT                   /transl_table=11
FT                   /locus_tag="BAV0214"
FT                   /product="Putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47819"
FT                   /db_xref="GOA:Q2L0H9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0H9"
FT                   /inference="similar to DNA sequence:INSDC:AB112586.1"
FT                   /protein_id="CAJ47819.1"
FT                   /translation="MTLMKDVYTGSVRVGDVPVTYHDSAPAAADAATIVLLHGTGGSAQ
FT                   NNFWALFPMLAMRHRVVALDFVDPELPEAQPYLDQVLAVVEACCGSRPVHLVGYSFGAV
FT                   IAALLAARHGRRLASLTLVAGWLKTDTQQKLRNTIWRSLYESGHEAIAPFSVFTNFSSS
FT                   FLNAKNEAELEALIQAVRTGPDRSRKMAFNRQVDIGDEVATIDVPSLVIGCKHDQMAPI
FT                   RHSRLLFGSIKNCRYAEINSGHGVVHERPSELFTMIDNFVRQPDGWPAGHVVQNSHA"
FT   misc_feature    220570..220599
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00120"
FT   CDS_pept        221146..222645
FT                   /transl_table=11
FT                   /locus_tag="BAV0215"
FT                   /product="Putative flavin-containing monoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47820"
FT                   /db_xref="GOA:Q2L0H6"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0H6"
FT                   /inference="similar to DNA sequence:INSDC:AF090329.2"
FT                   /inference="profile:HMMPfam:PF00743"
FT                   /protein_id="CAJ47820.1"
FT                   /translation="MKANHAAPRTETEVLIIGSGFSGLGMAVALKRQGKHDFLVLERAN
FT                   DVGGTWRDNAYPGAACDIQSHLYSYSFRPNPRWSRVYAPQSEIHQYLRDTASDEGIGEH
FT                   LRFGANVTQAVWDAQAGAWMVDTTAGGFKARVLISAAGHLSDPSYPDIEGMDTFKGRTF
FT                   HSAKWDAGYDFSGKRIGVIGTGASAIQIVPELAREAAQLTVFQRSAPYVIPRRDHVYSE
FT                   AEKGLFERFPEAAQELRDELFWGNESRFPQRRQVPAFIDQITAMALGHLRQQVPDAALR
FT                   QKLTPHYAIGCKRVLISNDYYPTLQRSNVALETAGIARIDADGVILKNDERVDLDLLVV
FT                   ATGFEATELPIAQLIRGQGGVLLADQWQAGGQAFACTAVSGFPNLFLMLGPNTGLGAGS
FT                   MVFMIETQINYIQGAVDFILDSGAVVDPDPQAQQAYVESIYRRSAGTVWLEGGCSSWYL
FT                   HPESGRLTALWPDFMTQFRKENGSFSAQGYQVSPARQEQGT"
FT   CDS_pept        222642..223541
FT                   /transl_table=11
FT                   /locus_tag="BAV0216"
FT                   /product="Putative 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47821"
FT                   /db_xref="GOA:Q2L0H3"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0H3"
FT                   /inference="similar to sequence:UniProtKB:P52041"
FT                   /inference="profile:HMMPfam:PF02737"
FT                   /inference="profile:HMMPfam:PF00725"
FT                   /protein_id="CAJ47821.1"
FT                   /translation="MSARIAVIGAGLMGHGIAQTFMVAGFEVSIWDPAEAARASVKTRI
FT                   AEHLALMGLAHQPVEVRVCDSLEACVEGCDLLIEAVPEKMDIKRALLAAVNALHPECII
FT                   ATNTSVLRITEIAEGSLHPERVVGTHWWNPPYLIPVVEVVRGEQTSEAVAQQVSAWLTQ
FT                   AGKTPVDVYRDVPGFVGNRMQFALMREAAYLVEEGICSAETVDLVASLTFGRRMAAVGP
FT                   LRNADFIGLDLVCNIMDYLSPSLSDAKTAPALFRERVAAGQLGAKSGAGVYAWAGSDRD
FT                   ETEKQLLLHLIAAERTAS"
FT   misc_feature    223161..223235
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00067"
FT   CDS_pept        complement(223799..>224779)
FT                   /transl_table=11
FT                   /locus_tag="BAV0217"
FT                   /product="putative exported protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47822"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0H2"
FT                   /inference="similar to DNA sequence:INSDC:BX572600.1"
FT                   /inference="profile:HMMPfam:PF03401"
FT                   /protein_id="CAJ47822.1"
FT                   /translation="VRLRWIKHTLLAAALALPMAAAHTANYPEKPINIIVPFSPGGVSD
FT                   VMARLVAAKLQDDLKVPVIVVNKPGASTTIATNHVARSAPDGYTVLMAASTFAVAPALY
FT                   KEKAGYDPEKDFRPLSLLAAVPHILVVTPSLPVDNVESLVKFLKTGDGKKTNYSSSGPG
FT                   TSNHLEGELFSSNAGVRPNHIPYRGSVPALSAIAAGEVNFMFVDLAAAKSFMDSGKVKA
FT                   LAVTTAKRSPLLPQLPTVGESGLVNFSATPWLGFVVPADVPDQVVATLSTSLRRMAEDP
FT                   KLKQRFFDMGLEPSFSTPEEFGAFMKQDRSKWEAVIKEAGTIALD"
FT   sig_peptide     complement(<224704..224779)
FT                   /locus_tag="BAV0217"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(224818..225786)
FT                   /transl_table=11
FT                   /locus_tag="BAV0218"
FT                   /product="putative ketopantoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47823"
FT                   /db_xref="GOA:Q2L0G9"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0G9"
FT                   /inference="similar to DNA sequence:INSDC:AL646074.1"
FT                   /inference="profile:HMMPfam:PF02558"
FT                   /protein_id="CAJ47823.1"
FT                   /translation="MDRILIVGAGAVGSTLAWHLAGTRASVALLARGERAEILERQGLT
FT                   LWRDGQDMGRRHLPILTQPQGSWDAILLCVKQYDLPQALRTFTALGDAPLIPLINGIPW
FT                   WLLQRHPRLRGQSGWGEFYASFPAVALSRVLGSVVYIPARMRDAANVEQGGRDALALGE
FT                   IDGLPRARTEALAATLNAGGLQCKVSQHIEADIWNKLLGNATFNPVSALANATMQQMLT
FT                   HADLRQLCARLIAELMAVGAALGYQEAQGVEGRLRQAESAGHARTSMLQDASAGRPLES
FT                   EALVGIVTRIAAHLHIPTPILDSIWALLHSRFPLPSGQPGS"
FT   CDS_pept        complement(225791..226543)
FT                   /transl_table=11
FT                   /locus_tag="BAV0219"
FT                   /product="putative class II aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47824"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0G7"
FT                   /inference="similar to DNA sequence:INSDC:AE016786.1"
FT                   /inference="profile:HMMPfam:PF00596"
FT                   /protein_id="CAJ47824.1"
FT                   /translation="MNSLRERVSETEWQTREALAAAYQLAALHRMTDHIYTHISARIAD
FT                   EDGHFLLNAYGLTFDEVTASNLVKVNLAGDILLDQTGLGINQAGFVIHSAIHAHRHDAM
FT                   CVMHTHTQAGVAVSAQASGLRMLSQQAMRFYGKLAYHDYEGVVLDMDEQERITRSLGAH
FT                   NALILRNHGLLVCGESISDAFDQMYYLERACQIQIAAQSGGEALIEASDAVAARVAAQF
FT                   DRPGRPSRDKHWPPLLRMLERLKPEYRQ"
FT   CDS_pept        226664..227575
FT                   /transl_table=11
FT                   /locus_tag="BAV0220"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47825"
FT                   /db_xref="GOA:Q2L0G4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0G4"
FT                   /inference="similar to DNA sequence:INSDC:AE016791.1"
FT                   /inference="profile:HMMPfam:PF00126"
FT                   /inference="profile:HMMPfam:PF03466"
FT                   /protein_id="CAJ47825.1"
FT                   /translation="MTRPNLMHAETLCWIARLGTFAAAAERMHATQPAISARMKELESA
FT                   LGYPLFERRGRRLELTLQARRFVERIAPLLREVEDLFNDTEAALLPAGTVRLGLGEVSM
FT                   TWLGGLMPMLRRALPHVTYDIELDLGVKLRERLVAGTLDVALVANSRETAGLAYTPLGK
FT                   VPMVWVCATSLLFTPEGRSRSLEELLRRETLWCVSKPSDFFAPAYNELRAAGADMSRLC
FT                   SCNKVKGLIDAVTAGGGIALLPRTMVARQLQSGELALLPGGLAGQTLDFAIALHCNQSQ
FT                   PAVLALVAELLRLSRLSPIGSP"
FT   CDS_pept        complement(227628..228383)
FT                   /transl_table=11
FT                   /locus_tag="BAV0221"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47826"
FT                   /db_xref="GOA:Q2L0G2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0G2"
FT                   /inference="similar to DNA sequence:INSDC:BX248360.1"
FT                   /inference="profile:HMMPfam:PF07702"
FT                   /inference="profile:HMMPfam:PF00392"
FT                   /protein_id="CAJ47826.1"
FT                   /translation="MAKPFLPNASEVLSRSKLPLYLQLAAEFRRNIAQGIWMPDQQIPS
FT                   LEALMAQYQVARMTLRNAIGILEEEGYIRRGRGKGTFVQRNIPNVTELQIPSNWEETVA
FT                   LSDLLGTESIADGEHAIASLPDLGMKFSGQYAKAYRHLCRLHVKDGVPYCFSEVYLAED
FT                   LFKQHKAAFLKAAAASVIARIPGLKIHEARQKITISGAGIESARALNLNVDDSVAEVRR
FT                   YACDKEKLIYYARLEFPTKFVKLEFDLCP"
FT   CDS_pept        complement(228395..229969)
FT                   /transl_table=11
FT                   /locus_tag="BAV0222"
FT                   /product="putative fatty acid CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47827"
FT                   /db_xref="GOA:Q2L0G0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0G0"
FT                   /inference="similar to DNA sequence:INSDC:U75363.1"
FT                   /inference="profile:HMMPfam:PF00501"
FT                   /protein_id="CAJ47827.1"
FT                   /translation="MDFYTLLQGHAAGRPAHIAFQDQDRVLDYAGLLAEVDRLAALMQE
FT                   QGVRRGDRLALWMPNCIEWLVTFLACARLGVTVIAVNTRFREHEVGQLLARGRCTWMAM
FT                   WPAFKGLPFVEILQGIDPEVLRGVRRIFAVGDNAALPAPLPAAVPFEAQAEHAGAISEP
FT                   GQESDGALVYTTSGTTSAPKLVLHRQAGLIHHGHIAARAYGISADSVVLLASPMCGAFG
FT                   FSTLLGGLTQGATLVSLAVFDAARTARQILEHGVTHTFANNEFLDLILKQAEGRSPAYP
FT                   SLRYVGFASFSPAMDDLPERALQAGMPIAGLYGSSELQALVAGHTLDTDWRHRRVAGGT
FT                   IASPEGRVRAVDSDSGAVLPHGAIGQIEIKAPSLMSEYLDNPEATRKAISDDGYFRTGD
FT                   LGYTVHERLFIFQGRDGDHLRLGGFLVAPLEIEQFLEGLPGVAGAQVVGAQHEGKTVPV
FT                   AFVRPQSGVQTDERAIIGACQSAMAKFKVPQRVIFVEDFPMVQSANSNKVQKHVLRQQA
FT                   QAMLDGQ"
FT   misc_feature    complement(228605..228628)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(228989..229021)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00435"
FT   misc_feature    complement(229421..229456)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        complement(229982..231022)
FT                   /transl_table=11
FT                   /locus_tag="BAV0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47828"
FT                   /db_xref="GOA:Q2L0F8"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0F8"
FT                   /inference="similar to DNA sequence:INSDC:AE017229.1"
FT                   /protein_id="CAJ47828.1"
FT                   /translation="MKRWKQRPAGSTWGDFGENDQLGRVNLLGQEQVLKGVQEVRQGKV
FT                   FCLSLPLDLPGGMALNPRRKPPRLSGTERDGVPYMNFPMEKLDPSSIDVLSDDQVVMSL
FT                   QYSTQWDALAHVGAYFDIDGSGTPRKVYYNGYEAGKDVLGAEDSGHGDCCGSGEQALGA
FT                   LKLGIEHFAVKGMQGRGVLVDFTRHYGRDRKLIGYRELMEVMEKDGVRVEAGDMLVLRT
FT                   GFAEVVTEMAGKPDPEALHKACCVLDGADEDLLAWITESGISAICADNYAVEAYPARER
FT                   EGKKSLLPLHHHCLFKLGLPLAELWYLKDLAEALHQEGRNRFLLTAPPLRLPGAVGSPV
FT                   TPIATL"
FT   CDS_pept        complement(231039..>231737)
FT                   /transl_table=11
FT                   /locus_tag="BAV0224"
FT                   /product="probable short-chain dehydrogenase/reductase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47829"
FT                   /db_xref="GOA:Q2L0F6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0F6"
FT                   /inference="similar to sequence:UniProtKB:P25716"
FT                   /inference="profile:HMMPfam:PF00106"
FT                   /protein_id="CAJ47829.1"
FT                   /translation="VLVTGASKGIGRAICERLTADGYAVVGVARTPPADLPAGMVFHAV
FT                   DLADNEAVNRFLAGEAAQQPFYGLVNNVGMVPVGNLETVSAEALYRAVQLNIEVALRFT
FT                   QALVPGMRAQGIGRVLNMASRAALGKTERSIYSMTKAGLIGMTRTWALELAPAGITVNA
FT                   IAPGPIETDFFAGANDAERTRALLASIPVNRMGRPEDVAHAVAYFMDERCGFVTGQTHF
FT                   VCGGMTVGNA"
FT   misc_feature    complement(231285..231371)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        231955..232905
FT                   /transl_table=11
FT                   /locus_tag="BAV0225"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47830"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0F5"
FT                   /inference="similar to sequence:UniProtKB:Q44018"
FT                   /inference="profile:HMMPfam:PF03401"
FT                   /protein_id="CAJ47830.1"
FT                   /translation="MKHLLIKPMVASLALCLGTAAFAADYPSNPVSLVVGYGAGGGTDV
FT                   CNRVLAQDVGKRIGQTLVIENKPGAGSSLSVSYITRQRPDGYSIASLSTGGVLNQVLNP
FT                   GNKYDVVKDLTPIAMVAQYQVGLLVRADSPHKNLADLVAAAKRKSLSYSTAGIGTPQHL
FT                   TTERLGQAIGSRWVHVPYKSGPETISALMRGDVDFMAQTAEWVPYVRDGRLRLLAVYTD
FT                   ERMQGFDAPTLKEQGYDLVAPSLLGISGPAGMDPAIVKRLQDAFQGATATPEFAHCADQ
FT                   FGLKVDFRDAAGFGDYVKNTLVNWTPLLQQFAGKE"
FT   sig_peptide     231955..>232021
FT                   /locus_tag="BAV0225"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        232908..234071
FT                   /transl_table=11
FT                   /locus_tag="BAV0226"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47831"
FT                   /db_xref="GOA:Q2L0F2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0F2"
FT                   /inference="similar to sequence:UniProtKB:P16219"
FT                   /inference="profile:HMMPfam:PF02770"
FT                   /inference="profile:HMMPfam:PF00441"
FT                   /protein_id="CAJ47831.1"
FT                   /translation="MSARQAWLQWPFLDERHRILGRELDAWCHTHLSDIDEADVYAACR
FT                   RLVQALGEGGWLRYSVPQEGAATLDARSLCVIRETLASHHALADFAFAMQGLGSGAISL
FT                   AGSAAQRAAYLPEVASGRSIAAFALSEPEAGSDVAALSCRAEAQSDGFVLNGHKTWISN
FT                   GGLADFYCVFARTGEPGSRGISAFIVDADTPGLVIEERIDVMSPHPLALLRFDRCRVPA
FT                   SQLLGDLNQGFKLAMRTLDVFRISVAAAALGFARRALAEGLDYASQRKMFGQTLADFQL
FT                   TQAAFGEAATEIDQSALLTYRAAWVRDVPQQSSTMETAMAKMAATESAQQVIDRVLQMF
FT                   GGRGVVRGNVLERLYRDIRSLRIYEGATEVQKLIISRELMRRHQERR"
FT   misc_feature    233289..233327
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00072"
FT   CDS_pept        complement(234056..234667)
FT                   /transl_table=11
FT                   /locus_tag="BAV0227"
FT                   /product="putative amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47832"
FT                   /db_xref="GOA:Q2L0E8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0E8"
FT                   /inference="similar to sequence:UniProtKB:P27847"
FT                   /inference="profile:HMMPfam:PF01810"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47832.1"
FT                   /translation="MNLSTLVLFALASTVIIATPGPTVLLAMTNGARHGWRMAAWGMAG
FT                   AILADLALVSVVACGLGVLLAASETAFQALKWVGAAYLAYLGWRLLRQDAARPSDGPTA
FT                   TARKQAVFTRSFLVALSNPKALIFMSAFLPQFINTQTPQTPQYLALAATLAVLNLLAML
FT                   IYAGLGIRLARGLPHLRWLNRLCGATLIGLGATLALYRRS"
FT   sig_peptide     complement(<234583..234667)
FT                   /locus_tag="BAV0227"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        234757..236085
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="BAV0228"
FT                   /product="ribosomal RNA small subunit methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47833"
FT                   /db_xref="GOA:Q2L0E3"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0E3"
FT                   /inference="similar to sequence:UniProtKB:P36929"
FT                   /inference="profile:HMMPfam:PF01189"
FT                   /protein_id="CAJ47833.1"
FT                   /translation="MAFASESGTLAPPLSAVLLSAAAAVQAVDEGRSLTEALAESEAGL
FT                   RPATQAVSFHAMRYMGWADTIANRLVPREPAPLAGALLRVALSLLKEAPGADPLPGMPV
FT                   YAPHTVVDQAVTAAAEHRRLAGFKGLINGSLRRFLREREQFEAQLANDPVVRWNHPQWW
FT                   IKTLRQAYPQQWQSLLAAANVPAPLTLRVNRRRASREQVLDAFSHAGLPAREAGEWGVV
FT                   VLEPRPVAQLPGFAEGWWSVQDAGAQLAAPLLPLADGMRVLDACAAPGGKTAHMLEIAN
FT                   LDLVALDSDASRLERVGQNLARLGLSGASLVAADAAKLDSWWDGKPFDAVLADVPCTAS
FT                   GIVRRHPDIRWLRRAPDVARTAALQARIADALWRVVAPGGHLLYVTCSIFPAEGQAQAQ
FT                   AFAARHADAIVLPAPGQLLPVALDATPERQHDGFFYALFAKRR"
FT   sig_peptide     234757..>234835
FT                   /gene="rsmB"
FT                   /locus_tag="BAV0228"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    235738..235773
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01153"
FT   CDS_pept        236128..236712
FT                   /transl_table=11
FT                   /locus_tag="BAV0229"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47834"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0E0"
FT                   /inference="similar to DNA sequence:INSDC:AE002370.1"
FT                   /protein_id="CAJ47834.1"
FT                   /translation="MIVRLFVAFVLAISPFFANEGGQAYAAEPRVTTIDPIIQDGRLAI
FT                   NADVDFPLNDQLRDAAQRGLPLYFTADIKISKARWWWFDRSIVDTSLTWRLSYNALTRQ
FT                   WRVGQGELSLNVASLDEAMNLVRHIRDWRVADADEFEAGEVYTGQLRLRLDTSLLARPF
FT                   QVNALNSSAWTAGTPWRDFSFTLTEPARNPS"
FT   sig_peptide     236128..>236203
FT                   /locus_tag="BAV0229"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        236709..239006
FT                   /transl_table=11
FT                   /locus_tag="BAV0230"
FT                   /product="two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47835"
FT                   /db_xref="GOA:Q2L0D8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0D8"
FT                   /inference="similar to sequence:UniProtKB:P45675"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00672"
FT                   /inference="profile:HMMPfam:PF00512"
FT                   /inference="profile:HMMPfam:PF02518"
FT                   /protein_id="CAJ47835.1"
FT                   /translation="MRLLLRLALVIGAISGLSLLGLLAWSTGNASRLARYYDLLLVVNG
FT                   VFALAMFVWVVALTVRLARQIRRRQFGARLTARFALAFALIGVVPGALIYTLSVQFLSR
FT                   SIESWFNVRVDNALEAGLNLGRAALDNQLADLDAKARSMASELNNLPDAELSSALNRLR
FT                   ESNGVQEALVFTGGGRPLAYSTNKLGQLVPPTPPSAVMNQLRLSRGYSAAEADEPGIPG
FT                   SEDGLHLRVIIPLNAPVRFDSSLVGAGEPRWLQLVQNVPEQIAHNANRVQQGFRDYQEL
FT                   ALSRTGLRKLYGITLTLALLLAVFAAIAVALSLSKRLVRPLLTLAAGTQAVSVGDYRPL
FT                   PEPPANDEIGHLTRSFNAMTRQLDEARLMVESNRRQLERSNVYLESVLANLSSGVVAFD
FT                   ESFRVTTVNQGAQDILQADLRSVVGRPLETIDGMLEFAHIVRDAFSAHAAVGSERQHWQ
FT                   QQFEITPGQPGAQPLILLARGTHLHVDGRGNGYLVVFDDITEVISANRTMAWGEVARRL
FT                   AHEIKNPLTPIQLSAERLAMKLAGHLPPAEAQMLARATNTIVNQVGSLKQMVDDFREYA
FT                   RTPPAVMQPIDFNGLVADVLSLYGWDPADGQPRHGGPKFEVSLAEGLPVIEGDSTQLRQ
FT                   VIHNLLTNARDAVSDKAEAAIIRVVTQLTPIPNSDGSETAALRFTVADNGAGFPPQVMQ
FT                   RAFEPYITTKAHGTGLGLAIVRKIVEEHGGRIDLANRKEGGARVSILLTRLARASDTMD
FT                   ETLQQKHNAATQ"
FT   sig_peptide     236709..>236796
FT                   /locus_tag="BAV0230"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        239018..239701
FT                   /transl_table=11
FT                   /locus_tag="BAV0231"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47836"
FT                   /db_xref="GOA:Q2L0D4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0D4"
FT                   /inference="similar to DNA sequence:INSDC:AL646057.1"
FT                   /inference="profile:HMMPfam:PF00072"
FT                   /protein_id="CAJ47836.1"
FT                   /translation="MARILVVDDEVGIRELLSEILYDEGHTVELAENAAQARAARLRSR
FT                   PDLVLLDIWMPDTDGVSLLKEWASQGLLDMPVIMMSGHATIDTAVEATRIGAMDFLEKP
FT                   ITLQRLLKTIAAGLARGRVPGPSSTPALNTMPAAVLTDELDPAPALAHPVASETASNGQ
FT                   LGSISLDQPLREARDEFERIYFEYHLVRENHSMTRVSERTGLERTHLYRKLKQLGIESA
FT                   RKRSS"
FT   CDS_pept        239698..241077
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="BAV0232"
FT                   /product="Trk system potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47837"
FT                   /db_xref="GOA:Q2L0D0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0D0"
FT                   /inference="similar to sequence:UniProtKB:P23868"
FT                   /inference="profile:HMMPfam:PF02254"
FT                   /inference="profile:HMMPfam:PF02080"
FT                   /protein_id="CAJ47837.1"
FT                   /translation="MKILIVGAGRVGTSLAENLVSEENDITVVDIHGGQLRYLQDRFDL
FT                   RVVQGDATQVSVLESAGAADTDLCIACAASDSINMVVCKIARQLFNVPRRIARIRMPEF
FT                   AEHPELMGDEGFCIDALISPERSVTTYLHSLIEFPEALQVVEFAEGKLSVVTARVGSGS
FT                   PMAHTPVDKLREVWPDVTARIIEVLRDGRPLHAGQRTVIAPGDEVVLMVDSRHARRAVR
FT                   KLREAEKSVHRVMIAGGGNIGLRLARQLAEENYSVRIIERDAKRCEHLAAELPSSVLVL
FT                   HGSGTDESLLERENIQDMDTWLALTSDDEDNIMSSLLAKRLGARKVVALINRPAYGELM
FT                   QGSHIDIAVSPSQATISELLRHVRRGDVVAVHRLRQGVAEALEAVAHGDRSTSRVVGRR
FT                   VGDISLPKGALIGALVREDEILLPDADTVIESDDHVIVFVPSRQQMARVEKLFQVSASF
FT                   F"
FT   CDS_pept        241101..242570
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="BAV0233"
FT                   /product="Trk system potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47838"
FT                   /db_xref="GOA:Q2L0C7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0C7"
FT                   /inference="similar to sequence:UniProtKB:P21166"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF02386"
FT                   /protein_id="CAJ47838.1"
FT                   /translation="MKRLLATCYVLGLTMVVFALTMLIPLGLAVWENDAGQQAFARGFA
FT                   IAIGSGLAVWLLARRWRSELHARDGFLLVSVVWAALPLLAALPLLLYFHDVGKPLSFTH
FT                   AYFEAMSGLTTTGATVLTGLDELPHSVNLWRVTLIWIGGMGILVLAVAILPLLGVGGQQ
FT                   VVRAETPGPMKDERLTPRIASTAKALYAVYFGFSILCFLAYRAVGLPWFDAWAHMATTM
FT                   GLGGFSIYDSGFLKFDSVSVEMVAIVFMLISGINFATHFNALRQRSFKPYLSCPQTLPY
FT                   LTVVLGVGLLISAYLYIRHVYTDPLQALRYGMFNTVSVATTTGFANTDYATWPLFAPLT
FT                   MLLLGAFATSAGSTGGGIKMIRVILLVKQARNELITMLHPHAVSPVRIGSRIVDQRVMF
FT                   SVLAFMLVYGLSIGVVSSLLLLSGLDLSTAFSAAMAMINNIGPGLGILGPMGNYGVLSD
FT                   FQIWVCTFAMLIGRLELLTVLVLFTPWFWRK"
FT   sig_peptide     241101..>241155
FT                   /gene="trkH"
FT                   /locus_tag="BAV0233"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        242938..244149
FT                   /transl_table=11
FT                   /locus_tag="BAV0234"
FT                   /product="glutamate-cysteine ligase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47839"
FT                   /db_xref="GOA:Q2L0C4"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L0C4"
FT                   /inference="similar to DNA sequence:INSDC:AL646074.1"
FT                   /inference="profile:HMMPfam:PF04107"
FT                   /protein_id="CAJ47839.1"
FT                   /translation="MEQIPFVSSSPNTLGIELELQLIDPAGFDLAAASDELLAQLANHP
FT                   VADRIKPEITRSMIELNSSVHEHPAGLLAEMREMRDALCEAADAVGVSVSGGGTHPFMR
FT                   WQERTISDTPRFQYLAEMYGYLARQFTVFGQHIHLGVPSGDAAVRLVHGLSPYVPHFIA
FT                   LSASSPYREGVDTLFSCARLNAVNSFPLAGHLPPEVADWYHFEAHIAQLRASGLAESIK
FT                   DLYWDIRPKPEFGTVEIRVCDTPLTVERACQLAAFAQALAVLLEREPSPPTQAWLAYRS
FT                   NHFQACRFGLHGSYVTPGGQRVRLADHLKALFVRLMPVAEELGTTDILQSLRDEMQRGG
FT                   NDARWLRAQFHRTRELSGTVEAMTQVFRGESAAQRRAPQAARRRIRASSEPLGPMSMWP
FT                   ERLH"
FT   CDS_pept        complement(244156..245085)
FT                   /transl_table=11
FT                   /locus_tag="BAV0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47840"
FT                   /db_xref="GOA:Q2L0C1"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0C1"
FT                   /inference="similar to DNA sequence:INSDC:AY593479.1"
FT                   /protein_id="CAJ47840.1"
FT                   /translation="MSQSTPLPDLPLSSLDVSRQFARRGDLSEAQFLYGEIARRMMGRL
FT                   GYIRLQPQALLDAGCGAGDNLPLLRERYPQASYTGLDHCAPLLAIARQRFQPAGLSALV
FT                   GKLTGRGKSPVQFTQADLAATGLAPESFDLVWSNLAMHWHPTPHAVLVEWRRILRVGGL
FT                   AMFSCLGPATLRELRQALDDAGLATATPAFVDMHDFGDLLVENGFADPVMDQEILTLTY
FT                   ATPDKLLQDVRALGGNPARGRRAGLTSRAWRTRLCDALEALRGPDGRISLTIEVAYGHA
FT                   WRAATHRAAPGETRLSVSAIGGRRSETL"
FT   CDS_pept        245295..245906
FT                   /transl_table=11
FT                   /locus_tag="BAV0236"
FT                   /product="putative phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47841"
FT                   /db_xref="GOA:Q2L0C0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0C0"
FT                   /inference="similar to DNA sequence:INSDC:AE016775.1"
FT                   /inference="profile:HMMPfam:PF00156"
FT                   /protein_id="CAJ47841.1"
FT                   /translation="MRGAAPRCPACRARLPAAAGLLCAGCLRRKPRCGQVVAAFDYELP
FT                   GDSLIRAYKGQGRLSLTPALGALMAMAWRARGPDLPLLLVPMPASPAALRRRGFNPAAE
FT                   LAAVVAQCQRLPLSRYGLRRTRIRTSQTGRGRRARWRGLRGLFVADAALAGRDVLLIDD
FT                   VITTGATAHAAALALRRVGARCVGVLAAARTPAPGWQNTP"
FT   misc_feature    245766..245804
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        245957..246427
FT                   /transl_table=11
FT                   /locus_tag="BAV0237"
FT                   /product="putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47842"
FT                   /db_xref="GOA:Q2L0B7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0B7"
FT                   /inference="similar to DNA sequence:INSDC:AL646058.1"
FT                   /inference="profile:HMMPfam:PF00588"
FT                   /protein_id="CAJ47842.1"
FT                   /translation="MFHVILVCPEIPPNTGNAIRLCANTGAQLHLVRPLGFELDDTRLR
FT                   RAGLDYHEWQPMKVHDDLPAALAATGAPPERIFALTTQGARSAAGMQYQRGDVFVFGRE
FT                   TAGLSPEHVALFAPGQRLRLPMRPGQRSLNLSNAVAVTVFEAWRQQGYEGGE"
FT   misc_feature    246002..246031
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00449"
FT   CDS_pept        complement(246442..247431)
FT                   /transl_table=11
FT                   /locus_tag="BAV0238"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47843"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0B5"
FT                   /inference="similar to DNA sequence:INSDC:AY305378.1"
FT                   /inference="profile:HMMPfam:PF03401"
FT                   /protein_id="CAJ47843.1"
FT                   /translation="MSFARLFNRLQRGLGLGLISALLPVAAHASWPDRPIHLVVPFPPG
FT                   SSPDLLARTIAEPLSQALQQPIVVDNKPGAGGNIGTRLVSQAKPDGYTLLYTINGPLVT
FT                   APTLYKRTLGYDPLKDLAPITLVATSPNVLTVPASLGVDNVEAFVKLARQRGGSMNYGS
FT                   VGPGSSAHLAMEMFKQEAKIDLTQIPYPGFPQVIAGIISGDIQAAFMVPAIAMPQAKDG
FT                   RVKALAITSLEPSEALPGIPTMASQGYPGFEAISWNAVLAPAGTPTPIIERLNSELARI
FT                   INSDAVRKQMLLQYFTPAPSTPEALTQRIRSEKARWDRVIDSLNLSLD"
FT   sig_peptide     complement(<247341..247431)
FT                   /locus_tag="BAV0238"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(247468..248532)
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="BAV0239"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47844"
FT                   /db_xref="GOA:Q2L0B2"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L0B2"
FT                   /inference="similar to sequence:UniProtKB:P37606"
FT                   /inference="profile:HMMPfam:PF07479"
FT                   /inference="profile:HMMPfam:PF01210"
FT                   /protein_id="CAJ47844.1"
FT                   /translation="MVTTNAPSLRIAVLGAGSWGTALAAAASRRHPTLLWARGAAQAAS
FT                   LSIERENTRYLPGVALPAALRFSADLDQALDFLGTDPDQALIILGVPVAGMSSIMAELA
FT                   LRLPLRGMIRTPIVWTCKGFETDSARLPHEIVHASVGELAGMACGVLSGPSFAREVAQG
FT                   LPVALTVASRHERVIRAVTAALHGAAVRVYASQDVPGVEMGGALKNVIAVACGISDGLA
FT                   LGTNARAALITRGLAEMTRFGLALGARADTFAGLTGLGDLVLTATGELSRNRRVGLEIG
FT                   AGRKLDDILASGVTAEGVRCARAALARAHSLGVELPITEAVCAVLFEGVAPMTAVSALL
FT                   AREARQEGSTDVQP"
FT   misc_feature    complement(247855..247920)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00957"
FT   sig_peptide     complement(<248457..248532)
FT                   /gene="gpsA"
FT                   /locus_tag="BAV0239"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(248549..249067)
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="BAV0240"
FT                   /product="protein-export protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47845"
FT                   /db_xref="GOA:Q2L0A9"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L0A9"
FT                   /inference="similar to sequence:UniProtKB:P15040"
FT                   /inference="profile:HMMPfam:PF02556"
FT                   /protein_id="CAJ47845.1"
FT                   /translation="MADQDQNTQQTGSEAPAFNLQRVYLKDLSVEMPNAPHIFLEQEGP
FT                   AVEVTINVGGQRLAETVFESTVTVTVTTRVNDKVLYLVEGTQAGIFELANIPPEQMDPI
FT                   LGIVCPTMLYPYLRANVADAITRTSLPALHLTEVNFQALYEQRLAEMAQQQEQSADSGI
FT                   ILPPSATRQ"
FT   CDS_pept        complement(249124..249381)
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="BAV0241"
FT                   /product="glutaredoxin 3"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47846"
FT                   /db_xref="GOA:Q2L0A8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0A8"
FT                   /inference="similar to sequence:UniProtKB:P37687"
FT                   /inference="profile:HMMPfam:PF00462"
FT                   /protein_id="CAJ47846.1"
FT                   /translation="MQKVVMYSKDYCPYCARAEALLRQRGVTEIEKIQIDRDPAQRDVM
FT                   IERTGRRTVPQIYIGDTHVGGCDDLQALDRSGGLLPLLNG"
FT   misc_feature    complement(249316..249372)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS_pept        complement(249446..>249868)
FT                   /transl_table=11
FT                   /locus_tag="BAV0242"
FT                   /product="putative sulphurtransferase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47847"
FT                   /db_xref="GOA:Q2L0A7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0A7"
FT                   /inference="similar to DNA sequence:INSDC:AL646058.1"
FT                   /inference="profile:HMMPfam:PF00581"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47847.1"
FT                   /translation="VDFLQFLIDKNNIFIVAVAVVSGLMLLVSGLRKGGAGAALDTGAA
FT                   IQMVNHQQAVWVDVRPAEQFQAGHIAQARSVPADDLEKKAAALPKNKPLIVVCEQGRTS
FT                   PRIAKRLAALGLTDVRTLQGGMRAWYAANLPVTQKG"
FT   CDS_pept        250052..250804
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /gene_synonym="gpm"
FT                   /locus_tag="BAV0243"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47848"
FT                   /db_xref="GOA:Q2L0A6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L0A6"
FT                   /inference="similar to sequence:UniProtKB:P62707"
FT                   /inference="profile:HMMPfam:PF00300"
FT                   /protein_id="CAJ47848.1"
FT                   /translation="MYKLVLMRHGESQWNLENRFTGWTDVDLTEVGREQARRAGELLKR
FT                   EGYTFDLAYASVLKRAIRTLWIALDAMDAMYTPVGLNWRLNERHYGQLQGLNKAETAAK
FT                   YGDEQVLIWRRAYAIAPEPLDIDDPRHPRFDSRYAKIPAEQLPATECLRDTVARVLPFW
FT                   NESIAPAIRAGRRVLVAAHGNSLRALIKHLDNISDDAIVELNIPTGQPLVYELDENLRP
FT                   IRHYYLGDAAEIEAAMAAVAAQGKAKKD"
FT   misc_feature    250067..250096
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00175"
FT   CDS_pept        250809..252395
FT                   /transl_table=11
FT                   /locus_tag="BAV0244"
FT                   /product="putative exported peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47849"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L0A2"
FT                   /inference="similar to DNA sequence:INSDC:AE011625.1"
FT                   /inference="profile:HMMPfam:PF01551"
FT                   /protein_id="CAJ47849.1"
FT                   /translation="MRFAAGLLSLAVAALAPAAVQAASADLANRQSEAERQQAALRTRI
FT                   DSLQKTIDEREAARKEAADALKVSESAISSINRRLRELADSGRQAESDLASLEKQAASQ
FT                   TAVLQERRAQLADQLKAQYQNGLSPWTELLSGGDPQELGRNLGYLEYVSKARAQAVREV
FT                   RQDIDRLAALQKRADARRTDLQRLLAETDVEKAALLTQQKERATLLAKLEGQIEAQRAE
FT                   AARLGRDDQRLSHLIDDLGTAIARQAEEEARRRAAEEARRKAEEARKAEEIRKAEVARK
FT                   AEAVRKAEEARKAEQARRAEAARQSQEAQRSQDAKEAARVREQAEAALERGRGPGPAVV
FT                   ADPEAAGLRPAEAAHPRLVETREPIVEKAVQAPKQDAVKPAEPAKPAAAREDTRPLVGG
FT                   GNGLRRGLPPPVKGQIQGRFGVGRPEGGVWRGIVLRAAEGTPVKAVAPGTVVYAEWLRG
FT                   FGNLIIVDHGQEYLTVYAYNQSLLKRVGDRVATGDTIATVGATGGQVESGLYFEIRHRG
FT                   APVDPAQWLAQ"
FT   sig_peptide     250809..>250872
FT                   /locus_tag="BAV0244"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        <252417..253871
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="BAV0245"
FT                   /product="carboxy-terminal processing protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47850"
FT                   /db_xref="GOA:Q2L099"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L099"
FT                   /inference="similar to sequence:UniProtKB:Q44879"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00595"
FT                   /inference="profile:HMMPfam:PF03572"
FT                   /protein_id="CAJ47850.1"
FT                   /translation="VCMSTRKFRGFGLVATGVVAGVLLSVGVTAVAQRGNPLPLDELRQ
FT                   LTNVFSAIKNNYVEQVDDKALIGNAISGMVSNLDPHSAYLDADAFREMQTATQGEFGGL
FT                   GIEVGAEDGFVKVISPIEDTPAARAGIMAGDLIIKIDDTPTKGMSLNDAVKLMRGKPKS
FT                   PITLTIVRADHPQPIVVKIVRDVIKVRSVRSKMLDDGVAYVRIAQFQEKTGSDLARHLR
FT                   ELGAKGAPKGLVLDLRNDPGGLLTSAIGVSGAFLPADSLVVSTDGRTPDSRHKYLATPS
FT                   EFARGEGNYLADLPEWTKTVPMVVLVNVGSASASEIVAGALQDHKRAKVLGNRTFGKGS
FT                   VQVILPLSESTAVKLTTSRYFTPSGRSIQATGIEPDYVVADTADGDLFRLPREADLQRH
FT                   LSNQQTSSEVKSNPNDNTEAPVGKVFEFGGKDDFQLQQAINVLQGKPVQKGSARAQAKA
FT                   DIKPNVSGKTERLTITPSGVEPAGKQ"
FT   sig_peptide     252417..>252504
FT                   /gene="ctpA"
FT                   /locus_tag="BAV0245"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        253868..254617
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="BAV0246"
FT                   /product="adenylyltransferase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47851"
FT                   /db_xref="GOA:Q2L095"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L095"
FT                   /inference="similar to sequence:UniProtKB:P30138"
FT                   /inference="profile:HMMPfam:PF00899"
FT                   /inference="profile:HMMPfam:PF05237"
FT                   /protein_id="CAJ47851.1"
FT                   /translation="MNDQQLLRYARHILLDDLGVEGQEAFLATKVLIIGAGGLGCPAAL
FT                   YLATAGIGHITLVDDDVVELSNLQRQILHTTASLGRPKAESGRDMLAAFNPEVVVTPRV
FT                   ERLEGEALAEAVAAADIVLDCCDNFATRHAINRACVRHRKPLVSGAAIRYDGQISTYDL
FT                   RRDDTPCYHCLFPEADEAEEISCATTGVLAPLVGIIGAMQAAEALKLACGLGETLAGRL
FT                   LQLDVRSMQWHSVNVPRDPDCPVCRQR"
FT   CDS_pept        254679..255389
FT                   /transl_table=11
FT                   /locus_tag="BAV0247"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47852"
FT                   /db_xref="GOA:Q2L093"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L093"
FT                   /inference="similar to DNA sequence:INSDC:AE014506.1"
FT                   /inference="profile:HMMPfam:PF00392"
FT                   /protein_id="CAJ47852.1"
FT                   /translation="MAYNPAMQTQTLTEQVARQLADAIGQGVYPVGDKLPSGRALAEHY
FT                   GVSAAVIREATERLRSQGLVRTRQGSGCTVIARTGVQGFQVPPGMDRAALGAVYELRMD
FT                   LEAGAAALAAQRRDSADLRAMDNALATLGHHLEDPVQGGEHDVAFHLAVASATHNDHYQ
FT                   RLLQYLNLQLRQAVTTARANTARQQGLARAVHDEHIAVFEAIRNGDADAARIAALRHLR
FT                   NAASRLQLDFSLTD"
FT   CDS_pept        255396..256808
FT                   /transl_table=11
FT                   /locus_tag="BAV0248"
FT                   /product="putative FAD-linked oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47853"
FT                   /db_xref="GOA:Q2L092"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L092"
FT                   /inference="similar to DNA sequence:INSDC:AL646065.1"
FT                   /inference="profile:HMMPfam:PF01565"
FT                   /inference="profile:HMMPfam:PF02913"
FT                   /protein_id="CAJ47853.1"
FT                   /translation="MSQNTFAERLTQALGPDVVLTRPEDIAPWLSDWRGLYQGQAQAVV
FT                   RPRTTEEVSRCLALCQAEGVPVVPRGGNTGLCGAATPDASPVNVVLSLDRMNAIRSVDT
FT                   IANTMVAEAGCILGNLRRAAQDAGRLLPLSLAAEDSSQIGGNVATNAGGVNVVRYGMTR
FT                   ELVLGLEAVLPTGEIFHGLRTLRKDNTGYDLKQLLIGSEGTLGVITAVALRLFPRTDVR
FT                   SVVLAAVESPAQALSLYELLFQACGARLQAYEFFTGDCLDLVLRHAEGVQEPFPQRYPA
FT                   YVLMELADTEDENALNELLERVIGRALEEGLCLDAAVSASLAQLQALWKLREEISEAQR
FT                   ADGPHLKHDVSLPIEKIPEFMQTAQQRVKALDPNIRLYIFGHFGDGNLHYNLSRPEGAP
FT                   REWAAAQGARVTDVVLDEVHRYGGSISAEHGIGQLKREHFLHTKDPLELRVMAGIKRLL
FT                   DPAGIMNPGKLL"
FT   misc_feature    255663..255692
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        complement(256827..257798)
FT                   /transl_table=11
FT                   /gene="alX"
FT                   /locus_tag="BAV0249"
FT                   /product="putative pH-regulated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47854"
FT                   /db_xref="GOA:Q2L089"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L089"
FT                   /inference="similar to sequence:UniProtKB:P42601"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF03741"
FT                   /protein_id="CAJ47854.1"
FT                   /translation="MTFLMNDFLGTPVWSWLLFLSVVVALLAFDLGVLHKDEREIGVRE
FT                   SLLLSAGYIAAALLFGSGIWWQMGAESGMAYYTGFLIEKSLSMDNVFVIALIFSYFAIP
FT                   RRYQHRVLFWGILGVIVLRALMIGLGTALVSQFGWVMYVFGAFLVYTGVKMWRMVDEEP
FT                   DIANNAILKFLKRRMRVTDDLRGNAFTVVETDPVTQRKTRFATPLLLALVLIEFVDLLF
FT                   AVDSVPAIFAITTDPFIVYTSNIFAILGLRALYFALSALIHRFHYLKYALALVLVFIGG
FT                   KIFLHGLIGKVPAVLSLSVTFGLIAAGILYSLWKTRAQEQAG"
FT   CDS_pept        257906..258787
FT                   /transl_table=11
FT                   /locus_tag="BAV0250"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47855"
FT                   /db_xref="GOA:Q2L085"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L085"
FT                   /inference="similar to sequence:UniProtKB:P10087"
FT                   /inference="profile:HMMPfam:PF00126"
FT                   /inference="profile:HMMPfam:PF03466"
FT                   /protein_id="CAJ47855.1"
FT                   /translation="MLNYRHLYYFWAVAKEGGFARAAERLDMAIQTISAQVRELERSLG
FT                   HQLLKPHGRGVALTEAGEAAFARAEEIFQIGQSLADEVRAAASRPIQRLAIGLSDGISK
FT                   LAVHALLQPVLDTPDLRLICHDGEVDELLGELARHHLDLVLTGQGAPPNPNLRLSSERL
FT                   VSSPVDWYGPVRWTRRNDVSGFPQTLARLPVLLPTRHAVLRQTLDRWFEEQGIVPHVVG
FT                   EFEDSALMAVFAARGLGVFPLSRLGGEGLLNNLRLLGRCDGAHEEIHAIRNRRGQRHPL
FT                   VQRILEQAATSS"
FT   misc_feature    257957..258049
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00044"
FT   CDS_pept        complement(258878..260791)
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="BAV0251"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47856"
FT                   /db_xref="GOA:Q2L083"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L083"
FT                   /inference="similar to sequence:UniProtKB:P30136"
FT                   /inference="profile:HMMPfam:PF01964"
FT                   /protein_id="CAJ47856.1"
FT                   /translation="MNANPKFLAATAEVDAAAVAPLPKSRKIYETGSRPDIRVPFREIE
FT                   QQDTPTMFGGERNPPLTVYDTSGPYTDPQAHIDIRRGLPELRRAWIEERGDVELLAGPT
FT                   SDYGRARLQDPQLTAMRFDLRRPPRRAKDGANVTQMHYARRGIVTPEMEYVAIRESLRR
FT                   EHYIESLRASGPEGEKMARRLLRQHPGQSFGAAIPAAITPEFVRDEIARGRAIIPANIN
FT                   HPEVEPMIIGRNFLVKINANIGNSAVSSGIGEEVEKMTWAIRWGGDTVMDLSTGKHIHE
FT                   TREWIIRNSPVPIGTVPIYQALEKVDGKAEALTWEIFRDTLIEQAEQGVDYFTIHAGVR
FT                   LPFIPMTADRMTGIVSRGGSIMAKWCLAHHKESFLYERFEEICEIMKAYDVSFSLGDGL
FT                   RPGSGYDANDEAQFAELKTLGELTQVAWKHDVQVMIEGPGHVPMQMIKENMELQLEHCH
FT                   EAPFYTLGPLTTDIAPGYDHITSGIGAALIGWYGTAMLCYVTPKEHLGLPNKKDVKDGI
FT                   ITYKIAAHAADLAKGHPGAAVRDNALSKARFEFRWDDQFNLGLDPDTAKEFHDETLPKD
FT                   SMKVAHFCSMCGPHFCSMKITQDVREYAASQGVSAQQALTQGMQEKAIEFVKKGAEVYH
FT                   RS"
FT   CDS_pept        261082..261636
FT                   /transl_table=11
FT                   /locus_tag="BAV0252"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47857"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L078"
FT                   /inference="similar to DNA sequence:INSDC:AE004885.1"
FT                   /protein_id="CAJ47857.1"
FT                   /translation="MTLTMRKLAPAALIAVLALAGCAAPKSGDKPAASNAGQPPQAQAQ
FT                   AQTPAPAPATSPTVEFYIATTTADPSLVAVPVADGTLYMQRTPVLTRADLSEAQALDDR
FT                   SGQNYVGLRFNEAGARKLSDISTQNQGKILVLVIDRELVAAPRLTEPLTRGVLAFGVPS
FT                   AQAAVAIAAKIRGDAAAAPKP"
FT   sig_peptide     261082..261150
FT                   /locus_tag="BAV0252"
FT   CDS_pept        complement(261655..>262050)
FT                   /transl_table=11
FT                   /locus_tag="BAV0253"
FT                   /product="putative transcriptional regulator"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47858"
FT                   /db_xref="GOA:Q2L076"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L076"
FT                   /inference="similar to DNA sequence:INSDC:AE013164.1"
FT                   /inference="profile:HMMPfam:PF01381"
FT                   /protein_id="CAJ47858.1"
FT                   /translation="VNTFSDRLREARVLRGYTQQSLARVAGLSQSAIASYESGRRQSSR
FT                   AMRQLARVLRVRLDWLETGQGPRDASPSFLLQDATSYCIEEAQLQILQPHERSILEQLI
FT                   RTYITACIDHAHRAAASKKKPADEAGR"
FT   CDS_pept        complement(262197..>262607)
FT                   /transl_table=11
FT                   /locus_tag="BAV0254"
FT                   /product="putative transcriptional regulator"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47859"
FT                   /db_xref="GOA:Q2L072"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L072"
FT                   /inference="similar to DNA sequence:INSDC:AJ580009.1"
FT                   /protein_id="CAJ47859.1"
FT                   /translation="VKTFSDRLRQARVLRGYTQQDLARICGLSQSAIGSYETGQRLSSR
FT                   SIRRLALALNVSLDWLEMGQGPMGPAASLMEPPPTREGCETPWPFRSVAPEHVEALSQR
FT                   DLLLLENTIRSFIEACQAEPAGPQNRRTRRPR"
FT   CDS_pept        262695..263468
FT                   /transl_table=11
FT                   /locus_tag="BAV0255"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47860"
FT                   /db_xref="GOA:Q2L070"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L070"
FT                   /inference="similar to sequence:UniProtKB:Q04942"
FT                   /protein_id="CAJ47860.1"
FT                   /translation="MVQSAQGLEDTTLSSRNAENPGHVQMVRAPVLLLITCQDASLSPS
FT                   DQEYLEMSVRRGGWQVHTLCATSAWERKLGELSPDVLLVRSGPAGAGTVTKIIRLVKAR
FT                   GQGICVAVQYGDVAPGLRIAALKVGADICFSMPQSGGPWLAAELLAILDAARRSRSLGL
FT                   SRGWSLSDSRRMLFGPQGVSLPLTPIEGKFLAGLFSSPGCCVRRGENARGIQSRRLDVM
FT                   VSRLRSKAREAGVDLPLRAVRHWGYIFLSELTERP"
FT   CDS_pept        complement(263485..264618)
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="BAV0256"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47861"
FT                   /db_xref="GOA:Q2L067"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L067"
FT                   /inference="similar to sequence:UniProtKB:P07005"
FT                   /inference="profile:HMMPfam:PF01472"
FT                   /inference="profile:HMMPfam:PF00696"
FT                   /protein_id="CAJ47861.1"
FT                   /translation="MTASPISVIASANRLVAKVGSSLVTNEGRGLDRAAVAHWAAQIAA
FT                   LHKQGRQVVLVSSGAIAEGMARLGWRKRPSVMHELQAAAAVGQMGLCQAYEAAFAEHGL
FT                   RTAQILLTHEDLADRHRYLNARSTLFALLRMGVVPIVNENDTVVTDEIRLGDNDTLGAL
FT                   VTNLIEADSLIILTDQRGLYEADPRKNPDARFISHAQAGDTALEAMAGGAGSGVGTGGM
FT                   LTKILAAKRAAHSGAHTVIASGRERNVLTRLAQGECIGTELQATLPVWSARKQWMADHL
FT                   RLRGRLVLDEGAVQALLNEGKSLLPIGVTEVQGDFERGDVVACVDASGRECARGLVNYA
FT                   SADARRIMRHPSSEITQILGSMTAPELMHRDNLVITE"
FT   misc_feature    complement(263710..263733)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(263911..263976)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00902"
FT   CDS_pept        complement(264697..265815)
FT                   /transl_table=11
FT                   /locus_tag="BAV0257"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47862"
FT                   /db_xref="GOA:Q2L062"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L062"
FT                   /inference="similar to sequence:UniProtKB:P20964"
FT                   /inference="profile:HMMPfam:PF01018"
FT                   /protein_id="CAJ47862.1"
FT                   /translation="MKFVDEATIEVIAGKGGNGVASFRREKFIPRGGPDGGDGGRGGSI
FT                   FAVADRNINTLIDFRYARLHRAKNGENGRGSDQYGAAAPDITLRVPVGTVVHDADTGEV
FT                   LFDLNRHGETVTLAAGGQGGMGNIHFKSSVNRAPRQWTPGKEGEQRRLRLELKVLADVG
FT                   LLGLPNAGKSTLISRISNARPKIADYPFTTLHPNLGVVRTSPSRSFVVADIPGLIEGAS
FT                   EGAGLGHLFLRHLARTRVLLHLVDVSSPDPDADPIESAVENARAIVEELRRYDPELAEK
FT                   PRWLVLNKLDMVPDPASVQQRFCEAFGWTGPVFCISGLNGEGTQELIWALQDYLDAEKR
FT                   KEQITQDKADGSYVHEDPRFDTTRDAPPSGKD"
FT   misc_feature    complement(265138..265179)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00905"
FT   misc_feature    complement(265297..265320)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(265998..266258)
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="BAV0258"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47863"
FT                   /db_xref="GOA:Q2L060"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L060"
FT                   /inference="similar to sequence:UniProtKB:P02427"
FT                   /inference="profile:HMMPfam:PF01016"
FT                   /protein_id="CAJ47863.1"
FT                   /translation="MAQKKGGGSTRNGRDSESKRLGVKVYGGQEILAGSIIVRQRGTRF
FT                   HPGVNVGVGKDHTLFALADGKVKFGTKGALNKATVWVEAAN"
FT   misc_feature    complement(266115..266159)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00831"
FT   CDS_pept        complement(266291..266602)
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BAV0259"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47864"
FT                   /db_xref="GOA:Q2L058"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L058"
FT                   /inference="similar to sequence:UniProtKB:P02422"
FT                   /inference="profile:HMMPfam:PF00829"
FT                   /protein_id="CAJ47864.1"
FT                   /translation="MYAVVKTGGKQYRVAAGEKLKVEQIPADIGQEITLDQVLSVGEGD
FT                   QLKVGTPLVAGAVVKATVLAHGRHDKVKIFKMRRRKHYQKRQGHRQNYTEIRIEAITA"
FT   misc_feature    complement(266321..266389)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01169"
FT   CDS_pept        266947..267912
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /gene_synonym="cel"
FT                   /locus_tag="BAV0260"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47865"
FT                   /db_xref="GOA:Q2L056"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L056"
FT                   /inference="similar to sequence:UniProtKB:P19641"
FT                   /inference="profile:HMMPfam:PF00348"
FT                   /protein_id="CAJ47865.1"
FT                   /translation="MNLPALIAPITDDMKAVDAVIRERLNSEVVLIRTIGDYIIGAGGK
FT                   RMRPAMVLMVARALGYEGTHHQLLAAVVEFIHTATLLHDDVVDESDLRRGRETANAVFG
FT                   NAASVLVGDYLYSRSFEMMVEANSMRIMQILSEATTVIAEGEVLQLLNVHDPEVSQERY
FT                   LQVVRYKTAKLFEAAAQVGAVLAGATPEQEAAAAAYGRHIGTAFQLIDDVLDYSGDALA
FT                   LGKNVGDDLREGKPTLPLIRVMEVGSPEQQALIRQAIETGQADFAAVAAAIRDTDALAH
FT                   ARRAAEVEAQKARDALSCYPASIFQKSLLEFCAFAVERDR"
FT   misc_feature    267187..267231
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00723"
FT   misc_feature    267553..267591
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00444"
FT   tRNA            267998..268071
FT                   /gene="tRNA-Pro (CGG)"
FT                   /product="transfer RNA-Pro (CGG)"
FT                   /anticodon="(pos:268032..268034,aa:Pro)"
FT                   /inference="profile:tRNAscan-SE"
FT   CDS_pept        complement(268341..>268616)
FT                   /transl_table=11
FT                   /locus_tag="BAV0261"
FT                   /product="hypothetical protein"
FT                   /note="start codon not provided"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L053"
FT                   /protein_id="CAJ47866.1"
FT                   /translation="VPSWKLSRVPLPDQEAGAAGTACESPHIACREDLLPSKHTGPLLN
FT                   PTLEPHFLAGYRRRSRDHEAASEANAFGFGQGHRSSPSPSMQPTAR"
FT   CDS_pept        complement(268628..270964)
FT                   /transl_table=11
FT                   /locus_tag="BAV0262"
FT                   /product="putative bifunctional protein: include
FT                   phospholipase and oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47867"
FT                   /db_xref="GOA:Q2L052"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L052"
FT                   /inference="similar to sequence:UniProtKB:P16640"
FT                   /inference="similar to DNA sequence:INSDC:BX572606.1"
FT                   /inference="profile:HMMPfam:PF01734"
FT                   /inference="profile:HMMPfam:PF00070"
FT                   /protein_id="CAJ47867.1"
FT                   /translation="MTYQDIDFLLVGGGLASAQAAETLRREGATGSILILSAESILPYH
FT                   RPELSKRYLLGTTDAPRLLVHPESFYCKQNIDVALNTAAVSLDAGERLLTTASGSHIRY
FT                   GQLLIATGATSRQLEVPGASLKGVLPLRSRDDCDVIRALIANASPKGLHAVVAGGSFLG
FT                   MEVAMTLAKLGLKVTIVERSTQLLKHLASPLLSDVFRDHAQAAGITVVMNDPVIAFQGQ
FT                   DQVSEVLTEQGRRIPCDLAILCTGVKPATQFLESSEISLEDGWVQVDDRLESNVPGVFA
FT                   AGDVASFFDPVFSRRRHIEHWDNAIKQGRLAAMNMLRRRQRYDEVSYFFCEIGDLGFDM
FT                   LGDPTEDIDQTIARGTLQERSFSLFYLKEDIARAVFTLGRSADETRIAESLIRYRTKLS
FT                   NEKEKLGHPGFALHGLPTQNVLILQGGGALGAFECGVVKALEECQIYPDIVAGISIGAV
FT                   NGAIIASHPHNATAALEAFWSELEVASLQGAAEPMQRAIAVMQILQLGVDNFFRPRWIP
FT                   SYDSPWEAPWNWTSFYDTAPMRRLLSKYVDFSSLKSSPVRLLVGAVNVLTAEFETFDSY
FT                   VDDLTPDHILASGSLPPGFSWTFVDGKPYWDGGIVSNSPLDLVIDCCGPDGKRVFIVDL
FT                   FASQKELPKNMVEIMARRDEIVYSERVRNDLRTRELIDAYRGMIENLLLEIEPQRRERI
FT                   KRLPRYIQLMGNGTQTQITRFIRQGPPDEPSSRDYDFSDIAIRANQKQGYEQAKTILAA
FT                   SSSTARRPPDCGAGSLKDGANANQG"
FT   sig_peptide     complement(<270901..270964)
FT                   /locus_tag="BAV0262"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(271008..271793)
FT                   /transl_table=11
FT                   /gene="bdhA"
FT                   /locus_tag="BAV0263"
FT                   /product="putative D-beta-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47868"
FT                   /db_xref="GOA:Q2L050"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L050"
FT                   /inference="similar to sequence:UniProtKB:O86034"
FT                   /inference="profile:HMMPfam:PF00106"
FT                   /protein_id="CAJ47868.1"
FT                   /translation="MSNLNGKVAVVTGAASGIGKEIARVLADAGAAVAIADLNLEGANT
FT                   AAREISQTGGKAMGIAMDVTSENSVNEGMDKVAADYGSIDILVSNAGIQIVNPIENYAF
FT                   SDWKKMQAIHLDGAFLTTKAALKHMYRDDRGGIVIYMGSVHSHEASPLKSAYVTAKHGL
FT                   LGLARVLAKEGAAHNVRSHVICPGFVKTPLVEKQIPEQARELGITEAEVVRKVMLGATV
FT                   DGVFTTVEDVAQTVLFLSTFPSAALTGQSFVVSHGWFMQ"
FT   misc_feature    complement(271281..271367)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        complement(271841..272581)
FT                   /transl_table=11
FT                   /gene="adc"
FT                   /locus_tag="BAV0264"
FT                   /product="acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47869"
FT                   /db_xref="GOA:Q2L048"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR023653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2L048"
FT                   /inference="similar to sequence:UniProtKB:Q9RPK1"
FT                   /inference="profile:HMMPfam:PF06314"
FT                   /protein_id="CAJ47869.1"
FT                   /translation="MNIDTVRANAFAMPLTSPAFPMGPYRFVKREFFVITYRTDPEALR
FT                   SVVPEPLAVTQPLVHYEFIRMPDSTGFGDYTESGQVIPVEYEGVAGSYTHAMYLNDHPP
FT                   IAGGRELWGFPKKLALPTLKVHTDTLVGTLDYGPIRVATGTMGYKHEEVDIVEQARHLS
FT                   APNFLLKIIPHVDCSPRICELVRYYLEDIRVYGAWSGPAALELAPHALAPVADLPVLEV
FT                   VGARHFIADLTLGLGEVVYDYLAK"
FT   CDS_pept        273187..273738
FT                   /transl_table=11
FT                   /locus_tag="BAV0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47870"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L047"
FT                   /inference="similar to DNA sequence:INSDC:AF361470.1"
FT                   /inference="profile:HMMPfam:PF05591"
FT                   /protein_id="CAJ47870.1"
FT                   /translation="MSNSLQKWVGRNRAPRVQITYDVENGGAIEKKELPMVVGVMADLS
FT                   GHPKEPLPKLKDRRFVEIDRDNFDEILDRIRPRLDLSVPDTAKGEGNLRIELEFSKFSD
FT                   FHPESLVQQVPRLQRLLQARHQLRDLLAKLDGNDELDSILDRVIRSTEELRALHDEAGQ
FT                   AADDQAAEEKPADPPAAEPS"
FT   CDS_pept        273790..275283
FT                   /transl_table=11
FT                   /locus_tag="BAV0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47871"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L046"
FT                   /inference="similar to DNA sequence:INSDC:AF361470.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ320483.1"
FT                   /inference="profile:HMMPfam:PF05943"
FT                   /protein_id="CAJ47871.1"
FT                   /translation="MSNETLPETADAVQSSAELTLLDRIVLEGNMAVEPSQSGYAKQLI
FT                   GQLASQILDEGMRTSPDKSVVAMIHERIAEIDALLSDQLNAIMHDPAFQQLEASWTGLH
FT                   HFVSGTETSSRLKLRLLNVSKKDLLKDLESAVDHDMSVLFKKVYEEEYGTFGGVPYSML
FT                   IGDYQFGRHPQDIALLERISRVASAAHAPFVAAAAPSLFDLKSFTDLGVTRDLAKIFES
FT                   AELERWRQFRDSEDSRYVCLVLPSYAARLPYGANSQPVDSFNFEEDVQDAKHGKYLWAN
FT                   AAYQLGLRITAAFAEHSWATAIRGVEGGGRVQGMAAHAYKTGEGDIAMKCPTEVTITDR
FT                   REKELSDLGFIALVNAKGTGEATFFGSQTVNRPKIYNTAAANANAQLSARLPYVLAASR
FT                   FAHYIKVIMRDKIGSFQSRSDVERYLNNWIADYVLINPSASHDQKASYPLSEARVDVTE
FT                   VPGRPGAYRATCFLRPHYQMEELTASIRLVADLPAAASQ"
FT   CDS_pept        275344..275820
FT                   /transl_table=11
FT                   /locus_tag="BAV0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47872"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L045"
FT                   /inference="similar to DNA sequence:INSDC:AE004663.1"
FT                   /inference="profile:HMMPfam:PF05638"
FT                   /protein_id="CAJ47872.1"
FT                   /translation="MNIYLKIKDIKGNSLVDPYVGYIVLDSYSLGVSQPVSHDVGNSER
FT                   TLGRPDFRLLSCSKQTDQSSPALMGACAGGKKLGEVELIVARNADDKSLNRICVTMGNC
FT                   IIASYDMSGGGGMESDSFTISFTSIKFEYTQQGPTGEKKGNASMGWDLETNKAL"
FT   CDS_pept        275829..276233
FT                   /transl_table=11
FT                   /locus_tag="BAV0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47873"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L044"
FT                   /inference="similar to DNA sequence:INSDC:AF361470.1"
FT                   /inference="profile:HMMPfam:PF07025"
FT                   /protein_id="CAJ47873.1"
FT                   /translation="MTRYLLPLFDRLSVDAPETVDMAGLHESVALDLDRLLNTRTARST
FT                   DLWLDESELDYGVPDFSIQMLRSQGDRETIEVVVACAIRRFEPRLNDVQVKFSFPETDA
FT                   RRGHFLVSARLNAQPKAPQVMFKIGVDLLN"
FT   CDS_pept        276250..277992
FT                   /transl_table=11
FT                   /locus_tag="BAV0269"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47874"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L043"
FT                   /inference="similar to DNA sequence:INSDC:AJ320483.1"
FT                   /inference="similar to DNA sequence:INSDC:AF361470.1"
FT                   /inference="profile:HMMPfam:PF05947"
FT                   /protein_id="CAJ47874.1"
FT                   /translation="MLSDEFLKYYRRELAYLREQGADFAQRYPKVAGKLGLHGGESPDP
FT                   HVERLLESFAFLSARVHREIDQTLPQLASDLLENLCPALALPVPSMSIAQLHLELSQGK
FT                   VTAGFSLPKGAELVARSAGKENCRFQTVWDSRLWPLHLRGIRSLDERTLSLELEADAGL
FT                   TLAELDIRSLRVHLAGDWMEAAPLYEWLVGGVIGTDLIVDDHRVSAGEWREVGFDHGEE
FT                   ALPRHGYAHPAHLLLQEIFAFPRKFHFFDLGLPQGLPLPGSRCEIRVNLRRPLRGNRGP
FT                   HEGSFKLGCVPIVNLFGSTSEPVALDQKAYEYPLSASWQDSETVEIFRVEKVYLSDPMA
FT                   ERTVEVPNFSSQQHLIQPEPPMFWTSRRQLSFRPNGGTDTFISFIDSRQRAMAPAVPVA
FT                   YANLWCTNRRLAEQVPAGASLLFEKVRSNLSATCLYEPTAQRDPPLDAGQLWQLAAFVT
FT                   SQQQSLFEPGGSSQRLQDLMRLFAGSSAREIGMIQGLLSAQATEASIPVSRGSWRGYQL
FT                   GTDVTLEFDPQAYVGSSPLLLAAGLARFFALTTSINSFVRTQVRLRDEIWRAWPPMSGY
FT                   EAIL"
FT   CDS_pept        277989..278903
FT                   /transl_table=11
FT                   /locus_tag="BAV0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47875"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L042"
FT                   /inference="similar to DNA sequence:INSDC:AF361470.1"
FT                   /inference="profile:HMMPfam:PF06996"
FT                   /protein_id="CAJ47875.1"
FT                   /translation="MSHDLLARPYQFNFFQAVRLLEQMSGKQGGRAVRFRTRVGISFDA
FT                   SDVLAISRNGEGPFELTSNVLCIAGANGPLPLPYTEQVLQARERGDSSASDFLDIFNHR
FT                   LMLMLFRARRRCYPALLGQGVEAPIWQVLRALTHLPADVEPLGAPASALLAIRTRSLAG
FT                   LQTLIAERLHLRVRGASMQGGWIALDQATRARLGAASRLSDTALGSRAWNPAAGIALTL
FT                   MPRHADAFTDVEAQALSAGGEGYRLLVACLRAYLRAPLDVEVRLAPTAGPVTRPRLGWS
FT                   SWLGKACRQSPRFRLRGVPLHKG"
FT   CDS_pept        <278906..281524
FT                   /transl_table=11
FT                   /locus_tag="BAV0271"
FT                   /product="putative ATPase with chaperone activity"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47876"
FT                   /db_xref="GOA:Q2L041"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L041"
FT                   /inference="similar to sequence:UniProtKB:Q9RA63"
FT                   /inference="profile:HMMPfam:PF02861"
FT                   /inference="profile:HMMPfam:PF00004"
FT                   /protein_id="CAJ47876.1"
FT                   /translation="VATDIRTLLTRMNAVCKTAMEEAAQLCVRQTHHTVEVEHLLLALQ
FT                   EARAPDLELLIERMGVDREMLSAQLKRSIDAFKRGNPRTPALSPYFAAWFEEALLQSAL
FT                   LLGEQQIRSGTLLVALLEKDELRQAILVSAPSLLNIPREQLRAVLPDALAAGQEGGSVA
FT                   ERGATSALSQYTVNLTEIALAGGLDPVTGRDAEIRQLIDVLLRRRQNNPILTGEAGVGK
FT                   TAVVEGLAQRIAQGTVPPSLKDVQLCTLDLALLQAGAGVRGEFENRLKGVMAEVKSSPR
FT                   PIVLFIDEAHQLIGAGGTEGQGDAANLLKPALARGELRTIAATTWAEYKRYVERDPALA
FT                   RRFQVIKVDEPSEDTAVEMLRAVVPRLLQHHQVEVLDSAVRDAVRLSHRYLSGRQLPDK
FT                   AVSVLDTACAIVASAHNGPPQALETLDRQLELARGRLNLLRHEVAKGQGNPAEVEQLTQ
FT                   RIEELAAEKTHLLDRLDNERLAVQQIRAWRARIEQAVQAEAGAEELRDMTNNLLRLEKG
FT                   LEVLQADEALVPSCVDSSVVARVISGWTGIPVGRMLTDELHTVLNLEDRLRERVVGQDA
FT                   ALDAIARRVRTFRAELDDPGKPVGVFLLVGPSGVGKTETATALADILYGGERNMITINL
FT                   SEYQEAHSVSGLKGAPPGYVGYGKGGVLTEAVRRRPYSVVLLDEIEKAHPDVLELFFQV
FT                   FDKGEMEDGEGTPIDFRNTLIILTSNAAQDVITDACAGEVWPDAQALRERLHAALSRQF
FT                   GPAFLGRTVVVPYYPLQDVQLERIVRLKLNKIAERIRLNHGAEFEWTPEVSQQIARRCR
FT                   EVDSGARNVDHILTQVVLPEIASQVLDCLSTGAEFALVRLSVDSSGNFVFGLTAKEAEH
FT                   D"
FT   misc_feature    279551..279574
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    279815..279853
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00870"
FT   misc_feature    280721..280744
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        281517..283367
FT                   /transl_table=11
FT                   /locus_tag="BAV0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47877"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L040"
FT                   /inference="similar to DNA sequence:INSDC:AE004663.1"
FT                   /inference="profile:HMMPfam:PF04524"
FT                   /protein_id="CAJ47877.1"
FT                   /translation="MTEVQHRWLGSVDTSLGQNVLLLEALRGTEALSALFDFRLRLRSE
FT                   KLDIDPKALLGSQMTVRLQRPGSRARFLHGLVTRFGHLGADARNAWYEARLQPRMCLMA
FT                   EGRDRKIFQDMTVPEILRKVLDQHAIRVTPKLRDTNYPRREYCVQFDESPLDFVSRLME
FT                   EEGIFYFFDFSESGHTLILADSPAAHRECAGASELVYAPQGPDKPGLFDLALSAEVEGP
FT                   APVLADYDYLNATVLHTDGAKAQGGRLYCYPGRYTQEGEGKRKADILAAALQLRRESGS
FT                   ARSESPALCAGAKFRLRGHPDSRYDQSYILKTVAHDFRQGEYHNQVDIFPESLPFRSLP
FT                   LTARPKVAGTHTGVVVGPSGEEIWTDDHGRIKVKFHWDDGPEKNQDASCWMRVTQPLAG
FT                   QGWGAWFLPRVGQEVLVAYADGDPDQPLVVGTLYNVKQTLPLQLPYQQTQTVLRSRSTP
FT                   SGQAGNELRMEDRAGEEQFYLRAQKDMKVEAQSQLFTQVGEGETHSIEKGDRVIRVADG
FT                   NERHEVQGKREINVTGDETHLNGARFSREVAGDYVLTVSGNLTLDVRGMLTIKTIGGYS
FT                   LESSSTVSVKGLSIEQKASATQTLDGGGLLLVKGGLVKVN"
FT   CDS_pept        283367..283996
FT                   /transl_table=11
FT                   /locus_tag="BAV0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47878"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L039"
FT                   /inference="similar to DNA sequence:INSDC:AE017145.1"
FT                   /protein_id="CAJ47878.1"
FT                   /translation="MQQTVMAMNDADGVGEEASAFLFKLATGERIDGTLRQGSLHGRCT
FT                   IINEDSSPLHEADYLSGKLHGESRHYLNGRLVGLQHYAMGQLDGPSQSFDAAGNVVCQV
FT                   FYAAGQLEGPAQWFQEGVLIREGSFHRGLPEGEWHHYDEGGRRLESMTYQQGLLHGPAC
FT                   RYGADGELAAKRLYQGGKPQAPWAPVSREDAGPQGSRLERWLRGGS"
FT   CDS_pept        283993..284379
FT                   /transl_table=11
FT                   /locus_tag="BAV0274"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47879"
FT                   /db_xref="InterPro:IPR025460"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L038"
FT                   /inference="similar to DNA sequence:INSDC:AE004663.1"
FT                   /protein_id="CAJ47879.1"
FT                   /translation="MTRQITTGATLACSFGLAPSVLNATPSPILTGGLPAATVMDHVPG
FT                   FNIPPFGMCVCPANPAVVAATAAALGTPTPAPCMPMTSTPWVPGQLNVLLSGKPGLRES
FT                   DVLTCGWGGLIRIVAPAQFQTMLG"
FT   sig_peptide     283993..>284059
FT                   /locus_tag="BAV0274"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        284383..284535
FT                   /transl_table=11
FT                   /locus_tag="BAV0275"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47880"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L037"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47880.1"
FT                   /translation="MSAIVFTLTRRMLTLLAICIIAVFLLLFLLGVQIGSRVAAPPAVK
FT                   AEVKS"
FT   sig_peptide     284383..>284497
FT                   /locus_tag="BAV0275"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        284535..285467
FT                   /transl_table=11
FT                   /locus_tag="BAV0276"
FT                   /product="putative extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47881"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L036"
FT                   /inference="similar to DNA sequence:INSDC:AE008394.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47881.1"
FT                   /translation="MRRAWSLLLLALLALMPCLAPAAASSPSATPVPAASDTASAPRSA
FT                   ALAELPLKRTDTGLVMWPDGSLYSPEISAIKQRGVLIVSMLNVDQPPYFSEVNGELVGI
FT                   DVDLARGLADGLNVRLEIDRSARTFNEVLQRLGEGKADLGISKLSRTLARTQFMAFSEP
FT                   YVSLNQALLVNRVAFAKRQGGRSMGAVIRHYDGTMGVWAKSSYASRVKSTFPHADVHYY
FT                   SSWEEVIDALLTGKVEAVYRDEYEIKKVLSDDPAAALKLRMVTLDDLWDKFSVAVNLDA
FT                   PALLNYVNLYLGMRGKPYDLDDLEKAKRR"
FT   sig_peptide     284535..>284604
FT                   /locus_tag="BAV0276"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    284841..284882
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01039"
FT   CDS_pept        285511..286755
FT                   /transl_table=11
FT                   /locus_tag="BAV0277"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47882"
FT                   /db_xref="GOA:Q2L035"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L035"
FT                   /inference="similar to sequence:UniProtKB:P21345"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47882.1"
FT                   /translation="MNPLVVVLCLVIGAGAGAIWPAFGTKVGFVGDIYIDLLKMTTLPF
FT                   MISAVIFSIQRLFRVGDAPLLFVRLIVMFLASMVLVALTGMVLMLLLTPGSDLPRSVLD
FT                   ALGSYVGTGGEAEVARVQLHGPDVVVAGPSLASMLGNLIPTNIFAALAAGDMLKALIFA
FT                   LLFGLAVGSVPERIASGLSAVLETIYYACQKIIHSLSLPLPLILLCMSASQMAKSGIEP
FT                   ILAMLWFLVAFGLASLLLMALAVVLVWQRSGGNLRATLLAMREPFSMAIATRNSAAAMP
FT                   SMIEGLATGLGYSRFTVELLVPLSLSLLRLGPIVYYVCATLFIAQLYGVDLTPVQLLLV
FT                   IFASMLAGLASAGSTGILTVSLIGIACGYLGLPFEAAFLLFLAIDPVCDMLRTLLLVIG
FT                   NFAVVAGICPKPLRI"
FT   sig_peptide     285511..>285562
FT                   /locus_tag="BAV0277"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        <286850..288160
FT                   /transl_table=11
FT                   /locus_tag="BAV0278"
FT                   /product="putative transport protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47883"
FT                   /db_xref="GOA:Q2L034"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L034"
FT                   /inference="similar to sequence:UniProtKB:P37312"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47883.1"
FT                   /translation="VLGLWFPGLSESLGYVSVIYQSLLQAMALPLVVAAVLFGFRQLFD
FT                   LQAPGSAVIRMTTVAFCVTLLAALAGVVASYGMLPRLTAPQLAELGNMFSQAHMPGDHI
FT                   VMHTSLPVVEDRPTSAVPVSIYGALAQGHLLQGIFGICLFGVAIARQNSVSTQFFDTLI
FT                   EAVYRALTRAINVMNLALPLVVFGVAVHLGPMVSGAGVRALSSLLFSFVLVVLLMVLCS
FT                   VGFIAWRTRRSYFQTLTALKEPAAVALVTGNPIAAVSLAIEAMSTKLGCPRHVSETAIP
FT                   LGAITVRPGMAVYLALVTMFTAGIYGLTPTATDVIVVVLLGVVLAFMSADAKGSIAPWH
FT                   FQMIMLYLGLPLEAAIIVAMAIDPLCDGVRNLLNLIAVCVVAAWLSEQFEAAAAREDNT
FT                   EIWRLTLSRSQLYLLGAVLLGCASLVLLLGLGLGARS"
FT   CDS_pept        288157..288609
FT                   /transl_table=11
FT                   /locus_tag="BAV0279"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47884"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L033"
FT                   /inference="similar to DNA sequence:INSDC:AE004662.1"
FT                   /protein_id="CAJ47884.1"
FT                   /translation="MRLLWLISCLILLAGCGWIGSSGERLSWKGAVITASSDMNDNSAL
FT                   AVDLVVARDAMLGGQLAALSAEQWFERRADLRAAYGAQLDVVSWELVPGQQWTVGAQGL
FT                   PAGRTMGVYLFARYGGSGAHRTRITQLNGTLRLYLGARNVRVLLAP"
FT   sig_peptide     288157..>288223
FT                   /locus_tag="BAV0279"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    288172..288204
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        <288651..289940
FT                   /transl_table=11
FT                   /locus_tag="BAV0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47885"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L030"
FT                   /inference="similar to DNA sequence:INSDC:AE004662.1"
FT                   /inference="profile:HMMPfam:PF05936"
FT                   /protein_id="CAJ47885.1"
FT                   /translation="VGKNAQVVDRIAWHEGMLLAPQHFQQLSARVDSLVAAQTLAAQPL
FT                   AWGLSHLVLDEQLLPVGRLRVLELEAVLADGTLVSYSALAGTPLEVDLGPFESAMQQEG
FT                   VDVYLTLALGQRRFISVAVSVEEDLVSDAPDAEVPRWVPDLQLLAGEAPGPDRTGLLLG
FT                   NFVQEGSTVKRGLRLGPLLHLPRDGEPYRQAVAVLARIRAKAVYLAKQTLTPVSDLESR
FT                   LAQAEQRGKLMALMAALPGAEGVLRLPRLHPCDLYLALVTLSGPMALLCPGQVAPIPPD
FT                   YDHERPQAALDPLLRFLNEMAAEVSEAYRLSKFVLVDGVFELRLESTLEQELLVGVMST
FT                   SERAAIAWMSGAVIGDQSEFSALRGRRVLGAAREPVGESGSMRYRNGYALFRIDAATLR
FT                   SGGMLHIANPNEGALAERPSEIVLFTQEDA"
FT   CDS_pept        289937..290680
FT                   /transl_table=11
FT                   /locus_tag="BAV0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47886"
FT                   /db_xref="GOA:Q2L028"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L028"
FT                   /inference="similar to DNA sequence:INSDC:AE004662.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47886.1"
FT                   /translation="MSFTRMPKEASATDVMLGQFVSYVELLLNLMRTAAEGEPACDAAR
FT                   RVNMQLIDALEIQTLEARRESSRFDIENMADSRYLKAAVADELLLHTPWPGQACWGDYL
FT                   LESALYRSNVAGDRIFELIEKILRDQEPAQRGLARLLLYALALGYEGRFRGEGQEGRLR
FT                   EYRLELYEFSYQRRPDLDSLDRVIEPKAYAHLLSHFSPRRFVAVSRGSLLFLIAVVGML
FT                   ALSEIAWLWQSWPVRTELNHVESGN"
FT   CDS_pept        290714..294478
FT                   /transl_table=11
FT                   /locus_tag="BAV0282"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47887"
FT                   /db_xref="GOA:Q2L027"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L027"
FT                   /inference="similar to DNA sequence:INSDC:AE004662.1"
FT                   /protein_id="CAJ47887.1"
FT                   /translation="MLLSNNLFLVSVLVLLIVAILGVAVVLYFATRPVGEKPKPEVVPT
FT                   WSADALRAGFRQAIDIIESNISSRAERYNVPWVVVLEDGDQARLPLGHTGIPGVYGSGP
FT                   ALSQQIHWEFFERGVVVDLAVGATQESDRDEQWEQFLTLCRSYRPQRPFDSVVVTIPAA
FT                   LLLDSEARPELIRRAGVMHRRLWLAQNRFAMRLALYVLVTECESMTGFSAFARALPDGM
FT                   RASMLGWSSPYDPSISYQSDWVEQAMADVAATVDDTVAEVLVTREVGVADMLVLTSRVR
FT                   EIQPQLQLYLDELMRPNVYHEPFLLRGVYLTGDSGELQAPQSANAPDLLQPAFLRAVFE
FT                   RKIFLESGLTRPIRNATLTRPLLHKGLRFAAGGVLGVWAIGIVVATIDVGRHAPGQVAA
FT                   LREIRRIAAADDQDRSADWYQRSAITLLGLEPEVRGEGGLAWMLPGSWSMFDGLNAALR
FT                   EALMREFRDVVRVAIERGFAARATALSGQTGPDGPCRAPAGLAEGADVLALTDRADFRA
FT                   MLAYVSQVERFSNAWSAWHDRTAGVLSLQPAVQYALGIDASPSALQILASMPPPEAHQN
FT                   VYADAFRCAYEKGMGQLEDSLFTQNPLLRAERKAQHALAAFTQRAPVDGEADLRDLVHA
FT                   ISAEQDLLSSANTAWLHQDVFMPDPLLEQIFSTAAKVPLLGQTVVAKSRASFQDAFAVL
FT                   RSQIASFTSGSDAGLQWRENQYVLSPGRLALRDSLAGLLVQPFMQVPPATQVPDLRGAA
FT                   LVHWDISALDQALVLMDARTAFLARGLAGVPLTYVPAVMQSANAQAGLGLYRRAVAALE
FT                   PGFALRSMEFQAAADRVRRIASLLGDLGAVRERGELLALLSRGALAALTHLDDMLRRAD
FT                   LYAVQTDVSLPGTSLLAAFGVADLAGLDAYLAQQAGTLQELSAQAAVYLTALSPSDARS
FT                   VVAQRWQMIGQELERYALRNPNSALLRLEQWIRLAGQTKDCAKWPAAPSASSGYFELHW
FT                   SRLAATLRERCLGRDSLQFQTDWRRFTTAYNELLGGRMPVADPKAPSRGVVPRPAATVQ
FT                   GVQDVLGRFQSLPSYEWPPGAIADFLTRFRAWAEVLQPLWSATGESGYHLAWNFRVNRG
FT                   AEVAANQIISWTLSVGSESVGSDMPDARLRWAVGLPITLSVRLAKDAPLLPRADPTQPR
FT                   MSVDGHQVSWTFHGPWALFTMLGWQGLDSGLLRFEVPVMVENINDFARLPPGQKLKFFV
FT                   DLNLFSLGEGKPLNWARPLPLIAPAGSGP"
FT   sig_peptide     290714..>290783
FT                   /locus_tag="BAV0282"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        <294475..295488
FT                   /transl_table=11
FT                   /locus_tag="BAV0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47888"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L025"
FT                   /inference="similar to DNA sequence:INSDC:AF361470.1"
FT                   /inference="profile:HMMPfam:PF06812"
FT                   /protein_id="CAJ47888.1"
FT                   /translation="VIEHLLQAISGEPAGRSLRYDPITTRISAMRQEDDASLPQGEWQR
FT                   ELQRADWNGVAALCEEALVEHGKDFQIAAWLCEAWARQRGLEGLCCGAQLLDGLIANFW
FT                   EDGWPAIEDDDVEARRAPFVWLVATLPVVLLAHIPLLDNRAQAWLTVDVFRRLTMRGAA
FT                   QADEALQEGPDMAQVERLIAAQPQHGDVLRTALDQARLAWEALDRRLNEHLGLEAPSFE
FT                   PLREAFRQWEACLAALWPLKAISQPEPVVEVVAPSAEPETMSVPARIERPRDRAHAYQQ
FT                   IEMIAAYLAEIEPHSPTPYLLRQAASWGAMPLDVLMRSIAQEEGGLARLLSLLDVA"
FT   CDS_pept        295613..296482
FT                   /transl_table=11
FT                   /locus_tag="BAV0284"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47889"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L022"
FT                   /protein_id="CAJ47889.1"
FT                   /translation="MSNHTNNVWEYAKYHVGNKSIHQRVWHSPKLHELRSAVSSRGSAL
FT                   SKGAKLGGNVTRTVLGLVPIPALATILSGVQTKIEEKYREYLRGKKLDGLASTDPEFVK
FT                   FSIKDASIEEMDRMRWKAEHDLTELQRVGQKWGEARQDAAGRGAVCDFMADAARHVAQA
FT                   ERRLDIFEKKVAEIKALMLACEIWSSNARKSIDKFRQEAEESFAELAKIDQQMGAYAAD
FT                   NHLNCGAFCIHGGRGQINRRRDQVINAAAVATTMLTDLGDIDSFLSLNRETFTVTDSLG
FT                   PYRASSDD"
FT   CDS_pept        complement(296612..298021)
FT                   /transl_table=11
FT                   /locus_tag="BAV0285"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47890"
FT                   /db_xref="GOA:Q2L020"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L020"
FT                   /inference="similar to DNA sequence:INSDC:AP005963.1"
FT                   /inference="profile:HMMPfam:PF01425"
FT                   /protein_id="CAJ47890.1"
FT                   /translation="MSHIAFATLSELALGLSEGRYSSVELARYFLDRIERANPVLNAFA
FT                   SVDREGALRLAEAADARRRSGYGLLSPLDGLPIAVKDLCDIEGQITTGGSAAWRQRRSE
FT                   VTATAVTRLLDAGMVILGKTQMVEFAFGGWGTNPLLGTPRNPWDMQHARIPGGSSSGSG
FT                   VAVAAGLVPAALGSDTGGSVRIPAALNGVTGLKTTRGLISLYGAVPLSTSLDSIGPLTR
FT                   DTRDAMLLTAVLAGPDARDPLTLHQPAFHCPAPGGSLRGMRIAMMSPTQFPLPIEADTL
FT                   QAFEEACRVLQNLGAEIQHPALPFDFHEMMLRNGQIIAAESYALHRSYIEDMELPIGPH
FT                   VRARVLNGKQIGAADYIEALQAQSEACQAWQSWIADFDALITPCLPIAACRVEEADELS
FT                   TPLAAFTRPGNYMNAPGLALPAGFSSEGLPIGVQLMGAPFAEDRLGRIGMSFQQETDWH
FT                   LRQPDLAGAGL"
FT   misc_feature    complement(297461..297556)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00571"
FT   misc_feature    complement(297650..297673)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(298069..299295)
FT                   /transl_table=11
FT                   /locus_tag="BAV0286"
FT                   /product="putative branched-chain amino acid binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47891"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L018"
FT                   /inference="similar to sequence:UniProtKB:P02917"
FT                   /inference="profile:HMMPfam:PF01094"
FT                   /protein_id="CAJ47891.1"
FT                   /translation="MLAKLWLTRLPALALALAAAAPTSAQTSDKIRIGMTVSSTGNFAL
FT                   ASQSGVRGVELWVDDVNSRGGIEIKGKKYPVELVKLDDRSDKQMVTRVYERLIADDKVD
FT                   LVFAPFGSTLTAAAATVTERLGKYMMVWSAASDDLYKQGFKNMVSGTQMPVSAMLRASM
FT                   EQAAKLGVKKVALIYADEPFPAGLAEGGREQALKNGMEVVMFEKYPKGQKDFSTLLQKA
FT                   RAAGAEALVPTSYEGDLISMTRQLKQLDINFPYVFMVYASTPQFQAIGADSNYIYSHTN
FT                   YHPAINWKVNAGLNREQFAAAYDKKFPKAEFPPDFQTALAYGAGALTEEIVKQAGSTDP
FT                   AALKKASLDLSGKVTVMAGPYAIDETGKQLQMPFPVVQLQPGKGMVPVWPLDVATEKPV
FT                   FPAPNWNKR"
FT   sig_peptide     complement(<299217..299295)
FT                   /locus_tag="BAV0286"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        <299415..300341
FT                   /transl_table=11
FT                   /locus_tag="BAV0287"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47892"
FT                   /db_xref="GOA:Q2L015"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L015"
FT                   /inference="similar to sequence:UniProtKB:P03030"
FT                   /inference="profile:HMMPfam:PF00126"
FT                   /inference="profile:HMMPfam:PF03466"
FT                   /protein_id="CAJ47892.1"
FT                   /translation="VHVLNKLNYRQTEMLWAIVMAGSISGAARLLNISQPAVSRMLAHT
FT                   EKAIGVALFERVRGKLRPTLQVRSLFEEIEKTQRMMQRVNDLADSLAGEGSAILRLVSI
FT                   PSLAQFLVPRAVARFQQHRPDMLLRLNTTALPLLIGEVLQGEAELGLVVMQAEHPFLVS
FT                   EQLYVGRMVAAIPKSYPLAARASVSLADLSPHPHILVGTRMPYGMLVQGAFEQAGLPCR
FT                   MVADVPWSQLACALVSAGVGIAIVDEFTVMPGALPDVVIVPLDENIPLTVSVVYASNRE
FT                   PSLIARQFIQELKGVLDEVFPVRKMPK"
FT   CDS_pept        300438..301427
FT                   /transl_table=11
FT                   /locus_tag="BAV0288"
FT                   /product="putative branched-chain amino acid transport
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47893"
FT                   /db_xref="GOA:Q2L013"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L013"
FT                   /inference="similar to DNA sequence:INSDC:AE009648.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF02653"
FT                   /protein_id="CAJ47893.1"
FT                   /translation="MSSSPTLAVAASHRAQDMHAIRLRTRIAVTLFAVLAIILAVVPAA
FT                   TSNISFAFYLMLWITMASAMNICVGFTGYLPFGYVVFYGVGSYATGICYKILGWPILPS
FT                   LLAAGGVGVAIAMLLAPTLRLRGVYFGIVSLALATIVKLVISNLPQSFTGGSMGIILSN
FT                   ANNPTHSYYAMLIVMAATLAVVTWLSVSGLGRALKAIRDDDGAAACVGIHVPNTRLKAW
FT                   LLAALFPALAGGIEAWYTNVVDPEYAFHVLITAKSIIYAMAGGFGTILGPVVGTLALLG
FT                   IDHVIWQKFPVVNLLLLGLIIVLLMLFLPRGIVGSLLKRKPELRRYIA"
FT   sig_peptide     300438..>300627
FT                   /locus_tag="BAV0288"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        301438..302319
FT                   /transl_table=11
FT                   /locus_tag="BAV0289"
FT                   /product="putative branched-chain amino acid transport
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47894"
FT                   /db_xref="GOA:Q2L011"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L011"
FT                   /inference="similar to DNA sequence:INSDC:AE017214.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF02653"
FT                   /protein_id="CAJ47894.1"
FT                   /translation="MTGLIIQGLINGLILGAIYGLIGVGLNVIFGVLRVVNFAHGEFLV
FT                   LGAYFAYYLMEYAGINPLIALPLSFAVFFLAGYLLYFVLIPRLSKAEDPEMSSLLLMFG
FT                   VSIMLGAIMLLAFDADARSLPFEMEPVFFKFGQVIIPTVRLLALVIALAIIAALTVFLY
FT                   RSQVGKALRAIIMNRDAVRIVGINAQRLSAVAFGLGLGLAAASGVLVAMVFPSFSPFMG
FT                   NDYTLIGFIVIVLGGLGHPVGALVGALLFAITEQVSVVFFNPSIATILGFALMVAMIFI
FT                   RPSGLFGRQALR"
FT   misc_feature    301582..301629
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00225"
FT   CDS_pept        302333..303040
FT                   /transl_table=11
FT                   /locus_tag="BAV0290"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47895"
FT                   /db_xref="GOA:Q2L009"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L009"
FT                   /inference="similar to DNA sequence:INSDC:AE009819.1"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ47895.1"
FT                   /translation="MLKVRNLKKRFGGLVALQGVDVDVPRGAILGVIGMNGSGKTTMLN
FT                   CINGLYTPDEGRIELDGQDIAGKPVHEVARLGVGRTFQVPRIFRQLSLLDNLDVAQQHT
FT                   GRSADDRYAQSEYWLNKVELYRLRHNYAEELSGGQQKLVELARIMAARPKVVLLDEPFA
FT                   GVNPALAQLLISIIRDMPREHDCSVVLVSHDLTSIYQLSDHIIVMNEGAILTQGDADHV
FT                   RADPRVVEAYLGA"
FT   misc_feature    302432..302455
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    302735..302779
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        303042..303782
FT                   /transl_table=11
FT                   /locus_tag="BAV0291"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47896"
FT                   /db_xref="GOA:Q2L007"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L007"
FT                   /inference="similar to DNA sequence:INSDC:D90908.1"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ47896.1"
FT                   /translation="MSNAILALEDVTVAYHGDITILNRINVQARQGKVTGVIGPNGAGK
FT                   STVLKTLFGFLPLRTGRITLRGEDISAQPSFERARHGVAFVPQHRSLFGELSVHDNLLL
FT                   GCWPFRKDKHRVRERIDSVYDRFPILAQKRHDPVSSMSGGQQRFVEFGRALLIEPSVIL
FT                   LDEPTAMLAPKISKEIYTLIRGFADEGMTVVLVDQNVRRCAEISDYMYILELGRNKAEG
FT                   GRETFAEGGGLREMVASWMDYKID"
FT   misc_feature    303156..303179
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(303898..304734)
FT                   /transl_table=11
FT                   /locus_tag="BAV0292"
FT                   /product="putative metallo-phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47897"
FT                   /db_xref="GOA:Q2L005"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L005"
FT                   /inference="similar to DNA sequence:INSDC:AE004490.1"
FT                   /inference="profile:HMMPfam:PF00149"
FT                   /protein_id="CAJ47897.1"
FT                   /translation="MRIQLLSDIHLEANPDFEFSPAPGADVLVLAGDIGSYQAGSQLPG
FT                   DDFGLGRFMAARPPAVIFVPGNHEFDGLAYQAATERMRAVCERLNIYWLERETLVLDGV
FT                   RFAGATLWTDFEALAITQKTETLRRQQLEKAYRAANFYLSKNTTLDNEGQPMLAEALRE
FT                   LGLQSQAWLRRTLAQPFDGPTVAITHFAPSLRSADPRYGLTPGTAGFCNALDDLLAQAD
FT                   LWLHGHLHCPHDYVVQDPATGRRCRVVANPLGYRRKGEQKHFLPHCVIEVPDRRPD"
FT   CDS_pept        complement(304769..305713)
FT                   /transl_table=11
FT                   /locus_tag="BAV0293"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47898"
FT                   /db_xref="GOA:Q2L003"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L003"
FT                   /inference="similar to DNA sequence:INSDC:AE017136.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00892"
FT                   /protein_id="CAJ47898.1"
FT                   /translation="MAALSSFSPHAMPAFSFLYPVSAILLWAGNVIVSKLSARSIDPLA
FT                   ITFWRLVLAVAVMSLFVARPAWRNRAMIRPQLLRLAFLGFLSMVLFQCLSYEAAHTTTA
FT                   TNMAILTSLVPLLTMLLSVLLLRETPTLGMLTGGVLSFCGLVYLISGGNPGVLLSGGAH
FT                   AGDLLMLAASLAYALYGVLLKRWQVGLPTWQSNYVQGITALIIMGLLTMRLPAEAALPK
FT                   HASLPLIAYAGLCASVLLPVLWMQGVKLLGPNRCAMYMNLLPLFTAAIAAGMFGESLKA
FT                   YHLMGGGAALAGVLMAQLLRRPLRTLRPEVSRA"
FT   sig_peptide     complement(<305662..305713)
FT                   /locus_tag="BAV0293"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        305783..306559
FT                   /transl_table=11
FT                   /locus_tag="BAV0294"
FT                   /product="AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47899"
FT                   /db_xref="GOA:Q2L001"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L001"
FT                   /inference="similar to DNA sequence:INSDC:AE016912.1"
FT                   /inference="profile:HMMPfam:PF00165"
FT                   /protein_id="CAJ47899.1"
FT                   /translation="MLAQPAHDIHLAFERTEHPVAVLAADYPQGARIPRHCHRRAQLLY
FT                   AVEGVMIVEARAGRWVVPPTRGVWLDAGLEHRVRMSGRVKMRTVFVEPDAVAHLPQGGC
FT                   VVEVPPLLRELILAAALLPLSYEDTGRDGLLMRLLLAELAAIPRLPLYLPWPQDKRLRA
FT                   LCDALSRDLAQVHEAAYWAEQMQVSTRTLHRAFLRETGMTFGRWRQHARLLSALERLAH
FT                   GEKILSIALDHGYTSQSAFSAMFKQHFGVPPSAFYT"
FT   misc_feature    306416..306541
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00041"
FT   CDS_pept        306923..308860
FT                   /transl_table=11
FT                   /locus_tag="BAV0295"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47900"
FT                   /db_xref="GOA:Q2KZZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZZ8"
FT                   /inference="similar to DNA sequence:INSDC:AP005038.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47900.1"
FT                   /translation="MHSSSPSQSSALMRPNAWLKELTRLKPAHWRWGRSIRVALGMAIP
FT                   LGFGLALDNIASVLFIAMGAMLQGVGERDAPYAVLFKKAAISAPLGAVSFLLGYLSALP
FT                   LGVMVGVMACVAFVSAIISSYSAALSIGCLQLLAMGAVFIGNPELAPYWPTGCMLLLGS
FT                   LLYMVLLALEALFYRQRPDRDMTINLLRALAELARSRAEGRVESARQQVTDQLAALYGL
FT                   LLQRRSHALGKNNHLNQAAAWLQQADALFALLMSSSDPQALRQAHDQLQSMARAYGAGS
FT                   DDPIAESADAAQPLSATIAALGQALWGRTAPASLTLDAPEPVHRQSRLALLLDKLTPGR
FT                   QVVQPALALALCTGLGYSLYWIDDKSHWYWVPMTVCIVMKPDMGSIFGRTVLRCLGTAG
FT                   GVVVGSAILAWLPPGPLFALIMVLIAAVMPWMGQRSYALFSLGLTPLVLVLIDAVSPET
FT                   HGVNYAVLRLIDTLLGAAIVLVFGYLIWPRSQDRQMESAFLVARRQIAAYLRASLDAAG
FT                   NRDAPQVHISRRQAYGALSNMRTRLQQALGDPPPAGREAAAWFPLLAAAERVCDAITAY
FT                   SSQVHPAPAEQDVRQLQELARVMDVGLDDPGWKQMDDRVPDTSPEARLITQIRSELRQS
FT                   RRMVEPGQGV"
FT   tRNA            complement(309251..309323)
FT                   /gene="tRNA-Phe (GAA)"
FT                   /product="transfer RNA-Phe (GAA)"
FT                   /anticodon="(pos:309288..309290,aa:Phe)"
FT                   /inference="profile:tRNAscan-SE"
FT   CDS_pept        309608..310882
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="BAV0296"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47901"
FT                   /db_xref="GOA:Q2KZZ5"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KZZ5"
FT                   /inference="similar to sequence:UniProtKB:P13580"
FT                   /inference="profile:HMMPfam:PF05201"
FT                   /inference="profile:HMMPfam:PF05200"
FT                   /inference="profile:HMMPfam:PF00745"
FT                   /protein_id="CAJ47901.1"
FT                   /translation="MSVAVLAFGLNHTSAPVSVRERVSMPVDLVKPALAGLRSAFGGAV
FT                   REAAILSTCNRTEVYCAADAAVAEQLPIWLADHHCMEAGSLHPHLYRLHQNDAVRHAFR
FT                   VASGLDSMVLGEPQILGQMKDAVRAAEEAGSLGTLLHQLFQRTFAVAKEVRSQTEIGAH
FT                   SVSMAAAAVRLAERVFGDLGQARTLFIGAGEMIELCATHFAAQHPRSMVVANRTAERAE
FT                   SLAGRFSAGTMKLADLTERLAEFDVVVSCTASSLPILGLGMVERATRQRRHRPMVMIDL
FT                   AVPRDIEPEVGRLDDVYLYSVDDLGRLVQSGTDARRAAVVQAEAIIETRVQGFMHWMQS
FT                   REVVPVIRGLHQAAEDVQAAELERARRLLARGESPEAVLEQLAHGLTQKYLHGPLAALN
FT                   RSAGDERKQLLAWMPRLFPGRDSRR"
FT   misc_feature    310082..310129
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00012"
FT   CDS_pept        310975..312045
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /gene_synonym="sueB"
FT                   /gene_synonym="uar"
FT                   /locus_tag="BAV0297"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47902"
FT                   /db_xref="GOA:Q2KZZ3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KZZ3"
FT                   /inference="similar to sequence:UniProtKB:P07011"
FT                   /inference="profile:HMMPfam:PF03462"
FT                   /inference="profile:HMMPfam:PF00472"
FT                   /protein_id="CAJ47902.1"
FT                   /translation="MLGRLEQLAHRLIEVDALLADPDSAGDMDRFRRLSRERAELEPVV
FT                   LAFNAFQSTQADLATAQEMLADPEMKAMAEEEIKAARERIEVLEGELQVLLLPRDPNDG
FT                   RSLFLEIRAGTGGDESALFSGDLLRMYSRYAESQGWRVEIMSESPSELGGYKEVIARID
FT                   GDGAYGRLKFESGAHRVQRVPATEAQGRIHTSACTVAVMPEADEMNDIVINPADLRIDT
FT                   FRASGAGGQHINKTDSAVRITHLPTGLVVECQDDRSQHRNKDRAMQVLAARLKDKELRE
FT                   RQSKEAAERKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLQQILEGDLNELTGAL
FT                   LAEHQAEQLAALGEDI"
FT   CDS_pept        312051..312860
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="BAV0298"
FT                   /product="protein methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47903"
FT                   /db_xref="GOA:Q2KZZ0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZZ0"
FT                   /inference="similar to sequence:UniProtKB:P37186"
FT                   /protein_id="CAJ47903.1"
FT                   /translation="MQIKDLLQDRRLPRLEARMLVEQVWRQSRAWLLAHDDDEARPDLV
FT                   AAYEMLAQRRLAGEPMAYVIGEREFMGHVFQVTPAVLIPRPDTETLVEAALAFLKTRPQ
FT                   ARVLDLGTGSGAIAVSIALACPQAEVSATDLSAEALAVARGNADRLGVRLHLAQGSWFA
FT                   ALDADARFDLIVSNPPYIHRNDAHLAQGDLRFEPRGALTDGADGLAALAEIALEAPGRL
FT                   LPGGALWMEHGWDQAAAVRALLQEAGLRDVASQPDLAGIERISGGFL"
FT   misc_feature    312570..312590
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        312901..313227
FT                   /transl_table=11
FT                   /locus_tag="BAV0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47904"
FT                   /db_xref="GOA:Q2KZY7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZY7"
FT                   /inference="similar to DNA sequence:INSDC:AL646072.1"
FT                   /protein_id="CAJ47904.1"
FT                   /translation="MSDVQNFIRDTVTQHPVVLFMKGTAQFPQCGFSGRAIQILKACGV
FT                   KKLVTVNVLEDDEVRQGIKTFSNWPTIPQLYVQGEFIGGSDIMNEMNESGELKTLLDQS
FT                   GATA"
FT   CDS_pept        313231..313797
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="BAV0300"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47905"
FT                   /db_xref="GOA:Q2KZY5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZY5"
FT                   /inference="similar to sequence:UniProtKB:P09550"
FT                   /inference="profile:HMMPfam:PF02441"
FT                   /protein_id="CAJ47905.1"
FT                   /translation="MRRLVVAITGATGALYAVRMLQVLRGVEDVETHLVVSASGVLNIQ
FT                   HEMDITRQEVQALADHVYGVRDVGATLASGAFATAGMVIAPCSMRTLAAVALGLSDNLI
FT                   TRAADVTLKERRRLVMLVRETPFNLAHLRNMTAVTEMGGIIFPPLPAFYHRPASIEEMV
FT                   DHTVARVLELFDIHVPGPTWEGTRP"
FT   sig_peptide     313231..>313285
FT                   /gene="ubiX"
FT                   /locus_tag="BAV0300"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(313807..314295)
FT                   /transl_table=11
FT                   /locus_tag="BAV0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47906"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZY2"
FT                   /inference="similar to DNA sequence:INSDC:AL646067.1"
FT                   /inference="profile:HMMPfam:PF06073"
FT                   /protein_id="CAJ47906.1"
FT                   /translation="MIALSLPQLIRQGRLQNNAWRLHEPQNSLPPDEAGWSVNLPLWLA
FT                   QHQALAARQHPVGLQLGPDAELKDLGQTLARTPPAFIAIEFPVYTDGRGYSLAQWLRRD
FT                   YGWQGELRAVGDVMIDTIYYQARVGFDSFLLKAGHDPEQALQAFSTFSVRYQQTYPTP"
FT   CDS_pept        complement(314304..316028)
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="BAV0302"
FT                   /product="putative sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47907"
FT                   /db_xref="GOA:Q2KZY0"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZY0"
FT                   /inference="similar to DNA sequence:INSDC:AF026066.1"
FT                   /inference="profile:HMMPfam:PF01077"
FT                   /inference="profile:HMMPfam:PF03460"
FT                   /protein_id="CAJ47907.1"
FT                   /translation="MYVYDPVDQQLVKERVAQFAGQTRRFLDGQLSADDFRVLRLQNGL
FT                   YEQRHAHMLRVAIPYGMLAARQLRKLAHIARKYDRGYGHFSTRQNIQFNWPALKDVPAI
FT                   LGELAEVQMHAIQTSGNCIRNTTTDHFAGIAPDELVNPLVWCEIIRQWSTLHPEFAFLP
FT                   RKFKIAVSGAIEDRAAVGVHDIGLQAIEQDGQLGFRVWIGGGMGRTPMVGHLIKPFVAW
FT                   QHLLTYLQAALRIYNLHGRRDNKYKARIKILVKDLTPEAYARQVEEEWLRIKDGPDTLT
FT                   QAQLDTIAGRFIWPAYQESTTDPNAALAAQDKHYARWLRTNVHAHKMPGYAAVTLSLKP
FT                   TGVPPGDITADQMDAAADLSERYGFGELRVSHEQNLILADVQRAQLPALWRELQALNLA
FT                   TPNVGLLSNIIACPGGDFCALANAVSIPVAEAIQKQFDDLDYLFEIGELDLNISGCINS
FT                   CGHHHIGHIGILGVDKAGEEWYQVTIGGRQNGGARPLTDLASTRGGGAAIGRIIGPSFA
FT                   REQVAHVVDRLIRTYLGLRDSELERFIDVVDRVGIDPFKKDVYADPLLAKPRETAQA"
FT   misc_feature    complement(314400..314447)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00063"
FT   CDS_pept        complement(316243..316893)
FT                   /transl_table=11
FT                   /locus_tag="BAV0303"
FT                   /product="putative carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47908"
FT                   /db_xref="GOA:Q2KZX7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZX7"
FT                   /inference="similar to sequence:UniProtKB:P42737"
FT                   /inference="profile:HMMPfam:PF00484"
FT                   /protein_id="CAJ47908.1"
FT                   /translation="MFPKRLTDGYQAFLQGRFPAERNRYEALAEKGQQPEILIISCCDS
FT                   RVSPEAIFDVGPGELFVVRNVANLVPPCDPDTESSYHGTSAAIEFAVNGLAVKHIVVMG
FT                   HASCGGIRSYYDHAEPLSKMNFIGKWMSQIAPVADALGESTGDRTQDLKRLELSVIGHS
FT                   LNNLMTFPSIRRRVEQGTLQLHGCYFGVATGVLFVRDPVSGAFSPCVDSLPQH"
FT   CDS_pept        complement(317117..318157)
FT                   /transl_table=11
FT                   /locus_tag="BAV0304"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47909"
FT                   /db_xref="GOA:Q2KZX5"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZX5"
FT                   /inference="similar to DNA sequence:INSDC:AE017229.1"
FT                   /protein_id="CAJ47909.1"
FT                   /translation="MQRWKQRPPGSNWGDYGPDDQLGRLNLITEEQVLKGAREIRAGKT
FT                   FCLSLPLDLPGGNVLNPRRHPPQLSPTRLNDTPYVNFPLRALNPDAVDVLSDDQVLLSM
FT                   QYSTQWDSLAHVGALFDADGDGQDELVYYNGFRAGVDIIGPADADHTGCGCNSGGPSAA
FT                   LKIGVEHLAEKGMQGRAVLVDLAREFGTGRSLIGAAELQQAMQAQDVVVEPGDMLVLRT
FT                   GYAEAVVKMQGKPDAEVLHQYGAALDGSDAALLSWISDSGIAAICADNYAVEAYPARDR
FT                   QGRRAMLPLHHHCLFKLGLPLAELWYLKDLAQWLQAHGRNRFMLTAPPLRLPHAIGSPV
FT                   TPIATV"
FT   CDS_pept        complement(318161..>318976)
FT                   /transl_table=11
FT                   /gene="catD2"
FT                   /locus_tag="BAV0305"
FT                   /product="3-oxoadipate enol-lactone hydrolase"
FT                   /EC_number="3.1.1.24"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47910"
FT                   /db_xref="GOA:Q2KZX4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZX4"
FT                   /inference="similar to DNA sequence:INSDC:AY044272.1"
FT                   /inference="profile:HMMPfam:PF00561"
FT                   /protein_id="CAJ47910.1"
FT                   /translation="VNGASRQYSGISMPYADLSQVRLYYVVDGPADAPALVLSNSLGTN
FT                   ADMWARQVPALAHHFRVVRYDTRGHGRSSVPDGEYCFEQLAGDVVELLDHLGVARAHFC
FT                   GLSMGGPTGLTLALNHPERIDRLVLCNTAARIGSAQGWSDRIAAVEKQTLAAMAPAVVE
FT                   RWLTEGYRQREPGLAQVLVDMLRRTPDAGYQANCAALRDADLRPRLAEIHTRTLVIAST
FT                   HDLAATPADGQYLAAHIPGARYVELDTSHISNWEDPDSFTRHVLAFLTE"
FT   misc_feature    complement(318242..318277)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00380"
FT   CDS_pept        complement(318981..319277)
FT                   /transl_table=11
FT                   /locus_tag="BAV0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47911"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZX0"
FT                   /inference="similar to DNA sequence:INSDC:AF042280.1"
FT                   /inference="similar to sequence:UniProtKB:P31070"
FT                   /inference="profile:HMMPfam:PF03795"
FT                   /protein_id="CAJ47911.1"
FT                   /translation="MPYIIETFDKPGSLALRQATRNEHLAFLDANKHLLLACGAKLHDD
FT                   GTDMGGGLYVVDVDTREEAERLIQADPFYQAQLFERVSIMRWRKAYVDGKSYL"
FT   CDS_pept        complement(319292..319567)
FT                   /transl_table=11
FT                   /gene="catC2"
FT                   /gene_synonym="mmlJ"
FT                   /locus_tag="BAV0307"
FT                   /product="methylmuconolactone isomerase"
FT                   /EC_number="5.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47912"
FT                   /db_xref="GOA:Q2KZW9"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZW9"
FT                   /inference="similar to sequence:UniProtKB:O33951"
FT                   /inference="profile:HMMPfam:PF02426"
FT                   /protein_id="CAJ47912.1"
FT                   /translation="MLYMVEMQVNLPVDMPADKADKLKADEKALAQKLQHEGKWQSLWR
FT                   VVGRYANVSIFNVDNHDELHQLLSSLPLFPYMDIRVTALARHPSAI"
FT   CDS_pept        complement(319641..320285)
FT                   /transl_table=11
FT                   /gene="catJ"
FT                   /gene_synonym="pcaJ"
FT                   /locus_tag="BAV0308"
FT                   /product="3-oxoadipate CoA-transferase subunit"
FT                   /EC_number="2.8.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47913"
FT                   /db_xref="GOA:Q2KZW5"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZW5"
FT                   /inference="similar to sequence:UniProtKB:Q01104"
FT                   /inference="profile:HMMPfam:PF01144"
FT                   /protein_id="CAJ47913.1"
FT                   /translation="MSEKLSRDAIAARVAQDIPEGAYVNLGIGLPTLVANHLPADREVI
FT                   LHTENGMLGMGPAPAKGQEDYDLINAGKQPVTELPGCAYFHHADSFGMMRGGHLDICVL
FT                   GAFQVSQQGDLANWHTGAPDAIPAVGGAMDLAIGAKQVFVMMELLTRDGQSKLVKACSY
FT                   PLTGVGCVSRVYTDLAVFDINKDGITVTDLFGGMTPERLLELTGLPLKFAH"
FT   CDS_pept        complement(320288..320905)
FT                   /transl_table=11
FT                   /gene="catI"
FT                   /gene_synonym="pcaI"
FT                   /locus_tag="BAV0309"
FT                   /product="3-oxoadipate CoA-transferase subunit A"
FT                   /EC_number="2.8.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47914"
FT                   /db_xref="GOA:Q2KZW1"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZW1"
FT                   /inference="similar to sequence:UniProtKB:Q01103"
FT                   /inference="profile:HMMPfam:PF01144"
FT                   /protein_id="CAJ47914.1"
FT                   /translation="MIGGFGTAGQPMELIDALLDQGAKDLVIINNNAGNGETGLAALLG
FT                   AGRVRKIVCSFPRQVDSQIFDGLYRSGKIELELVPQGNLAERIRAAGAGIGAFYTPTGY
FT                   GTPLADGKETREINGRQYVLEYPLTADYALIKAERADRWGNLVYRKTARNFGPIMASAA
FT                   RVAVAQVREIVELGGIDPETVVTPGIFVKRVVQIDAAHGAKE"
FT   CDS_pept        complement(321109..321834)
FT                   /transl_table=11
FT                   /locus_tag="BAV0310"
FT                   /product="putative acetoacetyl-CoA reductase (short-chain
FT                   dehydrogenase/reductase)"
FT                   /EC_number="1.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47915"
FT                   /db_xref="GOA:Q2KZV9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZV9"
FT                   /inference="similar to sequence:UniProtKB:P50205"
FT                   /inference="similar to DNA sequence:INSDC:AF173961.1"
FT                   /inference="profile:HMMPfam:PF00106"
FT                   /protein_id="CAJ47915.1"
FT                   /translation="MKPTAYLVTGASNGIGAAIAHALLNAGHTVVNIDYRLPEAAPAGL
FT                   VSFQADLTDAAQTEAVARQVTEQYAIVGLVNNAGATRPGSADTATLADLDYVVSLHLRT
FT                   ALILTQAVLPAMRAAGFGRIVNMSSRAALGKPERVVYSATKAGLIGMTRTLAMELGGDG
FT                   ITVNAIGPGPIATDLFMQSNPAGAPQTQRIIDSIVVKRLGTPEDVARAAMFFLSPDNGF
FT                   VTGQVLYVCGGTTLGVAPV"
FT   misc_feature    complement(321367..321453)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00061"
FT   sig_peptide     complement(<321765..321834)
FT                   /locus_tag="BAV0310"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(321850..323190)
FT                   /transl_table=11
FT                   /locus_tag="BAV0311"
FT                   /product="short-chain fatty acids transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47916"
FT                   /db_xref="GOA:Q2KZV7"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZV7"
FT                   /inference="similar to sequence:UniProtKB:P76460"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF02667"
FT                   /protein_id="CAJ47916.1"
FT                   /translation="MNKLTSFFTELMRKYLPDPFVFAIALTLLTVVLAFAVEGQGLPQI
FT                   TREWGSGFWSLLAFTTQMAVILAMGYVLATAPLTDRLLDRIVTHVHNPRTAIIVATLVG
FT                   GIGSYLNWGFGLVIGGIVAKKLALKVKGVHYPLIIAAAYSGFTLYGLGLSASIPVLVAT
FT                   PGHPLAKDMGVIPLSETIFSVPMLLTSLVIIITLPLLNAWLHPKAGDKIVEVDPNIDKA
FT                   TETAQPGHSIAGENTLANRLNNSRILSLLIGLLGIAYVVFYFADGKSLDLNLINFIILF
FT                   LGIILLGTPAAYVAKLNEGIKTISGIILQYPFYAGIMAIMAGSGLVNTISKIFVDVATP
FT                   ASLPFWGLISSFVINFFAPSAGGHWVIQGPFMIDAAKEIGSALNQTTMSVMLGNAWNDL
FT                   VQPFWILPALALSKLKLRDVMGYTVIMMLWVGVIHIAAVLAWGYLTH"
FT   sig_peptide     complement(<323079..323190)
FT                   /locus_tag="BAV0311"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(323260..324192)
FT                   /transl_table=11
FT                   /locus_tag="BAV0312"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47917"
FT                   /db_xref="GOA:Q2KZV3"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZV3"
FT                   /inference="similar to sequence:UniProtKB:P52041"
FT                   /inference="similar to sequence:UniProtKB:P76083"
FT                   /inference="profile:HMMPfam:PF00725"
FT                   /inference="profile:HMMPfam:PF02737"
FT                   /protein_id="CAJ47917.1"
FT                   /translation="MGFPIQNLAIIGAGAMGSGIAALFASRGLPVVLIDPVDGALARAV
FT                   AIIERQLGVYAPNDVAACLARIRMEPGLQAAADCDLVIEAVPEKLDLKRQLFAQLDALC
FT                   KPATVFATNTSGLSINAIAQAVSRRDRFVGMHFFTPADVIPLVEVVRGDETSDATADLA
FT                   MAVLRAGGKRPVRVNRDIPGFIANRIQHALAREAMSLLEKGVASAEDIDEVVKWSLGIR
FT                   LALTGPLEQRDMNGLDVHLAIADYLYADLENRVTPSDLLKRKVEAGELGAKTGQGFYDW
FT                   PAERRERVLREKSAALAALVQWLNTQKLD"
FT   sig_peptide     complement(<324114..324192)
FT                   /locus_tag="BAV0312"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(324428..>325099)
FT                   /transl_table=11
FT                   /locus_tag="BAV0313"
FT                   /product="fimbrial subunit"
FT                   /note="start codon not provided"
FT                   /note="One of 11 fimbrial subunits."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47918"
FT                   /db_xref="GOA:Q2KZV1"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZV1"
FT                   /inference="similar to DNA sequence:INSDC:BX640447.1"
FT                   /inference="similar to DNA sequence:INSDC:AE016914.1"
FT                   /inference="profile:HMMPfam:PF00419"
FT                   /protein_id="CAJ47918.1"
FT                   /translation="VAIRNPQSAIRNPQSAIECVKTTALTLLALGGIAAAPAHAADGLI
FT                   TITGEITAQTCKINGQTPPYNLLVALPKISTSALKNTGDTAGSTVFQLKLSDCPEALAN
FT                   QSLSAYFEAGPTVDYATGNLLAYKTNALPTEAANSLPNTGLGSSDVFSDMEIQLANTDG
FT                   SAIKIGSPAAEQNSKGVTAAKVNSTASATLTYLARYIKTGTGAIGAGKVQTYVQYSIVY
FT                   P"
FT   sig_peptide     complement(<324976..325099)
FT                   /locus_tag="BAV0313"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   complement(325050..325091)
FT                   /rpt_unit_seq="(attgcggattgcgg)3"
FT   CDS_pept        complement(325255..325905)
FT                   /transl_table=11
FT                   /locus_tag="BAV0314"
FT                   /product="fimbrial subunit"
FT                   /note="One of 11 fimbrial subunits."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47919"
FT                   /db_xref="GOA:Q2KZU4"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZU4"
FT                   /inference="similar to DNA sequence:INSDC:BX640447.1"
FT                   /inference="similar to DNA sequence:INSDC:AE012553.1"
FT                   /inference="profile:HMMPfam:PF00419"
FT                   /protein_id="CAJ47919.1"
FT                   /translation="MTQSAIECVKSTAFTLLALASMVAAPAHAADGLITITGEITTQTC
FT                   KINGNTPPYNLLVPLPKISTSALKNTGDTAGSTVFQLKLTECPQALATQSLSAYFEAGP
FT                   TVDYATGNLLAYKTDSPPSMAAGSIPTTGLGNSDVFANMEIQLANADGSAIKIGLPAAD
FT                   QNSKGVTATEVGSNGNKTASATLTYLARYIKTGSGAIAAGKIQTYVQYSIVYP"
FT   sig_peptide     complement(<325815..325905)
FT                   /locus_tag="BAV0314"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(326049..>326762)
FT                   /transl_table=11
FT                   /locus_tag="BAV0315"
FT                   /product="fimbrial subunit"
FT                   /note="start codon not provided"
FT                   /note="One of 11 fimbrial subunits."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47920"
FT                   /db_xref="GOA:Q2KZU2"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZU2"
FT                   /inference="similar to DNA sequence:INSDC:AF111796.1"
FT                   /inference="similar to DNA sequence:INSDC:AE016914.1"
FT                   /inference="profile:HMMPfam:PF00419"
FT                   /protein_id="CAJ47920.1"
FT                   /translation="VAQPYCVSVLSFIAKIMTQSAIRNPQSAIRNPQSAIECVKISAFT
FT                   LLALAGMAAAPAHAADGIVTITGEITDSTCKINGKEPPANIFVALPKISTSALKNVGDT
FT                   AGATLFTIKLTECPSSLTGNVKAHFEPGSTTDYANGSLYAYTNASSVNSAADSIPTGMA
FT                   ASKVDNLGIQLANPDGSKITIGQQPSTASGATLTEASGSKSATLRYLARYVKTGTGSIN
FT                   AGKVVTYVEYSIAYP"
FT   sig_peptide     complement(<326582..326762)
FT                   /locus_tag="BAV0315"
FT                   /inference="protein motif:SignalP:2.0"
FT   repeat_region   complement(326656..326697)
FT                   /rpt_unit_seq="(attgcggattgcgg)3"
FT   CDS_pept        complement(326854..327561)
FT                   /transl_table=11
FT                   /locus_tag="BAV0316"
FT                   /product="fimbrial subunit"
FT                   /note="One of 11 fimbrial subunits."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47921"
FT                   /db_xref="GOA:Q2KZT9"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZT9"
FT                   /inference="similar to DNA sequence:INSDC:BX640447.1"
FT                   /inference="similar to DNA sequence:INSDC:L43373.1"
FT                   /inference="profile:HMMPfam:PF00419"
FT                   /protein_id="CAJ47921.1"
FT                   /translation="MCKLSLLCPLDADESQCPTIRNPQSAIRNPQSAIECVKISAFTLL
FT                   ALAGMAAAPAHAADGIVTITGEITDSTCKINGGDPPANIFVALPKISTTALKSVGDTAG
FT                   ATAFTIALSDCPDSLTGNVKAHFEPGATTDYAHGNLYAYTETTSVTAAASTMPSLTAAT
FT                   RVANLGIQLANPNGSKIMIGDSASGASEVPLVESNGKKAATLRYLARYVKTGDGVINAG
FT                   KVVTYVQYSIVYP"
FT   repeat_region   complement(327461..327502)
FT                   /rpt_unit_seq="(attgcggattgcgg)3"
FT   repeat_region   327653..327661
FT                   /rpt_unit_seq="(a)9"
FT   CDS_pept        complement(327704..329560)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BAV0317"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47922"
FT                   /db_xref="GOA:Q2KZT7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KZT7"
FT                   /inference="similar to sequence:UniProtKB:P05791"
FT                   /inference="profile:HMMPfam:PF00920"
FT                   /protein_id="CAJ47922.1"
FT                   /translation="MPHYRSRTSTHGRNMAGARALWRATGMKDGDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDLGALVASQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKVVSPTDGKVIK
FT                   LDLVDAMIKAADPNVSDAEAEQVERSACPTCGSCSGMFTANSMNCLTEAIGLALPGNGT
FT                   IVATHAWRRGLFEQAGRLVVDLCRRYYEQDDASVLPRSIATKAAFENAMSLDVAMGGST
FT                   NTVLHLLAAAQEAGVDFTMADIDRISRKVPCLCKAAPATDKYHIEDVHRAGGILGILGE
FT                   LGRANLLDLSCGNVHSGTLGQAIAQWDVAGGAGEAAQTFYRAAPGGVPTTVAFSQDKTF
FT                   LTLDLDRKAGCIRSKEHAYSQDGGLAVLYGNLAEKGCIVKTAGVDESQWVFTGRARVFE
FT                   SQEDAVEGILGDKVEAGDVVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKTCALFTDGR
FT                   FSGGSSGLVIGHASPEAAEGGAIGLVEDGDVIEIDIPKRRMHLAVDDAELARRRAAMDA
FT                   RGDKAWQPLDRERVVSLALQAYAALATSADRGAVRDLSQIKR"
FT   misc_feature    complement(329165..329197)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00886"
FT   CDS_pept        <329758..330294
FT                   /transl_table=11
FT                   /locus_tag="BAV0318"
FT                   /product="acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47923"
FT                   /db_xref="GOA:Q2KZT5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZT5"
FT                   /inference="similar to sequence:UniProtKB:P31668"
FT                   /inference="similar to sequence:UniProtKB:Q57146"
FT                   /inference="profile:HMMPfam:PF00583"
FT                   /protein_id="CAJ47923.1"
FT                   /translation="VNLNLLIRDSAETDLDPIQAIYAHHVLHGTSSFELDPPGIHDIFQ
FT                   RRAAVLAQGLPYLVAERDGEIVGYAYATLYRPRAAYRHTCEDSVYVREGRHGLGIGRGL
FT                   LDTLVARCAAAGWRQMLAVVGDNNPASLALHARCGFEVAGTLKAVGYKHGQWRDTTFMQ
FT                   RTLGDGAHTPPPHHA"
FT   CDS_pept        complement(330316..331050)
FT                   /transl_table=11
FT                   /locus_tag="BAV0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47924"
FT                   /db_xref="GOA:Q2KZT1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KZT1"
FT                   /inference="similar to DNA sequence:INSDC:AE005980.1"
FT                   /inference="profile:HMMPfam:PF06508"
FT                   /protein_id="CAJ47924.1"
FT                   /translation="MHFPVFIMQNHQRRALVLFSGGQDSTTCLAWALDRYAHVETVAFD
FT                   YGQRHRIELDARLNVLREIRGRFPAWAARLGQDHLLDLKVLGQVGDTAMTSDRAIEMQA
FT                   NGLPNTFVPGRNLLFLTLAAALGYRRQLDVLVGGMCETDFSGYPDCRDDTMKAQQVALS
FT                   LGLGSRVTIETPLMWLDKADTWALADSLGGESLVQTIVEESHTCYVGERGQRHDWGYGC
FT                   GECPACVLRKAGWSRWAERAPR"
FT   CDS_pept        331148..333958
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="BAV0320"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47925"
FT                   /db_xref="GOA:Q2KZS8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZS8"
FT                   /inference="similar to sequence:UniProtKB:Q93MH3"
FT                   /inference="profile:HMMPfam:PF00311"
FT                   /protein_id="CAJ47925.1"
FT                   /translation="MTATRTPSNLAEPLRNDIRLLGHQLGIVVQACEGKRVYDTIETLR
FT                   RSAVRFRRQGKPEDGLLMQKLVKQLRGTDPNMVARAFSYFLHLFNIAEDRDQHRRQRAQ
FT                   ALTAPAPGSLHHTVQQLRSQGVTAERIRRLLAEACVMPVLTAHPTEVQRKSTLDAHREI
FT                   AALLAQRDQTLTAEEIADIDNALLGRVDTLWQTRMLRYTRLTVADEIENALSYYRSTFL
FT                   PAIPRLYTGLSKLLRPESSFSAAPEPLVPFLRMGSWIGGDRDGNPNVDAGTLELAMLRQ
FT                   AAVVFEYYLNEVHALGAELSITTLLSHVSDALRELADASGDSSPHRQDEPYRRALIGIY
FT                   ARLAATANTLTGRDLARRSTRPAAPYDHPQALMNDLNVIMDSLSRHHGSPIARLRLSGL
FT                   LQSVSVFGFHLATLDLRQSSDVHERVLTELFARAGGPPRYDLLDETERVQLLRDELATA
FT                   RPLASPWLEYSEDTRRELAILRAAAAARRRYGRAALRQTIVSHTESLSDLLEVLVLQKE
FT                   TGLIPPTAPDDGLMVVPLFETISDLERGPDIMAAWLDLPEVRRRVKIAQDDTQEVMLGY
FT                   SDSNKDGGYLTSNWSLYRAERELVEVFRARQVRLRLFHGRGGSVGRGGGSSFDAILAQP
FT                   PGAVAGQLRLTEQGEVIQSKYKDAEIGRGHLELLVSAVLQASLTPQPAARQAEDAHNEL
FT                   HGPLMQVLSDSARQSYCSLVYETSGFADYFFAATPISEIAGLNIGSRPASRKQGQRIED
FT                   LRAIPWGFSWAQCRLMLTGWYGMGSALQSYLELGAQGAPRSRRGRLTQLRAMAQDWPAF
FT                   RTLLSNMEMVLAKSDLAIASRYAMLVPQRGLRERIFGAISDEHGRTLAMLKLINQRELL
FT                   ADNPTLAASLRERFAYIDPLNYLQIDLIRRHRAAQCQPEKTEDPRLTRAIHLTINGIAA
FT                   GLRNSG"
FT   misc_feature    331211..331243
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    331574..331609
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00781"
FT   misc_feature    332861..332899
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00393"
FT   CDS_pept        334097..334759
FT                   /transl_table=11
FT                   /locus_tag="BAV0321"
FT                   /product="fimbrial subunit"
FT                   /note="One of 11 fimbrial subunits"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47926"
FT                   /db_xref="GOA:Q2KZS4"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZS4"
FT                   /inference="similar to DNA sequence:INSDC:AF111796.1"
FT                   /inference="similar to DNA sequence:INSDC:AE016914.1"
FT                   /inference="profile:HMMPfam:PF00419"
FT                   /protein_id="CAJ47926.1"
FT                   /translation="MLSSAIRNPQSAIRNPQSAIECVRITAFTLLALAGMAAAPAHAAD
FT                   GIVTITGEITDSTCKINGKEPPANIFVALPKISTSALKSVGDTAGATAFTITLSDCPEA
FT                   MAGDVKAHFEPGATTDYAHGNLFAYTDAASVTQAATSMPTIAAAKVDNLGIQLANANGS
FT                   KIMIGESPSGASGVSLVESGGKKGATLRYLARYIKTGNGNIAAGKLVTYVQYSIVYP"
FT   repeat_region   334105..334146
FT                   /rpt_unit_seq="(atccgcaatccgca)3"
FT   sig_peptide     334163..>334223
FT                   /locus_tag="BAV0321"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(334764..336101)
FT                   /transl_table=11
FT                   /locus_tag="BAV0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47927"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZS1"
FT                   /inference="similar to DNA sequence:INSDC:AP005963.1"
FT                   /protein_id="CAJ47927.1"
FT                   /translation="MNLHRLLKQRETDNKPLRLALIGIGKFSAMLLSQAQRTPGIRLIA
FT                   VADRDASRARSALTRCGWPAQTLGASTIHEALKHGKVFCCDDPLQVIADPDVEIVIDAS
FT                   TLAAEGIAHTLWCCEYRKDIIMVNLAADALAGPLLARRAREAGIVYSLAYGDQPALICE
FT                   MVDWARACGFEIMAAGKGTKYLPEFHTSTPDTVWPYYGFTDEMVAAGDFDARLFNSFLD
FT                   GTKSALEMASVANATGLTPAPQGLFYPPCGVDDLARVLRPREHGGILHHRGQVEVVSSL
FT                   ERDGRSVFRDLRWGVFVTLAADSDFVRSSFRDFGLVTDPSGNYAAMYRPYHLMGMELGM
FT                   SVASIGLRREPTGMPTAWHADVIATAKRDMAAGEVLDGAGGYSVYGRLVPARISTDDAY
FT                   LPIGLAEGAVLKHAVRQSQPIRTLDVSYDEETLAARLRREMEQAFA"
FT   CDS_pept        complement(336179..336739)
FT                   /transl_table=11
FT                   /locus_tag="BAV0323"
FT                   /product="putative 5'(3')-deoxyribonucleotidase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47928"
FT                   /db_xref="GOA:Q2KZR9"
FT                   /db_xref="InterPro:IPR010708"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZR9"
FT                   /inference="similar to sequence:UniProtKB:Q8TCD5"
FT                   /inference="profile:HMMPfam:PF06941"
FT                   /protein_id="CAJ47928.1"
FT                   /translation="MLILLDQDGVLADFEHAFIDAWRQRYPDIAPVAYEDRRSFHLLED
FT                   YPEALRARAEAIYTAPGFIRHLPPVAGALEAVRELIALGMDVRICTSPLRQYDNCVLEK
FT                   YQWVEHHLGRAATERLILTRDKTLIQGDLLIDDRPNIPGAVRPQWRHIIYDAPYNRQET
FT                   GCPRLTWQNWRNILAGALYQSDA"
FT   CDS_pept        complement(336833..338323)
FT                   /transl_table=11
FT                   /locus_tag="BAV0324"
FT                   /product="multidrug efflux system outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47929"
FT                   /db_xref="GOA:Q2KZR7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZR7"
FT                   /inference="similar to sequence:UniProtKB:Q51487"
FT                   /inference="profile:HMMPfam:PF02321"
FT                   /protein_id="CAJ47929.1"
FT                   /translation="MTQRIARLSALLAALLVLAGCAVGPDYHQPAAATPARYKEAAPQE
FT                   AGNWKTAQPSEAALRGEWWKIFGDTALNAMQEEALGANQSLKAAAARLAQARALQRDAR
FT                   ADFFPKVDAGVGPNRQRPSPASQDLSDNASPSASTQWRAQASAAYEADLFGRVANSVDA
FT                   ATADAQQSEALYRSILLALQADVASTYFLVRERDAESQLYRQTVALREASLTLIQRRFE
FT                   AGDIGELDLARAKSELAQAQAEALGVDRQRATAEHALAVLLGKTPAEFSMPPQPLKPLL
FT                   VTVPAGLPSALLERRPDIAAAERAMASANARVGVAKSAFFPRLEITGALGYESSQLSKL
FT                   FQWSSRTFLLGPLVGTALSLPIFDGGRRQASLDRALAVYEEDVAQYRQTVLSAFREVED
FT                   NLANLRILGNQTQAQSEAVDASARAASISHAQYREGSISYLDVIEADRTVLTQRRLSVQ
FT                   LTGEQARSTVDLIRALGGGWDSAVPAAGQETGKTAAMR"
FT   misc_feature    complement(336848..336871)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   sig_peptide     complement(338225..338323)
FT                   /locus_tag="BAV0325"
FT                   /inference="protein motif:SignalP:2.0"
FT                   /inference="profile:HMMPfam:PF00873"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(338340..341522)
FT                   /transl_table=11
FT                   /locus_tag="BAV0325"
FT                   /product="multidrug efflux system transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47930"
FT                   /db_xref="GOA:Q2KZR5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZR5"
FT                   /inference="similar to DNA sequence:INSDC:U97042.1"
FT                   /inference="similar to DNA sequence:INSDC:X99514.1"
FT                   /protein_id="CAJ47930.1"
FT                   /translation="MNISKFFIDRPIFAGVLSVLVLLGGLLAMFQLPISEYPEVVPPSV
FT                   VVRAQYPGANPKVIAETVASPLEEAINGVEDMIYMQSQANSDGNLTLTVNFKLGMDPDK
FT                   AQQLVQNRVSQALPRLPPDVQRLGVTTTKTSPTLTLVVHLISPNDRYDITYLRNYAIIN
FT                   IKDRLSRINGVGEATVWGSGNYSMRVWLDPQKVAQRGMTASEVVAAIREQNVQVAAGVI
FT                   GASPTLSDVPLQLNVNARGRLQTEEEFRDIVLKTSPDGGVTHLADVARVELDAQEYGLR
FT                   SLLDNKPAVGMGIMQSPGANALDVATQVRNTMQELSQDFPPGVEYRIEYDPTQFVRSSI
FT                   EAVVHTLLEAIALVVLVVILFLQTWRASIIPLLAVPVSIVGTFAFLLMFGYSINALSLF
FT                   GMVLAIGIVVDDAIVVVENVERNIAAGLSPREATYRAMREVSGPIIAIALTLCAVFVPL
FT                   AFMTGLSGQFYKQFAMTIAISTVISAFNSLTLSPALSALLLRGHHDKPDWLTRQMNRFL
FT                   GRFFAAFNRLFGSASDRYATNVEGVIRHKSKAMGVYALLLALTVGISYLVPGGFVPAQD
FT                   KQYLIGFAQLPNGASLDRSDAVIRRMTDIALAEPGVKSAIAFPGLSINGFTNSSSAGIV
FT                   FVTLKPFEERQSAALSGNAIAASLNQKFGAIKDAFVAVFPPPPVMGLGTLGGFKLQIED
FT                   RGALGYAELDRAAQAFLAKAAQTPELGPSFSSYQINVPQLDVDLDRVKAKQLGVPVSEV
FT                   FDTMQIYLGSMYVNDFNRFGRVFQVRAQADAPFRSHPQDILQLKTRNAAGEMVPLSSLV
FT                   TIKPTFGSEMVVRYNGYTAADINGGPAPGFSTNQAQAAAERIAAEVLPRGMKMEWTDLT
FT                   YQQILAGNAGLWVFPISVLLVFLVLAALYESLALPLAVILIVPMSILAALTGVWLTGGD
FT                   NNIFTQIGFMVLVGLSAKNAILIVEFARELEMQGSTPLEAAIEASRLRLRPILMTSIAF
FT                   IMGVVPLVLSSGAGSEMRHAMGVAVFFGMLGVTLFGLFLTPVFYVVLRTLSKRKLHSAS
FT                   PHDAPLHQHHAH"
FT   sig_peptide     complement(<341435..341522)
FT                   /locus_tag="BAV0325"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(341543..342730)
FT                   /transl_table=11
FT                   /locus_tag="BAV0326"
FT                   /product="HlyD-family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47931"
FT                   /db_xref="GOA:Q2KZR3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZR3"
FT                   /inference="similar to DNA sequence:INSDC:X99514.1"
FT                   /inference="profile:HMMPfam:PF00529"
FT                   /protein_id="CAJ47931.1"
FT                   /translation="MTLSRHRIAALTVAAALLAAGAAYTLLPASGGVAHAEGQPAAAAV
FT                   DVAPALARTILDWQRYSGRLEAIDRVDIRPLVSGTLTEVHFKDGALVKKGDVLFTIDPR
FT                   PYAAEVDRAAAQLAAAQARAAYTASDLARAQRLLSDNAIAKRDFEEKQNAAREAAAHLL
FT                   AARAAQESARIHLGYTRITAPVDGRVSRAEVTVGNVVNAGAQTLPLTTLVSVSPIYAAF
FT                   DVDEQTFLKSVNPARAAGTEVPVQLGLANEDGYSREGVVHYVDNRLDSNSATIRLRAVF
FT                   DNHDGSLLPGLYARVRLGGGGPREAVLVDEKAIGTDQNKRYVLVLDDQHRANYREVTLG
FT                   ANLGPLQVIEKGLKPGEQIVVNGLQRVRPGSVVAPTVVSMDTAPQAVKTAAAALK"
FT   sig_peptide     complement(<342619..342730)
FT                   /locus_tag="BAV0326"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        342974..343996
FT                   /transl_table=11
FT                   /locus_tag="BAV0327"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47932"
FT                   /db_xref="GOA:Q2KZR0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZR0"
FT                   /inference="similar to DNA sequence:INSDC:AJ297529.2"
FT                   /inference="profile:HMMPfam:PF00126"
FT                   /inference="profile:HMMPfam:PF03466"
FT                   /protein_id="CAJ47932.1"
FT                   /translation="MDRFQAMQVFVRVVEANSFTRAAESLTLPRTTVTTIIQNLERHLG
FT                   VRLLNRTTRRISLTPDGAAYYKHATRILAEVYETEACLQDAAARPQGRLRIDVPASVGQ
FT                   LILIPALCDFHTRYPDVELVIGMGDRKVDLVQEAVDCVIRSGELEDSSLVARRIGTVQT
FT                   VTCATPSYLERYGTPESLQDLERHHAVHYFSSGGRQCAWTFMVDGKEQLVDVAGTVSVN
FT                   DWSAHLTCGLNGFGLIQTARYMALPHLLSGALVEVLPQWKPKSVPISLLYLQNRQLSPK
FT                   VRVFSDWVADLFAGCTLLSGRDENEPGVLVCKVQQPTLLPAGEHEARRRVPQDMPEFVM
FT                   "
FT   misc_feature    343025..343117
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00044"
FT   CDS_pept        344091..345200
FT                   /transl_table=11
FT                   /locus_tag="BAV0328"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47933"
FT                   /db_xref="GOA:Q2KZQ7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZQ7"
FT                   /inference="similar to DNA sequence:INSDC:AE009130.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF01594"
FT                   /protein_id="CAJ47933.1"
FT                   /translation="MQQPVFPVYLIARWLLLLVVAAGLYFLSGFLVPALAALIIGLATW
FT                   PLYERVVRFCKGRNILAATLALCIVVLVVVVPLSMALTYAFKEASNFFAWALAANKHGV
FT                   EVPFWISSLPGVGERLSQYWTTYLGEPHALGAMVELVSGEHLGNIYRMALSATGNVFQW
FT                   LLTLLFMLITLFFVYKDGKSMVAQLDILGERVLPARWKRFSRVVPATVSSTVTGMCLIA
FT                   LGEGVVLGLAYWIAGVPSPVLLGVITGFMALIPGGAPLSFTLVSLYLVGSNHLVAGVGL
FT                   FVWGTVELFIVDKTLRPRLVGGPVKLPFLPTFFGLVGGVKTMGIVGLFVGPVLMALLVA
FT                   IWREWVRNTERDCDLERGMPSERGPGPSD"
FT   sig_peptide     344091..>344196
FT                   /locus_tag="BAV0328"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        345279..346046
FT                   /transl_table=11
FT                   /locus_tag="BAV0329"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47934"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZQ3"
FT                   /inference="similar to DNA sequence:INSDC:AL646077.1"
FT                   /inference="similar to sequence:UniProtKB:O14832"
FT                   /inference="profile:HMMPfam:PF05721"
FT                   /protein_id="CAJ47934.1"
FT                   /translation="MPTLSVADLVATLRQQGFAIARNFASPSEVQALRAAAEHDLHHQI
FT                   APVEYEADLQYPGAPSSRAAAGGMTVRRLLDAYGRGPCFQQWATQAAISEVLRAYFDGR
FT                   RPVVSTVHHNCVMTKHPMYGSLTGWHQDIRYWSFPQQDLVSCWLALGPESPHNGGLFFV
FT                   PGSHAAAYGPECFDSQKFFRDDLPANQDWIARAVSPELEAGDVVFFHCRTLHAAQQNRS
FT                   GRVKLSLVHTYYPEDCPPVEGTRSSSRPGVLLA"
FT   CDS_pept        346154..347326
FT                   /transl_table=11
FT                   /gene="kch"
FT                   /locus_tag="BAV0330"
FT                   /product="putative potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47935"
FT                   /db_xref="GOA:Q2KZQ1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZQ1"
FT                   /inference="similar to sequence:UniProtKB:P31069"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00520"
FT                   /inference="profile:HMMPfam:PF02254"
FT                   /protein_id="CAJ47935.1"
FT                   /translation="MLTKLRSFFARFFPSHLVLAVLVALVGYLHLLSAFNQAGRPDFEF
FT                   FSSFDSWRDAIEAVGLLDAPRALLGLGLVFMALGLLLRARIAWAFSLLMLVVVGILGYL
FT                   GSANMLLNLFNLLTFMLLVAAWSVFNRASLAAGSLFTVIAILSLLAYAIFGSLYLGPEF
FT                   APAISSLPAAIYFSVVTMSTVGYGDIVPHSDAARYFTLSVIILGITVFATSISAIAGPV
FT                   IGGNVKRLIKGRIAHAMRHDHIILAGASSLAATVYPVLRAHGYAVTAIVPEGEQHRYPD
FT                   GTDLIEGDPTTSAVLIEAGAQRARYVLALSGDDAENAFIVLAAKDVGSPETRTVAVANL
FT                   PEHLVKLKRVQPDIVFSLQQMVGELLARTLGGEKIDQAFIDNLFTGNKNH"
FT   sig_peptide     346154..>346259
FT                   /gene="kch"
FT                   /locus_tag="BAV0330"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    347254..359971
FT                   /note="Type II secretion pathway"
FT   CDS_pept        complement(347393..348064)
FT                   /transl_table=11
FT                   /locus_tag="BAV0331"
FT                   /product="putative type IV prepilin leader peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47936"
FT                   /db_xref="GOA:Q2KZP7"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZP7"
FT                   /inference="similar to DNA sequence:INSDC:BX640450.1"
FT                   /inference="similar to sequence:UniProtKB:P31711"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF01478"
FT                   /protein_id="CAJ47936.1"
FT                   /translation="MSIPDLLAAIAAGLLSGLMAWLAAERLPGLVIRQWMQDEAAIEAE
FT                   FGKLSPPGRGRRQALFIAAACTLALACGWRFCWTLGSLQALLLCAVLLTLADIDRRTLL
FT                   LPDILTQPLLWAGLLVNLDHAFAPLAQAVVGAALGYALPWLAAQGLRLARGSDGMGGGD
FT                   FKLMAALGAWFGAIRLIDIVLLASLSAILWMLTRGHRALPFGPFLAAAGIAALFLPSLP
FT                   L"
FT   sig_peptide     complement(<347995..348064)
FT                   /locus_tag="BAV0331"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(348075..349268)
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="BAV0332"
FT                   /product="general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47937"
FT                   /db_xref="GOA:Q2KZP4"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZP4"
FT                   /inference="similar to DNA sequence:INSDC:AF110185.1"
FT                   /inference="similar to sequence:UniProtKB:P31705"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00482"
FT                   /protein_id="CAJ47937.1"
FT                   /translation="MPSYRYEASDALGKIVRGTLDAESERSARNQLRSRGLFPISTARA
FT                   AQGGALQARLSDADLAWLTRQLASLLAASLPLDAALTITLEQAEKRHIATTLTGVRDDV
FT                   RAGHKLSSALASRPRDFPEIYRALIGAGEESGDLSQVMEKLAHYIEERNALRSKVLTAF
FT                   IYPVVVGAVSVLIVIFLLGYVVPQVVSAFSHAKQQLPLLTRIMLALSDYVREWGLISGL
FT                   GLTALIALWRYSLRMPAARAAWHGRLMRLPLAGRFVLGVNAARFASTLAILCGSGVPIL
FT                   AALDAARRTMTNDVLRTAVQEAAEHVGKGASLSGALARRKVFPPILIHLVASGEKTGQL
FT                   PELLDQCARNLSRDLERRALAMTALLEPALILVMGGLVLLIVLAVMMPILEMNQLIR"
FT   CDS_pept        349403..351985
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="BAV0333"
FT                   /product="general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47938"
FT                   /db_xref="GOA:Q2KZP0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZP0"
FT                   /inference="similar to sequence:UniProtKB:P15644"
FT                   /inference="similar to sequence:UniProtKB:Q01565"
FT                   /inference="profile:HMMPfam:PF03958"
FT                   /inference="profile:HMMPfam:PF00263"
FT                   /protein_id="CAJ47938.1"
FT                   /translation="MRFFLSMGLALVLTAASPLNAFAQPAADKPASTPDGKVSLNFVDT
FT                   DIPAVVRAISLFTDQDFLVDPRVKGKITLVSERPVSREQALALLSGSLRLQGFSMVEVA
FT                   GIMRVVPEADAKLQGTVVGAARRTAGGPVPVSDFLRGAASGQMMTRVFPLRYENAANLV
FT                   PVLRPMVPPNNPVTAYPGNNTVVVTDYADNLERIAEVIARIDVPSALSTDVVPIKGGIA
FT                   SDIAALASQLLDTQSNDPTQRITIVADPRSNSVLVRSGSSGRTRLARDLIVKLDAQQSV
FT                   ESNLHVVYLRNAQAARIAEVLGGLLTGQANNQAGSAANGGAGGSRSGAASPPAGNMPSR
FT                   SGASGGNYNGGSTGLGGSGNERIAREEVSNQPLSFSAGGATVQADPATNSLIISAPEPL
FT                   YRNLRTVIDQLDQRRAQVLVESMIVEVSEDKASEFGIQWMTGAGNINSNSTSFIGGTNL
FT                   GGSGLGGVQGPTSLDVLGKGLSLGVVKGTVDVLGNKVINLGVLARAMQKDGEANILSTP
FT                   NLLTLDNQSASILVGKTVPFVTGQYVTSGGNGSSNPFQTIEREDVGLKLNIRPQISEGG
FT                   AVKLDIYQEVSSIDTSNSTAVSGVVTNKRAIDTSVLVEDGQIIVLGGLLEDSVSQGANG
FT                   VPGLSSIPILGALFRYDSRRHTKTNLMVFLRPYVVRDNRRAASLTMDRYDYMRRQQAAS
FT                   QPEAHWLLPQVQTPELTPPGSRGSVSNNIYDMRPEQLARTMRRDPPPTLSASVVRQLPP
FT                   TRKFSPDEPIRASLPIGVTVALDPSDLESTAGNDGTVLQFASVQEQREAEQIARRVQSS
FT                   GLSAYVQVGPGGMGYVVRSQVSNDAGTVQTAMALLRELGYPAQIIKSL"
FT   sig_peptide     349403..>349469
FT                   /gene="gspD"
FT                   /locus_tag="BAV0333"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    350981..351004
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        351982..353403
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="BAV0334"
FT                   /product="general secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47939"
FT                   /db_xref="GOA:Q2KZN6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZN6"
FT                   /inference="similar to DNA sequence:INSDC:AB050004.1"
FT                   /inference="similar to sequence:UniProtKB:P31702"
FT                   /inference="profile:HMMPfam:PF00437"
FT                   /protein_id="CAJ47939.1"
FT                   /translation="MSVHPLPYAWARAQRAVLSLRAGQAQLTVSPRTPSWAVREVRRRH
FT                   GEVLLHEVDDQTLESLLTASYTHGEDAASVMGVAENEIDLDRLLQDIPEVADLLEAQDD
FT                   APVIRMINALFAQAARDGASDIHIEPFETHSAVRFRVDGTLRDVVTPRKGLHAALISRI
FT                   KIMAYLDIAEKRLPQDGRIALRVGGRPIDVRVSTLPTGHGERAVLRLLDKEAGRLQLER
FT                   LGMSPRVLGQLDRLIRQPHGIVLVTGPTGSGKTTTLYAALSRLDAATSNILTVEDPIEY
FT                   DLPGVSQTQINAKIDMSFAMALRAILRQDPDVIMIGEIRDLETAQIAVQASLTGHLVLA
FT                   TLHTNDSVSAVTRLVDMGVEPFLLASSLLGVLAQRLVRRLCPACKTPVDGGPQYRAVGC
FT                   PLCNHSGYSGRSGIHELFIVDDGARSHIHDGRDERALRVAAVAAGLRSMREDGQRWVDA
FT                   GETSPEEVLRVTKDD"
FT   misc_feature    352723..352746
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    352900..352944
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00662"
FT   CDS_pept        complement(353424..354185)
FT                   /transl_table=11
FT                   /gene="gspN"
FT                   /locus_tag="BAV0335"
FT                   /product="general secretion pathway protein N"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47940"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZN4"
FT                   /inference="similar to DNA sequence:INSDC:AF110185.1"
FT                   /inference="similar to sequence:UniProtKB:P31710"
FT                   /protein_id="CAJ47940.1"
FT                   /translation="MRGLNSKSLLAAMGLVLCALIAGLTVLPARWLLLISPAGAPIELA
FT                   DVQGSLWEGRAWIALGPPDSRRLLPEPLQWRVRWARLDIEATHPWLQGPLVIAPRLDGI
FT                   KISAQGLRAPAAAIAALGAPWNTLSPGGLLDMRWQALTLGRPMSGPVAQIRWQDASTAL
FT                   SPLPRIGAYVMRIQGNGKDLTLALSTESGVLQADGQGIANQHGVRFAGRLSYAANADAA
FT                   QRRALDGLLAMIGPRQGDAVSFGTPGAAMAP"
FT   sig_peptide     complement(<354116..354185)
FT                   /gene="gspN"
FT                   /locus_tag="BAV0335"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(354187..354747)
FT                   /transl_table=11
FT                   /gene="gspM"
FT                   /locus_tag="BAV0336"
FT                   /product="general secretion pathway protein M"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47941"
FT                   /db_xref="GOA:Q2KZN1"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZN1"
FT                   /inference="similar to DNA sequence:INSDC:AF110185.1"
FT                   /inference="similar to sequence:UniProtKB:P25061"
FT                   /inference="profile:HMMPfam:PF04612"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47941.1"
FT                   /translation="MKRLTQYWLKLSQYAAPQLHTLRARHAALSLRERRLLLAVSAILA
FT                   AAVIFLGFIEPPLAKLARLRTDLPSLRIQAAAVDDLAARASALSRRAQVRAELPTPSDL
FT                   RGSLIHAGLPADHWTLTREDAVYVLTLNDVPAQRLLDWLETSARDWGLLARQAELARAL
FT                   NPNGRPLPGLVNASLRLALTQGN"
FT   CDS_pept        complement(354744..355718)
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="BAV0337"
FT                   /product="Putative general secretion pathway protein L"
FT                   /note="Weakly similarity limited to the listed proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47942"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZM9"
FT                   /inference="similar to DNA sequence:INSDC:AE004503.1"
FT                   /inference="similar to DNA sequence:INSDC:AL646073.1"
FT                   /inference="profile:HMMPfam:PF05134"
FT                   /protein_id="CAJ47942.1"
FT                   /translation="MKNMLRVALPPLAALRADTLLPYAWHDRRGGLRQGESTAQALATA
FT                   FRRAPAELVMHPDDIITTVIGVPPLGRARQAAVVRGALEPLVLGDLNEVAIGYADTSAD
FT                   GQVEVAWTPRPALEQACALLAGQGMRLRAIIPPSALGEGQALQARGDPRWRAPSPGWSL
FT                   ELPRQAGNTVSQWRSPLQWAAAAALLWLIGLNLYASHLEAEARALRARMTQRVQQSFNL
FT                   PVVLDPLRQAQQGLAALGSGQANSHDFLSLARDVARLPLPTDDRVKQLNYADQALTLQL
FT                   FAEEDAARQVAVTPKLIQQAASLGLKLEQQEKTPTWRITRNSP"
FT   sig_peptide     complement(<355667..355718)
FT                   /gene="gspL"
FT                   /locus_tag="BAV0337"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(355715..356653)
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="BAV0338"
FT                   /product="general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47943"
FT                   /db_xref="GOA:Q2KZM7"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZM7"
FT                   /inference="similar to DNA sequence:INSDC:AB050004.1"
FT                   /inference="similar to sequence:UniProtKB:P31706"
FT                   /inference="profile:HMMPfam:PF03934"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47943.1"
FT                   /translation="MTGQRRQALARQRGTAVIMALIVVAVVAALATSLFQRQTASTRQF
FT                   ENALSGIQARRFLKGGTDWARLILRDHGRQNRITTPDQVWATPVMDTRIERPGDERVAV
FT                   FSGRLEDEQGKFNLYTLARNGAPQSEQQKVLARLLQLQQLPASLADTLLEAIAAAQASA
FT                   ALASNTGNPDLQAPLPRGVAELAAQLRLPPSTRAALTRTMTLLPAAVSVNVNTAPPEVI
FT                   AALIPGLSLSQARSITGERDRGNGFNNSADFSNRLAAFGVNEGIPPVVTHSNWYLASGT
FT                   LVYERARVGMQALLHSASPAAPKTQWIRELQ"
FT   sig_peptide     complement(<356557..356653)
FT                   /gene="gspK"
FT                   /locus_tag="BAV0338"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(356650..357258)
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="BAV0339"
FT                   /product="general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47944"
FT                   /db_xref="GOA:Q2KZM5"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZM5"
FT                   /inference="similar to sequence:UniProtKB:Q00517"
FT                   /inference="similar to sequence:UniProtKB:P31589"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47944.1"
FT                   /translation="MNASPHRRQLAQQGFTLIEVLVAISLMALVSVMAWRGLQQVADAR
FT                   ERIDSQSADTDQVMRAIGQLSRDVELAYTGPAFDPPSTEEITLTNGIRLSTRQLGQPVL
FT                   EIVRPDPDGAGLWQRVQWRVDGQGLWRATGMAAARMPLPQADQRVLLLPGITSLSLRAW
FT                   VPGAGWVPTARAPGSAPEGLELALERGPQQRYTTLVELP"
FT   misc_feature    complement(357160..357222)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00409"
FT   CDS_pept        complement(357255..357638)
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="BAV0340"
FT                   /product="general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47945"
FT                   /db_xref="GOA:Q2KZM2"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZM2"
FT                   /inference="similar to sequence:UniProtKB:Q00516"
FT                   /inference="similar to sequence:UniProtKB:P31588"
FT                   /inference="profile:HMMPfam:PF02501"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47945.1"
FT                   /translation="MTSDRPRHQQTGFSLIEVLVALAIIAIALTAALRATGLMAANHRA
FT                   LHDKTLALLSAQNALTQLRLEPVLPRAGKQTSACPQGGLPMRCEVTIANSLNRSFRQAS
FT                   VRVLGNDGAGVLIQLDGLISRIR"
FT   sig_peptide     complement(<357515..357638)
FT                   /gene="gspI"
FT                   /locus_tag="BAV0340"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(357546..357608)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00409"
FT   CDS_pept        complement(357625..358113)
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="BAV0341"
FT                   /product="general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47946"
FT                   /db_xref="GOA:Q2KZL9"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZL9"
FT                   /inference="similar to DNA sequence:INSDC:AF110185.1"
FT                   /inference="similar to sequence:UniProtKB:P31587"
FT                   /protein_id="CAJ47946.1"
FT                   /translation="MQTSAPGRSERGFTLLEMLVVLVIVGMTAGMVTLAVRPASDALLE
FT                   DARRLERAFTVAQGEALSDGRAIRWRANNAGWAFERDGRALTLSAQDDRVPPPDDFSTD
FT                   EQLRPMRFTAAPVSLRLDPERTLTFNTEWVAAPFALVLESAGRRVELRRDPAGNYDIR"
FT   CDS_pept        complement(358085..>358510)
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="BAV0342"
FT                   /product="general secretion pathway protein G"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47947"
FT                   /db_xref="GOA:Q2KZL6"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZL6"
FT                   /inference="similar to sequence:UniProtKB:Q00514"
FT                   /inference="similar to sequence:UniProtKB:P31586"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47947.1"
FT                   /translation="VRHRSPLSLQRGLTLIEMLVVMVIIGVLAALIVPRVLDRPEQARQ
FT                   VAARQDIAGIMQALKLYRLDNGRYPNTAQGLRALVEKPEGVSGWRGYLDKLPIDPWGQP
FT                   YQYLNPGVKGEVDVFSFGADNKAGGEGNDADIGSWAL"
FT   misc_feature    complement(358418..358480)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00409"
FT   CDS_pept        complement(358623..358940)
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="BAV0343"
FT                   /product="general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47948"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZL5"
FT                   /inference="similar to DNA sequence:INSDC:AB050004.1"
FT                   /inference="similar to sequence:UniProtKB:P31699"
FT                   /protein_id="CAJ47948.1"
FT                   /translation="MPAPLADAPPPAADNQAVARWFGRDEALTSDVKILGVIAAGRHGS
FT                   AVLSIDGGPPTAYRVGNALPGALVLRDIGADRVVLDQRGREMQLRTPSREAAPAGIVPL
FT                   P"
FT   CDS_pept        complement(359193..359516)
FT                   /transl_table=11
FT                   /locus_tag="BAV0344"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47949"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZL1"
FT                   /protein_id="CAJ47949.1"
FT                   /translation="MAAHAHVDADVQVAHYHCDAGRPFRVVYEFDHPRPEAHVHIHGRA
FT                   EKLVYEDGGFSNARYTLQGKVNRANVAKTGVFLFEHTREKFDGKWQPVDLMLGKNCMPA
FT                   KRP"
FT   CDS_pept        complement(359614..>359919)
FT                   /transl_table=11
FT                   /locus_tag="BAV0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47950"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZK8"
FT                   /inference="similar to DNA sequence:INSDC:AP003260.5"
FT                   /protein_id="CAJ47950.1"
FT                   /translation="VLCLAPWAIYFLALSVRPGLERRSLCGMSHLASVLVAADGDDAES
FT                   RKRYGVALRRVWAACAQHSPPLDAFLLTPHSSLLFIRNSPTHPLRGGMAEIIYLRC"
FT   CDS_pept        join(360274..361173,361176..362117)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tyrdC"
FT                   /locus_tag="BAV0346"
FT                   /old_locus_tag="BAV0347"
FT                   /product="tyrosine decarboxylase (pseudogene)"
FT                   /db_xref="PSEUDO:CAJ47951.1"
FT                   /inference="similar to DNA sequence:INSDC:AY303667.1"
FT                   /inference="similar to DNA sequence:INSDC:AF354231.1"
FT                   /inference="protein motif:Prosite:Pseudogene"
FT                   /inference="profile:HMMPfam:PF00282"
FT   misc_feature    361407..361472
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00392"
FT   CDS_pept        362211..363746
FT                   /transl_table=11
FT                   /gene="tyrP"
FT                   /locus_tag="BAV0348"
FT                   /product="putative tyrosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47952"
FT                   /db_xref="GOA:Q2KZK4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZK4"
FT                   /inference="similar to DNA sequence:INSDC:AF446085.2"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47952.1"
FT                   /translation="MFMVSKSAAGASPASNPIGLFTFIGMTCALVASVRNIPDLSATGW
FT                   SMFFYMFVATFMFALPITLISGEFAGMKPKEGGPELWVTSGIDERWGFVTSWLLWVQMF
FT                   PGMVMVASSLAPLLAIAIGNNAIGENNTFTLICILVVYWAISILNMFFDMAKIGGRIGA
FT                   WLGVYIPVIMLLVLGVAATIKTGIQTNNYLGEFSVAKLFPDTLSATGSLQYFAAICFIY
FT                   TGIEMSSVYIPRLKNPIATYIKGIFIALVFMLLFNLVNAFLLANAVAPGQIQLNNIAQG
FT                   PLLWLQALGLPMWIGNVFAGCVFIGVAVQLSAWASGPAKTIQASARRGLYPPSLGYWRE
FT                   NKYGVSRTIILTQAIIISLFALVYLLIPAVNAAFLLLVTATSVIYCVVYILMAVGIVKM
FT                   RKAQPDVPRPFRIGGANSKGNFWLWVVIVVFLGTILASIILTLFTFSFVDAAIVIGITV
FT                   VLTGLPLYIHHIRKPQWRVDVEAKMQALGQGHLIAKPESAAAIKTAPGGRGAA"
FT   sig_peptide     362211..>362304
FT                   /gene="tyrP"
FT                   /locus_tag="BAV0348"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        363762..363866
FT                   /transl_table=11
FT                   /locus_tag="BAV0349"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47953"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZK2"
FT                   /protein_id="CAJ47953.1"
FT                   /translation="MPGQSDWPGMSTGGRFGALAFGQGRGVFDMARDA"
FT   CDS_pept        363880..365253
FT                   /transl_table=11
FT                   /locus_tag="BAV0350"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47954"
FT                   /db_xref="GOA:Q2KZK0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZK0"
FT                   /inference="similar to DNA sequence:INSDC:AE000980.1"
FT                   /inference="similar to sequence:UniProtKB:P77400"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00324"
FT                   /protein_id="CAJ47954.1"
FT                   /translation="MMQQKQSGRGGQKLGLISCVAFAVGSMVGGGVFAMAGVAVNMAGP
FT                   GALLAYLLAGIVVGFSALSFAVVASRAPEGESGYTPVGVELGQIWQFITMWAFYVSTVT
FT                   AVAFMLIAFGNYLQYFFSSVDALLVALVGLLALVLLNLTSVGVIGKAESLMVGFKLLVL
FT                   FAMIGFGLAAFSGERLTPFFPKGEMPVLSTAAMLFSAYLGFSVITNMAGVVKNPQKTVP
FT                   RALMLSIGVVAVVYIGITFALLMADVGDLGDAGLAKAAEVLMGKWGAWLVALAACISTL
FT                   SGSNATLLGVSELMIGMAAKGYVPSFMGRMSRAGHAQMSVLIAGAVACVLMLTGDIASI
FT                   ITYCSVAGIWALIMMDITACRIAWKRWGPIGLRLPFGGLIPALAAIAAAAQLPSLGWEQ
FT                   VLIGTAMVAAGFLIYALRHRSDPKERETTQAQIAAQQTPLLRHVQGAQAAEHDRGAAS"
FT   sig_peptide     363880..>363985
FT                   /locus_tag="BAV0350"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        365642..366097
FT                   /transl_table=11
FT                   /locus_tag="BAV0351"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47955"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZJ8"
FT                   /inference="similar to DNA sequence:INSDC:AP006575.1"
FT                   /inference="similar to DNA sequence:INSDC:AP003598.1"
FT                   /inference="profile:HMMPfam:PF02469"
FT                   /protein_id="CAJ47955.1"
FT                   /translation="MKRFLVGATIALACGWAYAADIVDTAKSAGEFKTLTTAVQAAGLT
FT                   DTLKRPGPFTVFAPTDAAFAKIPKDKLDALLKDKAALTKVLTYHVVPGKVMAKDVKAGE
FT                   VKTVQGSPVTVTVADGKVKVDGANVVKTDIAADNGVIHVIDTVLMPK"
FT   sig_peptide     365642..>365696
FT                   /locus_tag="BAV0351"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    365651..365683
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(366238..367056)
FT                   /transl_table=11
FT                   /locus_tag="BAV0352"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47956"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZJ6"
FT                   /inference="similar to DNA sequence:INSDC:AE016856.1"
FT                   /inference="similar to DNA sequence:INSDC:AE012206.1"
FT                   /inference="profile:HMMPfam:PF00563"
FT                   /protein_id="CAJ47956.1"
FT                   /translation="MGAISSFFPARSTTMIPIHRSLGFLASDGLCHGCKSGEEGSIEMT
FT                   FAFQPIVDMTSGEAYAYEALVRGPQGESAASVLAQVDDSKRYRFDQRCRTTAIELAARL
FT                   GMDRFLSINFMPNAVYQPAACIRTTFEAAERHGFPTDRIIFETTESENIVDRAHLLAIF
FT                   KAYKSYGFKTAIDDFGSGYSGLTLLADFQPDIIKLDMALVRGVDADKARQRIISGVQRI
FT                   CTDLGIRVIAEGIETVGERDFLASEGITLMQGYLFARPAFKAMPPISHAR"
FT   misc_feature    complement(366721..366771)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00237"
FT   CDS_pept        complement(367409..368692)
FT                   /transl_table=11
FT                   /locus_tag="BAV0353"
FT                   /product="methyl-accepting-chemotaxis-protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47957"
FT                   /db_xref="GOA:Q2KZJ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZJ3"
FT                   /inference="similar to DNA sequence:INSDC:AF298190.1"
FT                   /inference="similar to DNA sequence:INSDC:AF010180.1"
FT                   /inference="profile:HMMPfam:PF00015"
FT                   /inference="profile:HMMPfam:PF00785"
FT                   /protein_id="CAJ47957.1"
FT                   /translation="MFSLFKNRNLEALRNAVPMIEFLPDGRILAANHRFCDMMGYHPDE
FT                   LLGQHHDIFCVPDPVGAARYTSILQDVAEDKPATRVFKRLRKDGVAVYLEATYLATRSQ
FT                   NGRIASVLQLAQDVTAQHLSRQQSGAIVQALNESTAMIEFTPEGFIVNANDRFLRSVGY
FT                   RRDEIVGQHHRLLCKPQYANTAEYRGFWERLRQGVAGVGLFDRVRKDGTLLWLEASYNP
FT                   IKDDMGNVRSVLKFATDVTQRENFNRESRLAVEETYRSSTRAQQQSEVLRLTGGASEQQ
FT                   VEALAGLVSESAGKIMALLKLSHSIGEMASGISDIAFKTNILALNAAIEAARAAEAGRG
FT                   FSIVAAEVRSLAGAVALQAKEIDRLTQLTQRGVREAVTALEQCDSKAKEALASTQTASS
FT                   ALKELNQCTTQMEAVSRSLAAVFQAQPA"
FT   CDS_pept        complement(368756..369313)
FT                   /transl_table=11
FT                   /gene="blc"
FT                   /locus_tag="BAV0354"
FT                   /product="outer membrane lipoprotein"
FT                   /note="This CDS does not exhibit a typical prokaryotic
FT                   lipoprotein signal peptide as is lacking a charged amino
FT                   acid (K or R) in the first 7 residues."
FT                   /note="Also similar to BAV3189 (36.6 38d)"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47958"
FT                   /db_xref="GOA:Q2KZJ0"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZJ0"
FT                   /inference="similar to sequence:UniProtKB:P39281"
FT                   /protein_id="CAJ47958.1"
FT                   /translation="MAALLAGSALLLAGCAATLPPPGVTPVSPFEVQRYEGRWYELARL
FT                   DHSFERGMTDVSATYTAQADGSVQVINRGYAPSTGKWREAVGKALFIGSPTTASLKVSF
FT                   FGPFYGGYHVAALDPDYRWALVLGNDTGYAWILARDKQLSAAQRDAIVAQAQALGVDTS
FT                   ALIWVSQERKDPRYDPSSAATQ"
FT   misc_feature    complement(369188..369223)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00213"
FT   sig_peptide     complement(<369256..369313)
FT                   /gene="blc"
FT                   /locus_tag="BAV0354"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(369269..369301)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(369408..370397)
FT                   /transl_table=11
FT                   /locus_tag="BAV0355"
FT                   /product="MerR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47959"
FT                   /db_xref="GOA:Q2KZI6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZI6"
FT                   /inference="similar to DNA sequence:INSDC:BX842648.2"
FT                   /inference="similar to DNA sequence:INSDC:AL939104.1"
FT                   /inference="profile:HMMPfam:PF00376"
FT                   /protein_id="CAJ47959.1"
FT                   /translation="MTPLTLPPVLASLDADDGALPIAAVERETGIGKDTLRVWERRYGF
FT                   PKPSRDSSGDRRYSAAQLQQLKLIRRLLDAGARPGKVVGLDQPGLQGLQALLTQQALAP
FT                   PVSLSRTNPGKVSDYPLLHELLSAIGAHDPQRLRHGLSYAQARIGLERFVTDLVAPLTT
FT                   AVGEAWAQGRFEIFEEHLYTEVVTGVLRQAIVSLSPPAIAQRPKVLLTTMQQEPHGLGL
FT                   LMVEALLALECCTCVSLGTQTPLSDIIQAARAHRADVVVMSFSNIHKGAVVPIFLHELR
FT                   ALLAADTELWVGGGCTALYQRPLAGVSTVRNLAGLAPLVAQWRQAHRT"
FT   CDS_pept        complement(370809..>373739)
FT                   /transl_table=11
FT                   /locus_tag="BAV0356"
FT                   /product="putative molybdenum-containing aldehyde
FT                   oxido-reductase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47960"
FT                   /db_xref="GOA:Q2KZI4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZI4"
FT                   /inference="similar to sequence:UniProtKB:Q46799"
FT                   /inference="profile:HMMPfam:PF02738"
FT                   /protein_id="CAJ47960.1"
FT                   /translation="VSSANQHGFSRRDFIKLGTVGGITLFLGRLPTAQALEVNSGPSPT
FT                   EWIGRNGKAKSRWDGVRKVTGQKNFAFDYRSRDIPGWPKQQGYAFMLKATDAEHRFAGV
FT                   DLAVLGDGLQPDRLILQKDLAGNGLEAPKSMGSRFYGEHILLPVGETAPLLGHPVAILF
FT                   YKDFDRFQAARRLLQFNTEAVKYGEFTGAKPPANYGAGRFVRIGGETPSAAPEFAPFQN
FT                   GAIKGGFHGNEVIWPPFKPDPALFVPDVIKRKRGSGFEDSLYAASLDPSVASQAMDAAM
FT                   VIAGDIEQARKNPDKIVLQRQGFSQSIDPCAMEPDNCTAWYDAATRSLHIMTATQSPVG
FT                   IVSAAADMVKNNTQVPVERIILLTGSTVGYGSKDYSVFPYYAIAACLYTDGLPVRVANN
FT                   RYDQFQMGMKRHSVEMDVTITADRKTGKFEILKGFYNCNGGGRENLSVAVSHVAARGAQ
FT                   SIYYFPKSDLATVAMATRAVEAGSMRGFGSLQSMSVTEVMVDELADQLGIDPIELRRRN
FT                   ALREGWQNTQGGVQAGDPRIIEMLDMAEQHPLWANRQKAKAEFEAANPGKRYGVGFAQV
FT                   QQVYGSSGDPSILALEFDSQGKLTMRHCVQEIGTGATTAQQVMVWQGLGKAPDQVEFGI
FT                   TDFPELPLTSAWADQKLQDEFSKNNPYWVPSIVPDMSSSAGVYYIGFATRQAARFLLEF
FT                   TLWPAARAIWSEGAGDGSFSSFDMQFSDVRIGPDGLGGGGMKPLPFETLARKAHEMGLI
FT                   TGVALHTFSRWEWARAEFDIPGVGLRNLPIDALAVRYGDGASAALKSRMTTAGYDFIKR
FT                   KSATYPPTQRSSAGPTTYTPAAYIVELNVNTFTGQVEVMSHHAFMDPGTMIVPELVSGQ
FT                   LQGGAAMGIGHALMEEMPLYENGPGDGTWNFNRYTLPRAKDVAVWTQTASYLPPLSETS
FT                   PPKGMAELGMIPVVAAVSNAISHAVGKRFYHYPITPQKIQVALAAG"
FT   CDS_pept        complement(373809..>374894)
FT                   /transl_table=11
FT                   /locus_tag="BAV0357"
FT                   /product="outer membrane porin protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47961"
FT                   /db_xref="GOA:Q2KZI2"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZI2"
FT                   /inference="similar to sequence:UniProtKB:Q04064"
FT                   /inference="similar to DNA sequence:INSDC:U16266.1"
FT                   /protein_id="CAJ47961.1"
FT                   /translation="VKKTLLGMTCVMGILSGTAQAQSSVTLYGTIDTGVGFQSWKNRSL
FT                   GVKESQVGTYNGVWESSIWGLKGSEDLGGGNSANFQLEGGFNAYDGKSSSDRLFKKATV
FT                   GLANTQWGSIKFGRVGNVVQEYASFIAGPDDEENLADITNTFSAAGSNKADNTVVYKSP
FT                   KIHGMDFAIGYSFNTNGPQSWKNKENVKLITTAMGYSQGPLTLGVGYDRLQSGSWDKDV
FT                   HSWVAVGAYDFEAVLLGMAVGQDINGRQSALSSYVPNSAFKTWNSGYTRDFKTSSFTIN
FT                   ATVPVGAVSSAMVGWSISRASSGFSNAYNLEKRQQNIYSAGYSYNLSKRTSLYAIGAYS
FT                   TGFAFQNVRGQQVIVGLDHSF"
FT   sig_peptide     complement(<374828..374894)
FT                   /locus_tag="BAV0357"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(375481..>375798)
FT                   /transl_table=11
FT                   /locus_tag="BAV0358"
FT                   /product="putative restriction endonuclease (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47962"
FT                   /db_xref="GOA:Q2KZI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZI0"
FT                   /inference="similar to DNA sequence:INSDC:AE008911.1"
FT                   /protein_id="CAJ47962.1"
FT                   /translation="MKCKRSLRVYCGQWTKTKVSGADRGKDILASPDGFGFQPPRLVIE
FT                   VTHRNGRHKNNRGLYVSTGGFTKAAQYDAERPSMAAAISADKRRRQPEQAPVCPIRNIP
FT                   R"
FT   CDS_pept        complement(375893..376273)
FT                   /transl_table=11
FT                   /locus_tag="BAV0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47963"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZH7"
FT                   /inference="similar to DNA sequence:INSDC:AE016864.1"
FT                   /inference="similar to DNA sequence:INSDC:AP005084.1"
FT                   /inference="profile:HMMPfam:PF04320"
FT                   /protein_id="CAJ47963.1"
FT                   /translation="MKPFQTVPRTRLHRWNRRQRKKLRLGEFQELGFTLHLSFHSPLDE
FT                   AAYERHGDAIIERIEALGLCVGGLGGTLPIAETEGFVSSWNPGSVTPEQVSRLLEWCRA
FT                   RPEVKEVRAGELVDAWHGWGLA"
FT   CDS_pept        complement(376293..>376439)
FT                   /transl_table=11
FT                   /locus_tag="BAV0360"
FT                   /product="putative type I restriction-modification system
FT                   specificity determinant (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47964"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZH6"
FT                   /inference="similar to DNA sequence:INSDC:AE011932.1"
FT                   /inference="similar to DNA sequence:INSDC:AE005738.1"
FT                   /inference="similar to DNA sequence:INSDC:AP005214.1"
FT                   /protein_id="CAJ47964.1"
FT                   /translation="MTSFLDREIAKLDKLKPDSERAIALLAARRSALIAAAVTGHIDVR
FT                   AVA"
FT   CDS_pept        complement(376446..376658)
FT                   /transl_table=11
FT                   /locus_tag="BAV0361"
FT                   /product="conserved hypothetical protein"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47965"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZH5"
FT                   /inference="similar to DNA sequence:INSDC:AF288536.1"
FT                   /protein_id="CAJ47965.1"
FT                   /translation="MVRSGHARLRDALNESLSIERRLDLAYNAAHAFCLAALRWHGYRS
FT                   SKRYVIFQLLPHTLDLGPAVWRITE"
FT   CDS_pept        complement(376723..377004)
FT                   /transl_table=11
FT                   /locus_tag="BAV0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47966"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZH2"
FT                   /inference="similar to DNA sequence:INSDC:AF288536.1"
FT                   /protein_id="CAJ47966.1"
FT                   /translation="MPRVEPAKHFKLTNSNKPMGTNAAIPSPQSLSDALFPGNKQRVLG
FT                   ILYEQPDRSLYANALIKLAASGSGAMRRELATLTHSGLVSMKQVGNRV"
FT   CDS_pept        377499..378572
FT                   /transl_table=11
FT                   /locus_tag="BAV0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47967"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZH0"
FT                   /inference="similar to DNA sequence:INSDC:AJ414145.1"
FT                   /inference="profile:HMMPfam:PF02661"
FT                   /protein_id="CAJ47967.1"
FT                   /translation="MSTYVGGTTPTHLFFQLKRIFHILESLGSARIEGNHTTLSDYVEH
FT                   LVDGDHNNRPPDQLREIDNIERAMDFIDGGVKEGEPLSEQFIRELHHLTVNDLEREGDR
FT                   TPGAYRLTQVSISKSKHLPPPASRVAMYMQELVDFVNRPNAPKYDLMKVALAHHRFGWI
FT                   HPFSNGNGRVVRLLTYAMLLKYGFNVSAGNRILNPTAVFCNNRDKYYQMLGVADQGTSE
FT                   GLEHWCCYVLGGILAELKKVDRLSSYEYLRPKILRPAIRHAIERGHINKTEENVLLAAL
FT                   RADDGLIKAKDLEAVLPNKNQRTYQIKKLVERGMLVQSAPNARSYYAGFANNFLLRGVM
FT                   KSLAVEGFLPDRLDAGL"
FT   repeat_region   complement(378906..378946)
FT                   /note="Duplication of the 3' end of tRNA Leu generated by
FT                   the insertion of prophage"
FT   misc_feature    complement(378947..402478)
FT                   /note="putative integrated plasmid"
FT   CDS_pept        complement(379168..379617)
FT                   /transl_table=11
FT                   /locus_tag="BAV0364"
FT                   /product="Hypothetical phage protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47968"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZG8"
FT                   /protein_id="CAJ47968.1"
FT                   /translation="MTEFAEMSGEQIKAEVFARLDQYKDRSALEQYAIFMGKAQILEFG
FT                   LKGLLARKFNVSHEEMERWTLGKTKNELRDRGVRPDFIRFLESVVDHRNNMAHEFLINT
FT                   EITRSLANFSDRKVYGDLFRALYELEQIIILHDWCEINNGWLPRG"
FT   CDS_pept        complement(379904..380680)
FT                   /transl_table=11
FT                   /locus_tag="BAV0365"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47969"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZG7"
FT                   /inference="similar to DNA sequence:INSDC:AE001272.1"
FT                   /protein_id="CAJ47969.1"
FT                   /translation="MSVISYLDARASSAVLSTDEQASINASIVTIKSRLNNYFGTALSE
FT                   QLRFGSSTRGTILPRKMDQHSDIDYMVVFAQGGAVPQTYLDRLKRFAEQYYSTSDIKQS
FT                   SPSLVLQLNHIKFDLVPALKVWGTTYQIPNGPAAWQNTNPNDFNGQLDALNHKEMYKIK
FT                   PMIRLLKYWNAEAGYIFDAYSLEKFVVSLSYYGVINIRDYLFTAFDNLYLGSDQAQWRK
FT                   DKVKRAKDIIAEVRSLERDGYPNLAEAEVKKLIPSA"
FT   CDS_pept        complement(380680..381192)
FT                   /transl_table=11
FT                   /locus_tag="BAV0366"
FT                   /product="Hypothetical phage protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47970"
FT                   /db_xref="GOA:Q2KZG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZG5"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47970.1"
FT                   /translation="MTNITDPRPAINAELQRIEEDCIHSGKAHFNAGIRWAKYHYGLGI
FT                   PSVVLSALAGLAFFKDYPEAAGVMSGIVAILTSLITFLKPSERSVSHKNSGDQYLSLRN
FT                   DARVFREIKLPALPEEQAVIDGLDVFTKRRNDLNQSSAQFSQGDFEKARKGIDAGEAAH
FT                   RVDRSNP"
FT   CDS_pept        complement(381282..382313)
FT                   /transl_table=11
FT                   /locus_tag="BAV0367"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZG3"
FT                   /inference="similar to DNA sequence:INSDC:BX571860.1"
FT                   /protein_id="CAJ47971.1"
FT                   /translation="MDKSVIFAVAGSGKTTRLVTALDEVRRFLLVTYTEANYDNLRAKV
FT                   IDRFGYLPPNIAIYTYFSFLHSFCYRPFLRSKKNTRGIIFKAPDRFPVYPLTNDRRYIS
FT                   PGGWLYANRLAKFIEQSGLVGAVLARMEKYFDVFFVDEVQDFGGHDFNFLLAISEAQMD
FT                   MNFVGDFYQHTFDTSRDGNVNSNLHENYNAYRKKFERARLKVDTDSLKCSRRCSKSVCD
FT                   FITEKIGVNIQAHDERTSVVRFEDDPAAVATLYRDPGTVKLFYKEHQKYGCFSQNWGAS
FT                   KGMDRYEDVCVVLNPGNVKAWNAGSFRDINPETRNKLYVACSRARGNLTFVPESLLKVY
FT                   KRS"
FT   misc_feature    complement(382269..382292)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(382298..>383866)
FT                   /transl_table=11
FT                   /locus_tag="BAV0368"
FT                   /product="conserved hypothetical phage protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47972"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZG1"
FT                   /inference="similar to DNA sequence:INSDC:BX571860.1"
FT                   /inference="similar to DNA sequence:INSDC:AF241171.1"
FT                   /inference="profile:HMMPfam:PF02463"
FT                   /protein_id="CAJ47972.1"
FT                   /translation="VATIQRLVLKNFKRFKALELEFDPELNILVGGNEAGKSSVLQAMD
FT                   IVLSASRSKVEAIGLEALFNADCIAEFLAGARRIADLPELLIEVYFDGLQDRHDLDGRN
FT                   NSKGGDHLGIKMVCQPVDEYTKEIQAILAEQHDNFPFEYYSVRFLTFTDDTVFPHKKPL
FT                   RHLLIDSSLINNEHATREYTRSMYAAHASIAQRNLHGYEYRKAKAKFKDDVFKTMNDGL
FT                   DAYKFDIRTSPKASVETDIIITEDNIPVDSKGKGRQCFIKTEFALRNREHALHALLLEE
FT                   PENHLSQVHMRKLIERIRASVKKQLFIATHSSFIATRLNLRKVLILSEESPSRPASLKE
FT                   LSPGTAEFFMKAPDNNILELALCKKAILVEGDAEFILMEALYKISAPGYSLDADGIHVI
FT                   SVDGTSFKRYLELAKLLGIKVAAIRDNDKDHAANCVANYADHVSASTRVFADPDNARHT
FT                   FEVCIYQDNQVACEELFAAGRKTLSVEEYMLKNKTDAAFQLLEKKGAELAAPDYIRQAV
FT                   TWIRA"
FT   misc_feature    complement(383753..383776)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(384024..384254)
FT                   /transl_table=11
FT                   /locus_tag="BAV0369"
FT                   /product="hypothetical phage protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47973"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZF9"
FT                   /protein_id="CAJ47973.1"
FT                   /translation="MTKKLRIWGLVQDRLSPGFALHVHPMFRGGGILVKALIQIRQLSA
FT                   KNGSPADVEQRLLCSGRCPSHIPHGCPIWEP"
FT   CDS_pept        complement(384251..384484)
FT                   /transl_table=11
FT                   /locus_tag="BAV0370"
FT                   /product="Plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47974"
FT                   /db_xref="InterPro:IPR041535"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZF6"
FT                   /inference="similar to DNA sequence:INSDC:AJ304453.1"
FT                   /protein_id="CAJ47974.1"
FT                   /translation="MAGKGKCRQQPPKTISDTERSRRQSAVNYARASVGLEGFSLSEAD
FT                   EAHAQRFVDGQISLQEFVQPRADALALQKSSS"
FT   CDS_pept        complement(384590..384793)
FT                   /transl_table=11
FT                   /locus_tag="BAV0371"
FT                   /product="Hypothetical phage protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47975"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZF2"
FT                   /protein_id="CAJ47975.1"
FT                   /translation="MVRPAAHRARTRPLDAAGAPHAMPGGRSSGPQPATPAPEAPAGEG
FT                   GESREAKPLWKLRLVRSRYWRP"
FT   CDS_pept        complement(385134..386186)
FT                   /transl_table=11
FT                   /gene="virB6"
FT                   /locus_tag="BAV0372"
FT                   /product="probable conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47976"
FT                   /db_xref="GOA:Q2KZF0"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZF0"
FT                   /inference="similar to DNA sequence:INSDC:AJ304453.1"
FT                   /inference="similar to DNA sequence:INSDC:U09868.1"
FT                   /inference="profile:HMMPfam:PF04610"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47976.1"
FT                   /translation="MGFALFQWIGSSVDAMLNTFVSETASNVILGFQMLMLTGVTLYIT
FT                   LTGYAISTGAVEAPFQTFIKQCMKILIITAFCMTADAYTTTVVSAIQGLETGLADIMST
FT                   SNAQATSIYQVLDNSADKGLNVAYDMLGKVAKREFYELGHMFWDALNALMMAIAVFLIH
FT                   LPAAATIIMAKLGLGIMLGLGPLFIAALMFPVTAKWFDKWFEQALAYILEIAITMVVVS
FT                   VGVALFKALFDRVISTTTDNPISSFVQIIVLALIIFFAQRKTSGLGARLAGGIAFDAVT
FT                   FRSMAQGIGNLVNPKTTRRDMQSGMMVTAGRTNHMIAGNTMWNPAYRQHVLQNMGKNWG
FT                   SATGGSVNGK"
FT   CDS_pept        complement(386188..386448)
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="BAV0373"
FT                   /product="putative conjugal-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47977"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZE6"
FT                   /inference="similar to DNA sequence:INSDC:AJ304453.1"
FT                   /inference="similar to DNA sequence:INSDC:X81123.3"
FT                   /protein_id="CAJ47977.1"
FT                   /translation="MKNILFPFFIVLTPAACGDNTPVQTVDWYKAHTPERNAMIEKCEA
FT                   SPGELAASANCINAKTAANHLAVDKRGYFDLKPINPLKGGQ"
FT   sig_peptide     complement(<386391..386448)
FT                   /gene="traG"
FT                   /locus_tag="BAV0373"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(386445..386891)
FT                   /transl_table=11
FT                   /locus_tag="BAV0374"
FT                   /product="putative plasmid-related protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47978"
FT                   /db_xref="GOA:Q2KZE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZE3"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ47978.1"
FT                   /translation="MAPFYAITLVPVVTLCLAIYRFWACARRLSPEYYRELLRRAPLMR
FT                   TLDVVAIGMAAFTAYYAAMGWFGFTLPFIDEEPLPPWMNIILSAVTSIACIGIVWINAP
FT                   NRFTQPTWGGMRESVVRTLAALRIIEAAEVAHALDIINAREAHK"
FT   misc_feature    complement(386607..386639)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(join(386902..387321,387324..387626))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="BAV0375"
FT                   /product="conjugal transfer protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAJ47979.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ297913.2"
FT                   /inference="similar to DNA sequence:INSDC:X81123.3"
FT                   /inference="protein motif:Prosite:pseudogene"
FT   sig_peptide     complement(<387557..387626)
FT                   /locus_tag="BAV0376"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(387883..388161)
FT                   /transl_table=11
FT                   /locus_tag="BAV0377"
FT                   /product="putative plasmid-related protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47980"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZE0"
FT                   /protein_id="CAJ47980.1"
FT                   /translation="MRKKDHKMALRYDALQDYCDDPARTGDVQVILYAHYWKGFALAVQ
FT                   DGTTEHRVMDDKGRPYRFRTVEMALAELANISYLSDRIIIDRRAWSP"
FT   CDS_pept        complement(388166..389161)
FT                   /transl_table=11
FT                   /gene="traR"
FT                   /gene_synonym="virD2"
FT                   /locus_tag="BAV0378"
FT                   /product="putative nickase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47981"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZD8"
FT                   /inference="similar to DNA sequence:INSDC:AJ297913.2"
FT                   /inference="similar to DNA sequence:INSDC:AF302424.1"
FT                   /protein_id="CAJ47981.1"
FT                   /translation="MSLVIDGILKDWGERIYTKPVTSQGVKRTVTRSRTSPPSKPLLLT
FT                   GSARVRDKLMLTTRKAPEVMVKISGGGKGIAQVKAHLDYISRSGLVALENEDGEIILGR
FT                   EAMQDVRDEWKSGQYGLPDNGSRRETFNIVLSMPPGTDRRAVNDAIRAFAKTEFGANHA
FT                   YVFAIHDDEAHPHGHLCVKALGLDGSRLNPRKADLQRWRERFAEALREQGIEANATPRR
FT                   ARSNTHTTVKQATRHAAKRGKSTKAAERERCTPSGVSRAIRNGYGHIAKALAAGDIEDK
FT                   SLALEIVRFLDPSQDTTLQVPQRSQRSTEVTKYAHRLDGTNHPDTGDLSR"
FT   CDS_pept        complement(join(389158..389295,389295..389699))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BAV0379"
FT                   /product="putative plasmid-related protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAJ47982.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ297913.2"
FT                   /inference="protein motif:Prosite:pseudogene"
FT   misc_feature    complement(389436..389513)
FT                   /locus_tag="BAV0380"
FT                   /inference="profile:HMMPfam:PF01402"
FT   CDS_pept        complement(389696..390706)
FT                   /transl_table=11
FT                   /locus_tag="BAV0381"
FT                   /product="putative plasmid-related protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47983"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZD4"
FT                   /protein_id="CAJ47983.1"
FT                   /translation="MSRQRTINDQIWRSNRLSGCTVEDRYALFYFLTSPFSNVIGAYEI
FT                   VIRVAASEMGWDPDLQLMPVMRRLIDAGILDFDPQANYIWIKDWWDHNSAKMAVATTLR
FT                   KKTLEQIAALPQGWRDAYVNDFIDRLPTEDPLRNTVAKALGYGPYRLSTPYAGPDDGRT
FT                   SIPAEPKDIHRNQSISNGHTPATAYLEAMGRGPGNTTTNTNPIYNPTTTTRTDDGLQYP
FT                   TALVPAEKLSIQNLLTDVQSVDAQALLDELDGAIKTPGTIRKTKVAYFKGILERHRTGG
FT                   FVPSAGIPIATRRERLAATQDMSRASESAPLSKAESQARLQEIKAQLELHTRMPK"
FT   CDS_pept        complement(390703..390972)
FT                   /transl_table=11
FT                   /locus_tag="BAV0382"
FT                   /product="putative plasmid-related protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47984"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZD2"
FT                   /protein_id="CAJ47984.1"
FT                   /translation="MTTGEYLLGRFGPLMSIVDVATLLGRSPDGVRVALYTDTDFSRKL
FT                   KPAMLRVGRRVYFRTLQVTEALNLEQPADDEITLAEAATRGPRA"
FT   CDS_pept        391398..392078
FT                   /transl_table=11
FT                   /locus_tag="BAV0383"
FT                   /product="serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47985"
FT                   /db_xref="GOA:Q2KZC9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041786"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZC9"
FT                   /inference="similar to sequence:UniProtKB:P03772"
FT                   /inference="similar to sequence:UniProtKB:P55799"
FT                   /inference="profile:HMMPfam:PF00149"
FT                   /protein_id="CAJ47985.1"
FT                   /translation="MTSGNVRVRRFQLNANGRDFAVGDIHGHFGRLEAALAAVKFSPEK
FT                   DRLFSVGDLVDRGPESADVLKWLKRPWFHAICGNHDLMTWRRARGNPIPDVDHRAHDGG
FT                   WLDACVAGVRERIAACLRALPLAIEVETPSGVVGMVHADFPYDDWQAIHGATFSPEDED
FT                   ACLWSIDRYRMQYSQPVRNVRAVVHGHMTLRKPAQLGNVYYIDTGGWQDAGMFTLLDLH
FT                   TLKS"
FT   CDS_pept        complement(392184..392498)
FT                   /transl_table=11
FT                   /locus_tag="BAV0384"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47986"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZC6"
FT                   /inference="similar to sequence:UniProtKB:Q06126"
FT                   /protein_id="CAJ47986.1"
FT                   /translation="MTFSILKDDLKALWDYRHLGYAKRFWQDSYERAMSSGIEPLCQFA
FT                   RRLRTYLPDILAHARWPPGTNLVEGINNRIKAIKPRAYGLRNDHYFFLKIRATFPGNRR
FT                   "
FT   CDS_pept        complement(392900..396034)
FT                   /transl_table=11
FT                   /locus_tag="BAV0385"
FT                   /product="restriction-modification system, endonuclease
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47987"
FT                   /db_xref="GOA:Q2KZC4"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZC4"
FT                   /inference="similar to DNA sequence:INSDC:AE014812.1"
FT                   /inference="similar to DNA sequence:INSDC:AF013165.1"
FT                   /inference="profile:HMMPfam:PF04851"
FT                   /inference="profile:HMMPfam:PF04313"
FT                   /protein_id="CAJ47987.1"
FT                   /translation="MTNFAKESEFEAAVIHELRQRGWGELEVIKCPSEADLLANWKKIL
FT                   FENNRGKDRLNEVPLTDSEMQQVMEQIVALRTPLKLNGFINGKTVAITRDNPADTLHFG
FT                   KEVSLKVYDRHEIAAGQSRYQIAQQPRYARASELQHDRRGDLLLLINGMPVIHIELKKS
FT                   GVPVSQAYNQIQKYARESVFTGLFSLVQIFVAMEPEEALYFANPGPDGKFNKDYAFHWA
FT                   DFNNEPITGWKRFTQELLSIPMAHQLIGFYTVADEADGVLKVMRSYQYYAAHAISDKVA
FT                   KTDWKNPNRLGGYIWHTTGSGKTMTSFKSAQLIANSKDADKVVFLLDRVELGTQTLKAY
FT                   RDFAGDSNQVQATENTGVLVKTLKSTAPADTLIVTSIQKMSRITDDADGLKAHDLENMR
FT                   GKRIVFIVDECHRSTFGDMLAKIKASFSGAVFFGFSGTPIHKENVRKDNTTTDVFGDEL
FT                   HRYSIADGIRDKNVLGFDPYQVLTYRDRDLRQAVALDRAKAATVAEALADAAKKKVFNR
FT                   YMNDVRMAGYRDAAGEYQRGIEDYLPNTQYERDEHRNAVVEDIADNWEVLSQGGKFHAI
FT                   FATSSITEAITYYRLMKAQCPALRITALFDPHISDEDGGSTDSAFKAAGLEEIIKDYNA
FT                   AYGQKFDMGTHANFKKDLAARLAHKVPYIRVEAEQEKRLDLLIVVNQMLTGFDSKWINT
FT                   LYCDKLLDYENIIQAFSRTNRLFGPDKPFGTIRYYRKPHTMKRNVDAAVKLYSGDKPIS
FT                   LFADQLPRNLERLNDCFTEISAIFSVSGITDFAKLPDDLAARAVFAKQFNLFSAILEAA
FT                   KIQGFTWDQSVYEFDTEPKQSIVVVITKLQYLTLLQRYKELGAGGGGAGETIPFDIDSH
FT                   ITEIDTGKIDADYMNSRFAKYLKELQSGDEPSKEVTLAELHRSFTSLSQEDQKLAEIFL
FT                   HDIQRGDVQIDPARTFRDYLTDYKTAAKDKEVAAIVSALGVHAAKLIALMSTHLTEANL
FT                   NEYGRFDDLRGTVDQEKAKAYFDGLEGVSLPIFKVKIKAAKLLSDFLLRGGVEGS"
FT   CDS_pept        complement(396052..397290)
FT                   /transl_table=11
FT                   /locus_tag="BAV0386"
FT                   /product="restriction modification system, specificity
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47988"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZC1"
FT                   /inference="similar to DNA sequence:INSDC:U90222.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ315964.1"
FT                   /protein_id="CAJ47988.1"
FT                   /translation="MADQIAGKVPRIRFKAYSEPWAEEKIGDVLAEKRRPIVLEDDQRY
FT                   ELITVKRRNEGVVSRGHLLGRDILVKNYAQLKAGDFVISKRQVVHGATGIVPPALDGAI
FT                   VSNEYLVAVDSERLRTEFLTIVASLPAMRRKFVLSSYGVDIEKLFFDAADWKKRDIPIP
FT                   CTKEQTDISGYFQALKHIIEFHQQKHGKIQALKQALLQKMFPRSGAATPELRFKGFSGN
FT                   WAIERLGQVGRTQSGIGFPDTEQGGKVGTPFFKISDMSLAGNENEMLTANNYVNDAQLQ
FT                   RNRWVPIGDVPAVVFAKVGAALMLNRKRMVRSPFLIDNNAMAYIFDSTWDEDFGKALFD
FT                   TIYLPKYAQVGALPSYNGSDIEGITVHRPKDRLEQKQIGGFFKLLDTLISKHATQLHKL
FT                   KQVESACREVMFV"
FT   CDS_pept        complement(397292..>400066)
FT                   /transl_table=11
FT                   /locus_tag="BAV0387"
FT                   /product="restriction-modification system, modification
FT                   (methylase) subunit"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47989"
FT                   /db_xref="GOA:Q2KZB8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZB8"
FT                   /inference="similar to DNA sequence:INSDC:AE014812.1"
FT                   /inference="similar to DNA sequence:INSDC:AF013165.1"
FT                   /inference="profile:HMMPfam:PF02384"
FT                   /inference="profile:HMMPfam:PF02506"
FT                   /protein_id="CAJ47989.1"
FT                   /translation="VNKQQLAAKIWESANQMRSKIEANEYKDYILGFIFYKYLSDRLVA
FT                   FASAEDFTDEDFSAVTEEDTETVEHFKSNLGYFIAHKHLFSTWLDQTSDFTVGDVREAL
FT                   SAFSRLIHPNHKRLFEGIFKTLETGLSKLGDTAAKQTKAIGDLLQLIKDIPMDGKQGYD
FT                   VLGFIYEYLIGMFAASAGKKAGEFYTPHEVSVLMSEVIAHHLKDRETIQIYDSTSGSGS
FT                   LLLNIGQAIAKHMGDKDSIKYYAQELKENTYNLTRMNLVMRGILPGNIVTRNADTLEDD
FT                   WPYFDEQDPVNSYNPLYLDAVVSNPPYSQKWDPLHKDADPRYARFGLAPKSKADYAFLL
FT                   HDLYHLKPNGIMAIVLPHGVLFRGGEEGVIRKQLIENDHLETIIGLPSNIFFGTGIPTV
FT                   ILVLRQKRESSDVLFVDASKGFAKEGKNNKLRACDIKKITDVVIARATVPGFSRLVPKT
FT                   ELQGEANDYNLNIPRYVDSSEPPESWDLYTSMFGGIPLSELDALSDFWKAFPNLRTALF
FT                   AVDGTPYAQPKADDLAEAVRQHPEVKQFSQSFTRAFDGFKPWLHTELIGKMLTLQVPRQ
FT                   EALICEELFARLAKVGTVPLIDKYRAYQVLDDHWQPIAVDLEVLQTEGFGAARVVDPNF
FT                   VVKKKDGKEVEVQEGWKGRILPFELVQKTHFSAELLTLHQSGSRLDEISATLAEIIESL
FT                   SEADGEYSVLNSSNDKFALAEVKNELKDQLGDIVTDEIKTLQAYLGLVATSASKQDKLA
FT                   FIAKHNEVNWAQIHTNKDGTFGKSKVEARIVELQSEVDFPDDTFAAKLIKALALLDEEK
FT                   ELKDLQRERAAALHQKTKSTIESLTDRQVHELLASKWIAPMVDELHRLPGLVMDGLIGK
FT                   LETLVEKYRITYADNARDIQQAEDALVSMLGELDGGEFDLKGIEELKTLLAGN"
FT   misc_feature    complement(399143..399163)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        complement(400528..401154)
FT                   /transl_table=11
FT                   /locus_tag="BAV0388"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47990"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZB6"
FT                   /inference="similar to DNA sequence:INSDC:BX640438.1"
FT                   /inference="similar to DNA sequence:INSDC:BX640424.1"
FT                   /protein_id="CAJ47990.1"
FT                   /translation="MHTAIKIVAISSLALTLAACGSAKDANKSNFSKAIQAYLDTQKGL
FT                   CAAIPAKGLPFTLANQDMLGGQSKKRADALVDAGLLTKRDTEVKAMFGNKMEPATEYQI
FT                   TDTGKKFLVANGANTMAGQDAFCTGKYTVVEVSNFTEPSDMMGVKLSQVNYRYKVEGAD
FT                   DWAKSESMRANYKNFAEQTQGDIQGKAAVILTNDGWMHERLFKRG"
FT   sig_peptide     complement(<401082..401154)
FT                   /locus_tag="BAV0388"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(401095..401127)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(join(401216..401992,401994..402344))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BAV0389"
FT                   /product="Putative integrase (pseudogene)"
FT                   /db_xref="PSEUDO:CAJ47991.1"
FT                   /inference="similar to DNA sequence:INSDC:AE016857.1"
FT                   /inference="similar to DNA sequence:INSDC:U82619.2"
FT                   /inference="protein motif:Prosite:Pseudogene"
FT                   /inference="profile:HMMPfam:PF00589"
FT   repeat_region   complement(402479..402535)
FT                   /note="Duplication of the 3' region of tRNA Leu following
FT                   prophage insertion"
FT   misc_feature    complement(402536..443683)
FT                   /note="prophage 1. Shares few genes (on the right arm) with
FT                   the Bordetella phage that undergoes tropism switching"
FT   CDS_pept        complement(402633..403667)
FT                   /transl_table=11
FT                   /locus_tag="BAV0391"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47992"
FT                   /db_xref="GOA:Q2KZB2"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZB2"
FT                   /inference="similar to DNA sequence:INSDC:AE016788.1"
FT                   /inference="similar to DNA sequence:INSDC:AE004060.1"
FT                   /protein_id="CAJ47992.1"
FT                   /translation="MTNKYPNLRSHTRRRKGGKVVTYYFFDRRAAGEKDIPLGTDYDSA
FT                   LEKWAEISKGGPRIAGTLEQAFQAWEADKVTGLGSYTNADTLRDYTRALRKLRPVFGTA
FT                   TWEAVEFTHLTIYLRKRTAKTRANREIATLQVIWNWARKEGMHNVNWPAAGMEKSRWRN
FT                   KEKARDFEVSDELFEAIYYAGDDLLRDCMDVASATGMRIKDTINVMMPEGDILRLQSSK
FT                   TGKKADFDVSLSAVLPDLIRRRRKVKATHSMLLTTPTGRVVTYAMLRARWEFAREYAAI
FT                   NAEAAGEQSLADDLRAMFLRDMRRYASNIAATDEEASQLLQHSSVSLTRKHYRTKATQL
FT                   KAVR"
FT   CDS_pept        complement(403664..403870)
FT                   /transl_table=11
FT                   /locus_tag="BAV0392"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47993"
FT                   /db_xref="InterPro:IPR025319"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZB0"
FT                   /inference="similar to sequence:UniProtKB:P12552"
FT                   /inference="similar to sequence:UniProtKB:Q7M299"
FT                   /protein_id="CAJ47993.1"
FT                   /translation="MAEFLTQDDLRELTGYSRAKEQRQMLDKEGIPYKALGGRTIVLAS
FT                   HISAWIEGRSVTRHSAPDMSMIT"
FT   CDS_pept        complement(403960..404547)
FT                   /transl_table=11
FT                   /locus_tag="BAV0393"
FT                   /product="putative phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47994"
FT                   /db_xref="InterPro:IPR019908"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZA8"
FT                   /inference="similar to DNA sequence:INSDC:AF165214.1"
FT                   /protein_id="CAJ47994.1"
FT                   /translation="MTPNTKQTVLEPCPFCGCASAYFERIGTPFQSCVVECGDCGARLE
FT                   ANEEGQDCGNAWNSRAEPASHPWPSKPTPAMIDAMRVGSRKDYPSDELCRVRYAALRSA
FT                   ALTVTATGKTGIPVSEKNQALSSDERAAVRNAALDEAAAVAKRISDKYAYGYYGQPADA
FT                   ADEIEREIRALKSVVPPTQQPAPTGIVADEHC"
FT   CDS_pept        complement(404730..>405026)
FT                   /transl_table=11
FT                   /locus_tag="BAV0394"
FT                   /product="Hypothetical phage protein"
FT                   /note="start codon not provided"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47995"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZA6"
FT                   /protein_id="CAJ47995.1"
FT                   /translation="VMGKDFIPRPACTVASGDCLYAGRCLLQCTTRLTAAAANEKLTEA
FT                   LALLSKLREYTISFRSVTLYVDGSEIDAAVRKAGQLLNASRRSAAPSIQGEGR"
FT   CDS_pept        complement(405023..405883)
FT                   /transl_table=11
FT                   /locus_tag="BAV0395"
FT                   /product="Hypothetical phage protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47996"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZA4"
FT                   /inference="similar to DNA sequence:INSDC:BX640442.1"
FT                   /protein_id="CAJ47996.1"
FT                   /translation="MTNQAIPHGWRLVPAEMTLDMSIAFAEAWYSKRRVIDDHEMQDAY
FT                   AAMLAAAPGQPASDTYQLPSPAVSAEPVGRNNSKHPIPDDLRRRFSQLEDTASDTGAMK
FT                   MFTDMRTTVQAYFAATPAADERANVGKVLPEWEQVSAKLECGETLTPLEVFVHYNEPAG
FT                   DDADAWRDQLSAALASAPVVNPTLPLERALHGLISKICPGLDTGEILQDARWASAALSD
FT                   IMANTPAADARDALISSIQSAVNEMKFDNFNATKRQMEFIKAGARRVIAEVNAAIAAQQ
FT                   GKGGE"
FT   CDS_pept        complement(405880..406782)
FT                   /transl_table=11
FT                   /locus_tag="BAV0396"
FT                   /product="Putative phage-related recombination associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47997"
FT                   /db_xref="GOA:Q2KZA2"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZA2"
FT                   /inference="similar to sequence:UniProtKB:P36767"
FT                   /inference="similar to DNA sequence:INSDC:AY133112.1"
FT                   /inference="similar to DNA sequence:INSDC:AF234173.1"
FT                   /inference="profile:HMMPfam:PF04381"
FT                   /protein_id="CAJ47997.1"
FT                   /translation="MWFKNLKVYRLSGAWSCLGETLEAALAKHAYQPGNNLEMQRLGWV
FT                   SPRENGQLAHVVNGQILLVLRSEKKLLPSTVVSQVARARAQEIEEQQGYKPGRKQMKEI
FT                   KERVTEELLPRALSVYRDTRVWIDTQHRWLVIDAASSARADEVIGLLVKTVDPLPLENL
FT                   YVAQSPAAAMTGWLAEDEAPANFTIDQDTELRASGESRAAVRYVKHSIDTDDARKHIQS
FT                   GKQCTRLAMTWADRVSFVLTESLNIKRVTPLDVLKERPDDLSTNADERFDSDFALMTGE
FT                   LARLLADLIDALGGEKEST"
FT   CDS_pept        complement(406794..407114)
FT                   /transl_table=11
FT                   /locus_tag="BAV0397"
FT                   /product="Hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47998"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZA0"
FT                   /inference="similar to DNA sequence:INSDC:AF369303.1"
FT                   /protein_id="CAJ47998.1"
FT                   /translation="MPGFVVLGVRPGRIDQLISTQVSAQERRLKRRTTPEAHALRIEKA
FT                   RARALAAPPQVELSAEYSAPQFAIDWARLAARQGYSFLQVAYKDTDLLTGRTVYQLTEQ
FT                   QP"
FT   CDS_pept        complement(407193..408224)
FT                   /transl_table=11
FT                   /gene="recT"
FT                   /locus_tag="BAV0398"
FT                   /product="phage recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ47999"
FT                   /db_xref="GOA:Q2KZ99"
FT                   /db_xref="InterPro:IPR004590"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ99"
FT                   /inference="similar to sequence:UniProtKB:P33228"
FT                   /inference="similar to DNA sequence:INSDC:AY150271.1"
FT                   /inference="similar to DNA sequence:INSDC:X67865.1"
FT                   /inference="profile:HMMPfam:PF03837"
FT                   /protein_id="CAJ47999.1"
FT                   /translation="MTGPTMSQTTSLADLKKTSKMVASQAGIGQVKAFFDSQKSTLAAV
FT                   LPRHVSADRMLKIALGALRTTPKLMGCTVESLMGAVVQCSQLGLEPNTPLGHAYLIPFE
FT                   KRRKQGNDWVTDKIEVQIVLGYKGLIDLARRSGQIVSIAAHAVHENDHFEYAYGLDEKL
FT                   EHKPAMGERGAIIAFYAVAKLVGGGHAFEVMSEQQIIEIRNASQGWQQAVRAKKTDASP
FT                   WGAHFAEMGRKTVLRRLFKYLPVSIELANAAALDELNARGESQALDNVLEGEYITPAPG
FT                   DDDAAPAAITYDPSPLFQQIADAANLDALDLVGDSLRDVPDEHYDALQRAYQNRRAELT
FT                   PAD"
FT   CDS_pept        complement(408221..409075)
FT                   /transl_table=11
FT                   /locus_tag="BAV0399"
FT                   /product="phage-related exonuclease"
FT                   /note="Also similar to the C-terminal region of Escherichia
FT                   coli exodeoxyribonuclease VIII, recE; length 866 aa;
FT                   id=37.4; ungapped id=41.1; E()=1.5e-25; ; 278 aa overlap;
FT                   query 14-280 aa; subject 597-860 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48000"
FT                   /db_xref="GOA:Q2KZ96"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR024432"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ96"
FT                   /inference="similar to DNA sequence:INSDC:AY129333.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ277755.1"
FT                   /protein_id="CAJ48000.1"
FT                   /translation="MDAITEAARLIDAPCVIKGQPIEQYHGGPGISKTGLDRINVSPAN
FT                   FYDLTMNPARPPEPQRKGQLEGQLAHCAILEPEEFATRYAVGPDVIRSTKEWKAFEAAL
FT                   PAGVIGIKPDQRETAMRQAEAVRRLPDVAEALAAGVAESSAYWIDQETGVLCRCRPDWC
FT                   HPAGESGVILLDVKTFSDASPHEFSRQIARKRYHVQDAFYTDGYAAASGKSVLAFIFVA
FT                   VQDAWPFAASAVMLDPRSQDQGRRDYRRNLSTYADCLTSGNWPGFGQGIHLASLPNWAF
FT                   NDE"
FT   CDS_pept        complement(409079..409264)
FT                   /transl_table=11
FT                   /locus_tag="BAV0400"
FT                   /product="Putative phage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48001"
FT                   /db_xref="GOA:Q2KZ94"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ94"
FT                   /inference="similar to DNA sequence:INSDC:BX640412.1"
FT                   /inference="similar to DNA sequence:INSDC:BX640443.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48001.1"
FT                   /translation="MIRRALAYLHAKRLDLDLAGYAAMVAALAMATGLIGPTLDAHQST
FT                   LTACEGCGKTAYAAKD"
FT   misc_feature    complement(409100..409123)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(409261..409563)
FT                   /transl_table=11
FT                   /locus_tag="BAV0401"
FT                   /product="Hypothetical phage protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48002"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ91"
FT                   /protein_id="CAJ48002.1"
FT                   /translation="MPGEIMLHYPELTDQQIIDALYELFAGEADIAFGQDREWWADAII
FT                   DGGHDALCRIALTALSTTPVPEYVIQTQRELRADLIGIARLLMGKAHAEGREIHA"
FT   CDS_pept        complement(409618..410367)
FT                   /transl_table=11
FT                   /locus_tag="BAV0402"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48003"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ88"
FT                   /inference="similar to DNA sequence:INSDC:AJ414151.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ560763.1"
FT                   /inference="profile:HMMPfam:PF02498"
FT                   /protein_id="CAJ48003.1"
FT                   /translation="MSQSALAFQPDSTAFNFESHVVRVVVINGEPWFIAADLCKALKLS
FT                   NPSESLKALDDDEKMTLSSTEGHSGKRGGAQFQSVISESGMYTLVLRCRDAVKPGTLPH
FT                   RFRKWVTAEVLPTIRKTGSYGTPRIDPAELLLSGQSDLTIDLPDNVQAALNARAGVLAG
FT                   EAFTLIREHLRRRIAYRAVSGRPSSVNEPKALRVIAEGDLGEALAHGLILKVQHLLSHA
FT                   DYCITLSNQFFAGLQDTLRDLGCTRSH"
FT   CDS_pept        410720..410983
FT                   /transl_table=11
FT                   /locus_tag="BAV0403"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48004"
FT                   /db_xref="GOA:Q2KZ86"
FT                   /db_xref="InterPro:IPR024461"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ86"
FT                   /inference="similar to DNA sequence:INSDC:AE012559.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48004.1"
FT                   /translation="MSIVTFDTHKFIKTLEAAGLSEAQAEAFARAQQEMLSDVLNTSLA
FT                   TKMDMNRIEMKLTEHDGEFKLVRWMLGLLMAGVASLILKAFF"
FT   CDS_pept        complement(410984..411109)
FT                   /transl_table=11
FT                   /locus_tag="BAV0404"
FT                   /product="Hypothetical phage protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48005"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ84"
FT                   /protein_id="CAJ48005.1"
FT                   /translation="MTKINDGGPAFPRDERYLGHNRGDLRQRIERRLIDLAKDAA"
FT   CDS_pept        complement(411161..>411385)
FT                   /transl_table=11
FT                   /locus_tag="BAV0405"
FT                   /product="Hypothetical phage protein"
FT                   /note="start codon not provided"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ82"
FT                   /protein_id="CAJ48006.1"
FT                   /translation="VAYKAVTVEISLDEFDDEEIIGEAEIRGLIGDTLGARLGAQRQEM
FT                   LRALWNHDDAKAVELLKTYLCDCLGRATI"
FT   CDS_pept        complement(411417..>411509)
FT                   /transl_table=11
FT                   /locus_tag="BAV0406"
FT                   /product="Hypothetical phage protein"
FT                   /note="start codon not provided"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48007"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ79"
FT                   /protein_id="CAJ48007.1"
FT                   /translation="VQVGSPRQAIVVSWLARIHLPALSKESAYR"
FT   CDS_pept        complement(411608..411739)
FT                   /transl_table=11
FT                   /locus_tag="BAV0407"
FT                   /product="Hypothetical phage protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48008"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ78"
FT                   /protein_id="CAJ48008.1"
FT                   /translation="MLLTPPVGCSSGSIAPTGMAVALRGIPAVSSPPSAVHGETGEA"
FT   sig_peptide     complement(<411670..411739)
FT                   /locus_tag="BAV0407"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        411924..412319
FT                   /transl_table=11
FT                   /locus_tag="BAV0408"
FT                   /product="Hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ76"
FT                   /inference="similar to DNA sequence:INSDC:AE005493.1"
FT                   /protein_id="CAJ48009.1"
FT                   /translation="MAALFVTAALAGCVSSGVRVKDEQISAFVPGQTTKQEVIASLGQP
FT                   TTQMRNADGTSMLMYSYVEAKARPASYIPFVGAFVGGADSSSSVVQLHFDAAGKLLQHS
FT                   SSQSNYGIGTGFAAGSVDSVPDQPRRP"
FT   sig_peptide     411924..>411984
FT                   /locus_tag="BAV0408"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    411930..411962
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(412523..414001)
FT                   /transl_table=11
FT                   /locus_tag="BAV0409"
FT                   /product="Hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48010"
FT                   /db_xref="GOA:Q2KZ74"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ74"
FT                   /inference="similar to DNA sequence:INSDC:AF486551.1"
FT                   /inference="similar to DNA sequence:INSDC:AY316747.1"
FT                   /inference="profile:HMMPfam:PF04326"
FT                   /protein_id="CAJ48010.1"
FT                   /translation="MQQSNTRRAHLRLLIEKLTQRETEAEWFEFKVNNEDPHQIGEYIS
FT                   ALANSTAILGRPAGYVIWGVDNTTHEIVGTDFTPQDARRGGEELEPWLLRSLQPQLNFS
FT                   FIETSIDEKRVVILRIPRATHRPIAFFGEEYIRVGSYKKKLRDTPEKERALWRAFDNVP
FT                   FEKHIALDGLEDAEVTTLLDYPAYFDLTDSELPPNRNSILASMEDEGFITKGDDGLWAV
FT                   TNLGAILFAKKLADFSSLSRKAARVILYRDNGRTDPIKEQIGTKGYAAGFKGMLGYISN
FT                   FIPSNEVVGQAIRADLPMYPPIAIRELVANAIIHQDFGITGAGPMIEIFTDRIEISNPG
FT                   RPLLPVDRLLDKPPRSRNESLASFMRRVGMCEERGSGIDRVVASTESYQLPAPEFMEAD
FT                   DSFRATLFAHRPYAKMDRADKVRACYLHACLRYVLRDYMTNTSLRERFGIAQANSAIVS
FT                   RLIKEAVDMGLICPHDENSGKRFVKYVPSWAKRN"
FT   CDS_pept        complement(414160..415113)
FT                   /transl_table=11
FT                   /locus_tag="BAV0410"
FT                   /product="Putative phage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48011"
FT                   /db_xref="GOA:Q2KZ72"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ72"
FT                   /inference="similar to DNA sequence:INSDC:BX640443.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ560763.1"
FT                   /inference="profile:HMMPfam:PF00717"
FT                   /protein_id="CAJ48011.1"
FT                   /translation="MDTAPMKKRSINDILAANLSRLMDKHGHKQASLAKLSGIGQTTIS
FT                   LYLNPDRRQPSKSGKLPSAKLSEVEVLAEVLGVSPWELLTPHDHAQPNSAAADSHAQAP
FT                   KRGTPIDMDAVADEFPMRIPGLPPGPSQIDEPAPAYVAPRLSLEQAVAVNVAPGEHHAA
FT                   NDKFEKVPELADVRLAAGEGIENHTEEMTGFVQFRRSFLRAVGADGGRGRVVYAKGDSM
FT                   EPIIRDGAALLVAIDQSLTLHDVAAGGVYAINYDGKMLVKTVAKDRLTGRWVARSFNAQ
FT                   HPDIPLEGNGLVRVLGRVVWAGARLGGDEAGQWVRS"
FT   CDS_pept        complement(415990..416280)
FT                   /transl_table=11
FT                   /locus_tag="BAV0411"
FT                   /product="Hypothetical phage protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48012"
FT                   /db_xref="InterPro:IPR025730"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ70"
FT                   /protein_id="CAJ48012.1"
FT                   /translation="MDCHTTTLSKKEPTMNENEIPLFPVAAWEVGPLPTIGLAAIKFDF
FT                   LTNPSQPLQEANPGRHYVLTPIQLRALIRKLEETLHVLETSEPTAPQGPQH"
FT   CDS_pept        416468..416932
FT                   /transl_table=11
FT                   /locus_tag="BAV0412"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48013"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ69"
FT                   /inference="similar to DNA sequence:INSDC:AF447491.1"
FT                   /protein_id="CAJ48013.1"
FT                   /translation="MRRPIKQSHRALFLALQADAKEYPGGIRAIAESMGMNGNTLANGI
FT                   NPDNEVAPPSFGVIVEIIVLAQARRAVFALAQMVGQVPMDIELEPGDPRESVQLFLSLV
FT                   SSASNLLGVGSEAAKDGRFCAQERRALEPLLLALMKSTGELLQVVRGGAL"
FT   misc_feature    416495..416626
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00041"
FT   CDS_pept        <416929..417180
FT                   /transl_table=11
FT                   /locus_tag="BAV0412A"
FT                   /product="phage-related protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0412A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48014"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ67"
FT                   /inference="similar to DNA sequence:INSDC:AY349011.1"
FT                   /protein_id="CAJ48014.1"
FT                   /translation="VIARATGFRGRRMKGGPLARLAGQLCARRDFQVFCCARTPDEAAA
FT                   FIRHVCGVQSRADLDHNTQARDRFHTLIRRPFAYRTGR"
FT   CDS_pept        417177..418001
FT                   /transl_table=11
FT                   /locus_tag="BAV0413"
FT                   /product="Hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48015"
FT                   /db_xref="InterPro:IPR010781"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ64"
FT                   /inference="similar to DNA sequence:INSDC:AF447491.1"
FT                   /inference="similar to DNA sequence:INSDC:AE008819.1"
FT                   /inference="profile:HMMPfam:PF07120"
FT                   /protein_id="CAJ48015.1"
FT                   /translation="MNYYPHHIGDFNSATRHLTRLERSVYRDMLDLYYDTEQPLTRDIG
FT                   ALCRLLIARSNEERTAVEQVLNEFFTETEQGWRHSRCEAEIERYHAQREAKSAAGKASA
FT                   AKRAQKTQRPINTSSTAVQQPYNDCATNQNQNQNQNQNQKPIKETPPNPRKRGQSFDAA
FT                   AIDLPDWLDREAWAAWVADRKARKKPITEKAAELQIKQLADLMRQGHAPAAVIAHSIAS
FT                   GYQGLFAPSALNRATPTGKAQRLADWNDELRDVLAEGGRPTEIFMGTIDATH"
FT   CDS_pept        417988..418686
FT                   /transl_table=11
FT                   /locus_tag="BAV0414"
FT                   /product="Hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ62"
FT                   /inference="similar to DNA sequence:INSDC:AL646065.1"
FT                   /protein_id="CAJ48016.1"
FT                   /translation="MQLTDHHMTSLGALVINEMRLMYGTKFGQQWQGLTARELKDSWDQ
FT                   KLSGLTEREVRTGLTACLTRDWPPSLPEFLRLCRPWMNPEVAYHEAVVGMASRRRGDMG
FT                   TWSHPAIYWAAVYVGPHDLLNSTYSVMKTRWERAFGNELAKGQWHGIPEVLEVLPAPGQ
FT                   TQATREEAAAALKAMDADKVFEPKRSRDPRGWAKKILDEQGRKGGKRYAFATLTLAKRA
FT                   LGLELNPGEA"
FT   CDS_pept        418683..419054
FT                   /transl_table=11
FT                   /locus_tag="BAV0415"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48017"
FT                   /db_xref="GOA:Q2KZ60"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ60"
FT                   /inference="similar to DNA sequence:INSDC:AY055382.1"
FT                   /inference="similar to DNA sequence:INSDC:AY129333.1"
FT                   /protein_id="CAJ48017.1"
FT                   /translation="MISLLLPWPPKELSPNFRGHWASISRAKKVYRIAACLTTMRALRH
FT                   AERFDRLGGVRITYEFCPPTARAYDRDNLAARMKAATDGISDALGMNDRGFHFAPVAIG
FT                   SKEKGGLVRVTIESLKEGV"
FT   CDS_pept        419215..419481
FT                   /transl_table=11
FT                   /locus_tag="BAV0416"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48018"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ58"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /protein_id="CAJ48018.1"
FT                   /translation="MAFPRLIGEGARTKAVTVNDAGLRVGEDHPNAKLTDGEVERIRSL
FT                   HEDGLSYQTLAEKFEISKGAVAKICRYERRGQFAVRVKIVPVR"
FT   CDS_pept        419563..420075
FT                   /transl_table=11
FT                   /locus_tag="BAV0417"
FT                   /product="Putative phage terminase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48019"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ56"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="similar to DNA sequence:INSDC:AF335538.1"
FT                   /protein_id="CAJ48019.1"
FT                   /translation="MKKVSTYTEAIATEICDRIADGEPLRQICRDQHMPAWRTVYHWIE
FT                   ARSKFAERMERARRVGFDAIAEEALEIANTPQIGEETEQEGSKFRVKRGDMLGHRKLQV
FT                   ETRLKLLAKWHPTKYGDKTSMELTGAGGGPVRIDETQAAARLCALAAIARARRVSQEAD
FT                   DPAGGLV"
FT   CDS_pept        <420075..421613
FT                   /transl_table=11
FT                   /locus_tag="BAV0418"
FT                   /product="Putative phage terminase large subunit"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48020"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ54"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="similar to DNA sequence:INSDC:AF071201.1"
FT                   /protein_id="CAJ48020.1"
FT                   /translation="VDMDLSVAEVRDLLPYLTPAERAELDAILVADMARVLWRPLPGPQ
FT                   RMAYESQADITGYGGAAGGGKTDLAVGLTLTAHDRTLFMRREKAQSEGFVQRLAEVLGN
FT                   TEGYNSQKGFWRLPGGRLCEVGGLDNPGDENRWRGRPHDLIVLDEATELREHQARFVLG
FT                   WNRTTKAGQRCRVLMTFNPPTTVEGRWVVEYFAPWLDPKHPHPAKPGELRWFAVIDGKE
FT                   VEVEGGAPFAHNGETIVPRSRTFIPSRIADNPFLMGTGYESVLQSLPEPLRSQMLYGDF
FT                   NAGIEDDPWQVIPTAWVEAAQARWKRPDRLAPMDSLGLDVARGGRDKTILARRHGWWFD
FT                   EPLVYPGKDTPDGPTVAGLAISALRDHAVIHLDVIGVGASPYDFLVTAKQQVVGVNVAE
FT                   AACGTDKSGRLRFFNRRSELWWRMREALDPIHNTGIALPPDPRLLADLTAPTWSLSGAT
FT                   LKVASREDIIDKIGRSPDFGSAYVLALMDTPKRAAVEALGQARSRLDYDPYARM"
FT   misc_feature    420252..420275
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        <421618..422121
FT                   /transl_table=11
FT                   /locus_tag="BAV0419"
FT                   /product="Putative phage acetyltransferase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48021"
FT                   /db_xref="GOA:Q2KZ52"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ52"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="profile:HMMPfam:PF00583"
FT                   /protein_id="CAJ48021.1"
FT                   /translation="VPVPCAVAVTLRGMETAIVRRVAFAELADASTFASLCAEYAQESA
FT                   NADLAGRAPDHHAYAGMEAAGVAHFLGAFRGEELVGFACLLVTPVPHFQGRLIGTTESI
FT                   FVAAAHRPGGAGIALLRATEALARDLGATGLYVSGPAGGRLVRLLPAAGYRETNRTFYR
FT                   GLYA"
FT   CDS_pept        422118..422576
FT                   /transl_table=11
FT                   /locus_tag="BAV0420"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48022"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ50"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /protein_id="CAJ48022.1"
FT                   /translation="MTTLVASGLHLPAMSVEAIERVRRLEGALAKLPQVEIPTAHLFHA
FT                   GVYARTIRIPAGVVLTGALIKVSTVLIFSGHATVFIGGKAVELHGYHVIPGSAGRKQAF
FT                   VAHADTDLTMLFPSEARSVAEAEAQFTDEADLLLSHQQGAGTITFTGE"
FT   CDS_pept        422697..422957
FT                   /transl_table=11
FT                   /locus_tag="BAV0421"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48023"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ49"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /protein_id="CAJ48023.1"
FT                   /translation="MQGQQVRAQAKAQQSAQQQAQRQAQQQAAQAQQAMNRANQRQPDA
FT                   QRALSAIGGAARAGQSGTMLTGPQGVDQAALTLGKSTLLGQ"
FT   misc_feature    422916..422939
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        <422959..424626
FT                   /transl_table=11
FT                   /locus_tag="BAV0422"
FT                   /product="Putative phage head-tail connector protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48024"
FT                   /db_xref="InterPro:IPR020991"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ47"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="similar to DNA sequence:INSDC:AY150271.1"
FT                   /protein_id="CAJ48024.1"
FT                   /translation="VAEQTERKLLLSRWGQLKAERESWISHWKEISDYLLPRSGRFFIN
FT                   DRNRGGKRHNNILDNTGTRALRVLAAGMMAGMTSPARPWFRLTTSIPELDESAAVKAWL
FT                   ANVTRLMLMVFAKSNTYRALHSTYEELGLFGTASSIVLPDFKDVIRHHTLSAGEYAIAA
FT                   DNQGRVDTLYREFQITVAQMVREFGKDKCSTTVRNLFDRGALEQWVTVIHAIEPRADRD
FT                   PNKRDDRNMAWKSVYVELGADETRTLRESGYRSFRALCPRWALAGGDIYGNSPAMEALG
FT                   DVRQLQHEQLRKAQGIDYKSNPPLQLPVSAKNQDISTVPGGLSYVDVAAPNGGIRTAFE
FT                   VNLDLSHLLADIVDVRERIKASFYADLFLMLANGTNPKMTATEVAERHEEKLLMLGPVL
FT                   ERMHNEILDPLIELTFQRMVEANILPPPPQEMQGVDLNVEFVSMLAQAQRAIATNSVDR
FT                   FVGNLGVVAKIKPEVLDKFNADRWADTYADMLGIDPELIVPGNQVALIRKQRAEQQQAA
FT                   QQAALLNQGADTAAKLGSVDTSKQNALTDVTRAFSGYT"
FT   CDS_pept        424713..425060
FT                   /transl_table=11
FT                   /locus_tag="BAV0423"
FT                   /product="Hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48025"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ45"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="similar to DNA sequence:INSDC:AY150271.1"
FT                   /protein_id="CAJ48025.1"
FT                   /translation="MSYEDPTDIRRQERAQADTDLRRRLVQDAEEADFKWLMGSKRGRR
FT                   IVWRFLERAGVYRLSFNTNAMAMAFAEGNRNEGLRILAQIHTLCPELYAVMVKEQNRDN
FT                   RNADDASYNDY"
FT   CDS_pept        425035..425709
FT                   /transl_table=11
FT                   /locus_tag="BAV0424"
FT                   /product="Putative phage endoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48026"
FT                   /db_xref="GOA:Q2KZ44"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ44"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="similar to DNA sequence:INSDC:AY150271.1"
FT                   /protein_id="CAJ48026.1"
FT                   /translation="MTQATTTTEGQPASQPAAEQPATGAGDDGQQQQQQPTQEQGAQGQ
FT                   QPAADASKTQGEDKAKPHGATEQYEFQVPEGVALDDGVLGAFSEVARELNLPQDKAQRV
FT                   LDKMLPVMQTRHAEQIGEFYADIGGLPETWVASSTVDKEFGGDKLEENLAMAKKARDAF
FT                   GTPELTTLLNKTGLGNHPEIIRVFYRAGLAISEDRLVVGHNGNPPKQGDAQRLYAASNM
FT                   NP"
FT   CDS_pept        425723..426718
FT                   /transl_table=11
FT                   /locus_tag="BAV0425"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48027"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ42"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="similar to DNA sequence:INSDC:AY150271.1"
FT                   /protein_id="CAJ48027.1"
FT                   /translation="MPTLSNTNPTLADVAARMAPDGKIDPQIVEMLNETNEILEDMTVI
FT                   EANGFTEHKTTIRSGLPTGTWRKLNYGVQPEKSRTVQVKDSMGMLETYAEVDKALADLN
FT                   GNSAAWRLSEDRAFIEGMNQTQASTLFYGDSSIDAEKFMGLTPRFNSLSAENGQNIIDA
FT                   GGTGSDNASIWLTVWGPNTLHTIYPKGSQAGLQSRDLGEDTLVDADGGRYQGYRTHYKW
FT                   DIGLTLRDWRYVVRIANVDVSELTKNASAGADLIDLMIQAVELIPNVGMGRPAFYMPRR
FT                   IRSFLRRQITNKVAASTLTMEEIAGKKVVAFDGIPCRRTDALLLTEARVQ"
FT   CDS_pept        426737..427159
FT                   /transl_table=11
FT                   /locus_tag="BAV0426"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48028"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ41"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="similar to DNA sequence:INSDC:AY150271.1"
FT                   /protein_id="CAJ48028.1"
FT                   /translation="MIIDKLLQVSHQQAITNSAASTDVIDFGQAHPNTGMDDRSKMVIT
FT                   VTESATATGSATVKFAVQDSADNSSFADVAVTAAVGKADLVAGKQVVIPMSTQLRRYCR
FT                   VYYTVDSGPLTAGKFSAQIVMGLQQNVAYPDSPRIA"
FT   CDS_pept        427172..427372
FT                   /transl_table=11
FT                   /locus_tag="BAV0427"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48029"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ38"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /protein_id="CAJ48029.1"
FT                   /translation="MKVTALKPGYFGKLREPGDEFDVPDGAKASWFAPASAAQYAPRIN
FT                   RAPKPDRNPRGSDEKSGGDLV"
FT   CDS_pept        427447..428118
FT                   /transl_table=11
FT                   /locus_tag="BAV0428"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48030"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ36"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="similar to DNA sequence:INSDC:AY150271.1"
FT                   /protein_id="CAJ48030.1"
FT                   /translation="MASEVDICNLALAYLGDEATVAGINPPEGSVQAEYCARFYPFARD
FT                   SLLELHTWGFATKCAQLAAMDISRPEWHFAYAQPADAIKIVAVLPHDAANIEAGIDNAQ
FT                   PFSCEIDDTGADIILSNQVNAVARYISLVKDTTKFSPLFVQALAWHLASMLAGPLLKGD
FT                   VGAAESKRCVSAMQAYLSQAMVSDANQHKTKLTYMPMWMRVRGASFVEGNLPGLPNVWR
FT                   R"
FT   CDS_pept        428118..430163
FT                   /transl_table=11
FT                   /locus_tag="BAV0429"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48031"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ34"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="similar to DNA sequence:INSDC:AE017314.2"
FT                   /protein_id="CAJ48031.1"
FT                   /translation="MSNVRVLQRSFGGGEISPEMFGRIDDVKYQSGLAICRNFVVKPQG
FT                   PVENRAGFSFVREVKDSTKKVRLIPFTYSVTQTMVIELGAGYFRFHTDGGTLLNGDTPY
FT                   EIANPYTEADLFSIHYVQSADVLTLVHPNYAPRELRRIGATDWQLATIAFMSSVAMPTG
FT                   VTATSNNKGTDYTYRYVVTALDAEGKTESAPSSAGICANNLFTNGGANTIAWSAASGAS
FT                   RYNVYKEQGGLYGYIGQTTGTSLVDDNIAPDLSVTPPIYDAVFNAAGDYPAAVSYFEQR
FT                   RCFAGTINKPQNIWMTRSGTESAMSYSLPVRSDDRVAFRVAAREANAIRHIVPLTELLL
FT                   LTSSGEWRVASVNSDAVTPTTISVRPQSYVGATDVQPVVVNNTAIYGAARGGHVRELAY
FT                   NWQANGFVTGDLSLRCAHLFDNLNILDMAYAKAPQPIVWFISSSGKLLGLTYVPEQQIG
FT                   AWHQHDTEGVFESCAVVAEGNEDRLYVVVRRIIGGKEVRYIERMASRQFDAQADAFFVD
FT                   SGLTYSGEPVTHISGLEHLEGKTVSILADGAVHPQRIVTSGAIDLDVQARTVHVGLPIT
FT                   ADMQTLPVTMQLDGSFGQGRVKNINKLWLRVHRSSGIFAGPCVDALTEVKQRTSEPYGS
FT                   PPALKSEEIPLVLSPKWGDSGQLFVRQADPLPLTVVSMTAELAIGA"
FT   misc_feature    428664..428687
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        430175..430768
FT                   /transl_table=11
FT                   /locus_tag="BAV0430"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48032"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ31"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /inference="similar to DNA sequence:INSDC:AY150271.1"
FT                   /protein_id="CAJ48032.1"
FT                   /translation="MSGATFAKALSSLSLGSSVVSLGSGVVGSYYGAKAQKSHLNFQAS
FT                   IADINARIAELGAQQELLRGQQEVGRLTLGAGQLKGQQRAALAASGIDLGEGSAAEVQV
FT                   WTDMLKDIDASTLTANAVRSAWGHRIQGVSLQGEARMIRAQAKGIRPGMSAATSLLESV
FT                   GSVASSWYKHAQHHPDRKIEHDSIDDLASSKGWW"
FT   sig_peptide     430175..>430241
FT                   /locus_tag="BAV0430"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    430187..430216
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00599"
FT   CDS_pept        <430765..432375
FT                   /transl_table=11
FT                   /locus_tag="BAV0431"
FT                   /product="phage protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48033"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ29"
FT                   /inference="similar to DNA sequence:INSDC:AY150271.1"
FT                   /inference="similar to DNA sequence:INSDC:CR378676.1"
FT                   /protein_id="CAJ48033.1"
FT                   /translation="VTVPRVPTYDNLQVTPNGLPQVRLNVPSAPGIAGQQAQQIGAATQ
FT                   QLGNQVAAIAADIQRKASMAEMMEAERELADWQINALYSPDGGALSLRGKAAFGIVKAM
FT                   TERFDSEVQRLSGSFSLPAQRQAFQRLVQSRRTQMQMQLAAHERSESEAYVKGQLQGTL
FT                   QTSLNAAALQFADPQAVEQEIRRSSGVLKAFGVLQGWSEEQTQAAIHAQISEMRSAVAE
FT                   RIIQEDPFKGVEYVQSNISQFNAAEGARLQKVATSTMESKLRLVLAYEDRAQRIRQRQD
FT                   QIIAKQVAMQGDVLLSQGKLSADWIERNRDQLTPQDYRYFYGKLEGSQERTDLSVYAAL
FT                   RARIASGEDVSKEARESLQLGLLKPDDFKRLTEIQEFSSLSGEVPSVYKRGVQYIQNSL
FT                   RVSELNPDPAAAQRQASALNDWDDYLKVNPKISEREAQQEYERIVEEYALADTRQMSLT
FT                   KRMPRYAVGDRQNLDIDATAQRTVEAFRKKHGDDPDAMLADPEYQQQSRLIEEWKAIMA
FT                   KAAAKRVARPSNGERNGRQ"
FT   CDS_pept        432362..435751
FT                   /transl_table=11
FT                   /locus_tag="BAV0432"
FT                   /product="phage-related protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48034"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ27"
FT                   /protein_id="CAJ48034.1"
FT                   /translation="MAGSDDLTSTVMAVREASTSLSAGARLLDQYWPAAPVSSVSRGQR
FT                   SGAWTDVGPDGVMNINIAQEDPPNMVERVAKDVGRGVIELPRSVVGGVRDAVQNTVLEP
FT                   INGLASWLEEQFPLGSIEIGSSGVRHSDESRDFSLPNVPEGETVTGDMVRHVTQFLVGF
FT                   LGPGKLAVTKFAPAARLGTAGRAAVQGAVADFSAFNEHEARLSDLLQEVPAIRNPVTEY
FT                   LASSEDDGFIEGRLKNALEGLGLGVATEGLIRSLKAMRAARIAKRAESEVQATAAAVRP
FT                   EIAQDAFELLGDESAPALATREVGQSRVAGPASDDLDLAEHAAHGIAQPVEPEAYINFA
FT                   RIDAPEDVQNVMQQMADAFKGDVDAARRGEKMTFAQMELSASQEDAFKVLLDRRQGQPL
FT                   NAEQSLAARQLWAASGQKLTEVAKIAADNPSEANLFAFRKMLATHYAIQNEVIAARTET
FT                   ARALASWRIPAGSGMERFAQIENALRSSGDLDLSREMATRIAALSQAGMHRELDQIVRG
FT                   SVWARSRDAFLEAWVNGLLSSPPTHLVNMMSNTSVIFQQMYERAAAAQISRILGVDGGV
FT                   QLGEATAQLFGMLSGFKDALRYSAKSFLTNETGYGMGKIDLPRARAISAEAWGQAKDSP
FT                   LGRSLDVLGAVVTMPGRALGAEDEFFKTLGYRMELNALAVRRATHEVNSGIIRSDQVKE
FT                   RVAAIVSDPPTDLRLEAIDQATYQTFTSAPGELTKAITRGVNSVPLAGRLILPFVRTPA
FT                   NILKYSFERTPLAPLMAHVRADIAAGGARRDIALARITTGSLLMATAADMAMSGVLTGR
FT                   GPSDRRERQAMERSGWQPYSIKVGDRYFAYNRLDPIGTSLGLSADMVEILANMDDDEAL
FT                   GDAEVERTQAAIVMSIANNVMNKTYMSGLAELVTAMSDPQRYGEGYFQRFAGSLVPAGV
FT                   ATAARATDPYALEADTMLERIRSRIPGLTKDLPVRRDLWGEPIAYRSGLGAIYDAVSPI
FT                   YSRREKPSPIDKEMLRLEAFVSAAPRKTGFDGVTINLANYPGAYSRFVELAGRGVKNTF
FT                   GLSAKDYLDAVVTGKHVMSAVYERLGDGPDGGKADFIRKTINDFRALAKKQLLEEYPAI
FT                   KVDVAAKKRAIQQEKLDALMGR"
FT   CDS_pept        435912..437024
FT                   /transl_table=11
FT                   /locus_tag="BAV0433"
FT                   /product="Putative phage tail fibre protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ26"
FT                   /inference="similar to DNA sequence:INSDC:AY150271.1"
FT                   /inference="similar to DNA sequence:INSDC:AY029185.2"
FT                   /protein_id="CAJ48035.1"
FT                   /translation="MSVQSTHRVAGPYACNGLTKQFPFDFKVFSADEVVAILSDADGVE
FT                   STLNLGTDYAVALNDNQNANPGGSLTTQQVYGAGYRVTLTSGVTNTQPQTLTNQGGFYP
FT                   KVLEDAMDRNTIQVQQLAEQVARCVKVGISDVRKPEELLAAIFDSVRQSQENAAQAQGA
FT                   RDTITALWNLVQSAAQEGKERWDELLSIVRQAGGRAVAGTYPKVTVDARGWVTAGSALS
FT                   ESDVPTLPIDKVQGLQAMLDGKAASSHSHEMAQVNGLQTALDGKAATHHTHDWSQITGT
FT                   PDSLGVGQTWQSVSRAANTTYTNTTGKPIMVHVQSTGDQSVTVASITVQGQTLLSQSYN
FT                   GRTASISAIVPHQAAYQVSGSPSMVVRELR"
FT   CDS_pept        437030..437422
FT                   /transl_table=11
FT                   /locus_tag="BAV0434"
FT                   /product="putative phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48036"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ22"
FT                   /inference="similar to DNA sequence:INSDC:BX640442.1"
FT                   /protein_id="CAJ48036.1"
FT                   /translation="MDFKYYRDPTNGDVYAYEGDGSQDAYIREGLVAMTDDEVKAHLSA
FT                   PSSHTVAPTSVTMRQARLALLKLGLLAQVNAAVASLPGDEGEAARIEWQFAGSVERGSE
FT                   LVGALSQVLGWSSARLDELFELAVTL"
FT   CDS_pept        437463..438269
FT                   /transl_table=11
FT                   /locus_tag="BAV0435"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48037"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ19"
FT                   /inference="similar to DNA sequence:INSDC:BX640447.1"
FT                   /protein_id="CAJ48037.1"
FT                   /translation="MVSVGLSYWRVDCCVEPAEAPFLINGTVLDLQAPLLLTKLTRITG
FT                   GAGTQTLSGRISNHQPYFAIGAVQVLPQTSLMVPGYRLARLTGVVGGGLQGQGISSTQL
FT                   PVQAYHFRSVGEYKEVQLQAVQDGLAKMVKVRFAGQSEGIVAGVVYAKDADAAMLGADF
FT                   DVIEARDQPASSSYQDPGYGCVGLVLDGIPARSVIRYELDTDAVLTVSGDNDYSGSTFV
FT                   VSGTVRAGSVNAFGGSQVVVMRNGTLDKAGLRLSNKITNRGGVILG"
FT   CDS_pept        438274..438489
FT                   /transl_table=11
FT                   /locus_tag="BAV0436"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48038"
FT                   /db_xref="GOA:Q2KZ17"
FT                   /db_xref="InterPro:IPR032124"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ17"
FT                   /inference="similar to DNA sequence:INSDC:BX640447.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ564013.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48038.1"
FT                   /translation="MDLSSSPEKAALTAMYGGGGSALIFGLSANDFFALVGAVVAVVGL
FT                   VANLWFKYQHLKIAREAAAKTDKEDA"
FT   CDS_pept        438489..439040
FT                   /transl_table=11
FT                   /locus_tag="BAV0437"
FT                   /product="Putative phage lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48039"
FT                   /db_xref="GOA:Q2KZ14"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ14"
FT                   /inference="similar to DNA sequence:INSDC:AJ278614.1"
FT                   /inference="similar to DNA sequence:INSDC:BX640447.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48039.1"
FT                   /translation="MQPGQRIKGGAAALVASGVLILASAGLMGFLGRWEGEGQHVVYAD
FT                   KLAGGLPTVCKGITKHTSPYPVVVGDYWSPDRCEEVERMVVAKGQLKLADCIQVHVSQP
FT                   IFDALSSHAHNVGTAATCASRAVGLINHGRVAEGCDALANAPDGQPVWSYITDKQGRKV
FT                   FVQGLRNRRLAERELCLSGL"
FT   sig_peptide     438489..>438561
FT                   /locus_tag="BAV0437"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(439274..440035)
FT                   /transl_table=11
FT                   /locus_tag="BAV0438"
FT                   /product="Putative phage anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48040"
FT                   /db_xref="InterPro:IPR018875"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ11"
FT                   /inference="similar to DNA sequence:INSDC:AP000363.1"
FT                   /inference="similar to DNA sequence:INSDC:AP005154.1"
FT                   /protein_id="CAJ48040.1"
FT                   /translation="MTASQGALALEISPIEVLFHGAVLLVVEHNGQPYVPMKPVVDGME
FT                   MDWAAQFTKLKANSGRWGIVKITIPSNGGNQEAVCLPLRKLPGWLMTISPNKVRPELRE
FT                   KVITYQNEADDILWDAWQQKAATPSTPRIDVRALLLDGQSDLTLDLPDNVQAALNARAG
FT                   VLAGEAFTLIREHLRRRIAYHAVSGRPSSVNEPKALRVIAEGDLGEALAHGLILKVRHL
FT                   LSHAEYCVDLSTQYFTGLQGALHDLGCARSH"
FT   CDS_pept        complement(440032..440205)
FT                   /transl_table=11
FT                   /locus_tag="BAV0438A"
FT                   /product="putative phage-related protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0438A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48041"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ08"
FT                   /protein_id="CAJ48041.1"
FT                   /translation="MWLFFRPQHGTSYGRAVWEGSNPLPVTTSGTPTCMVPPTSDWRRR
FT                   SGLFTAQVGGQP"
FT   CDS_pept        complement(440229..440450)
FT                   /transl_table=11
FT                   /locus_tag="BAV0438B"
FT                   /product="putative phage-related protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0438B"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48042"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ06"
FT                   /protein_id="CAJ48042.1"
FT                   /translation="MQTRRPRPLLRCGAFAFLYRPHFGANLDSLLPWYGHPSISPITMC
FT                   SANQPPAPGLPFSLHTHTRCERDWRPGK"
FT   CDS_pept        complement(440532..440888)
FT                   /transl_table=11
FT                   /locus_tag="BAV0439"
FT                   /product="putative phage-related protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48043"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ04"
FT                   /protein_id="CAJ48043.1"
FT                   /translation="MGSKGRGRSRSSAGSIGHSCYVRLGCGQRLTHNRQVSLCAIQPQI
FT                   GYHGILAPALRRPGRPASQQCADHRHQAITLPPNKSPAHHHHTTCNSATTKGVTAHAKI
FT                   AIPMQKRNHGDNTV"
FT   CDS_pept        complement(440971..441240)
FT                   /transl_table=11
FT                   /locus_tag="BAV0439A"
FT                   /product="putative phage-related protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0439A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48044"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ02"
FT                   /protein_id="CAJ48044.1"
FT                   /translation="MLLSTTQCKHAATQCTKLPPGGAFSFRPRPHRRPVPCSTHSIRHQ
FT                   HLILHPRLPGVIVGGILRRLGQLRARRRQLTVQRRHDSWHVQRR"
FT   CDS_pept        complement(441376..442179)
FT                   /transl_table=11
FT                   /locus_tag="BAV0440"
FT                   /product="phage-related protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48045"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KZ01"
FT                   /protein_id="CAJ48045.1"
FT                   /translation="MASRQRKEAKVLRPTYKVYVDEAGDEGFKFLENEKGSSRWFVLSA
FT                   TIVRTVNDGRLVECAKSIRALLNKPDNHALHFRNLRHEQRIPFSRMIGELPIRTIHIMV
FT                   HKPSIGDPENFQRQPYSLYRYATRLLIERISWLCRDQRRDAPNYLAELIFSNRSAMSYD
FT                   DLKDYLGRLLAIEQNVQIDWGAFDMRLVRAVNHDQLAGLQLADAVASGAFYAVHKSVYG
FT                   ETEDRYLHLTQRVLYRHNRNLNGYGIKFWCSEDAEKRRVLAICRD"
FT   CDS_pept        complement(442669..442938)
FT                   /transl_table=11
FT                   /locus_tag="BAV0441"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48046"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYZ9"
FT                   /inference="similar to DNA sequence:INSDC:BX640443.1"
FT                   /protein_id="CAJ48046.1"
FT                   /translation="MDYTPPSPAQLQALKTSLDFTGKQMAELACVGEQHWRKYTGGAAP
FT                   REMPYPNLFHLAAQLALSPDEMAKVLEKMREIGAEFDFTEPPTA"
FT   CDS_pept        complement(442972..443217)
FT                   /transl_table=11
FT                   /locus_tag="BAV0442"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48047"
FT                   /db_xref="GOA:Q2KYZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYZ7"
FT                   /inference="similar to DNA sequence:INSDC:AL162755.2"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48047.1"
FT                   /translation="MRYYSLHGKRTPRSPKTRKDDEMDKTLDTIKTEAEIAKLMAETGK
FT                   LNAEAAKMIRERAWYPIVIVAAAFTTGAALAKLVIG"
FT   CDS_pept        complement(443272..443553)
FT                   /transl_table=11
FT                   /locus_tag="BAV0443"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48048"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYZ5"
FT                   /inference="similar to DNA sequence:INSDC:BX640443.1"
FT                   /protein_id="CAJ48048.1"
FT                   /translation="MPFRPPLHLSELRAIQDRNPGNEDMLALLWEIKRLQSLVIRLNQV
FT                   LPEMHRPTGVLGPAFDALAEQVPKEPCVTEISMRTIEVAAALARQAKQ"
FT   tRNA            complement(443684..443768)
FT                   /gene="tRNA-Leu (CAA)"
FT                   /product="transfer RNA-Leu (CAA)"
FT                   /anticodon="(pos:443732..443734,aa:Leu)"
FT                   /inference="profile:tRNAscan-SE"
FT   repeat_region   complement(443684..443740)
FT                   /note="Duplication of the 3' region of tRNA leu following
FT                   prophage insertion"
FT   CDS_pept        complement(443860..444423)
FT                   /transl_table=11
FT                   /locus_tag="BAV0444"
FT                   /product="ankyrin repeat-containing exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48049"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYZ1"
FT                   /inference="similar to DNA sequence:INSDC:AF001355.2"
FT                   /inference="similar to DNA sequence:INSDC:AY078506.2"
FT                   /inference="profile:HMMPfam:PF00023"
FT                   /protein_id="CAJ48049.1"
FT                   /translation="MLTRPLRIPLLCACLTLSSAPLLHAAPPEAPAALQAELQARLRQA
FT                   AREGDMTALAAFAQAATNWNARDAQGRSPLILAAYHGQTNALRFLLKQGADPCLPDARG
FT                   NTALMGALFQGHDSAARLLLDTACPIDQTNHAGQTAAMYAALFQRHALLQTLRERGANM
FT                   QAQDKQGNTPDTLARGEIKGPLGQ"
FT   sig_peptide     complement(<444345..444423)
FT                   /locus_tag="BAV0444"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(444483..>446006)
FT                   /transl_table=11
FT                   /gene="katB"
FT                   /locus_tag="BAV0445"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48050"
FT                   /db_xref="GOA:Q2KYY9"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYY9"
FT                   /inference="similar to sequence:UniProtKB:Q59635"
FT                   /inference="profile:HMMPfam:PF00199"
FT                   /protein_id="CAJ48050.1"
FT                   /translation="VYKTAISLGMAISATLCLPALAQEPTLTLDNGAPVGDNQNSQTAG
FT                   PNGPVLLQDVQLLQKLQRFDRERIPERVVHARGTGAYGEFIAHEDLSDLTQAELFRKDI
FT                   KTPVFVRFSSVVHGVHSPETLRDPRGFAVKFYTTQGNWDLVGNNFPTFFIRDAIKFPDM
FT                   VHAFKTDPRTNLDDDRRRFDFFSFFPEATRTLTQLYANEGTPASYRHMDGNSVHAYKFV
FT                   NAAGQTHYVKFNWRTRQGRKNLDPGEVQAMQGKDYSHMTRDLVEAIDRGDYPKWDLYIQ
FT                   VLKPEQLASFDFDPLDATKIWPDVPSRKIGEMVLNRNPENVFQETEQVAMAPSNLIPGI
FT                   APSEDRLLQGRLFAYADTQMYRLGATALSLPINRPHNAVLTRNQDGALNAGHTQGSVNY
FT                   QPSRVSPALESAAARATPTPLSGTVQQRPIQRQQNFKQAGELYRSYSAKERADLIQSLG
FT                   SELARTQDDTKHIMISYFYKADPEYGQGLARVAKADMNKVRHLASQLAD"
FT   misc_feature    complement(444930..444956)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00437"
FT   misc_feature    complement(445767..445817)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00438"
FT   sig_peptide     complement(<445937..446006)
FT                   /gene="katB"
FT                   /locus_tag="BAV0445"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(446199..447602)
FT                   /transl_table=11
FT                   /locus_tag="BAV0446"
FT                   /product="putative Xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48051"
FT                   /db_xref="GOA:Q2KYY5"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYY5"
FT                   /inference="similar to sequence:UniProtKB:O32139"
FT                   /inference="similar to DNA sequence:INSDC:AP005073.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00860"
FT                   /protein_id="CAJ48051.1"
FT                   /translation="MSSAPQTQTHPPPAHGQVTPDLIYGPDDRPATPVAFIAALQHLLA
FT                   ILVPIVTPGLLICQALGVSSRDTTLIVSMSLVISGIATYVQCRRFGPFGAGLLIVQGTS
FT                   FNFVGPLIAGGSMMVAQGTPVEAVMAAIFGVVIAGSFVEMGISRILPFVKRLITPLVTG
FT                   IVVLLIGLTLIKVGLISMGGGFSAMQNGTFANSENLLLSGLVLGTIIVLNRLPIVWVRS
FT                   AALVIALIVGYLAAASLGRLDLSSARDAALFQVPLPLHFGLSFSWPLFVPMLIIYLVTS
FT                   LEAIGDITATSQVSRQPVHGPLWMQRIKGGVLVNGTNSLLAGVFNTFPSSVFAQNNGVI
FT                   QLTGIASRRVGIWIAGMLVVLGLFPAVAGLLQAVPEPVLGGAAMVMFGAVAASGINILA
FT                   GVRLDRRALLIIAVSLALGLGVSQVPEFLAHMPHALKSILESGVATGGICALLMNWFLP
FT                   ESPAQAKAA"
FT   misc_feature    complement(446421..446483)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01116"
FT   misc_feature    complement(447045..447095)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00879"
FT   CDS_pept        447783..449675
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="BAV0447"
FT                   /product="chaperone protein HtpG"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48052"
FT                   /db_xref="GOA:Q2KYY2"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYY2"
FT                   /inference="similar to sequence:UniProtKB:P10413"
FT                   /inference="profile:HMMPfam:PF02518"
FT                   /inference="profile:HMMPfam:PF00183"
FT                   /protein_id="CAJ48052.1"
FT                   /translation="MTQNATSETLGFQAEVKQLLHLMIHSLYSNKEIFLRELVSNASDA
FT                   CDKLRFEAIDQPELLAGDSELAIRVSYDKAARTITIADNGIGLSREEAIANLGTIARSG
FT                   TREFFSQLTGDKQKDAQLIGQFGVGFYSSFIVADRVSVLSRRAGSDEAIRWESDGQGEF
FT                   SIASAEKATRGTDVVLHLRADEDEFLNGWKLREVLRRYSDHISLPILMRKEEWDADKDE
FT                   QVTRDEWETVNQANALWTRSKSEISDEQYREFYKTVSHGFDEPLAWTHNRVEGRSEYTQ
FT                   LLYVPRQAPFDLWDRDARRGVKLYVKRVFIMDDAEQLLPAYLRFVRGVIDSADLPLNVS
FT                   REILQESRDVRAIREGSAKRILSLLEDLAENRKDDYAVFWGEFGQVLKEGVGEDPSNQE
FT                   RIAKLLRFASTHAGDASQTTSLQDYLGRLKEGQDKIYYVTADSYSAASNSPHLEIFRKK
FT                   GIEVLLLWDRVDEWMLSHLREFEGKSLVSVAKGGLDLADLADEEEKKKQTEVAESFKPL
FT                   IERLQTALGEQVKEVRVTLRLVDSPACVVVGQNDLSPHLLRMLKAAGQEVPEVKPVLEI
FT                   NPEHALIARIRDVSDADFGAWAQLLLDQALLAEGAQIADPAAFVKRLNALLLKV"
FT   misc_feature    447864..447893
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00298"
FT   CDS_pept        complement(449747..450367)
FT                   /transl_table=11
FT                   /locus_tag="BAV0448"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48053"
FT                   /db_xref="GOA:Q2KYY0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYY0"
FT                   /inference="similar to DNA sequence:INSDC:AL646062.1"
FT                   /inference="profile:HMMPfam:PF00043"
FT                   /inference="profile:HMMPfam:PF02798"
FT                   /protein_id="CAJ48053.1"
FT                   /translation="MLKIWGRLSSVNVQKVVWAVRELALPHTLTEVGGKFGGLDTPEYL
FT                   SMNPNRRVPVIDDSGFILWESNAIVRYLASRYGAGSLWPVDPCVRGDADRWMDWQTTDW
FT                   QTAQGPAFLGLIRTPEDQRDKAAIAASIAKSNASALILEKALQGREFITGPQFTMGDVV
FT                   LGCAAHRWLALPIERPDTPNIAAWYRRLMMRPAVQGVLTLPLA"
FT   CDS_pept        complement(450383..450994)
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="BAV0449"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48054"
FT                   /db_xref="GOA:Q2KYX8"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYX8"
FT                   /inference="similar to sequence:UniProtKB:P30013"
FT                   /inference="similar to sequence:UniProtKB:P13016"
FT                   /inference="profile:HMMPfam:PF01510"
FT                   /protein_id="CAJ48054.1"
FT                   /translation="MPGLETLLFAMSLPQLDRHGWLHPAPTVTLLPSPNVDARPPGAQV
FT                   SLLVLHNITLPPGEFGGPYVADLFLNRLDLNAHPWFARLKGLRVSAHFFVRRDGNIVQF
FT                   ASIHDRAWHAGVSRFAGRERCNDFSVGVELEGTDRLPYTDAQYTTLSKLARRLRARLPI
FT                   RAAWGHEDIAPGRKTDPGPAFDWPRFARGAGFLRRELPPR"
FT   CDS_pept        complement(451031..451270)
FT                   /transl_table=11
FT                   /locus_tag="BAV0450"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYX5"
FT                   /inference="similar to DNA sequence:INSDC:AJ249642.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48055.1"
FT                   /translation="MGKIIFWFFAILTILTVWRMINARTPRKPGTTRQPPTAKAVEPMV
FT                   SCTHCGLHLPRSEAVQAHGQSWCSQEHARLGQSK"
FT   CDS_pept        complement(451276..452118)
FT                   /transl_table=11
FT                   /locus_tag="BAV0451"
FT                   /product="putative cytochrome assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48056"
FT                   /db_xref="GOA:Q2KYX2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYX2"
FT                   /inference="similar to DNA sequence:INSDC:AL646072.1"
FT                   /inference="profile:HMMPfam:PF01578"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48056.1"
FT                   /translation="MSSGIVFHAVAALVYAVLGASMWRRLQRAGSVEHTGKIARLCLLG
FT                   ALIVHGYALREAMLGAHHIFIGWALALSAAVWLGLVMYWLESLFIRIDGVQLLLLPLAS
FT                   LATLLAALFPQGIQVPHEGNPWLRIHLLIALAAYGLITIAALHAMLMALLDRHLHRPLD
FT                   APDGRSIIGRVLDAQPPLLVQEQLLFRIILIGFIVLTLAVGTGSVASILLTGRILPFDH
FT                   KTIFTLLSWLTFGGLLVGRQAWGWRGRVALRWTIVGFCFLILAYTGSRFVLEMILHRS"
FT   CDS_pept        452236..453648
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="BAV0452"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48057"
FT                   /db_xref="GOA:Q2KYX1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYX1"
FT                   /inference="similar to sequence:UniProtKB:P07019"
FT                   /inference="profile:HMMPfam:PF02881"
FT                   /inference="profile:HMMPfam:PF00448"
FT                   /inference="profile:HMMPfam:PF02978"
FT                   /protein_id="CAJ48057.1"
FT                   /translation="MLDNLTQRLSRVVKTLRGEARLTEANTQEMLREVRMALLEADVAL
FT                   PVVRDFVARVKEKALGEEVASSLTPGQTLVGLVHKELTSLMGGDLGPGSGELSLAVQPP
FT                   AVILMAGLQGAGKTTTTGKLARWLSEGEHIQNGRKSGKKKVLVVSADVYRPAAIEQLKT
FT                   VAAQVGVDFLPSDPSQKPEDIARNAVEHARRHHYDVLIVDTAGRLGIDEAMMREIAALH
FT                   ALVKPVETLFVVDAMQGQDAVNTARAFAEALPLTGVVLTKLDGDARGGAALSVRHITGK
FT                   PLKFVGVSEKLDGLQPFHPERMAQRVLGMGDIVSLVEQAQKNIDIAEAEKLAKKIKSGD
FT                   KFDLNDFREQLGQVKKLGDMSSLLEKLPSQFQQAAGQLQGGQAEKQLRRTEGILNSMTP
FT                   AERSKPELIKAARKRRIAAGAGVPVQEVNKLLNQFEQMQGMMKQMKKGGMAKMMRAMGG
FT                   IKGLGRFGGFGR"
FT   misc_feature    452566..452589
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    452992..453009
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    453079..453120
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00300"
FT   CDS_pept        complement(453730..453930)
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="BAV0453"
FT                   /product="putative thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48058"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYW8"
FT                   /inference="similar to sequence:UniProtKB:O32583"
FT                   /inference="profile:HMMPfam:PF02597"
FT                   /protein_id="CAJ48058.1"
FT                   /translation="MQITLNGQPRALPASLTVMGLLEELGYAGKRVAVERNGEIVPKSR
FT                   HSATPLADGDQIEIVVAVGGG"
FT   CDS_pept        complement(453938..454879)
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="BAV0454"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48059"
FT                   /db_xref="GOA:Q2KYW6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYW6"
FT                   /inference="similar to sequence:UniProtKB:O32449"
FT                   /inference="profile:HMMPfam:PF00561"
FT                   /protein_id="CAJ48059.1"
FT                   /translation="MLYPAIEPYRHGMMDTGDGHQVYWELCGNPKGKPAVFLHGGPGSG
FT                   CSPVHRQLFDPSRYHVLLFDQRGCGRSTPHASLDNNTTWDLVADIERLRQEVMGVQSWL
FT                   VFGGSWGSTLALAYAETHPERVSELVVRGIFSLRRAELQWFYQEGASWLFPDYWEDYLA
FT                   PIPQTERGDMIAAYRKRLTGADPAEQLRAAKAWSQWEDRTVTLLPSPRHQQSHAADRAA
FT                   LAFARIENHYFVHAGFMEEGQLLRDAHKLHGIPGTIVQGRYDACTPARTAWELHRAWPQ
FT                   ADFHLVPDSGHAFDEPGTLARLIEATNRYASY"
FT   misc_feature    complement(454268..454294)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00037"
FT   CDS_pept        complement(454906..455676)
FT                   /transl_table=11
FT                   /gene="yggH"
FT                   /locus_tag="BAV0455"
FT                   /product="tRNA(guanine-n(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48060"
FT                   /db_xref="GOA:Q2KYW5"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYW5"
FT                   /inference="similar to sequence:UniProtKB:P32049"
FT                   /inference="profile:HMMPfam:PF02390"
FT                   /protein_id="CAJ48060.1"
FT                   /translation="MNANTPTPIDGQPTELTPSTQAALEPANHAPASPGATHIRSFVHR
FT                   RGHITQRQRDALEQLMGKWAIPYAPRPLNPATAFGREAPTILEIGFGMGETTEKIALAR
FT                   PEDNFLGVEVFNAGVGSMLHRIETSQIPNVRIIQHDAVEVVRDMIAPDSLAGVHVYFPD
FT                   PWPKKRHHKRRLLQPAFVQLLASRIKPGGYLHCATDWQDYAVQMLEVLGGEALLENTAQ
FT                   DYAERPAYRPQTKFETRGLRLGHGVWDLIFKRKA"
FT   tRNA            455847..455917
FT                   /gene="tRNA-Gly (CCC)"
FT                   /product="transfer RNA-Gly (CCC)"
FT                   /anticodon="(pos:455879..455881,aa:Gly)"
FT                   /inference="profile:tRNAscan-SE"
FT   CDS_pept        complement(456166..457668)
FT                   /transl_table=11
FT                   /locus_tag="BAV0456"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48061"
FT                   /db_xref="GOA:Q2KYW3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYW3"
FT                   /inference="similar to DNA sequence:INSDC:AJ414154.1"
FT                   /inference="profile:HMMPfam:PF00392"
FT                   /protein_id="CAJ48061.1"
FT                   /translation="MKEVLLADLLTGSLSRAADEPLQKQIYEIVRRGVLDHTLAAGQRL
FT                   PSSRALAEELGVSRITVTLAYERLIAESYLSARGGSGTFVEQTVDKPLRTAGAPDLIEH
FT                   ERPALSARGAITGSGTGGLGQHTGAFVPGIADASLFPFHIWRRLVSRHLNKSNLELAGY
FT                   AKDGAGFLPLRMAIANYLRLSRSVVCEPAQIIVTAGTHQSVDLCARLLAESGDSALVES
FT                   PCHWAFAPVLGAAGLRTRAARLDDQGIDIAASPLPRRARMVITSPSHQYPTGVIMPLAR
FT                   RLELLQQARARSLWVLEDDYDSEFRYDAAPIPSLQGLDADGRVIYMGTFSKTMFAGLRL
FT                   SYMVVPEHVAHAFSNACARIYRPGHLHLQAALADFMNDGHFSHNIKRMRLEYAQRQSVL
FT                   REALERRIGEPLRLSQARAGLHVYARLGPEICVQALADAARAEALVLGMPHFLDDDTHS
FT                   DRQAVVLGYGGVPSDHIEEGVSRLARSLEHASRKTRSAAKRA"
FT   sig_peptide     complement(<457611..457668)
FT                   /locus_tag="BAV0456"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(457988..458779)
FT                   /transl_table=11
FT                   /gene="hutG"
FT                   /locus_tag="BAV0457"
FT                   /product="putative N-formylglutamate amidohydrolase"
FT                   /EC_number="3.5.1.68"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48062"
FT                   /db_xref="GOA:Q2KYW1"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYW1"
FT                   /inference="similar to DNA sequence:INSDC:AF032970.1"
FT                   /inference="profile:HMMPfam:PF05013"
FT                   /protein_id="CAJ48062.1"
FT                   /translation="MSDTYHFEAGSTPLLISIPHLGSLIPDEQAPDMTAIGLSSADTDW
FT                   HLDRLYAFGRALGASFLWARYSRYVVDLNRPPNDASLYPGQAKTGLCPTHTFDGQPLYL
FT                   DGRDAISETERESRRARYWQPYHDQLRAEIERLRARHGKVLLWEGHSIASVIPRLFDGK
FT                   LPDLNIGTASGASAARAVQDAIQQALEQQAGYSWVVNGRFQGGYITRHYGDPERQIHAV
FT                   QLEMCQSTYMEERPPYAWDGALAAAASGAVETLVRAALDAI"
FT   CDS_pept        complement(459136..460185)
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="BAV0458"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48063"
FT                   /db_xref="GOA:Q2KYV7"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYV7"
FT                   /inference="similar to sequence:UniProtKB:Q59701"
FT                   /inference="profile:HMMPfam:PF02423"
FT                   /protein_id="CAJ48063.1"
FT                   /translation="MPMTRFIDVPAMSQLIQKVGLPTFIGELADTIKADFTRWPDFDKS
FT                   ARVANHSDIGVIELMPVSDAQDYAFKYVNGHPGNTARGLYTVMAFGLLAEVETGYPVLL
FT                   SELTLATALRTCATSLMAARALARPDSRVMALIGNGAQSEFQALAFHCHLGIEELRVYD
FT                   IDPQATEKLIRNLAGFPDLKIVRAASTAEAVRGADIVTTVTADKAYATIITPDMLEPGM
FT                   HLNGVGGDCPGKTELHADVLRAATVFVEYEPQTRIEGDIQQLPADFPVKDLWRVLAGHL
FT                   TGRQDAKEITVFDSVGFALEDYSVLRYVLAKSLEHHIGKTVQLVPEAADPKDLFCHTGQ
FT                   GAARLRRVA"
FT   misc_feature    complement(459481..459504)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        460508..461149
FT                   /transl_table=11
FT                   /locus_tag="BAV0459"
FT                   /product="putative negative transcriptional regulator of
FT                   degradative-enzyme production"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48064"
FT                   /db_xref="GOA:Q2KYV2"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYV2"
FT                   /inference="similar to sequence:UniProtKB:P21341"
FT                   /inference="profile:HMMPfam:PF04299"
FT                   /protein_id="CAJ48064.1"
FT                   /translation="MYIPAPFTVNDPAVLHTLMRDHPLGMLVTQGGSGLDANHLPFELD
FT                   AGEGPLGRLSAHVARANPVWQDVADGDEVLVVFRAEQAYLSPSWYPSKHETHQQVPTWN
FT                   YRVVHARGRITIRDDERYVRGVVARLTRRHEAGEAVPWKMSDSAPDFIDGMLRTIVGIQ
FT                   VDITAIEGKFKLSQNKASRDIAGAAQALAERGNTALSAAMLACDPGKPAS"
FT   CDS_pept        461446..462744
FT                   /transl_table=11
FT                   /locus_tag="BAV0460"
FT                   /product="putative amidohydrolase/peptidase/deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48065"
FT                   /db_xref="GOA:Q2KYV1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR033687"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYV1"
FT                   /inference="similar to sequence:UniProtKB:P23908"
FT                   /inference="similar to DNA sequence:INSDC:AP003011.2"
FT                   /inference="profile:HMMPfam:PF01546"
FT                   /inference="profile:HMMPfam:PF07687"
FT                   /protein_id="CAJ48065.1"
FT                   /translation="MPELTPALKARILEAVDAGFAAQTELTAQLVRLPSQRGEEATAQD
FT                   FMAARYAERGYAVDRWKIDVDAIRHLPGFSPVAVSYDHAYNVVGAYRSHSLQGRSLILN
FT                   GHIDVVPVGPLSQWSRDPYDPAIVDGWMHGRGAGDMKSGLVACLSAMDALASLGLAPAG
FT                   DVFLQSVVEEECTGNGALACLARGYRADAAFIPEPLLPMLMRAQVGPMWFQVQVEGDPQ
FT                   HASAAFTGAGANAIQKAIFLIQALDELEVRWNGRKCDHRHFHDHPHPIRFNLGKIAGGD
FT                   WPSSVPAWCTFDMRVAVYPGQSLESARAEIEAFIAEAAARDPFLAQHPPKVVYHGFMAE
FT                   GYELKDSEAVEVALRSAHERVFGEPLREYATSAATDARFYGLYADTPAIVYGPECRMPH
FT                   GYDEAVNLESVRKVTQTIALFIAEWCGLEERSV"
FT   CDS_pept        462741..463808
FT                   /transl_table=11
FT                   /locus_tag="BAV0461"
FT                   /product="putative phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48066"
FT                   /db_xref="GOA:Q2KYU7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYU7"
FT                   /inference="similar to DNA sequence:INSDC:AF182845.2"
FT                   /inference="similar to sequence:UniProtKB:O32378"
FT                   /protein_id="CAJ48066.1"
FT                   /translation="MSASAAQALFAAEPPKLTPGEAEALAARFYGLTARADTLSSERDQ
FT                   NFRLTLADGQRYVLKATHPAEDPAVTDFQTQAQLHMMRAGGDLPIPRLVPGLAGEYVCW
FT                   HEGAEGARRAIRLITFIQGRPLHSVGRSAAQRRALARALARVDHALSGFEHPMADHELL
FT                   WDVQHADRLADLLPLIEEPERRALAEKHMAYFTQRVRPALMGLRRQVIHNDLNAYNVMV
FT                   GADNADHIAALLDFGDMVRAPLVQDIAVACAYQLEDAPDPLSTAARDCVASYHQVLPLG
FT                   EAELALIPDLIAARLLITVAITGWRARQHPENRQYILRNNALAWNGLARLDALPLSQAR
FT                   DIVFAACHTSLENSA"
FT   CDS_pept        463805..465181
FT                   /transl_table=11
FT                   /locus_tag="BAV0462"
FT                   /product="putative decarboxylating aminotransferase"
FT                   /EC_number="4.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48067"
FT                   /db_xref="GOA:Q2KYU5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYU5"
FT                   /inference="similar to sequence:UniProtKB:P16932"
FT                   /inference="profile:HMMPfam:PF00202"
FT                   /protein_id="CAJ48067.1"
FT                   /translation="MSRDKAMLNAFDPAAAAGLPQAERALIERRQRMLGPAYRLFYDQP
FT                   LHIVRGEGVWLYAADGQRYLDAYNNVASVGHSHPRVVQAIAAQAAVLNTHTRYLHEGVL
FT                   DYAERLLATFPPALSQVIFTCTGSEANDLALRVARSHTGGSGVIVTRLAYHGVTAAVAA
FT                   VSPSLGQAVPLGLDTRAIDAPDSYRQDPATLGLWFAERVREAIADMRRHGIQPAALLVD
FT                   TIFSSDGVYAEPAGFLAPAVAVIREAGGLFIADEVQAGFARTGSCMWGFQRHGLEPDIV
FT                   TMGKPMGNGHPIAAMVARPDVLARFGSEARYFNTFGGNPVSCAAAAATLSVIEDEGLQA
FT                   NAAEVGHYLRQGFRALAARHPLIGDVRGDGLFLGVELVSDRQAKTPAKAHTHRFVNLMR
FT                   ENHVLLSATGLHGNVLKLRPQLPFRTEHADILLAAADKVFTQLAEESTRLTVLAPGLGF
FT                   "
FT   misc_feature    464558..464674
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00600"
FT   CDS_pept        complement(465404..465829)
FT                   /transl_table=11
FT                   /locus_tag="BAV0463"
FT                   /product="AsnC/Lrp-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48068"
FT                   /db_xref="GOA:Q2KYU2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYU2"
FT                   /inference="similar to DNA sequence:INSDC:AL591985.1"
FT                   /inference="profile:HMMPfam:PF01037"
FT                   /protein_id="CAJ48068.1"
FT                   /translation="MLLDPLDRRLIALLRTDARLPTAALAKQLAVSRGTIQNRMQRLER
FT                   AGVITGYTLRMAEHEDQAGVQAVTLIEVHGAATDQVIAALRRLPEATQVHSTNGRWDLV
FT                   VHLHTADLAAFDRVLRELRGIAGVANSESHLLLAAHR"
FT   CDS_pept        join(466017..466196,466198..466941)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BAV0464"
FT                   /product="arginase (pseudogene)"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="PSEUDO:CAJ48069.1"
FT                   /inference="similar to sequence:UniProtKB:P39138"
FT                   /inference="protein motif:Prosite:Pseudogene."
FT                   /inference="profile:HMMPfam:PF00491"
FT   misc_feature    466300..466341
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00147"
FT   misc_feature    466381..466407
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00148"
FT   misc_feature    466696..466761
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01053"
FT   CDS_pept        complement(466932..467588)
FT                   /transl_table=11
FT                   /locus_tag="BAV0465"
FT                   /product="fimbrial subunit"
FT                   /note="One of 11 fimbrial subunits"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48070"
FT                   /db_xref="GOA:Q2KYT9"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYT9"
FT                   /inference="similar to DNA sequence:INSDC:X77612.1"
FT                   /inference="similar to DNA sequence:INSDC:AF111796.1"
FT                   /inference="profile:HMMPfam:PF00419"
FT                   /protein_id="CAJ48070.1"
FT                   /translation="MAFAFKPQTVIDCIRTTSVVLVALAGMAAVPAHASDGVITITGEI
FT                   TTQTCKINGNTPPYNLLVTLPKISSSALKNVNDTAGSTVFHIELTECPESLKNKMLAAY
FT                   FEPGPAVDLATGNLQTYTIDTLPTKAASTIPGDLDSSKLFDNVEIQLANTDGSAIKIGA
FT                   ADHRSKGFTAVEAGSGNSKTASATLTYLARYIKTGNGAIKAGKVHTYVQYSILYP"
FT   sig_peptide     complement(<467483..467588)
FT                   /locus_tag="BAV0465"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(467767..471684)
FT                   /transl_table=11
FT                   /locus_tag="BAV0466"
FT                   /product="putative serine protease autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48071"
FT                   /db_xref="GOA:Q2KYT6"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR030895"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYT6"
FT                   /inference="similar to DNA sequence:INSDC:BX640425.1"
FT                   /inference="similar to DNA sequence:INSDC:D78380.1"
FT                   /inference="profile:HMMPfam:PF03797"
FT                   /protein_id="CAJ48071.1"
FT                   /translation="MSNTAVTVSGENVPNNVKNKNKIQLSGSASLTIENGGSLSPADWI
FT                   ILPGATASVTVTGAGSTLTTGEVQITESGASLKVEDQGKAVLNKLNLDKGQTLVTGQGS
FT                   SLQVKADGSFRVGNNGAATLQIKDGGALTSDTMLTLTNTNTDSATLGIDGAGSSLNVSG
FT                   EVSSGAGGTTAITVLNGGSLNSQGATLGKSDGNKTTVLIDGAGSRWTNTGAITLNAQAS
FT                   VQLRNGGALDLGDKTLTLTGQNTSLNLGGTNTEGAAATGTLLAAAVAFSKSDATAATQA
FT                   LVFNHSDSEGFEFGAKLSGDGKVILKHGLTRLSADSSQFSGSTEIAGGSLQVVGKLGGK
FT                   LNLINGELQVSGTVDTPEALTLTQDTSDTASLLISGSGASLTTAQTVDSSTGGGMASIK
FT                   ILDGGSLNSQGATLGKSDGDKTTSVLIDGVGSRWTTTAKPFTLNDNATLQLRNGGTLDL
FT                   GDQALTLSGKDAEVSIGSLSTEAAVAPGLLKTPEVAFATNNSDDTLQILAFKHTTNGLD
FT                   FSPKITGNGSIVVEQGLTNLTADSSTFSGETLITGGSLDVAGKLGGALTISNGELKVSG
FT                   TVDSQSAVQLKSTRSSSLLVEGENASLTTASTVNAQATEGKVDIKILDGGSLKSQGATL
FT                   GKPGDGESTTVLIDGAGSHWAATQAFTLNDNASVQLRNGGTLDTGNKALSLQGKHSRLI
FT                   LGGEDAAAAAGTLSTKGLEFSSLDDSAATQQLVFNHNSDNYEFGAPITGRGHITQQHGV
FT                   TLLTGDSAAFAGQTDVLGGTLRVDGKLGGTLTVHSGAFLSGTGQIGSTVINEGGTLSAG
FT                   GRQPVTVMGDLEIKNGGALSVALASDTVPTQALLNVSGKTKLEETSKLDVEARDAQLDA
FT                   PYLLLKATGGVEGKFGTVSSKVDNNLAFIDTTLDYNTPGQISLTLTRRANDTFASQAVS
FT                   SNERAVANALDHMPESGELPQFVQRLPKGAPAAVFDALAGDAHTSVSNALQQSAVAPVM
FT                   QVPMAHLRSNLQAGLLPGAPLAQSGGSYPVSALPSSAAQPLWAQTFGSWQHDKGDSNAP
FT                   GGRAFTGGLFIGVDQALGKNKDIRLGAALGYSQTQVNIRTRSAKATIDNFSLTAYGGKQ
FT                   WETGLGQLNLLAGGAYTSHHIRSKRDLSQVGLADTLRAGYHGNTVQLFTELGHAFPWRH
FT                   GYVEPYAGISLNRLHTESYTESGGVAALHGAAQSRSNLVTSLGVRAAYDLKVSGKDLRL
FT                   RAGLAWRYTGQDLTPQSKLAFQNGPDFTVSGTPIARSTAQAELGADLAISPKATLGVGY
FT                   TGEFGSRSRQQTATLQGRWAF"
FT   CDS_pept        complement(472024..472620)
FT                   /transl_table=11
FT                   /locus_tag="BAV0467"
FT                   /product="putative membrane-associated phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48072"
FT                   /db_xref="GOA:Q2KYT3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYT3"
FT                   /inference="similar to DNA sequence:INSDC:AE001441.1"
FT                   /inference="profile:HMMPfam:PF01569"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48072.1"
FT                   /translation="MTFRDILRLPLSYPAARLKLLGLGWCLAIAAMVFPYDHDKHVSPD
FT                   APAAAWAVEHVGRHLNTLMQISMPLLTRDWVGLKQLLVVAITAAATVHGLKRLLNDVEI
FT                   AGNRLGQRPHSASSKHNMPSGHSSLAASGAWFVARRYGLIFLWILAPMTLMTMGARVML
FT                   DAHTIWATLAGALLGILLTDLFTTARHKRLRPANV"
FT   CDS_pept        complement(472617..474203)
FT                   /transl_table=11
FT                   /locus_tag="BAV0468"
FT                   /product="putative membrane-associated sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48073"
FT                   /db_xref="GOA:Q2KYT1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYT1"
FT                   /inference="similar to DNA sequence:INSDC:AE017147.1"
FT                   /inference="profile:HMMPfam:PF00884"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48073.1"
FT                   /translation="MRLAPPTPVSLASFRTPPACSRTAFAALFVLLNSLLFIWPLLRYA
FT                   ARHNDGHINILITLILTQAGLSFLLLALFALLSRRAAKLAAALLLIGNAIALYFINTYG
FT                   VLIDRAMMGNVLSTDWAESSELLHPMLGFYVLVLGLLPAALLWRLRLRSGGRLHLAASA
FT                   GTVLLALLAWLYAASGSWLWLDQHAKRLGGLVLPWSYLVNTVRYASHEAGQQTVQRLLP
FT                   DAALPPPLAEKEVVVLVIGEAARAANIAHYGYERDTNPYTRDTTLLALPGARSCATYTT
FT                   ASLACMLSHKGDAASLPVSDEPLPSYLSRQGVDVIWRGNNSGEPRIAVNTYEQRGDIAQ
FT                   DCPECDGHDADLLHGLAKRIQASTSERVFVVLHLAGSHGPAYHRKHPPAFTAFTPVCRS
FT                   VQPSECSSESLINAYDNTLVYTDYVLGSLIGMLSSLPYPATLLYAADHGESLGEHGWYL
FT                   HGAPNALAPDVQRDIPFYLWLSDSHPRLRLPTQAPDDLSHNHVFHSVLGAFGMQSPIYQ
FT                   PEHNLFREKTP"
FT   sig_peptide     complement(<474122..474203)
FT                   /locus_tag="BAV0468"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        474353..474862
FT                   /transl_table=11
FT                   /locus_tag="BAV0469"
FT                   /product="putative heat shock lipoprotein"
FT                   /note="This CDS is also similar to its adjacent
FT                   CDS,BAV0470, 36.875 38dentity (39.0730ngapped) in 160 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48074"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYT0"
FT                   /inference="similar to sequence:UniProtKB:P52644"
FT                   /inference="profile:HMMPfam:PF03724"
FT                   /protein_id="CAJ48074.1"
FT                   /translation="MSLPRAMLCAGLLALSAGCATHTGQARPVGSAAANAATSADSLAQ
FT                   TRWELTRWTDALGNQRDITKGGEPISLTFLADGKQYTVHGFSGCNRYSGSYKLEADKLS
FT                   ITAPASTRMACPDPQQAQLESDYLRALAAIRSFTLDASGAPRHLTFNVATGDVLEFSRR
FT                   EDASNL"
FT   sig_peptide     474353..>474458
FT                   /locus_tag="BAV0469"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    474377..474409
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        474935..475447
FT                   /transl_table=11
FT                   /locus_tag="BAV0470"
FT                   /product="putative heat shock lipoprotein"
FT                   /note="This CDS is also similar to its adjacent
FT                   CDS,BAV0469, 36.875 38dentity (39.0730ngapped) in 160 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48075"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYS8"
FT                   /inference="similar to DNA sequence:INSDC:CR378667.1"
FT                   /inference="profile:HMMPfam:PF03724"
FT                   /protein_id="CAJ48075.1"
FT                   /translation="MPAIFRPLCYLTLLLGLAACASRPAPPPVMGQQVGQQSDVFAQTS
FT                   WELARWTRPGGALRPVPHAHSGQRPITLVFTQDRGRGQMGGVAGCNSYSSQYVVANGQL
FT                   LVQSPPVVTYMACPTDTMQLEQDYLAGLTGITASHLNDVTRPERLTLTLASGDVLDFVR
FT                   LANRAPR"
FT   sig_peptide     474935..>475025
FT                   /locus_tag="BAV0470"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    474962..474994
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        475489..476217
FT                   /transl_table=11
FT                   /locus_tag="BAV0471"
FT                   /product="rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48076"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYS7"
FT                   /inference="similar to sequence:UniProtKB:Q8XXB0"
FT                   /inference="profile:HMMPfam:PF00581"
FT                   /protein_id="CAJ48076.1"
FT                   /translation="MSIVNIAAYKFVSLPDTVLLREALQERADALGLKGTILLAPEGIN
FT                   LFLAGSGEAIEAFLAGLRADARFADIEVKYSTSADVPFGKMRVRLKREIIRMNHPAIRP
FT                   EAGRAPSVNAHTLARWLEQGRDDDGREVVMLDTRNAFEVDVGTFRNAIDWRIDRFTQFP
FT                   DAVREHRAELEGKTVVSFCTGGIRCEKAAIFMEDIGIAHVYQLEGGILKYFEETGGPGY
FT                   DGACFVFDERHALDPALKPV"
FT   CDS_pept        complement(476289..478364)
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="BAV0472"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48077"
FT                   /db_xref="GOA:Q2KYS4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYS4"
FT                   /inference="similar to sequence:UniProtKB:P00959"
FT                   /inference="profile:HMMPfam:PF01588"
FT                   /protein_id="CAJ48077.1"
FT                   /translation="MSRTLFVTTALPYANGSFHIGHIMEYIQADIWVRSMRMAGHTVHF
FT                   VGADDAHGAPIMLKAEKEGITPQALVARYAAERPRYLDGFHIRFDHWHSTDSAENVALS
FT                   HEIYRALKAAGLIETRSIEQFFDPVKGMFLADRYIKGECPRCHAKDQYGDSCEVCGAVY
FT                   APTELIQPYSALTGATPVLKRSDHFFFKLSDPRCVEFLQQWTTGSNRNGIKHLQSEVQA
FT                   KTREWLGGEEGEAKLGDWDISRDAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKSYCDK
FT                   IGLDFDALLDPSSATEQVHFIGKDIIYFHALFWPAMLKFAGRKTPDALNVHGFITVSGE
FT                   KMSKSRGTGISPLRYLEVGMDPEWLRYYMAAKLNARVEDMDFNPEDFIARVNSDLVGKY
FT                   VNIASRAANFITRHFEGKLAYLGDTAALSAEFAQQTESIRAALEAREFNRAIREIMAYA
FT                   DGINQAFDAAQPWVLAKGFAEADEARRAQLQDICSRALAGFKALSVMLAPVLPALTSRV
FT                   ARDLFGAQRDFIWSDAADLPAQVAPFKHLMQRVDPQMLDALFEPPAELAAPAPTPGGEA
FT                   LADTISIDDFVKVDLRIAKIINCEEVEGSTKLLRLTLDAGEGRHRNVFSGIKSFYKPQD
FT                   LIGKLTVLVANLAPRKMKFGVSEGMVLAASHADEKVDAGIYVLEPWPGAQPGMRIH"
FT   misc_feature    complement(478296..478331)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS_pept        complement(478540..478812)
FT                   /transl_table=11
FT                   /locus_tag="BAV0473"
FT                   /product="putative exported protein"
FT                   /note="This CDS seems to be present in the Bordetellae
FT                   only"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48078"
FT                   /db_xref="GOA:Q2KYS1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYS1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48078.1"
FT                   /translation="MTNALIRFLRAIPIILLGLIGTLMALVFMASTVIALGILYLVAKV
FT                   RGKPFGVRAYWSQRQANRPFQGPFPGASAPTRTQDVIDVEAREIR"
FT   sig_peptide     complement(<478704..478812)
FT                   /locus_tag="BAV0473"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        478915..480009
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="BAV0474"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48079"
FT                   /db_xref="GOA:Q2KYR9"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYR9"
FT                   /inference="similar to sequence:UniProtKB:P21590"
FT                   /inference="profile:HMMPfam:PF01656"
FT                   /protein_id="CAJ48079.1"
FT                   /translation="MSITIDQIRAALRGVSDPITGLSLGASVKDRDIHIENGRVRLLIE
FT                   QGYPGLAAQARLAELARDALAAVGVDQAEIAVKVAVQAHAVQRGLKPLPNVRNIIAVAS
FT                   GKGGVGKSTTSVNLALALAAEGASVGVLDADIYGPSIPTMLGITGRPESLDNKSMEPLV
FT                   GHGIQANSIGFLIDADSPAIWRGPMVTQALEQLLRQTNWRDLDYLIVDMPPGTGDVALT
FT                   LAQKVPVVGAVIVTTPQDIALLDARKGLRMFQKVEVPILGVVENMAIHVCSQCGHAEHI
FT                   FGEGGGQRMAAQYEVPWLGSLPLTLAIREQTDAGAPTVVADPQSEAAGLYREIARKVAA
FT                   QVAALPRDMAGRMPSVVVQQQRPS"
FT   misc_feature    479227..479250
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    479518..479568
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01215"
FT   CDS_pept        480012..481865
FT                   /transl_table=11
FT                   /locus_tag="BAV0475"
FT                   /product="putative surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48080"
FT                   /db_xref="GOA:Q2KYR5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYR5"
FT                   /inference="similar to DNA sequence:INSDC:BX321859.1"
FT                   /inference="profile:HMMPfam:PF01103"
FT                   /protein_id="CAJ48080.1"
FT                   /translation="MRGSRAAVVLAALVYVSHAQAKPEIIIDPGGVTPQSLKVITEAVD
FT                   AIARLAEDQDGGETTRLRRRARDATVAALATQGYFSPTVTLAPGTDVAGDTWDITIGPG
FT                   PRATIRSVDLQFTGRVLRPEYAARIAQWREDWSLKVGQPFINDNWSKAKATLLDNVSAR
FT                   DFMLAAMTGSQADVYAEDAKVDLKVVIDSGPLVRLGALQTQGLERVPESLVTRYVRYDK
FT                   GAPYNQEQLDDWQQELQSTAFFRGAFVTLRRSGAQPVQTEAPPPSGLPADVKTQPVPAV
FT                   APQVYDSDGELTLPVDVRVVEAPPKALTVAVGFDDTAGARFETLYRQNVVFGLPLTMET
FT                   GVGADRLQQRAFMDFTLPPDARGRRNSIGVLAQHSDIQGLDVTRYALGFTQAQDRKAAG
FT                   DSRVEYETRWGGLLAHDHVQIDGGPTYDLPTATLTADWLRRDVDSKYDPREGNLIAAGA
FT                   GLGAVLDNGDPYLRLRLRGQKWWPVGQRDVLTLRGELGRVWSNSKTHVPDDFGFRTGGA
FT                   RSIRGYRYQSIGLKRNSATVGAPTLAVASVEYDHYFDERWGIGFFVDAGDAAESFGSMD
FT                   LAVGYGVGARVRTPAGPLFLDVAYGQRERDLRLHFSLGIAF"
FT   sig_peptide     480012..>480072
FT                   /locus_tag="BAV0475"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        481862..485482
FT                   /transl_table=11
FT                   /locus_tag="BAV0476"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48081"
FT                   /db_xref="GOA:Q2KYR2"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYR2"
FT                   /inference="similar to DNA sequence:INSDC:AL646069.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF04357"
FT                   /protein_id="CAJ48081.1"
FT                   /translation="MIKLRAVLRHVLVWWLPGLAMLAALAASFVLWLVATQNGSRLLLT
FT                   SAVQLLDGQIENIEGSVLRGLRIGKLDVTVAATQVRADDLGLDVDWRALGQGRAHVRAL
FT                   TAANLAIGLPPSEEAGAKPPQESGLPESLSLPVSIDVDRLAVGRFSLTQAGKPLPVALS
FT                   DIVLALHVQRDKAARLAVESLRVDHDEGQLRLNGVLDLHELAAPWPLSAQIEARAAATR
FT                   PDSTLCVEWDHAGRKREEAAAKAGELGAYLMTQPQAQHQAAALLGRDAVIDDTGRQRWL
FT                   ETLDQMCPVTVSVRAQGSMDQLALTLKGDGGGIAIDAQAALAPLAAFPLRGARVDIKRD
FT                   DGSGLSATLDWQTAEQAGAPDHVKAELRADRLDLRRLVGDRLPQALLSAQAEVQAEVLN
FT                   LSELLSASVRLNIAPDSRWNQQALSGAVKADLRAGGGALAPGLPAGWRLPMLDIDLTLG
FT                   KNRILAQGELQAQRARLMLDARAPELAAFWPDLPGGAVLKATLDGDAAHHRGKLDARYT
FT                   PPGAQPKLLGRAPVEARLAFDGGWAEQDGQAGWRGKLTGLSAQSAGFTVAIPGAMALAY
FT                   LPDAPQWQWQVGAAQIQAVFPDKQSLVLSHAGSRGGPERWESAGRANNFVLRASMVRQL
FT                   MQALEPEAGAAAKVNAVTADVQRRIALDFSWDLKYDQALSGRVRLARRDGDLQIPGDPP
FT                   IPLGLKTLQLDLSATPGGGNASRINAALALTTEHMGDVKATASTQLRGLTLPPNQAIRA
FT                   EVSADIADLAWVGLFVSDTLELGGSLRANVRADGSLGGAWKASGSIEGDKLRMVRIDDG
FT                   VRLMDGTLRARLDGDRVVLESLRFPAVLRVMPDEWRTKEWITTNPGAKGGYLEAKGDWN
FT                   LAESAGRVGVTLYRFPALQRSDRYAMVSGKVDIDAALPRVSIDGSITADAGWFSLEILQ
FT                   GVPTLDDDVRVVHPGQSLKAGPPIQLSMDLKVDMGPRFYITGMGLDAGLVGSIQILMQD
FT                   GRLSGIGALHTRDGGIEAYGQKLRLRRGTLTFQGRLDNPLLDIEALRTGKAVEAGVRVA
FT                   GTAQRPRIDLVSYPDVSDVEKLSWLVLGRGPDAGGGDTALLLSLGTSLLSGKGPPLYKQ
FT                   FGLDDVSMRTGAIGSSGSVLPDRTVASSVNRDADADLATQFLVASKNFANGITLSVEQA
FT                   MSGSETVGRASYALAKGLSLDLKGGSVNGIELVYRWLGGQ"
FT   sig_peptide     481862..>481937
FT                   /locus_tag="BAV0476"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    481868..481990
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00041"
FT   CDS_pept        485531..486094
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /gene_synonym="dus"
FT                   /gene_synonym="paxA"
FT                   /locus_tag="BAV0477"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48082"
FT                   /db_xref="GOA:Q2KYR0"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYR0"
FT                   /inference="similar to sequence:UniProtKB:P28248"
FT                   /protein_id="CAJ48082.1"
FT                   /translation="MSIKSDRWIRRAAEGGMIEPFEAGQVRTVNGGRIVSYGTSSYGYD
FT                   VRCADEFKIFTNINSTIVDPKNFDEGSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVL
FT                   TICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPAKIYAGEGCAQMLFLESDE
FT                   VCETSYRDRGGKYQGQRGVTLPRT"
FT   CDS_pept        complement(486095..486610)
FT                   /transl_table=11
FT                   /locus_tag="BAV0478"
FT                   /product="probable acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48083"
FT                   /db_xref="GOA:Q2KYQ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYQ4"
FT                   /inference="similar to DNA sequence:INSDC:AL646077.1"
FT                   /inference="profile:HMMPfam:PF00583"
FT                   /protein_id="CAJ48083.1"
FT                   /translation="MSSACIRPLGPESAASFQALRLAALCDTPDAFGSSYEEEQRLTTQ
FT                   EWAGRITPTSASLVLGAWEAERLVGCAGLYRLSPLKQQHKAVIWGVYVAPAQRGAGLGR
FT                   QLILSAIDHARQWQGLRQLLLTVNSSKLAACQLYRSLGFKAYGHEPAALYIDGRPIDET
FT                   LMLKPLDD"
FT   CDS_pept        486690..487145
FT                   /transl_table=11
FT                   /locus_tag="BAV0479"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48084"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYQ2"
FT                   /protein_id="CAJ48084.1"
FT                   /translation="MFGLFKKKAQAVLPNPEVQAEFIDRVSQAAADFLAALSDTQGLDY
FT                   QPASVALLDRVAARVRAGTLSLSPIQRVGMAAYLYEVARRAHGGQYEVCDNDDPVVLVI
FT                   GEPVFDVCLCGISRVESTLQGRVQEPLAVFYGRFEAAVRAARPALLR"
FT   CDS_pept        487302..489569
FT                   /transl_table=11
FT                   /gene="adiA"
FT                   /locus_tag="BAV0480"
FT                   /product="biodegradative arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48085"
FT                   /db_xref="GOA:Q2KYQ0"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYQ0"
FT                   /inference="similar to sequence:UniProtKB:P28629"
FT                   /inference="profile:HMMPfam:PF01276"
FT                   /inference="profile:HMMPfam:PF03711"
FT                   /protein_id="CAJ48085.1"
FT                   /translation="MKFRFPIFIIDEDFRSENASGLGIRALASAIEAEGVEVIGVTSYG
FT                   DLSSFAQQQSRASAFILSIDDEEFDVDSPEDVASAIKNLRTFIGELRFRNADIPIYLYG
FT                   ETRTSEHIPNDILRELHGFIHMFEDTPEFVARHIIREARSYVDSLPPPFFRELVKYAQD
FT                   GSYSWHCPGHSGGVAFLKSPVGQMFHQFFGENMLRADVCNAVDELGQLLDHTGPIAESE
FT                   VNAARIFHADHCYFVTNGTSTSNKVVWHANVAAGDVVVVDRNCHKSILHAITMTGAIPV
FT                   FLRPTRNHLGIIGPIPLEEFDPENIRKKIEANPFAREAKNKNPRILTLTQSTYDGVIYN
FT                   VEMIKEKLGSYVDTLHFDEAWLPHASFHEYYQDMHAIGQDRPRSKDAMVFATHSTHKLL
FT                   AGISQASQIIVQESESRKLDRNVFNEAYLMHTSTSPQYAIIASCDVAAAMMEPPGGTAL
FT                   VEESIREALDFRRAMRKVESEYGKKDWWFKVWGPNRLVSEGIGNRDEWMLQANDHWHGF
FT                   GELAEGFNMLDPIKATIITPGLDMSGSFGETGIPAALVSKYLTEHGVVVEKTGLYSFFI
FT                   LFTIGITKGRWNTLLTALQQFKDDYDRNQPLWRILPDFCREHRKYERLGLRDLCQMIHE
FT                   AYRERDVARLTTEMYLSDMVPALKPSDAFARMAHREVERVEIDQLEGRVTGVLLTPYPP
FT                   GIPLLIPGERFNRTIVQYLQFAREFNERFPGFETYIHGLADEVGPDGAKRYYVDCLKEG
FT                   DA"
FT   misc_feature    488475..488519
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00703"
FT   CDS_pept        489630..490817
FT                   /transl_table=11
FT                   /locus_tag="BAV0481"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48086"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYP7"
FT                   /inference="similar to DNA sequence:INSDC:AE009028.1"
FT                   /inference="profile:HMMPfam:PF03486"
FT                   /protein_id="CAJ48086.1"
FT                   /translation="MFDVAIVGAGAAGMMCAAVAGQRGLSVVLIDHASRLAEKIRISGG
FT                   GRCNFTNLGTSPGQFLSENPHFCRSALAGYTPQDFLSLMREHRIAWHEKHRGQLFCDNS
FT                   SEDIIEMLRSECDRGRVSWRMPCAVREIAREGETWALATDGGAIRAGKLVIATGGMAIP
FT                   QLGATDYGLKIARQFGLKVVEPRPALVPLTFDPQQWQAFAELSGLALEVSLATGEGKAR
FT                   GEFLEDLLFTHRGLSGPAILQISSYWKPGTQIRIDLAPGRDLGDELLAAKSGARQQLHT
FT                   LLSGLWPKRLADTWLAAEPGLAHARLADVPDRRLRELAVGIHAWSLIPTGTAGYKKAEV
FT                   MRGGVDTRGLDQKSMQARAVPGLYFIGETVDVTGWLGGYNFQWAWASAAACGRAL"
FT   sig_peptide     489630..>489687
FT                   /locus_tag="BAV0481"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(490814..491887)
FT                   /transl_table=11
FT                   /locus_tag="BAV0482"
FT                   /product="LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48087"
FT                   /db_xref="GOA:Q2KYP4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYP4"
FT                   /inference="similar to sequence:UniProtKB:P06964"
FT                   /inference="similar to sequence:UniProtKB:P15039"
FT                   /inference="profile:HMMPfam:PF00532"
FT                   /protein_id="CAJ48087.1"
FT                   /translation="MASNPMKPSIRRPTLADVAKLAGVSLGSASRALSVPNEVKPATLE
FT                   RVNRAVAQLGYIRDGAAAALASRRTRTVGAVYPTLNNPIYAHSTHSMQQTLWEMGYQLL
FT                   IASHEYHIDDEAAVLRATVERGVDGIIMVGTDHSEEVFALLHQRSLPYVLTWSVDDSNY
FT                   PHCVGISNYTAAYDLARCVLARGHTRVGICGGPIERNERARGRRNGVLGALREQGLSVP
FT                   AEWINEQPFSFEGGRQAIREYWSRPERPSVIFFGTDLLAMGALHECRRLGIAVPEQLSI
FT                   VGFDGIDEGEMMQPELTTVSIPAQEIGRRAARHIVDLIEDREPASSGPLPHTVLERGSL
FT                   GAPATAPRRAAKTETRA"
FT   misc_feature    complement(491789..491845)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00356"
FT   CDS_pept        492125..493339
FT                   /transl_table=11
FT                   /locus_tag="BAV0483"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48088"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYP1"
FT                   /inference="similar to sequence:UniProtKB:P04816"
FT                   /inference="profile:HMMPfam:PF01094"
FT                   /protein_id="CAJ48088.1"
FT                   /translation="MEVAKVCARLLAGMSVALGLTATTLAADEIKMGALFPFSGGLAQL
FT                   GDESYRGLQMAIEERNAKGGLLGKQIVLVKADAVDANQAVGEARRLTSVENVAAVFGSF
FT                   SSALSFAATQVTELAGVPFLELGAVSDSVTDRGFKYVFRSNSTARDFANGTIEGVVDVI
FT                   GPALKTDPKALRLAIIHEDGLYGKTIAGFQQERAKALGLNVVEVLPYSAKAVDLSSLIL
FT                   RLRGAKADVVLQTSYQNDTMLYFRQAKSAGFKPRAVIGAGGGYSLSDTAKALGGEMDGA
FT                   FDVDFPQFAMNEKGAPGLSDFVTVYKKRFNSEPRSGHSLVNYVGAKAFLDAIEQAGSLD
FT                   KDKVRAAVLAYKQPVGSNAAGWGFDFGENGQNRAATTTLMQWQDGKLVTVWPKAAAVTE
FT                   PIIKR"
FT   CDS_pept        493392..494264
FT                   /transl_table=11
FT                   /locus_tag="BAV0484"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48089"
FT                   /db_xref="GOA:Q2KYN8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYN8"
FT                   /inference="similar to DNA sequence:INSDC:AE014538.1"
FT                   /inference="profile:HMMPfam:PF02653"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48089.1"
FT                   /translation="MDILLQLIVNGLLLGGAYAIISIGLTLIFGVVRVVNFAHGEFLMV
FT                   GMYATYLLAMNLGWHPYVSLAPVALLLFVIGAAMQRFVVQPLLDADGHIQIFATVGVST
FT                   ALMNLALLVFGADVRATPVELGTGIISLGSISVVSGQLITLIAALALAGGMHWFMTRTY
FT                   LGRAFRAVAQHRNAAALMGVNVRGIYVLAFGIGSAFVGVAAALLTPQYPVFPTIGTYFV
FT                   LTAFVIVVLGGMGSLFGALLGSMLIGLVDSLAGYYIAPDLKEVVYFAIFLLILVLRPTG
FT                   LFGLGRGSE"
FT   misc_feature    494043..494105
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00079"
FT   CDS_pept        494277..496058
FT                   /transl_table=11
FT                   /locus_tag="BAV0485"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48090"
FT                   /db_xref="GOA:Q2KYN7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYN7"
FT                   /inference="similar to DNA sequence:INSDC:AE001863.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF02653"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ48090.1"
FT                   /translation="MFPDIRRPRVYVGLLALSLLLIIPLLIQSPFAYHLFVLICLYGAL
FT                   ATAWNIVGGYAGQLSLGHAVFYGVGSYAATLLVINFGISPWIGMFVGMALAALVALLIS
FT                   YPTFRLRGPFFALATIAVLEVVKLLVVNQDSWTGGAAGLSVPLNIGLEWMIFREKWAYL
FT                   LVAFGMLAITIWVAWAIRHSRLGFYLVAVREREYAAPAVGIDTVRVKLAAAVISAMLTA
FT                   MVGSFHAMYLTFIEPSAAFSLELSIQIAMFALIGGLGSVAGPLAGTVLVVPIAELARGW
FT                   LGAFGSGMHGFIYGVILVLVVLTMPRGIVGQFGARVRAWVDRLPGPTESPVAPAAAPTL
FT                   AQSAGVGTPILKAESLNKHFGGLHATNNVSLTLNEGEILGVIGPNGAGKTTVFNQLSGF
FT                   IRPDSGTVSVRGPAGWEQPADSRAFARAGVGRTFQIAQPFAGLSVLENIMLGAFLHTSD
FT                   RREAEAIARQVADLTELTASLDAEARSLTVGGLKRLEVARALATRPRILLLDEVMAGLN
FT                   PTDVERAIRMVRRVRDAGVSVLLIEHLMQATMALSDRILVINLGQVLISGTPEAVVNDP
FT                   QVIEAYLGKEYLHAQNS"
FT   sig_peptide     494277..>494418
FT                   /locus_tag="BAV0485"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    495423..495446
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        496042..496746
FT                   /transl_table=11
FT                   /locus_tag="BAV0486"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48091"
FT                   /db_xref="GOA:Q2KYN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYN3"
FT                   /inference="similar to DNA sequence:INSDC:AE014538.1"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ48091.1"
FT                   /translation="MLKIRDLSAGYGKSEVLQGISLDVPEGKVVTLIGANGAGKTTTLK
FT                   TLCGLIRPSAGTIEFEGRQIAGETPHQIVERGITMIPEGRQLFPFLTVRDNLLMGAYKR
FT                   SARPVAQERLEEVLTLFPRVRERLDQFAGSLSGGEQQMVAIARGMMACPRLLIFDEPSL
FT                   GLSPLLVEQMFAVIRDVVRQGITVLLVEQNVYHTLKLADMGYVLENGRIALSGSGEELL
FT                   NSPHVRRAYLGH"
FT   misc_feature    496141..496164
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    496444..496488
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        496743..497318
FT                   /transl_table=11
FT                   /gene="dad"
FT                   /locus_tag="BAV0487"
FT                   /product="putative 2,4'-dihydroxyacetophenone dioxygenase"
FT                   /EC_number="1.13.11.41"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48092"
FT                   /db_xref="GOA:Q2KYN1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYN1"
FT                   /inference="similar to DNA sequence:INSDC:AJ133820.1"
FT                   /protein_id="CAJ48092.1"
FT                   /translation="MNTAQTRKEIFIMSGNIHRPDEQAIAYRLPQAPDMMRDLVHPGVA
FT                   TDWLADDNLWVPSSATVSFKPLLFSASQGYYINLLRVRGSGVVSRHRHTGPVHAMVLKG
FT                   RWYYLEHDWVAEQGGYAFEPAGETHTLFVPEDVPEMITWFHVTGGYTYVDPEGVAQGYE
FT                   DVFTKIETARKHYRSLGLPDDYVKQFIR"
FT   CDS_pept        497332..498099
FT                   /transl_table=11
FT                   /locus_tag="BAV0488"
FT                   /product="probable short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48093"
FT                   /db_xref="GOA:Q2KYM8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYM8"
FT                   /inference="similar to DNA sequence:INSDC:AE009721.1"
FT                   /inference="profile:HMMPfam:PF00106"
FT                   /protein_id="CAJ48093.1"
FT                   /translation="MQQDHEGRVVLVTGGLRGIGQAIVAAYAERGAAVGVVDLDEEAGL
FT                   RQAAELQAQGVRAAFAAADVGDFEACRRAVASLSETLGMPDTLVCNAGISPKHAGRPAP
FT                   VHEMDPTEWRRVVAVNLDSAFYFSHLLAGSMIQRGFGRIVLMSSVAGKVYLDMVAAHYS
FT                   ATKAGIAGLTRHLAGELGPHGITVNALAPGRIDTPLVRGVADGVNDEVVARTPLRRLGR
FT                   PAEVADTCLYLTSAQASFVTGQVIDVAGGWVMS"
FT   misc_feature    497776..497862
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        <498096..499193
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="BAV0489"
FT                   /product="probable alcohol dehydrogenase"
FT                   /EC_number="1.1.1.6"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48094"
FT                   /db_xref="GOA:Q2KYM7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYM7"
FT                   /inference="similar to sequence:UniProtKB:P32665"
FT                   /inference="profile:HMMPfam:PF00465"
FT                   /protein_id="CAJ48094.1"
FT                   /translation="VIAGMGFPGRYVQGPGALAHLGELLAELGWSRPTVVVDPAVAPLA
FT                   AVLMADMPRLPFAGECSSETIAALAAAVPPDRDCLLAFGGGKTIDAAKGVARERGLPIV
FT                   VCPSAASSDAPTSRLIVRYDAEHAVAGVDKLRRNPDAVVVDTDVIVRAPAHLFAAGIGD
FT                   ALSKAFEVRACVAAGGRNAYGYRATDTAQGLARLCLEVLLARGVPAMQAVRAQRGGADV
FT                   EAVVEATVLLSGLGFESGGLSLAHALIRGLTTVPELAVRLHGELVAFGTLVQMAAMGCP
FT                   AAEAGPVLGLMRAVGLPDCLAALGLQRELNEAQWRRLIEATLATDYSRHLVPALTPARL
FT                   RAALDVAQAWATAEDGCASSAGDNQ"
FT   misc_feature    498519..498605
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00913"
FT   CDS_pept        499190..500245
FT                   /transl_table=11
FT                   /locus_tag="BAV0490"
FT                   /product="probable alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48095"
FT                   /db_xref="GOA:Q2KYM4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYM4"
FT                   /inference="similar to DNA sequence:INSDC:AB006902.2"
FT                   /inference="similar to sequence:UniProtKB:P42327"
FT                   /inference="profile:HMMPfam:PF00107"
FT                   /protein_id="CAJ48095.1"
FT                   /translation="MKSMQVTEFGQPLVAAESPTPVPRGREVLLRVRAAGVCHTDLHLW
FT                   HGGYDLGHGRTLSLKERGVTLPLTMGHETVGMVEAVGEDAGEVPVGALRLIYPWVGCGE
FT                   CEVCREGRENLCLTPRTIGINRAGGYADYIVVPDPRYLVDLHGLDPVRAAPLACSGLTC
FT                   FSALRKIGEDVLARGPIVVVGAGGLGLMCLKLLQALGLPGAVMVELDAAKREAALQAGA
FT                   LAAIDPTRPDAAQAIRDAVGGPVRAVLDLVANPASAALGFDLLTKGGRLVLVGLFGGAA
FT                   PWPLPLIPIKSITIQGSYVGSLPELRELVALVARERLELIPVATCGMSALGEALRDLEA
FT                   GRVVGRVIMTP"
FT   misc_feature    499400..499444
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00059"
FT   CDS_pept        500603..501703
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="BAV0491"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48096"
FT                   /db_xref="GOA:Q2KYM2"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYM2"
FT                   /inference="similar to sequence:UniProtKB:P27248"
FT                   /inference="profile:HMMPfam:PF01571"
FT                   /protein_id="CAJ48096.1"
FT                   /translation="MSASLKHTPLAETHLAAGARMVDFGGWEMPLAYGSQLEEHHAVRQ
FT                   DAGMFDVSHMLNADITGPDATAFLRYLVANDVARLNTPGKALYSCMLNPQGGVIDDLII
FT                   YYFAPDSWRVVVNAGTAEKDMAWMARVAAAGNFDVVITPRRDLAMIAVQGPNARAKVWA
FT                   ARPAWQPASEGLGPFTAAILPEDTLVARTGYTGEDGFEIVLPASAAVALWQDLVAQGVR
FT                   PCGLGARDTLRLEAGMNLYGQDMDELVQPNQAGLSWTVSLKDAERRFIGRDALEQFATP
FT                   CAFLGLKLSERGVMRAHMAVRTPQGMGLTTSGTMSPTLGVSIAFARLPLDVQPGSAVEV
FT                   DIRGKWVPALVCKLPFVRNGKAVEHS"
FT   CDS_pept        501780..502157
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="BAV0492"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48097"
FT                   /db_xref="GOA:Q2KYL9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYL9"
FT                   /inference="similar to sequence:UniProtKB:P23884"
FT                   /inference="profile:HMMPfam:PF01597"
FT                   /protein_id="CAJ48097.1"
FT                   /translation="MSLPTDRKYTTSHEWVKAEGDVFVVGITENAQDQLGDLVFVGDVS
FT                   VGANLKAGETAGVVESVKAASDIYAPVDGVIVAFNDELEANPNLINESAFTAWIFKIKP
FT                   LNAADADKLLDAAGYEAVANG"
FT   CDS_pept        502209..505076
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="BAV0493"
FT                   /product="glycine cleavage system P protein"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48098"
FT                   /db_xref="GOA:Q2KYL7"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYL7"
FT                   /inference="similar to sequence:UniProtKB:P33195"
FT                   /inference="profile:HMMPfam:PF02347"
FT                   /protein_id="CAJ48098.1"
FT                   /translation="MSRALDTHSDFIPRHIGPSEADQAKMLATIGCSSLDALLEEVVPP
FT                   RIRNQAPLALPGARSEPDVLAELKQMAARNKVFRNYIGQGYYGTHTPNVVLRNVLENPA
FT                   WYTAYTPYQPEISQGRLEALLNYQTMVADLTGLDISNASLLDEGTAAAEAMTLARRSAK
FT                   SKSAVFFVSQHCHPQTIEVVRTRAQGLDIDVLVGDESQGLPECFGVLLQYPHSLGGVVN
FT                   YRELAEAAHAQGAVVACATDLLALALLTPPGEWGADIAVGTAQRFGVPFGFGGPHAGFM
FT                   ACRDAFKRNMPGRLVGVSKDAQGNPALRLALQTREQHIRREKATSNICTAQVLLAVMAG
FT                   LYAVWHGPAGLRRIATRVHTFAGVLRQHVQALGLTVENDSYFDTLLINTGPATPAVLRA
FT                   AECAHINLRRVDAGRVAVSIDETVTVEDLQALINVFAAGLGKDDITLDAATLAPEAGLP
FT                   AGTVRTSPILSHPVFSSVQSETDMLRYLRKLADKDLALDRSMIPLGSCTMKLNATAEMI
FT                   PITWPEFALIHPFAPADQTAGYRELIERLSAALCEITGYDNISLQPNSGAQGEYAGLLA
FT                   IRGYHQARGEHQRNICLIPSSAHGTNPASAQLAGMDVVVVASDDHGNVDLDDLRAKIEQ
FT                   VGDRLAALMITYPSTHGVFEETVTEICERVHAAGGQVYLDGANMNAMVGVAKPGKFGSD
FT                   VSHLNLHKTFCIPHGGGGPGVGPVAVRAHLAPYLPGVLNEQGKLDAEAKVGPVSAAPYG
FT                   SAGILAIPFVYISLMGAEGLRRATEVAILNANYVATRLREYYPVLYAGRHGRVAHECIL
FT                   DIRPLKESIGISAEDIAKRLMDYGFHAPTMSFPVAGTLMVEPTESEGLAELERFIDAMI
FT                   AIRAEVAQVERGERDREDNVLKNAPHTAQMLLAEEWHHAYPRQQAAYPLASLRDGKYWP
FT                   PVARVDNAYGDRNLVCSCLPIEAYI"
FT   CDS_pept        complement(505172..505996)
FT                   /transl_table=11
FT                   /locus_tag="BAV0494"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48099"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYL3"
FT                   /protein_id="CAJ48099.1"
FT                   /translation="MSFTARLSAAAKWPAWRARRTLWKINKRRYRPSFGPAYAPGLALR
FT                   SMGTAYGGWTFVDDPQLRCAHIISCGLGTDASFDIKFATHYGASTLIVDPTPSAIRHFR
FT                   AIEARLGEPAALPYPKKGNIPAEAYDLRAIRPGQLRLAPTALWVEAGNIRFYAPPDNGV
FT                   SHSINNYGNHYRHDTPYIEVAAAPLDILMRDYGLSVPPLIKLDIEGAEIEVIHDMMEKG
FT                   IFPQQILVEYDELARPSARNQARIQDAHHALLAHGYLLVHCDGHMNFTYWRN"
FT   CDS_pept        complement(506233..508119)
FT                   /transl_table=11
FT                   /locus_tag="BAV0495"
FT                   /product="putative exported protein"
FT                   /note="This CDS is also similar to its adjacent
FT                   CDS,BAV0496, 35.041 38dentity (36.0760ngapped) in 488 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48100"
FT                   /db_xref="GOA:Q2KYL1"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYL1"
FT                   /inference="similar to DNA sequence:INSDC:BX571866.1"
FT                   /inference="profile:HMMPfam:PF06097"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48100.1"
FT                   /translation="MKKRVAITSGVVIVGVGAWLGATWYTGKRIEEQTHQYLAQANEKL
FT                   ANVLPGLTIRLEQDRYDRGFFSSQARYTLSFTADKDDETPLAISFKSDIAHGPFPGGAI
FT                   KRGKFLPQLAFVHSELESNEQIKPLFDMAQGKTPLWSNAIISYDGVVDDQAGIAALSLN
FT                   KDGGAIDFSGAAINTVYDYRTQAVKGRLQADQLLVDVPKGDTPSKASLNGLSLDIDTHL
FT                   GKFGVSVGNSGLLIKRLELQTPNIDQKLLIENLGYAVVVSEDDKFVGGKAVYKVDKVGL
FT                   ADTDLGGGELALSVSHLDGPALKSLSATYKQMMHSLMGAGQADEGQQDEQVASVIENAT
FT                   KLLAANPSLGIDQLVWRNTAGESRFNLALDLTLPPGKDLAALDLSEGASQLVQQLVKSI
FT                   AAELKVSKPMAALLAQQVLTLRGASPEQAKREADETIQGLAGMAEMMALGRNDGDNIIS
FT                   KFNYADGRGELNGKEVPVKEWLAELGNSLGGDDVEEAEETIIFDTLEADMIGALLDEAG
FT                   YDYDYDAATRRFTIDPDGMTPTAISATLICAPDCTTLRMQAVYDDLPVPSPADITRWNE
FT                   EYQTFGRASINKRGKVVLQNDVDVSDGLSLDVLQIYLLTFLAISDDFPEIEE"
FT   sig_peptide     complement(<508056..508119)
FT                   /locus_tag="BAV0495"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(508289..509737)
FT                   /transl_table=11
FT                   /locus_tag="BAV0496"
FT                   /product="putative exported protein"
FT                   /note="This CDS is also similar to its adjacent
FT                   CDS,BAV0495, 35.041 38dentity (36.0760ngapped) in 488 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48101"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYK8"
FT                   /inference="similar to DNA sequence:INSDC:AJ414151.1"
FT                   /inference="profile:HMMPfam:PF06097"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48101.1"
FT                   /translation="MKKSVALTAGVVIVLAGAWLGGTWYTGQRVADESQVRLDQINDYL
FT                   TANFPGEGLKLEQLSYSRGFFSTQARYGLSAGGLPASILKPGARLEIDARVDHGPLPAG
FT                   SLAQGHFLPTMAYVHAQIADTEAARTLFAGAQGKNPLSADAVLKYGGGASVQAEAAPLQ
FT                   LAEPKLSFGGARFDGDLGKQLSTVKGKLSLEPVTLLLPEDEQTTPMLVKLGPSVLDMDG
FT                   KASQYGYHVGSSTLHVDSIDVQAQGEGGGHFAIGGLNYRAIASENGQFIDGQADFGLNS
FT                   LSINGSALGSQQLSLKFARIDGAKVKAFNEVYTRLAAETAAKGRPQDDFDRAQIEQLVN
FT                   AGLPLLADNPTIAIDPLVWKNDKGESRLNLALTLALPAEAQKYDASFVRQAIKNLDLKL
FT                   TLNKPMLTELGSTILQLQGQPPEAAAQQAVRQINNISGMAMMLNLGKLQGNDIISDLHY
FT                   GNGIFSLNGRDMPVDALLGMLPQH"
FT   sig_peptide     complement(<509641..509737)
FT                   /locus_tag="BAV0496"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(509849..511324)
FT                   /transl_table=11
FT                   /locus_tag="BAV0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="This CDS is also similar to BAV0502, 31.846 identity
FT                   (32.84538ngapped) in 493 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48102"
FT                   /db_xref="GOA:Q2KYK6"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYK6"
FT                   /inference="similar to DNA sequence:INSDC:AP003008.2"
FT                   /inference="profile:HMMPfam:PF07171"
FT                   /inference="profile:HMMPfam:PF07364"
FT                   /protein_id="CAJ48102.1"
FT                   /translation="MRWLLAMIKHETNTFSPVPTPLARFFRGSPEILCGERAIRAYEDT
FT                   DSGLGGYIEVARRVGAEIVVPVAAESWPSSPTDAATYEQLCSLILNEVRKGGYDAILLD
FT                   LHGAMVAEGVEDAEGQLLRRLREIDPRTPVGVTLDMHANVYDDIIQNANVVTGFHTYPH
FT                   VDIRESGVRAAEVIVRTLKGEIKPVMRWGNVPMLPHVMCQGTHADPNKSLQARCIELEQ
FT                   GAVLAASVFVGFPHADIREAGLSAVVCTNDDPQAAQAYCDALLDQAWTQREKWVFHPEP
FT                   LEPTIAHAKSLTQGPVVLLDHFDNTGSGGTMDTTTVLAEILRQELENVVFYAICDPQAA
FT                   QEAASAGVGNTITIQLGGKVPMPALKVENRPLAVTGRVKLIFDGVYLNRGPMYRGVRND
FT                   TGLTVVLDTGRVEIIIVSRHQEPFDINCLLSAGIDPLQKRYVVLKSRVHWRAGFASMAS
FT                   EIIECTGTGVTTSDYSQIEFKHVRRPIYPLDTM"
FT   misc_feature    complement(510101..510121)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00307"
FT   CDS_pept        complement(511371..513023)
FT                   /transl_table=11
FT                   /locus_tag="BAV0498"
FT                   /product="putative ABC transpoter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48103"
FT                   /db_xref="GOA:Q2KYK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYK5"
FT                   /inference="similar to DNA sequence:INSDC:BX572596.1"
FT                   /inference="profile:HMMPfam:PF00005"
FT                   /protein_id="CAJ48103.1"
FT                   /translation="MKPASHRDAVLSIRDLSVEVQGTDSRVVRQFNLDVHPGETVCVVG
FT                   ESGSGKSVTSLAVMGLLPAGILKVSAGSITIDGEDIVNASPRRLREMRATHMAMVFQEP
FT                   MTALNPVHRVGQQVDEVLRLHRKTMNRAQRRDKVLEMFRSVHLPDVERIYDAYPHQLSG
FT                   GQRQRIVIAMALILEPRLLIADEPTTALDVTTQKQILALIKELQEKQGTAVLFITHDFG
FT                   VVAEIADRIVVMNRGDLVETGTRDDILTRPSQPYTRRLVSSVPSLVPTQRPAPDGQAIL
FT                   HVQNLGRTYGAKRGLFGAGGHSVVAAADVNLVLRRGEILGIVGESGSGKSTVARCIVRL
FT                   IEPTAGSLCLGGEDVARVQGAALRPLRKRIQIVFQDPYRSLNPRRPVGESIIEGLLNFG
FT                   MAREAAERRAGDTLRVVGLSPDVMQRYPHQFSGGQRQRICIARALVMEPEVLVADEAVS
FT                   ALDVSVQAQVLDLLEEVRQRTGVGVLFITHDLRVAAQICDTIMVMQRGQVVETGSAATV
FT                   LTHPQHAYTRALIDAAPGRGWDFRNFRPLQAAA"
FT   misc_feature    complement(511692..511736)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(512031..512054)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(512499..512543)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(512868..512891)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(513027..513920)
FT                   /transl_table=11
FT                   /locus_tag="BAV0499"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48104"
FT                   /db_xref="GOA:Q2KYK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYK2"
FT                   /inference="similar to DNA sequence:INSDC:BX572596.1"
FT                   /inference="profile:HMMPfam:PF00528"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48104.1"
FT                   /translation="MQTDAINDTPLPGSGSPNAGAWQRLRQELRSWPVMLSLAILILVA
FT                   LGAIFAPWIGTVDPTAINPGARLKPPFGEYLFGTDAFGRDVWSRVVYGARVSLLAGLGA
FT                   AFISVAVGLVIGVLAGWFRSLDGLIMRTMDAIMAIPGILLAIALVSVGGASLTTVLVAI
FT                   TIPEIPRVVRLVRGQILSVREEPYVEAALALGTPLPLLLWRHMVPSTIAPLTVQGTYVF
FT                   ASAMLTEAILSFLGAGIPPEIPSWGNIMSEGRMYFRMLPGLILFPGLFLSLTVLSVNML
FT                   GDALRDALDPKMARRS"
FT   misc_feature    complement(513297..513383)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS_pept        complement(513923..514864)
FT                   /transl_table=11
FT                   /locus_tag="BAV0500"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48105"
FT                   /db_xref="GOA:Q2KYK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYK1"
FT                   /inference="similar to DNA sequence:INSDC:AP005947.1"
FT                   /inference="profile:HMMPfam:PF00528"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48105.1"
FT                   /translation="MLAFVLRRLLATIPVLIMVAVVVFAILRFSPGDPAIIMAGDGATP
FT                   ERVEQIRQAMGLDQPLLKQFLIWGGNLLQGDMGTSLMSGVPVRELIRQRLEPSLSLAVI
FT                   TLILTLLIALPLGVLAAWRRGKLLDRAVMGFSVMGFSVPVFVTGYLLIWAFAIKLGWFN
FT                   VQGYTPLSQGFWPYLHRLILPSLALSTVYIALIARITRTSVIEVMGEDFIRTARAKGRG
FT                   EAGVMLGHALRNAAVPIATVVGVGIALLISGVVVTESVFNIPGLGRLVVEAVLARDYPV
FT                   IQGLTLFFAFVYVFINLLVDCAYTVFDPRIRY"
FT   misc_feature    complement(514736..514795)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00187"
FT   sig_peptide     complement(<514786..514864)
FT                   /locus_tag="BAV0500"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(514946..516511)
FT                   /transl_table=11
FT                   /locus_tag="BAV0501"
FT                   /product="putative extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48106"
FT                   /db_xref="GOA:Q2KYJ9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYJ9"
FT                   /inference="similar to DNA sequence:INSDC:BX572596.1"
FT                   /inference="profile:HMMPfam:PF00496"
FT                   /protein_id="CAJ48106.1"
FT                   /translation="MLKFVRAAFVAGATMMAAHGAYADTAIKAVMHSPLRLTDPHATTA
FT                   YITTWHGYMIYDTLLATDADNKIQPQMLEKWEVSPDGKTYTMTLRDGLKWHDGKPVTAD
FT                   DCVASIKRWAAGDGMGRTLLRFTDKIEPIDDKQFRIVMKEPTDLALRALSKPTGTAAFM
FT                   MPKRIAEMPIGQPITDMTGSGPFKVAEFKPGVKTVYVKNTDYVPRKEPASALAGGKVVN
FT                   VDRVVWEVMPDALTTANALLNGEIDFVEQFPYDLLPMVEGNKDLKEETLSPVGYFTMYR
FT                   FNFKHPPFDNKKIRQAAMYAVNQEDVMKALVGNPKYWQTCASLWGCGTPLQSDIGKDMT
FT                   VPGNIEKARALLKEAGYDNTPILIMHATDVGTLSAQPVVIAQALRKAGFNVNLQAMDWQ
FT                   SVATRRASKAAPKDGGWNIHNTNWYATDIMDPVRSAPAAASGDNAWFGWPEFAQIEELR
FT                   TKFALSSDPAEQRKIADEVQRIGVDEGLYVPLGQMSVPTVYSSKLSGLVHAPVFAFWNV
FT                   KKAP"
FT   sig_peptide     complement(<516439..516511)
FT                   /locus_tag="BAV0501"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(516585..518090)
FT                   /transl_table=11
FT                   /locus_tag="BAV0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="This CDS is also similar to BAV0497, 31.846 identity
FT                   (32.84538ngapped) in 493 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48107"
FT                   /db_xref="GOA:Q2KYJ6"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYJ6"
FT                   /inference="similar to DNA sequence:INSDC:BX572596.1"
FT                   /inference="profile:HMMPfam:PF07171"
FT                   /inference="profile:HMMPfam:PF07364"
FT                   /protein_id="CAJ48107.1"
FT                   /translation="MRIGIGGFQHETNTFAPSKAAWEDFADKGGGWPRLVSGPAMFAAV
FT                   AGANIPIAGFIEAMSGHTLLPTTWAAASPSGPVTRDAFERISALILDGLRQAMPLDAVY
FT                   LDLHGAMVAEHLDDGEGEMLRRVRALIGPDVPLVASLDLHANVTRAMIRHADGLICYRT
FT                   YPHVDMAETGARTAQFLQKRLDGMPRPYVALRSLPFLISLCWQSTDIEPARSLYRLLGD
FT                   IEDRSALSLSFATGFPAADFPECAPAVWAYGESQSAADAAADEMTRAVLNAEEDFGGPI
FT                   YDPDQAVQEAMRIAADAMRPVVIADVQDNPGAGGSSDTTGILRALIRHGARHAAIGLIV
FT                   DPAAAMAAHRAGVGNTVRLALGGHSGIPGDEPLSADFLVEKISDGRFDTHGAFYRGFHM
FT                   DLGPSACLRIDGIRIVVASIKVQMADQEMFRFVDIEPRRAAILVLKSTAHFRADFTDIA
FT                   DRILVCAAPGSMLMDAEKQPWTRLRHGIRMAPCGPEFSGRVTP"
FT   CDS_pept        complement(518193..519686)
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="BAV0503"
FT                   /product="putative methylmalonate-semialdehyde
FT                   dehydrogenase [acylating]"
FT                   /EC_number="1.2.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48108"
FT                   /db_xref="GOA:Q2KYJ3"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYJ3"
FT                   /inference="similar to sequence:UniProtKB:P28810"
FT                   /inference="profile:HMMPfam:PF00171"
FT                   /protein_id="CAJ48108.1"
FT                   /translation="MNKLTHFINGQRYEGRSGRFTEGYNPSTGEVINSVALASAEDVDT
FT                   AVAAAHAAFPSWSETPALKRARILFNFKALLDQHQDELAALITREHGKVFSDAKGEVTR
FT                   GIEVVEFACGIPQLLKGQYSDQIGGGIDNWSMRQALGVVAGITPFNFPMMVPCWMFPVA
FT                   LACGNTFVLKPSERDPSVSLRLAELLKQAGLPDGVFNVVQGDKIAVDALIAHPNVEALS
FT                   FVGSTPIAEYIYAEGTRRGKRVQALGGAKNHLVVMPDADLDQVTDALMGAAYGSAGERC
FT                   MAISVAVAVGDVADQVIERLKPRVAALVVKDGMSPDAEMGPLVTPQHRKKVLGYIEDGI
FT                   AAGATLVADGRSLTVPGHENGFFLGGTLFDHVTPAMNIYREEIFGPVLCVVRVPDFASA
FT                   VALINSHEFGNGVSCFTSDGGIARAFARQIKVGMVGINVPIPVPMAWHSFGGWKRSLFG
FT                   DHHAYGEEGVRFYSRYKSVMQRWPDSIAKGAEFTMPVAK"
FT   misc_feature    complement(518832..518867)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00070"
FT   CDS_pept        complement(519731..521014)
FT                   /transl_table=11
FT                   /locus_tag="BAV0504"
FT                   /product="omega-amino acid--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48109"
FT                   /db_xref="GOA:Q2KYJ0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYJ0"
FT                   /inference="similar to sequence:UniProtKB:P28269"
FT                   /inference="profile:HMMPfam:PF00202"
FT                   /protein_id="CAJ48109.1"
FT                   /translation="MPFTANRQFKAQPRLLAGAKDMHYTAVDGRQILDGTAGLWCVNAG
FT                   HCRDEIVQAIARTAGELDYAPGFQLGHPSAFEAATAVASFMPEGLDRIFFTNSGSESVD
FT                   TALKIALAYHRARGEGQRTRLVGRERGYHGVGFGGISVGGIPGNRKTFSGALLPAVDHL
FT                   PHTHNLEKNAFTQGQPEWGAHLADELERIVTLHDASTIAAVVVEPMAGSTGVLIPPKGY
FT                   LQRLREITSRHGILLIFDEVITAFGRLGASTAAEYFGVTPDLITMAKGVSNAAIPAGAV
FT                   AVRREVHDTIVNSVQGGIEFFHGYTYSAHPLASAAILATLGIYRKEGLFQRAHELAPAF
FT                   ERAAHRLREANHVIDVRNIGLVAGIELGSRTGAPGARAAEVFQKCFDRGLLVRYTGDIL
FT                   AISPPLIVSEAQINEIFDTIHSVLNDIA"
FT   misc_feature    complement(520190..520219)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00599"
FT   CDS_pept        521212..522615
FT                   /transl_table=11
FT                   /locus_tag="BAV0505"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48110"
FT                   /db_xref="GOA:Q2KYI8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYI8"
FT                   /inference="similar to DNA sequence:INSDC:AE016783.1"
FT                   /inference="profile:HMMPfam:PF00392"
FT                   /inference="profile:HMMPfam:PF00155"
FT                   /protein_id="CAJ48110.1"
FT                   /translation="MDFLAIRSRKQGPTLVEQVVQAFARAIEQQVLRPGMSVPSVRAFA
FT                   REHGLSTFTVASAYNRLVARGWLAARPGSGYRVLGLQRQPALRPAGWSPPSLNTDWLLS
FT                   DIYADHSIPIKAGCGWLPGEWLNEEGLHQALRHMGRVPALRISGYGHPLGYAPLRESIA
FT                   AGLAQHGLLAAPDQIVLTQGVTQGLDIVMRSLLQPGDTVLVEQPCYANLLQLLRLAGIR
FT                   AVAVPRNEAGLDLQALDEAVRTHRPRALFVNTVLQNPSGTTLSMANAFRLLQSANQHGY
FT                   WIIEDDISRELQPGLAPLLAALDGAERVIYLGGYSKIISPSVRVGYVVAHRDLARDLAR
FT                   TKMATGLTSPEIMERVVHQVIREGRYRAHIQRTRERLAQAHAQVERQLDDSGFEIAARP
FT                   QAGLFLWARPSGRAQGARALAEAALRDGIWLAPGCYFDAAQADTPWLRFNVAYSNKPAL
FT                   WRFLRQRQA"
FT   CDS_pept        complement(522669..523151)
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /gene_synonym="tmrA"
FT                   /locus_tag="BAV0506"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48111"
FT                   /db_xref="GOA:Q2KYI7"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYI7"
FT                   /inference="similar to sequence:UniProtKB:P00379"
FT                   /inference="profile:HMMPfam:PF00186"
FT                   /protein_id="CAJ48111.1"
FT                   /translation="MAQLTLIVAYARNRVIGRDNTLPWRLPGDLAHFKRSTLGHPIVMG
FT                   RNTWESLGRPLPGRKNIVVSRNPDYRAEGAIVVPDLQSALKMAEADEVFVIGGAQIYSQ
FT                   ALPLATRIIATEIQANVAGDAYFPPLAQTEWRETSRQPQPEENGYHYDFVVYERNR"
FT   misc_feature    complement(523041..523109)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00075"
FT   CDS_pept        complement(523154..524125)
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="BAV0507"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48112"
FT                   /db_xref="GOA:Q2KYI3"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYI3"
FT                   /inference="similar to sequence:UniProtKB:P00469"
FT                   /inference="profile:HMMPfam:PF00303"
FT                   /protein_id="CAJ48112.1"
FT                   /translation="MRQYLDLVQSIIDQGAWQENRTGVRTLSLPGAMLRFDLQQGFPAV
FT                   TTKKLAFKSAIGELVGFLRSARSAADFRALGCKVWDQNANENSQWLNNPYREGLDDLGP
FT                   VYGVQWRNWPAYKLLRADRQAQISDALSRGYAKVAELDEAGVPQVLLYKAVDQLRQCLD
FT                   TIHRNPSDRRILFHGWNWAQIEEMALPPCHLLYQFLPNASTREISLCLYIRSNDVGLGT
FT                   PFNLTEGAALLHLVGRLTGYTPRWFSYFIGDAHIYENHLDMLREQLKREPHASPRLLLS
FT                   DRIPDFRQTQRYEPEWLEHVEPSDFSLEGYQHHAPLTAPMAV"
FT   CDS_pept        complement(524169..524600)
FT                   /transl_table=11
FT                   /locus_tag="BAV0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48113"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYI0"
FT                   /inference="similar to DNA sequence:INSDC:X89443.1"
FT                   /inference="profile:HMMPfam:PF02566"
FT                   /protein_id="CAJ48113.1"
FT                   /translation="MECTIDWGGPSGMLFMATTGSGHVTAMDGAVDGGGHNLAPRPMEM
FT                   LLAGTGGCTAYDVVLILKRGRHDVSGCSVKLEADRADADPKVFTRIHFAFTVTGRNLPR
FT                   AAVERAVQLSHEKYCSASAMLEKTAALSFSVEIVDTAAA"
FT   CDS_pept        524728..525375
FT                   /transl_table=11
FT                   /locus_tag="BAV0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48114"
FT                   /db_xref="GOA:Q2KYH8"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYH8"
FT                   /inference="similar to DNA sequence:INSDC:AE016922.1"
FT                   /protein_id="CAJ48114.1"
FT                   /translation="MNYASPRHAGPLDALLIEVDRALQVLSRSAVAGRAYPAHAAEAPL
FT                   ADTEKRHAAGLMRVNHVGEICAQALYRGQAVACRDAGTRELLREAAAEEVDHLVWCDRR
FT                   LKELDSRPSLLNPLWYAGSFALGVAASVAGVPRNLGFMAETERQVEAHLDEHLRTLPAA
FT                   DERSREIVRQMKDDEAGHRESAERAGGIPLPAPVRGIMRAMSKVMTGTAYRL"
FT   misc_feature    526110..537450
FT                   /note="Locus possibly encoding a lipopolysaccharide
FT                   O-antigen"
FT   CDS_pept        <526137..527240
FT                   /transl_table=11
FT                   /locus_tag="BAV0510"
FT                   /product="putative O-antigen biosynthesis
FT                   glycosyltransferase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48115"
FT                   /db_xref="GOA:Q2KYH2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYH2"
FT                   /inference="similar to DNA sequence:INSDC:AF498408.1"
FT                   /inference="similar to DNA sequence:INSDC:U17293.1"
FT                   /inference="similar to sequence:UniProtKB:O34753"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00953"
FT                   /protein_id="CAJ48115.1"
FT                   /translation="VTWFYICVVAFMVGGLIVASERWHGAFTGDNDLNKPQASHTRSTP
FT                   RVGGLAVLAGTLAGLLVLGPSNMTLTWLWPALFVAALPVFVAGLLEDITKDIGASKRLL
FT                   AAFASAAIAWWLLGGVSRVGIAPVDWVLSFWPVSLLFTVFAVGGCTHALNIVDGMNGLA
FT                   GMVATLMSVSICLVALQVGDMPIFMIAAALASATLGFLVWNFPFGRVFLGDGGAYFLGF
FT                   MLAELAVLLVVRNPSVSPFYALAVLFYPVFETGFSIWRRRFKRGVPVDQPDALHLHQLV
FT                   FRRLVRVTFSRRSRHAVPALCNALASPYMWVLALIGLVPATIWWDNAWVLCASLLVFAG
FT                   VYIWLYIRLVSWRRPGWLLLPSVLRTH"
FT   CDS_pept        527330..528604
FT                   /transl_table=11
FT                   /gene="wbpO"
FT                   /locus_tag="BAV0511"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48116"
FT                   /db_xref="GOA:Q2KYH0"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYH0"
FT                   /inference="similar to DNA sequence:INSDC:AF035937.1"
FT                   /inference="similar to sequence:UniProtKB:Q04972"
FT                   /inference="profile:HMMPfam:PF03721"
FT                   /inference="profile:HMMPfam:PF00984"
FT                   /inference="profile:HMMPfam:PF03720"
FT                   /protein_id="CAJ48116.1"
FT                   /translation="MRIQDVKLAVVGLGYVGLPLAVEFGKKRSVIGFDINTRRIDELRA
FT                   GRDHTLEVDDQELAEAKHLRYTTDRAELGQANVFIVTVPTPIDEYKQPDLTPLVKASET
FT                   IGAVLKRGDIVIYESTVYPGATEEDCVPVLEKVSGLKFNVDFYAGYSPERINPGDKAHR
FT                   VSTIKKVTSGSTPEVAELVDQLYKEIIVAGTHKASSIRVAEAAKVIENTQRDVNIALIN
FT                   ELALIFNKMGIDTEAVLQAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQSIGYHPEI
FT                   ILAGRRLNDSMGGYVVSQLVKCMTKKRLHVQGAKVLVMGLTFKENCPDLRNTRVVDIIR
FT                   ELGEYNVDVDVYDPWVDAQEAQHEYGITPVAEPVEGSYDAVILAVAHHQFVEMGAEAIR
FT                   KLGKPEHVLYDLKYVLTAQESDLRL"
FT   CDS_pept        528626..529651
FT                   /transl_table=11
FT                   /gene="wbpP"
FT                   /locus_tag="BAV0512"
FT                   /product="UDP-N-acetylglucosamine C4 epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48117"
FT                   /db_xref="GOA:Q2KYG7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYG7"
FT                   /inference="similar to DNA sequence:INSDC:AF035937.1"
FT                   /inference="similar to sequence:UniProtKB:Q04973"
FT                   /inference="profile:HMMPfam:PF01370"
FT                   /protein_id="CAJ48117.1"
FT                   /translation="MTTRYDAVRADLQARPRKWLVTGCAGFIGSNLIETLLKLNQTVVG
FT                   LDNFATGHQRNLDEVRGLVTAEQWARFTFIEGDIRDLDTCRRAADGVDKVLHQAALGSV
FT                   PRSLNDPITTNAVNISGFLNMLVAARDAKVGAFVYAASSSTYGDHPALPKVEENIGRPL
FT                   SPYAVTKFVNELYADVFARSYGFTTVGLRYFNVFGRRQDPNGAYAAVIPKWTAAMIQGE
FT                   TVVINGDGETSRDFCYVDNAVQANILGAMAGDEARNQVYNVAYSGRTTLNQLFDFLKTS
FT                   LGRQGVAYDKQAEHADFRAGDVRHSQADISKAGRLLGYQPAFDILQGLDAAMPWYTQFL
FT                   R"
FT   CDS_pept        529653..531008
FT                   /transl_table=11
FT                   /locus_tag="BAV0513"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48118"
FT                   /db_xref="GOA:Q2KYG3"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYG3"
FT                   /inference="similar to sequence:UniProtKB:P56882"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF03023"
FT                   /protein_id="CAJ48118.1"
FT                   /translation="MKALLRKFGGIHPDHQRIFRGAFRVAVFLILGKAAGAIKEMAVAY
FT                   RYGISDAVDAYQFAQTMATWLPVTIVGVLSVVLIPVLVRLRREGGAERDLFVSELQGWT
FT                   LLGGLLLAGLTWLGWPYVLAWLGPGLSSAVAGMTQELLWAFVPVSAVLLIAGISAARLR
FT                   SHERHVNTLLDSVPAVTTLAWVMLAAAGGDQVGPLLWGTLVGYLIQAVWLAWLAARADQ
FT                   GFWGAPRLTLRSPHWPELLSAAGVMLVGQVAMSFVNPLDQYTAANLGGNANATLGYASR
FT                   LLSLVLGIGAVSVGRAALPVLADVQHRGDGLRARAMALKWSWAMVGAGIAAVAIGWLLA
FT                   PWGVALLFERGAFTAQNTEAVASVLRWGLLQLPFYFGVLILVQLLASQGRYPVMALIAV
FT                   ANFLLKAVLNTVLGPRMGTEGIMLATSLMYFLSFICYTGVALRALPETAERS"
FT   CDS_pept        531009..532118
FT                   /transl_table=11
FT                   /locus_tag="BAV0514"
FT                   /product="putative O-antigen biosynthesis
FT                   glycosyltranferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48119"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYG1"
FT                   /inference="similar to DNA sequence:INSDC:Z47767.1"
FT                   /inference="similar to sequence:UniProtKB:Q46634"
FT                   /inference="profile:HMMPfam:PF00534"
FT                   /protein_id="CAJ48119.1"
FT                   /translation="MARRRILIFIHSLHGGGAERVAVDLAGHWVRAGHEVMILTQAEGD
FT                   AYPIPEGVLRQVLGTDGRGGARGILDNVRRVRALRAVLRQFRPDIVLGMMTTSSILAVL
FT                   AAWGLPIKVIATEHTHPPSQQLSGMWQRLRRLTYPRAARVVALTRGTADWIAEHVPGSR
FT                   LAVIPNPVHWPLPRNEPRLRPPTLPGRHYLLAVGRLHPDKGFEVLIDAYAQLAARFPDW
FT                   DLLILGEGEERTRLEAQAAAHGLGERIYLPGRAGNVADWYESADLYVLSSRFEGLSNTL
FT                   LEAMASGLAPVCFDCDTGPREIVRDGLDGVLVRPVSDAAAMAQALAALMQDAPARSRMA
FT                   AQAQTARERFSARHVLGLWRQLFDDALEN"
FT   CDS_pept        532126..534051
FT                   /transl_table=11
FT                   /gene="wbpS"
FT                   /locus_tag="BAV0515"
FT                   /product="putative O-antigen biosynthesis aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48120"
FT                   /db_xref="GOA:Q2KYF9"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYF9"
FT                   /inference="similar to DNA sequence:INSDC:AY380835.1"
FT                   /inference="similar to DNA sequence:INSDC:AB012956.1"
FT                   /inference="profile:HMMPfam:PF00310"
FT                   /inference="profile:HMMPfam:PF00733"
FT                   /protein_id="CAJ48120.1"
FT                   /translation="MCGIVGLWGPLEDKTRILAESCQRIRLRGPDSKGFWEDREAGVGF
FT                   GHVRLAIQDLTEAGHQPMVSACGRYVLTYNGEVYNHLDMRAKLEQAGQAPDWRGHSDTE
FT                   TILAYAAAFGVQAMLRDAVGMLAIALWDRQTRSLTLARDRMGEKPLYYGYVGANLVFAS
FT                   QLKGLSPVPGFGRRIDRNALASFMRHNYVPAPQSIYEGIRKLPAASWVVFSEAQLRARE
FT                   MAPPQAYWSALEVADAGQRQPRRFASDNEATDALQEVLLQAVRGQMLSDVRLGAFLSGG
FT                   IDSSTIAALMQSQSNAPVRTFAIGFHEKEYDEAQHAKAVAAHLGTDHSELYVTPKDALD
FT                   VVPHLADIYDEPFADSSQIPTALVTRMAREHVTVALSGDGGDELFGGYSRYLRVARWWD
FT                   QCERLPAPLRALAGAAMRGSTRLPGAGAWRGKVGKMGELLRARSQGEFYRLFVSYWSDP
FT                   ARVVKGGEEPPSLFEQPLSGPLFEAMMKLDTVTYMPDDILVKVDRAAMAVSLETRVPLI
FT                   DHRVYEFAWSLPFNYKLRGGTGKWLLRQVLYRHVPQSLVDRPKRGFAVPLASWLRGPLR
FT                   DWAEALLDPARLRQQGWFEPEPILRKWREHQSGHRNWDSHLWGVLMMQAWLDRYHSGQL
FT                   GEGMDP"
FT   misc_feature    532126..532143
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00443"
FT   CDS_pept        534048..535148
FT                   /transl_table=11
FT                   /locus_tag="BAV0516"
FT                   /product="putative O-antigen biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48121"
FT                   /db_xref="GOA:Q2KYF6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYF6"
FT                   /inference="similar to DNA sequence:INSDC:AF142639.1"
FT                   /inference="similar to sequence:UniProtKB:Q46634"
FT                   /inference="profile:HMMPfam:PF00534"
FT                   /protein_id="CAJ48121.1"
FT                   /translation="MRIVLAVSSMNAGGAERVAATLVNAWAERGDNVTLLPTYSGGGQC
FT                   FYPLASAVELLWLAQAVPAQGRLAPLKRLLGLRRLIRERRPDVVVSFLTNVNVGAILAT
FT                   RGLDQPLIVCERTNPVVDTTTGKVWRRLRRWLYPRADVVTVQAKDTVAPFAAQVPGIRH
FT                   LAVIPNPLPPELLDAPLADLKPDAQGRKRLMAMGRLVPDKQFDLLIDLFAQLAAAHPDW
FT                   DLWIWGDGPRRQALQAQVERLGLQDRVRLPGRTTEPWAALSASSAFVLSSAVEGFPNVL
FT                   LEAMAKGLPCATFDCPSGPREMTRDGADALLVDSAAAMSEALGRLMSDETLRADLGRRA
FT                   ALSVRERYALPVVLAQWDRLFALARH"
FT   CDS_pept        535156..536286
FT                   /transl_table=11
FT                   /gene="wbpT"
FT                   /locus_tag="BAV0517"
FT                   /product="putative O-antigen biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48122"
FT                   /db_xref="GOA:Q2KYF4"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYF4"
FT                   /inference="similar to DNA sequence:INSDC:AY380835.1"
FT                   /inference="profile:HMMPfam:PF00534"
FT                   /protein_id="CAJ48122.1"
FT                   /translation="MRIVHIITGLGQGGAEAVLYRLATYAETTTRHVVISLTDEGVYGA
FT                   RLRAAGISVHALGMARGRVTLGGLMALRALLRKEAPDAVQTWMYHADLIGGLAARLAGI
FT                   KALSWGIRNSGNHLNRSSRSARLVLRLCALLSGWMPRAIVCAAQDAADRHQALGYDTGK
FT                   MVVIANGYDLSRYAPDPLAGERMRALWGVDAGTPLIGCVARWDPLKDHRNLLAALGQLL
FT                   REGQAPRCVLVGRGMTPANAELMALIDGQGLAGRVLLAGPSDDVPAVMNSLDLHVLSSC
FT                   AEGFPNVVAEAMACGTPCVVTDVGDAAYIVGDTGVVVPPEQPAALARGIAQGLREMAAG
FT                   GRAAEAARERVLALFDLGRMVRAYEAVWRRIAGDRV"
FT   CDS_pept        536283..537416
FT                   /transl_table=11
FT                   /gene="wbpU"
FT                   /gene_synonym="wbnL"
FT                   /locus_tag="BAV0518"
FT                   /product="putative O-antigen biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48123"
FT                   /db_xref="GOA:Q2KYF2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYF2"
FT                   /inference="similar to DNA sequence:INSDC:AY380835.1"
FT                   /inference="similar to DNA sequence:INSDC:AB012956.1"
FT                   /inference="profile:HMMPfam:PF00534"
FT                   /protein_id="CAJ48123.1"
FT                   /translation="MSPTRLLFVVNNPAFFLSHRVALAIAAQAQGYEVHVATMDGPSVP
FT                   QIQALGMTHHVIPMSRSGKKPMEELKTMLALYRLFRKLRPDLVHLVTIKPVLYGGIAAR
FT                   LARVPAMVAAISGLGYVFMAKGARARLVRAVVGRFYRLALGHPNSRVIFQNANDRDLLS
FT                   RLGAVRSERVEMIRGSGVDLSRYRAEPEPPAPPVVVLMVARLLRDKGVYEFVEAARLLR
FT                   QQGLNVRMRLAGGVDLGNPASIRADEVQAWARAGLVEALGERQDIAELYAASHIAVLPS
FT                   YREGLPKSLIEAAACARAVVTTDVPGCRDAIDPDQTGLLVPPHDAPALAAAIARLVADP
FT                   AQRQRMGQAGRRLAEREFSIDDVCRRHLAIYAALLAR"
FT   CDS_pept        complement(537441..539003)
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="BAV0519"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48124"
FT                   /db_xref="GOA:Q2KYE9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYE9"
FT                   /inference="similar to sequence:UniProtKB:P11537"
FT                   /inference="profile:HMMPfam:PF00342"
FT                   /protein_id="CAJ48124.1"
FT                   /translation="MPQSLPFSPAWLAFEEAVRGASHRGDHLRIIEGGGLSVDLTAQAY
FT                   SPQLEAAGLALCEQQGFALARRQLFEGGEANWTEHRPAWHTALRAALPPPSVAKDILNE
FT                   RERLRRFVDEADARGAYKYVLHLGIGGSDWGPRLVARALRHQGLKREVRFASNVDSHAV
FT                   ADAMHQLDPHETLVIVASKSFTTTEPLANAEVAIHWLQNAGVADPIKQVVAITANVDAA
FT                   LDFGISPQHVFRFWDWVGGRYSLWSAIGLPIALAMGNNTFDELLAGAAAMDEHFLRAPL
FT                   AANAPVQMALAGLANRSVMGFNSLAIAPYDSRLAHLVPWAQQLEMESLGKVATRDGSPA
FT                   GVPTGPVVWGMTGTDCQHTFFQWLHQDTTGAPVDFIVCEHADHTYDHHHRLLIANCLAQ
FT                   RAALLRGKSFEDALAETCARVDDPSEARILAEHLVHPGRRPSTLIVLPRMTAHNLGALL
FT                   ALYEHKVFTQGVLWGINPFDQWGVEFGKALARGIIGELDKPSGMASADPSTRYWVDLLS
FT                   RRS"
FT   misc_feature    complement(537546..537599)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00174"
FT   misc_feature    complement(537780..537803)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(538254..538295)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00765"
FT   CDS_pept        complement(539010..>540392)
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="BAV0520"
FT                   /product="phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48125"
FT                   /db_xref="GOA:Q2KYE5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYE5"
FT                   /inference="similar to sequence:UniProtKB:P40391"
FT                   /inference="similar to sequence:UniProtKB:P26276"
FT                   /inference="profile:HMMPfam:PF00408"
FT                   /inference="profile:HMMPfam:PF02880"
FT                   /inference="profile:HMMPfam:PF02879"
FT                   /inference="profile:HMMPfam:PF02878"
FT                   /protein_id="CAJ48125.1"
FT                   /translation="VKNNYPASVFKAYDIRGTVPDLIDPDFARALGYALAARAREVGNT
FT                   ELVIGYDGRLSSPALSAALQQGIHEGGVNTLDIGRVPTPLVYFGAYSLGLGAGVAITGS
FT                   HNPPKYNGFKMMLGGRALYGEAVQSLRDAMNQPQPAGSAHGTGRNTDLVPAYIERIVSD
FT                   IKLARPMKIAIDCGNGVAGAVAPELFRALGCEVTELFCEVDGNFPNHHPDPADPHNLQD
FT                   LIHCLATTDCEIGLAFDGDGDRLGVVTKSGQIIWPDRQLILFARDVLQRCPGETIIYDV
FT                   KCSRHVGLAVAAAGGQPLMWQTGHSLVKAKLAETGAPLAGEMSGHIFFKERWYGFDDGL
FT                   YTGARLLEILAREANPSALLEALPTAVSTPELKLEMEEGQPHALIRELQEHGRFDDASQ
FT                   VITIDGVRAEFADGFGLARASNTTPVVVLRFEAENADALARIQTLFKRELLRLAPQARL
FT                   PF"
FT   misc_feature    complement(540057..540101)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00710"
FT   CDS_pept        540632..541273
FT                   /transl_table=11
FT                   /locus_tag="BAV0521"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48126"
FT                   /db_xref="GOA:Q2KYE3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYE3"
FT                   /protein_id="CAJ48126.1"
FT                   /translation="MGAKVSFLTPSAHIVGMRRPPGGPAGGAERRLDIHVLVQEDGRVE
FT                   ASAAWERCVWRDQRVLIAECPAPRLSSRMEATLREVAIHIAQHRGWLGLGTVVFSLDDE
FT                   SGLFRMIEALPHGRIGKAALMEPMAAHALEVGIGACAASGRPGANLLVWGVTRGDALRR
FT                   AYQAIGDMPGLAVPERAFLLNRIASPAFCSGLTGSRLAGISDWSDHRAAS"
FT   CDS_pept        541329..542744
FT                   /transl_table=11
FT                   /locus_tag="BAV0522"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48127"
FT                   /db_xref="GOA:Q2KYE1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYE1"
FT                   /inference="similar to DNA sequence:INSDC:AL646065.1"
FT                   /inference="profile:HMMPfam:PF01565"
FT                   /inference="profile:HMMPfam:PF02913"
FT                   /protein_id="CAJ48127.1"
FT                   /translation="MTLLQALQSLLGPAHVLTGEDAEPYLLDWRRRYRGRALAVVRPGS
FT                   TEEVAAALRLCRQHGAPVVPQGGNTGLCGGATPDDSGQAVIFSTRRLNRVRAIDRDNDT
FT                   ITVEAGCVLQAVQEAAEQAGRLFPLSLAAEGSCTIGGNLATNAGGTQVLRYGNARELAL
FT                   GLELVTAEGEIWHGLRGLRKDNTGYDLRDLYIGSEGTLGIITAATLKLYPLPVARCTAL
FT                   LTLSRIEDAVEVLARARAGFGASLTGFELMAADCLQSVIRLFPQQRLPFEGESLKAPWF
FT                   ALLELSDSESEEHARERFEAVLSAAIGEGLVGDAAIAANLAQSQALWHLRESIPLAEAE
FT                   LGKAVKHDVSLPISSIAHFVSVTNAALQERFPGVRNVIFGHLGDGNLHYNVARGAGQTE
FT                   ADLLALQPAIYDVVHASVQAHAGSISAEHGVGQLKRDELPRYKSPVEIALMKRIKAALD
FT                   PEGVMNPGKVLQG"
FT   CDS_pept        542749..543435
FT                   /transl_table=11
FT                   /locus_tag="BAV0523"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48128"
FT                   /db_xref="GOA:Q2KYD8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYD8"
FT                   /inference="similar to DNA sequence:INSDC:Y09798.2"
FT                   /inference="profile:HMMPfam:PF00072"
FT                   /inference="profile:HMMPfam:PF00486"
FT                   /protein_id="CAJ48128.1"
FT                   /translation="MNGARVLIVEDNLTIAGNLYEYLQTQGFMPDAAYEGKSALAMLER
FT                   QEFDAVLLDVGLPGGLDGYGVLHHLRTALRKPVPVLILTARDGLDDKLAGFSHGADDYL
FT                   TKPFALAEVKARLLALIQRSRHAVVDAVYRFGPLAMDSRSREVSVNGKPVHLARKSVLI
FT                   VEMLLRDPGKVVSRETLEAALWGDEPPASDALRSQVHLLRRALSEAGFDGIETTHGIGW
FT                   RLVQKA"
FT   CDS_pept        543432..544742
FT                   /transl_table=11
FT                   /locus_tag="BAV0524"
FT                   /product="two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48129"
FT                   /db_xref="GOA:Q2KYD6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYD6"
FT                   /inference="similar to DNA sequence:INSDC:Y09798.2"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00672"
FT                   /inference="profile:HMMPfam:PF00512"
FT                   /inference="profile:HMMPfam:PF02518"
FT                   /protein_id="CAJ48129.1"
FT                   /translation="MTRGGTLTQRVVWALTGIVAIFVTLLALLAYLTFDQMEDDLVNDI
FT                   LTTETERVIQHLVSEPDYIPERGSRELGGSMHAWLHLPGMANDDLPAPLRGLDNGLHLL
FT                   EPGSDTWHVMVADANHGRGKVYVMYDATENEDRVKIFGLFVLGVGAVCIVVAYGLARRL
FT                   AGYVVGPLLDVTDHLAHWAPGAPDMAVTRDDEAGRLVEAFNRMQGQVDQSIARQREFAA
FT                   NLSHEVRTPLASIRSDSEMMQMDTRLPPEVQRRLTRIVDGVDSISSSLESARAMAREER
FT                   CAPEPVRLAECMGAAWQGFAGNAEQAGLRFSNDIDTETVRELNRYALLTVLRNLVRNAI
FT                   EHAAPAELRASLDGQGSLVLADNGRGIAPEELPFVFQRYFSSRLKDSGGVMNESDPQRG
FT                   LGLAIAKQVCDVQGWTLTVDSAREGAQRGTRFTLSFS"
FT   CDS_pept        545001..545735
FT                   /transl_table=11
FT                   /locus_tag="BAV0525"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48130"
FT                   /db_xref="GOA:Q2KYD5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYD5"
FT                   /inference="similar to DNA sequence:INSDC:AE016872.1"
FT                   /inference="profile:HMMPfam:PF00392"
FT                   /protein_id="CAJ48130.1"
FT                   /translation="MNAPNEPPAAQRRPRNLAQGLVESISGRIRAGDIPPGQKLPTEPE
FT                   IMRQFGVSRTVVREALSRLQEAGLVETRHGVGTYALQASPGADFRVSPAELASIRDILV
FT                   ALELRIGLESEAAGLAAQRRNDEQLAAMRRALDLFQARLLNQGDTITPDFEFHLLVAQA
FT                   TQNRHFAELMSHLGSAIIPRTRINSARVFQENPGQYLARINVEHENIYDAILRQDAEAA
FT                   RAAMRTHLSNSRERLRRIESSR"
FT   misc_feature    545118..545192
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00043"
FT   CDS_pept        545818..547740
FT                   /transl_table=11
FT                   /locus_tag="BAV0526"
FT                   /product="putative sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48131"
FT                   /db_xref="GOA:Q2KYD3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYD3"
FT                   /inference="similar to DNA sequence:INSDC:AP005345.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00884"
FT                   /protein_id="CAJ48131.1"
FT                   /translation="MRRLTLRFLIAVLLLLTASRLGLAFWQWDRVQAAGGLWPLLFGGW
FT                   RIDLVMVGMVIAMPAVFSYWFGHRPLAASITAWWFRIWWMLLALLEISTPQFISEYDTR
FT                   PNRLYFEYLVHPREVAGMLWEGYKGVLLAAFLALLLAAWLAKRLFPLGKTDPYMRWWKR
FT                   PFASLLTLAVVVLAIRGTLEHRPINPSVVAFSSDAMVNTLPLNSLYNVLDAAYRLRDER
FT                   SSAALYPEMPIEKMNAIVRQASGMEGPALDPAYPSVHAQKASVRRDKPLNLVIILQESL
FT                   GAQYVGSLGGANLTPELDKLGKEGWMFHRAYATGTRSVRGIEAVTTGFLPTVAEAVVKL
FT                   PRSQTHFFTLASLLKAHGYHSRFVYGGESHFDNMRGFFLGNGFDQVVDRKDFVDPVFVG
FT                   SWGASDEDMFKQVDRLLRNDGDKPVFTLAFSVSNHSPWEYPAGRIQPQGEAASVQNTVR
FT                   YADWAIGQFFEQARKAPYWDNTVFLVIADHDSRVFGANLVPVRHFQIPALILGGSIAPR
FT                   QDERIVSQIDMGPTLLSLMGVDNINPMLGSDLTQRDPNRAIMQYGDNFGYLRGDSLVVI
FT                   EPRKTPTSYRYTRMPRDQEDKFEPAPIDAQQAEEALAFALWPSWAYREGRYKLPPQTQA
FT                   GTTRP"
FT   sig_peptide     545818..>545887
FT                   /locus_tag="BAV0526"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(547781..549094)
FT                   /transl_table=11
FT                   /gene="fahA"
FT                   /gene_synonym="fah"
FT                   /locus_tag="BAV0527"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48132"
FT                   /db_xref="GOA:Q2KYD2"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYD2"
FT                   /inference="similar to sequence:UniProtKB:Q00770"
FT                   /inference="profile:HMMPfam:PF01557"
FT                   /protein_id="CAJ48132.1"
FT                   /translation="MTLNETHNPSLKSWVASANTGDSDFPIQNLPFAAFRRRGSQEAFR
FT                   PGVAIGDAIVDLGALRLARPFDGDAQRALDACADTHLNALMALGPTAWSALRLALSRAL
FT                   REGSAQRALIEPLLVPQAEAEFSTPARIGDYTDFYISLHHATAVGKQFRPDNPLLPNYK
FT                   WVPIGYHGRASSIGVEQTFARPVGQQRPLNEGEAPQFGPCKRLDYELELALFIGQGNAQ
FT                   GDRITLDAAEHHVFGLGILNDWSARDLQAWEYQPLGPFLAKNFASTISPWVVTLEALAP
FT                   FRTTWTRPEGDPQPLPYLASAANKAEGAFDVQMEVLLSTAQSRAKAAEPARLSRSNFRD
FT                   AYWNVAQLVAHHTVNGCNLQPGDMMGTGTLSGPQPDEAGSLLELSQGGKHPIALPWGET
FT                   RTFLEDGDQIIMRAECVKPGYPRIGFGQCVGTVAPARL"
FT   CDS_pept        complement(549148..550446)
FT                   /transl_table=11
FT                   /gene="hmgA"
FT                   /locus_tag="BAV0528"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48133"
FT                   /db_xref="GOA:Q2KYC8"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYC8"
FT                   /inference="similar to sequence:UniProtKB:Q00667"
FT                   /inference="profile:HMMPfam:PF04209"
FT                   /protein_id="CAJ48133.1"
FT                   /translation="MPLNYQSGFGNACATEALPGALPQGRNSPQQCPYGLYAEQLSGTA
FT                   FTAPRSENRRSWLYRIRPGVVHRPFEPYAGAPHWLADFGTGPVTPNQLRWSPLPLPATP
FT                   TDFIDGVHTWGGNGGPDEQSGVGIHLYAANQSMKGRFFYNADAEMLLVPQLGRLRLATE
FT                   MGLLDLEPLEIAVLPRGVRFRVELLDAEARGYLLENFGTALRPPELGPIGSNGLANARD
FT                   FQTPVAWYEDVEGDFELIAKFTGGFWRAPLTHSPLDVVAWHGTHAPYKYDLRHFNTIGS
FT                   ISYDHPDPSIFTVLTSPSDTPGTANLDFAIFPPRILAMENTFRPPWFHRNIASEFMGLI
FT                   QGVYDAKAEGFAPGGASLHNCMSGHGPDADTFEKASVADTSKAHYIRDTMAFMFETRRV
FT                   IRPTRQALASAQLQGDYYQCWQDLKKHFNPEKA"
FT   CDS_pept        550568..551488
FT                   /transl_table=11
FT                   /locus_tag="BAV0529"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48134"
FT                   /db_xref="GOA:Q2KYC5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYC5"
FT                   /inference="similar to DNA sequence:INSDC:AF169302.2"
FT                   /inference="profile:HMMPfam:PF00126"
FT                   /inference="profile:HMMPfam:PF03466"
FT                   /protein_id="CAJ48134.1"
FT                   /translation="MNKGGVVDALRKLDLNLLVVFQHLLEERNISAVARRLDLSQPAVS
FT                   NALRRLRLAFGDELFVRTAQGMLPTPLAEGMGGQVSEALSLLSHLADAAQPFDPATSQR
FT                   RLRIAMSDAGEIHFMPTLMELCARHVPGVRIDSLRCTDLQRELDTGRVDLALGAFDGLG
FT                   SGIVQRMLFRQGYATLFRAGHPRAYAGMSARAFRAEQHLVVSRAAPDGQINQALERAGV
FT                   VLQEQFSVPHFAAVPYIVSTTDLLATVPEKLAASAAPRFGLQVLTLPIKVPLLQTNLYW
FT                   HRRFQRDGANQWLRGLIIDTFADRA"
FT   misc_feature    550652..550744
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00044"
FT   CDS_pept        complement(551492..551689)
FT                   /transl_table=11
FT                   /locus_tag="BAV0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48135"
FT                   /db_xref="InterPro:IPR021233"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYC4"
FT                   /inference="similar to DNA sequence:INSDC:AL646080.1"
FT                   /protein_id="CAJ48135.1"
FT                   /translation="MPLTLTPNLAEPDTFYQALIDAHQDLSDEQSREMNAALILVLANH
FT                   VGDAAVLAQALAVARASVQG"
FT   CDS_pept        complement(551701..>553359)
FT                   /transl_table=11
FT                   /locus_tag="BAV0531"
FT                   /product="putative oxygenase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48136"
FT                   /db_xref="GOA:Q2KYC1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYC1"
FT                   /inference="similar to DNA sequence:INSDC:AJ007932.2"
FT                   /inference="similar to DNA sequence:INSDC:AF293355.2"
FT                   /inference="profile:HMMPfam:PF01360"
FT                   /inference="profile:HMMPfam:PF01494"
FT                   /protein_id="CAJ48136.1"
FT                   /translation="VGDIDYQALEFAYQASSDQKADTPAAHQVTIVGAGPVGLTTALDL
FT                   ARRGVRVLVLDDDCRLSTGSRAICFAKRTLEVWDRLGVGQRMVDKGVSWNVGKVFFREG
FT                   EVWRFDLLPESGHQRPAFINLQQYYAEGYLLEAAQAEPNIELRWKNKVAGVESGDDGVL
FT                   LAIETPDGPYALRTQWLIACDGARSPIRRLLGLEAHGRIFKDRFLIADVKMTAPFPAER
FT                   WFWFDPPFHPNQSVLLHRQPDDVWRIDFQLGWNADPVEAVKPANVLPRIRALLGADTPF
FT                   ELEWVSVYTFACERMERFRHGRVVFAGDAAHRVSPFGARGANSGVQDADNLAWKLHRVL
FT                   DGRSPESLIDSYASEREYAADENILNSSRSTDFITPKSEVSKNFRNAVLNLARDHAFAR
FT                   KLVNSGRLSLPACYENSALNTADEHRFAGAMRPGSVAADAPVESDDARQWWLQMLDGDF
FT                   TLALFAGEQAPETETLEALAGLADLLLVRPAGAAWTAPEGTRCVTDKEGLLAARYDARP
FT                   GTCYLIRPDQHIAARRRDTDITALRAALARACGQH"
FT   CDS_pept        complement(553456..554409)
FT                   /transl_table=11
FT                   /locus_tag="BAV0532"
FT                   /product="putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48137"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYB9"
FT                   /inference="similar to DNA sequence:INSDC:AF098966.1"
FT                   /inference="similar to DNA sequence:INSDC:AB088224.1"
FT                   /inference="profile:HMMPfam:PF00753"
FT                   /protein_id="CAJ48137.1"
FT                   /translation="MSKQFASHADLDDKVVSFEKLSDNAYAYTAEGDPNTGVIIGDEAV
FT                   MVIDTQATPVMAQDVIRRIREVTDKPIKYVLLSHYHAVRVFGASAYQAQEILASRDTWD
FT                   LIAERGEQDKASEIGRFPRLFRNAESIPPGLVWPTMTFKGEMTVNLGNLEVKLLQVGRG
FT                   HTKGDTIAWLPEQKILFAGDLVEYQSTPYCGDAYFRDWPTTLDALSGFAAEKMVPGRGP
FT                   ALKNAEEVRKGLAGTRAFLTDLYGAVNRGVADGKDLKTIYREVYDFMKPRYSDWVIFDH
FT                   CMPFDVSRAYDEAQGITDPRIWTDKRDIEMWQQLEG"
FT   CDS_pept        complement(554522..555349)
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /gene_synonym="fpg"
FT                   /locus_tag="BAV0533"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48138"
FT                   /db_xref="GOA:Q2KYB7"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYB7"
FT                   /inference="similar to sequence:UniProtKB:P05523"
FT                   /inference="profile:HMMPfam:PF06827"
FT                   /inference="profile:HMMPfam:PF06831"
FT                   /inference="profile:HMMPfam:PF01149"
FT                   /protein_id="CAJ48138.1"
FT                   /translation="MPELPEVETTRRGIDPVITGQTLRRLVVREPRMRWPIPADLPSLL
FT                   TDRPVLATGRRGKYLLLRFEHGVQIVHLGMSGSLRRVAMDEAPRKHDHVDWVFDHAILR
FT                   LHDPRRFGAVLWHPNTDGPVEAHPLLIGLGIEPFDPRFDGKWLHDHFRDKRVAVKQALL
FT                   AGHAVVGVGNIYASECLFRAGIDPRTPAGKLSRPRCERLAQAVRATLADALASGGSTLR
FT                   DYVGASGEPGAYFAIHAAVYERAGLACRVCGTPIRRLVQGQRATYFCPHCQKR"
FT   misc_feature    complement(554531..554605)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01242"
FT   CDS_pept        <555411..557231
FT                   /transl_table=11
FT                   /locus_tag="BAV0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48139"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYB4"
FT                   /inference="similar to DNA sequence:INSDC:BX321861.1"
FT                   /inference="profile:HMMPfam:PF00515"
FT                   /protein_id="CAJ48139.1"
FT                   /translation="VKLSFKQINFGLASLAFALTSLPAITAQAAGPARDATGPRLIEAP
FT                   RQPETQVIRLHPGQLPDVNLTGDIFYRVIASEIAAQRGLYGPAATTLINLARDTSDPRL
FT                   ARRALEFQLAGGNLPGALEAARLWARLSPGDIEASSTELALSAANGQTKGLAQALRERI
FT                   EATPDKTGGITQAMSVLSRLNDRRLALRILDEALSDKVRKLPVAHLALADAAQAAGDFT
FT                   RADSEARAALLADPRSEAAAQRVLEYGAKVDPARAEEAARAFIARNPNARKLRLMLAAQ
FT                   MAERGDYDSAQAELAAMSRSAPEDFDLLFMQAQLAYKAGHLNQARSLLLQYLDVQDQRK
FT                   QATVAGASDAGAAAADAHVLLARIAEDQGRYDEAIAELERVDDPSMRYAAHMRQAALRA
FT                   RQGRIEDALALVDAAGALDDEEQTLGVLTKAQILRDAGQVDKAAALLAKADKDLPDTVE
FT                   IKYELAMLSERQGKVAQLEKLLRQVIALDPEHAHAYNALGYTLADRNQRLPEALDLITQ
FT                   ALELSPNDPFILDSMGWVKFRMGDLPAAAEYLQRAYALRPEPDIAAHLAEVLYAQGKRS
FT                   QAEDMLRELHKRDPKNGTVLDTMKRLGVQP"
FT   sig_peptide     555411..>555495
FT                   /locus_tag="BAV0534"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        557228..557812
FT                   /transl_table=11
FT                   /locus_tag="BAV0535"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48140"
FT                   /db_xref="GOA:Q2KYB2"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYB2"
FT                   /inference="similar to sequence:UniProtKB:P61320"
FT                   /inference="profile:HMMPfam:PF03550"
FT                   /protein_id="CAJ48140.1"
FT                   /translation="MTLRDGLARGARLLGVLSMAAIAACSSLPTSEGVSGADTFSRSGR
FT                   FAITATQADGRQEAVQGGFTWQDNGREYILDLTTPLGSTEARVQGRPGVAVLTRANGAS
FT                   LQAADPDTLAEDALGSPVPVSGLRDWLRGRLAPAQPEAVKRDEAGRPTRFEQGGWSAQL
FT                   SRYDAAGPQLLVLERQEPGRRIIVRLVVTPP"
FT   CDS_pept        <557822..558748
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BAV0536"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48141"
FT                   /db_xref="GOA:Q2KYA9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYA9"
FT                   /inference="similar to sequence:UniProtKB:P62615"
FT                   /inference="profile:HMMPfam:PF00288"
FT                   /protein_id="CAJ48141.1"
FT                   /translation="VTLYDVPAPAKLNLFLHIVGRRPDGYHLLQSVFRFIDLCDTLSFE
FT                   ARADGRIERAYDLPGVPAEQDLIVRAARALQAATGTRQGAHIGLQKRIPQGGGLGGGSS
FT                   DAATTLIALNRLWGCGLSRRDLMALALPLGADVPVFVFGQSAFAEGVGEDLQAIALPQA
FT                   AYLVLQPEASVPTAEIFSAPDLTRDKKRVRITDFLALPTSDFGQNDMEAVVFRLYPQIA
FT                   GAVRKLAELGIRVRMSGSGACLFAEYPNASEARHAEVVLAKFENTATMRGADKTVSDTQ
FT                   PELQIGFRLIKACAGLNEHPLRSWIAN"
FT   tRNA            558750..558823
FT                   /gene="tRNA-Gln (TTG)"
FT                   /product="transfer RNA-Gln (TTG)"
FT                   /anticodon="(pos:558784..558786,aa:Gln)"
FT                   /inference="profile:tRNAscan-SE"
FT   CDS_pept        558974..559906
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /gene_synonym="prsA"
FT                   /locus_tag="BAV0537"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48142"
FT                   /db_xref="GOA:Q2KYA5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KYA5"
FT                   /inference="similar to sequence:UniProtKB:P08330"
FT                   /inference="profile:HMMPfam:PF00156"
FT                   /protein_id="CAJ48142.1"
FT                   /translation="MIFTGTANTRLAVDVVNHLDMSLGKMTVGRFSDGEVMVEINENVR
FT                   GKDVFVLQPTCAPTNDNLMEIMVMVDALRRASAGRITAAIPYFGYARQDRRPRSARVAI
FT                   SAKVVANMLQVAGVDRVLTMDLHADQIQGFFDIPVDNIYAGPILLGDIWRRNFSNLVVV
FT                   SPDIGGVVRARALAKQLEADLAIIDKRRPRANVSEVMNIIGEVDGRTCIIMDDMVDTAG
FT                   TLCKAAQALKDRGAGAVYAYCTHPVLSGGAIERIASSSLDELVVTDTIPLSEEAQGCGK
FT                   IRQLSCAPLLGETILRISNAESVSSLFAD"
FT   misc_feature    559316..559345
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    559346..559393
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00114"
FT   misc_feature    559604..559642
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        560020..560616
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="BAV0538"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48143"
FT                   /db_xref="GOA:Q2KYA2"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KYA2"
FT                   /inference="similar to sequence:UniProtKB:P14194"
FT                   /inference="similar to DNA sequence:INSDC:BX321862.1"
FT                   /inference="profile:HMMPfam:PF01386"
FT                   /protein_id="CAJ48143.1"
FT                   /translation="MKFNATLRSVQGTSASRRLRRAGRVPAIVYGGTAAPLNIELDHNE
FT                   IFHALRKEQFHASILTMALEGGANEQVLLRSVQWHPFKQQVLHVDFQRVDANQALHTKV
FT                   PLHFVNAETSPAVKLSGAIISHVVTEVEVTCLPQSLPQFIEVDLGNLLGGGSIHQKDIV
FT                   LPKGVTFTHPNDEQVIVSAVVKGGAADDAEEAPAA"
FT   CDS_pept        560665..561288
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="BAV0539"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48144"
FT                   /db_xref="GOA:Q2KY99"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KY99"
FT                   /inference="similar to sequence:UniProtKB:P23932"
FT                   /inference="profile:HMMPfam:PF01195"
FT                   /protein_id="CAJ48144.1"
FT                   /translation="MHAQGFLCSKHAMSEPIRLIVGLGNPGPDYETTRHNAGFWLADRL
FT                   ADDLRATFALEKGFMGMVAKARFEGENVLLLKPITYMNRSGQAVGALARFYKLAPEQVL
FT                   VLHDELDLLPGQVKMKQGGGHAGHNGLKDIQAALGTPNFWRLRLGIGHPRTLNLAQQVA
FT                   DFVLHPPRRDEQAEIDTVIDRCRAVVPALLRGDFAQATRQLHTA"
FT   misc_feature    560752..560793
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01195"
FT   misc_feature    561034..561066
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS01196"
FT   CDS_pept        561288..562037
FT                   /transl_table=11
FT                   /locus_tag="BAV0540"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches. Seems to be unique
FT                   to the Bordetellae."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48145"
FT                   /db_xref="GOA:Q2KY95"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY95"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48145.1"
FT                   /translation="MTRPPSGQAPLRQEIADWWRFLRRPSPAGRIGPRHGGAMADWWPN
FT                   IRFGRLLAWAALLWAFNLFVLGPIAVGAAGLGGAQHRLDPQRLPWLTAVLWAPLVEELL
FT                   FRYGLRRPVQALWLVPAIAPAVFWGPQFWTGCLSAAVVLLAIYGTRAPQPFKSAARRFY
FT                   SRHFGLIFHLSALAFAAVHLNNFSLNHMAWWMLPLLVLPQWLTGLVLGWMRMRRGIGAS
FT                   IALHALFNAGPMALIWLVLTLLPDAAI"
FT   CDS_pept        562153..563244
FT                   /transl_table=11
FT                   /gene="engD"
FT                   /locus_tag="BAV0541"
FT                   /product="GTP-dependent nucleic acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48146"
FT                   /db_xref="GOA:Q2KY93"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY93"
FT                   /inference="similar to sequence:UniProtKB:P31216"
FT                   /inference="profile:HMMPfam:PF06071"
FT                   /protein_id="CAJ48146.1"
FT                   /translation="MALQCGIVGLPNVGKSTLFNALTRAGIAAENYPFCTIEPNVGVVE
FT                   VPDPRLGKLAEIVKPERILPATVEFVDIAGLVAGASQGEGLGNQFLSHIRETDAIVNVV
FT                   RCFEDPNVIHVAGKVDPIADIEVIETELALADLQTAEKALHRHSKTARSGDKDAQRLVG
FT                   VLEKCIAHLNEAKPVRSLGLSDDDMALIKPLCFITAKTAMYVGNVSDDGFTNNPLLDRL
FT                   TEFAAKRNAPVVAICAAIESEIVDLPDEDRQAFLADMGMEEPGLDRLIRAAFKLLGLQT
FT                   YFTAGVKEVRAWTVPIGATAPQAAGVIHTDFERGFIRAQTIAYDDYIACKGEQGAKEAG
FT                   KMRAEGKEYIVQDGDVMNFLFNV"
FT   misc_feature    562153..562179
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00443"
FT   misc_feature    562177..562200
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    563265..577549
FT                   /note="Low 4096C region. Laterally acquired genomic
FT                   island."
FT   CDS_pept        complement(563605..>564552)
FT                   /transl_table=11
FT                   /locus_tag="BAV0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48147"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY90"
FT                   /inference="similar to DNA sequence:INSDC:AE004701.1"
FT                   /inference="profile:HMMPfam:PF04373"
FT                   /protein_id="CAJ48147.1"
FT                   /translation="VALNLNKAVLDCLKAHPEEKLTARQIAEWTLKTYPAECQEKKVNS
FT                   KGGYINTDADLVQQLVAEIGSRRPNLQKQHPELKTTEGRPRKYYHSEKSDAAEVAAAEG
FT                   QSVTLPTEPTSKSIGEHALYPILSAYLWEEFGVYSKRIDEKRSSNKRGPNGNRWLYPDM
FT                   VGMEDLGAEWHREVRDCVNQYADKRTKLWSFEAKLLINRSNVRECFFQAVSNSSWANFG
FT                   YLVAAEIEGQDTLKELRMLFAAHGIGLIKLDADNPAESQVLIPARERDEIDWDMANRLA
FT                   TENRDFIEFVKLVKQFYQIGEAKRSDWDLPDEEA"
FT   CDS_pept        complement(564642..567743)
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="BAV0543"
FT                   /product="type I restriction enzyme EcoR124II R protein"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48148"
FT                   /db_xref="GOA:Q2KY88"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY88"
FT                   /inference="similar to sequence:UniProtKB:P10486"
FT                   /inference="profile:HMMPfam:PF04851"
FT                   /inference="profile:HMMPfam:PF04313"
FT                   /protein_id="CAJ48148.1"
FT                   /translation="MIDYSPIAESKNYIVLDKYTQEWKVSESYQSEGDLEREFIQDLQN
FT                   QGYEYLPGLNAPEALLANVRVQLQVLNNVQFSDGEWSRFVETWLDKPSDGIVEKTRKIH
FT                   DDYIHDFVFDDGRIQNIYLLDKKTITRNKVQVIKQFEQTGSHANRYDVTILVNGLPLVQ
FT                   VELKKRGVAIREAFNQVHRYSKESFNREHSLFKYLQLFVISNGTDSRYFANTTQRNKNS
FT                   FDFTMNWAKADNTLIKDLKDFTATFFQKHTLLNVLLHYSVFDVSNTLLVMRPYQIAATE
FT                   RILWKIKSSHQAKNWSNTESGGFIWHTTGSGKTLTSFKAARLATELDFIDKVFFVVDRK
FT                   DLDYQTMKEYQRFSPDSVNGSDSTAGLKRNLEKDDNKIVVTTIQKLNNLMKSEADLPIY
FT                   GKQVVFIFDECHRSQFGEAQKNLKKKFKKFCQFGFTGTPIFPENALGAETTASVFGREL
FT                   HSYVITDAIRDEKVLKFKVDYNDVRPQFKAIETEQDEKKLSAAENKQALLHPDRIREIS
FT                   QYILNNFRQKTHRLHAGNKGFNAMFAVSSVDAAKLYYECFRELQKASDKPLKVATIFSF
FT                   AANEEQDAIGDIQDESFDVSAMNSSAKEFLSAAIADYNVLFKTNFSVDSNGFQNYYRDL
FT                   AKQVKAKEIDLLIVVGMFLTGFDAPTLNTLFVDKNLRYHGLMQAYSRTNRIFDATKTFG
FT                   NIVTFRDLEQATIDAITMFGDKNTKNVVLEKSYKEYMEGFTDTATGEARRGFMDVVQEL
FT                   EARFPDPAAIEKESDKKAFAKLFGEYLRVENVLQNYDEFARLKELQSVDQADPAAVEAF
FT                   KAKHYLSDEDLASLQAITLPPERKVQDYRSTYNDVRDWLRREKAGAEKEKSTIDWDDVV
FT                   FEVDLLKSQEINLDYILELIFEHNKKIKSKSELVDEVRRVIRASLGNRAKESLLVDFIN
FT                   RTDLDQISDKASVIDAFFKFAQAEQQREAQELIDTENLNVEAARRYLITSLKREFASEH
FT                   GTELNALLPKMSPLNPQFKTKKQTVFQKIAAFVEKFKGVGGQLI"
FT   CDS_pept        complement(567740..568942)
FT                   /transl_table=11
FT                   /gene="prrC"
FT                   /locus_tag="BAV0544"
FT                   /product="anticodon nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48149"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY85"
FT                   /inference="similar to sequence:UniProtKB:P17223"
FT                   /protein_id="CAJ48149.1"
FT                   /translation="MGKTLTEIAQQLKGANKKVQLIYAFNGTGKTRLSREFKQLIAPKD
FT                   DSDAEGDQVELSPNKILYYNAFTEDLFYWDNDLEEDAEPKLRIQPNTFTDWVLKDQGQD
FT                   MNVITTFQRYTNDKLTPRFNEERKDDKTGEAIAKAFSEVTFSLESGDATHSGNLKISKG
FT                   EESIFIWSIFFALLEQVIDVLNVAEPRDRETDQFNQLEYVFIDDPVSSLDDNHLIQLAV
FT                   DLAHLVKSNESSVKFIITTHNPLFFNVLCNEFGSDDTSERYSWKSKWFSKSRLERNSDG
FT                   SFSLVEQPNDSPFAYHLHLISQLEGAIKSGQIEKYHFNLLRNVLEKTATFLGYKRWENL
FT                   LPEIGGGQPNPYAKRIVNFSSHSKHAAEEAQPLKPEEKKLLEKLVKHIVEQHRFWQETT
FT                   T"
FT   misc_feature    complement(568850..568873)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(568944..570164)
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="BAV0545"
FT                   /product="type i restriction enzyme EcoR124II specificity
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48150"
FT                   /db_xref="GOA:Q2KY82"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY82"
FT                   /inference="similar to sequence:UniProtKB:P10485"
FT                   /inference="profile:HMMPfam:PF01420"
FT                   /protein_id="CAJ48150.1"
FT                   /translation="MSDIDFLPQLLDGAEVDWKPLGEVLNRTKGTKITAGQMRELHKEG
FT                   GPVKIFAGGKTVAFVNFNDIPEKDIQTVPSIIVKSRGIIEFEYYENPFTHKNEMWAYNA
FT                   KDRALNIKYVYHFLKLNEPHFHGIGSKMQMPQIAIPDTDGFSIPIPCPNNPKRSLEIQA
FT                   EIVRILDAFTELTAELSTELSARKKQYNYYRDQLLSFGEGVPFLSLAQCCESIADGDHQ
FT                   APQKTEDGIPFITISNVSATNQIDFSNTKFVSNSYYDGLDSKRKARTNDILYTVVGSFG
FT                   IPVHIDCEKKFAFQRHIAILRPNPAVVLSKYMYHALRSSAVEKQAHKVAAGAAQKTITL
FT                   SALNRMLIAVPSLEEQARIVAILDKFDVLTNSIAEGLPREIELRKKQYKHYRDLLLSFP
FT                   KPEEVEA"
FT   CDS_pept        complement(570161..571720)
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="BAV0546"
FT                   /product="type i restriction enzyme EcoR124II M protein"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48151"
FT                   /db_xref="GOA:Q2KY78"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY78"
FT                   /inference="similar to sequence:UniProtKB:P10484"
FT                   /inference="profile:HMMPfam:PF02384"
FT                   /inference="profile:HMMPfam:PF02506"
FT                   /protein_id="CAJ48151.1"
FT                   /translation="MTSNEQRAALQRKIWDIANDVRGAVDGWDFKQYVLGALFYRFISE
FT                   NFIDYITGGDASMDYAAMPDNDENIAAAKDDAIKTKGYFIYPSQLFVNVAANANTNENL
FT                   NTDLANIFAAIEASANGYPSERDIKGLFADFDTTSNRLGNTVKDKNDRLSKVLKRVAEL
FT                   DFGGFDASHIDLFGDAYEFLISNYAANAGKSGGEFFTPQHVSKLIAQLAMHKQTSVNKI
FT                   YDPACGSGSLLLQAKKHFDQHLIEDGFFGQEINHTTYNLARMNMFLHNVNYDKFNIQLG
FT                   NTLIEPHFGEDKPFDAIVSNPPYSVKWIGGDDPTLINDERFAPAGVLAPKSKADFAFVL
FT                   HALNYLSSKGRAAIVCFPGIFYRGGAEQKIRQYLVDNNYVETVISLAPNLFYGTTIAVN
FT                   ILVLAKNKKDTTTQFIDASGLFKKETNNNVLLDSHIEQIMAVFDSKDNVDHFAKSVPLE
FT                   EVVNKEYNLSVSSYVEAKDNREVVDIAKLNAELKTTVTKIDQLRKDIDAIVAEIEGGEF
FT                   EA"
FT   misc_feature    complement(570809..570829)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        complement(571956..572186)
FT                   /transl_table=11
FT                   /locus_tag="BAV0547"
FT                   /product="putative phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48152"
FT                   /db_xref="GOA:Q2KY75"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY75"
FT                   /inference="similar to DNA sequence:INSDC:U20246.1"
FT                   /inference="similar to DNA sequence:INSDC:AY129330.1"
FT                   /protein_id="CAJ48152.1"
FT                   /translation="MSIEPWVTAEDVAQHLGVAKDTVYRWREGKGLPAHRVGRLWKFQL
FT                   SEVNEWVRAGGADEKSSDASADGAQRRPLGR"
FT   CDS_pept        complement(572690..573193)
FT                   /transl_table=11
FT                   /locus_tag="BAV0548"
FT                   /product="MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48153"
FT                   /db_xref="GOA:Q2KY74"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY74"
FT                   /inference="similar to sequence:UniProtKB:O33817"
FT                   /inference="profile:HMMPfam:PF01047"
FT                   /protein_id="CAJ48153.1"
FT                   /translation="MARDRTSNTPRSRRASLADTAEVDAILRHFRLEEVPSHLLRRAHF
FT                   KAEEIFASTFAGEGVTPRQKAALILLYQDPGLSQNALAERLAMDRNTVAEMVKRMHRAG
FT                   LLERSPSPADARAYQLYVTPAGMEVLRRVMPRDVIVEDQLLARLPEEYRALFVKCLRLI
FT                   AEAE"
FT   misc_feature    complement(573047..573106)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00179"
FT   CDS_pept        <573499..573738
FT                   /transl_table=11
FT                   /locus_tag="BAV0549"
FT                   /product="conserved hypothetical protein (partial)"
FT                   /note="Partial CDS. Seems to be truncated at the
FT                   N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48154"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY71"
FT                   /inference="similar to sequence:UniProtKB:P37552"
FT                   /inference="similar to DNA sequence:INSDC:AJ617740.1"
FT                   /protein_id="CAJ48154.1"
FT                   /translation="VRADIYVSGLDRQTGMFAGDGEQTRCLFLHLQALCEEQGGSIERI
FT                   VLARVYCAGVDAVRGMNETWGAFCDEIEPPARTW"
FT   CDS_pept        573802..574725
FT                   /transl_table=11
FT                   /gene="amnB"
FT                   /locus_tag="BAV0550"
FT                   /product="2-aminophenol 1,6-dioxygenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48155"
FT                   /db_xref="GOA:Q2KY69"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR034943"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY69"
FT                   /inference="similar to DNA sequence:INSDC:AB020521.1"
FT                   /inference="profile:HMMPfam:PF02900"
FT                   /protein_id="CAJ48155.1"
FT                   /translation="MREGVILAGFLAPHPPHLVYGENPPQNEPRSEGGWEPLRWAYAQA
FT                   RESIARLKPDVLLVHSPHWITQVGHHFLGVPRLSGRSVDPIFPNLFRYDFGMDVDVELA
FT                   EACCEEAAHLGLVSKMMRNPRFRPDYGTITTLHMIRPQWDIPVVGISANNTPYYLNTKE
FT                   GLGEMDVLGRATREAIRKTGRRAVLLASNTLSHWHFHEEPALPEDMTKEHPERYDGYKW
FT                   DVRMIDLMRQGRMKEAFALLPQFIDEAFAEVKSGAFTWMHAAMGYPELAGRLHGYGTVI
FT                   GTGNAVIEWNLQDAGLAGLTPATQSA"
FT   CDS_pept        574760..575572
FT                   /transl_table=11
FT                   /gene="amnA"
FT                   /locus_tag="BAV0551"
FT                   /product="2-aminophenol 1,6-dioxygenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48156"
FT                   /db_xref="GOA:Q2KY67"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY67"
FT                   /inference="similar to DNA sequence:INSDC:AB020521.1"
FT                   /inference="profile:HMMPfam:PF02900"
FT                   /protein_id="CAJ48156.1"
FT                   /translation="MTIVSAFLVPGSPLPQLRPDVAPWGRFRDALRQVGRSLARSRPDC
FT                   VLVYSTQWFAVLDQLWITRARSTGLHVDENWHEFGEQPFDIYSDAQLAHRCVQACNEAG
FT                   IKTRSVDYDQFPIDTGTITASTLMNFGTEDLPVITAANNLYHSAAQTEQLGSIAACALQ
FT                   DKRVAVLGIGGLSNSMFREAIDVHEDHIISEGDDAWNKRLLALIEDGDLPALRASLPEY
FT                   SKAARPDMGLKQLHWLLGAMGDRYQQAVVHEYGPLYGSGGAVVEFKLQ"
FT   CDS_pept        <575626..577107
FT                   /transl_table=11
FT                   /gene="amnC"
FT                   /locus_tag="BAV0552"
FT                   /product="2-aminomuconic semialdehyde dehydrogenase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48157"
FT                   /db_xref="GOA:Q2KY65"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017628"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY65"
FT                   /inference="similar to DNA sequence:INSDC:AB020521.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ617740.1"
FT                   /inference="profile:HMMPfam:PF00171"
FT                   /protein_id="CAJ48157.1"
FT                   /translation="VFKQYRNFINGRFVESEKRFAGINPATGVQFAEVHEASRAMVDEA
FT                   IAAGHRAVRAWGATSVADRADMLYRIADEIDRRAEVFLEAEVSDTGKPVSLASKLDIPR
FT                   GAANFRIFADILKTAPLETFRTELAGGAQAINYAVRKPLGVVGIISPWNLPLLLFSWKV
FT                   APALACGNAVVAKPSEETPGTASLLAEVMQSVGLPEGVFNLVHGFGPNSAGEFISRNPD
FT                   ISAITFTGESKTGSAIMHAAADGVKPVSFELGGKNAAIIFADCDVEKTLEGMTRAAFLN
FT                   SGQVCLCSERIFVERPIYQRFVAALAERAKRIKLGDPADAETEMGPLISAAHRDKVLAY
FT                   YALAREEGAEFIVGGGTPRFGNALDGGFWVEPTLIAGLPDDARCVSEEIFGPIGHITPF
FT                   DSEAEVIRRANATPYGLAATIWTSNVNKAHRVAQSMNVGVAWVNAWFLRDLRTPFGGSG
FT                   LSGIGREGGLHSLNFYSELTNVCIHVDGPEASDEG"
FT   misc_feature    576376..576399
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00687"
FT   misc_feature    576460..576495
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00070"
FT   CDS_pept        577112..577549
FT                   /transl_table=11
FT                   /gene="amnE"
FT                   /locus_tag="BAV0553"
FT                   /product="2-aminomuconate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48158"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY62"
FT                   /inference="similar to DNA sequence:INSDC:AB020521.1"
FT                   /inference="similar to DNA sequence:INSDC:AJ617740.1"
FT                   /inference="profile:HMMPfam:PF01042"
FT                   /protein_id="CAJ48158.1"
FT                   /translation="METTATVSAVISGWAQPRGRFPHVKRAGDFLFVSGTSSRRADNSF
FT                   VGAESDAMGVLDADIRAQTRAVIENIKAILESVGAGLKDLVELSTYLVDMGDFKGYNEV
FT                   YAEYFDYDGPCRTTVAVHQLPHPMLRIEIKAVAYKPLASDA"
FT   CDS_pept        complement(577652..578815)
FT                   /transl_table=11
FT                   /locus_tag="BAV0554"
FT                   /product="putative calcium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48159"
FT                   /db_xref="GOA:Q2KY60"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY60"
FT                   /inference="similar to sequence:UniProtKB:P31801"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF01699"
FT                   /protein_id="CAJ48159.1"
FT                   /translation="MCTLHHRARASRPRIPRPALIKLIWAWLVVIVFTVYGGDLLAAPL
FT                   TPAVALGCFALLFFTIVAASFGVVHEADRLAQQLGEPYGTLILTLSIVSIEVILIASVL
FT                   LGPGEFPTIGRDAIFAVMMIIINLVMGICLIAGALRHGEQTYNAQGAKAYLGMIVLLTG
FT                   CALVLPNSLPGAGAFSTVQAWTIAGITAALYGLFLALQMGRERRLFMQPEPGLMAIAHR
FT                   PDQASDSAPAQDKAQGSTRQSSLLLLAMIVPIVLLAHHLAVVIDYGVVAAGAPIAVSGL
FT                   LIAIIVFTPESLTAVKAALNQDMQRAINLCLGAFVSTVGLTVPAVLVIGLLTGKPVIMG
FT                   ISALETLLFALTVMLAMLSFGGQKTSVIQGALHLALFALYGFLLFGA"
FT   misc_feature    complement(578657..578689)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        579418..580266
FT                   /transl_table=11
FT                   /locus_tag="BAV0555"
FT                   /product="putative 2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48160"
FT                   /db_xref="GOA:Q2KY58"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY58"
FT                   /inference="similar to DNA sequence:INSDC:AF169302.2"
FT                   /inference="similar to DNA sequence:INSDC:AP003005.2"
FT                   /inference="profile:HMMPfam:PF01557"
FT                   /protein_id="CAJ48160.1"
FT                   /translation="MKLVRFGPAGQEKPGLIDAQGVLRDLSGLVPDIGPAQLGRAALAA
FT                   LIGRDPASLPQVPGEPRLACPVANVGKLVAIGLNYFDHAAEVGAPVPQEPVIFMKATSC
FT                   IQGPDDPVMLPEGSQKGDWEVELGVVIGERARYVEADDALDYVAGYCVVNDVSEREYQM
FT                   ERGGTWDKGKGCDTFGPIGPWLVTRDEVPDPQALDLWLDLNGRRMQTGNTRTMIFDVKT
FT                   LVSYVSRFMTLLPGDIITTGTPPGVGLGMKPPVFLREGDVMTLGVQGLGTQRQRVVAFT
FT                   R"
FT   CDS_pept        complement(580313..581728)
FT                   /transl_table=11
FT                   /locus_tag="BAV0556"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48161"
FT                   /db_xref="GOA:Q2KY56"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY56"
FT                   /inference="similar to DNA sequence:INSDC:D28119.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF03413"
FT                   /protein_id="CAJ48161.1"
FT                   /translation="MSTSASLNKDDREHVAAADLYRAVWRWHFYAGMLVLPFMILLAAT
FT                   GMLYLFHDEIESVWYRDLRQVAEHDAAPRAPETLAAAALAAQPGTLLKYLPPAGPHASA
FT                   RAVIRPASGANISVYLNPYTAQVLGSLPEQGSLMWTVRKLHSLKYFNAAALIEIAAGWS
FT                   LLLVASGIYLWWPRGRRLGVISVRGSPARRVFWRDLHAVTGVFTAFFIVFLALTGMPWS
FT                   QVWGAKINQWANGSNFGYPSGVRVQVPMSTLKLADQGLTTWSLEQARLPQSGHEGHDSH
FT                   AGHAAQEAPQGQNRQGEHPGRPAPIGLNRAVAALEALHLAPGYSINLPKGDRGVYSASV
FT                   YPNDLQRQRVVHLDQYSGKPLLDMSYADYGPLGKTLEWGINVHMGQEFGLANQLVLTLA
FT                   CLAMVLMSVSAAVMWWKRRPAGGLGIPPAPHNARALRGVLVIMVIGGLIFPLVGLSLIV
FT                   MGVLDWLALKLTR"
FT   CDS_pept        complement(581739..581939)
FT                   /transl_table=11
FT                   /locus_tag="BAV0557"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48162"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY55"
FT                   /protein_id="CAJ48162.1"
FT                   /translation="MSIPYARTALAVWGYAHASSWAHTASVATLPGLSAMRHPGETADD
FT                   EPTQWLIGEGRRLELSASYRF"
FT   sig_peptide     complement(<581870..581939)
FT                   /locus_tag="BAV0557"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(582012..582410)
FT                   /transl_table=11
FT                   /locus_tag="BAV0558"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48163"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY53"
FT                   /protein_id="CAJ48163.1"
FT                   /translation="MQTKPCTLTRSRTAVFWLALLLFAFKAMVPQGFMPGSSQGGTLIQ
FT                   LCSAAGPVWVQGPAKADQGPDERHAAQAAACSSGAAVSAAALLPAPLYPIPVSEQAFPV
FT                   SARAPPAAPVFPIFSVPLGARAPPLPLV"
FT   CDS_pept        582825..585305
FT                   /transl_table=11
FT                   /locus_tag="BAV0559"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48164"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY52"
FT                   /inference="similar to DNA sequence:INSDC:AE004185.1"
FT                   /inference="profile:HMMPfam:PF05170"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48164.1"
FT                   /translation="MKTWFKRILIGLVVLVLVAVVGLAIFLLTFDPNAYKYKLEELVQE
FT                   RYHRTLTIEGEIELSLFPRIGLAVQGVSLSEANSPEVFASIDSMRLAVAVWPLLSNNLV
FT                   VDHVTINGFKARIAREKSGQFNFENLVGGVEPSTAVPANAAEATVGAIAGAAQALSSGT
FT                   VSAPRSMQIDIAGLDLKDGELQLQDALSGMAVSVTHLNANTGRVTFNQPFDVSFNARVE
FT                   GGDPRFDAGLTGQALLRLDPSAKRYSAQRLDLRMEGKLPSAQAKSLAVRGNLAFNGASS
FT                   SLDVAGLEVVFQGDVTHPAARLTGVEASVAMPKLSVDPHKAQLQIDKLAARAKGNSPEG
FT                   PFEFALDTPSLHISPTSAGGDALTGRIRNPSLDASFSLTGISGNAAELDIKEAKIDAAV
FT                   KQGERVVKTVFASPVSLNLTQRAGSLAALKGDVNITDPALPKGSLQIPVIGSLSADLLK
FT                   DQASAKINAVLEGGKFDLMADLAQLTTQPQLKFALAVDTLDLDKLMPALPVKPAADGKQ
FT                   EESKPSAKPAAPAKPRDDSINLSGLIGPSADGTVKIGQLVMRGLKAAQVGASIKLDHGK
FT                   LDISGISADLYNGKLAGGLSVNAAEGNKMAAKLNLTGVAIEPLLMDVAKRNTLSGNGSL
FT                   ALDLSTAGNNSYALTSNLGGTVQLRLREGAVKGINLSQTLKDLKALVNGQGENHSFASD
FT                   SSRQTDFTAMDADMTLAKGVGTVKRLDVATDFLRVSQGSPAIIDFVNSGLDFVVVARVT
FT                   NTAKEGKELADLRNLPVPVLISGSFEKPLYTVQWREIASALIKRGLESTIKDALGAKGG
FT                   KSNVGKALKGVLNR"
FT   sig_peptide     582825..>582930
FT                   /locus_tag="BAV0559"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        585302..585706
FT                   /transl_table=11
FT                   /locus_tag="BAV0560"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches."
FT                   /db_xref="EnsemblGenomes-Gn:BAV0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48165"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY49"
FT                   /inference="profile:HMMPfam:PF03476"
FT                   /protein_id="CAJ48165.1"
FT                   /translation="MSGFQPVAECGETAQAEAAAYERRWLISNDAGQWLDRGLCPRLAE
FT                   ISVALRLGYLVLTAPGMLRLDIPLDVIEDDDSVRYQLRIGEQVVDVVDEGDLAAAWLSH
FT                   YLGIPARLLKVHPDMGAVSWPAGSLRPSQA"
FT   CDS_pept        complement(585713..586918)
FT                   /transl_table=11
FT                   /gene="benE"
FT                   /locus_tag="BAV0561"
FT                   /product="putative benzoate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48166"
FT                   /db_xref="GOA:Q2KY46"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY46"
FT                   /inference="similar to DNA sequence:INSDC:AF218267.1"
FT                   /inference="similar to DNA sequence:INSDC:AB024746.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF03594"
FT                   /protein_id="CAJ48166.1"
FT                   /translation="MSGPEQSSTAPHRPAIRDLSVSAIAAGLIAVLVSFSGTAVLMVQA
FT                   GHAGGLSAVQIGSWLGSICLALGLGGTIFSLRTGLPVVFAWSTPGAALLVTGLAGVPFD
FT                   QAVGAFMLAAALTLICGVFGWIDPIVRRIPGEIAGAMLAGVLLNFGMGIFRNISSAPAM
FT                   VLAMCVAYLLCKRWLPRFAILIVLALGLLIAASQGLLQLNSLSWEWTEFVWTTPHFTVQ
FT                   SAISLGIPLFVVAMASQNLPGLAILQAAGYRPPASRLVAATGLVGLAAAPFGAHSVTLG
FT                   AIIAALCAGPEAHHDPARRYVAAATYGISYVLLSVAAGTVALFFQALPAALIATLAGLA
FT                   LLGAIMGGMANAMGNPQRREAALITLLATASGMSFWGIGSAFWGLAAGLLAHAVFSLRA
FT                   KS"
FT   CDS_pept        complement(586915..587169)
FT                   /transl_table=11
FT                   /locus_tag="BAV0562"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48167"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY43"
FT                   /inference="similar to sequence:UniProtKB:P00208"
FT                   /inference="profile:HMMPfam:PF00037"
FT                   /protein_id="CAJ48167.1"
FT                   /translation="MALLITDECINCDVCEPQCPNEAISMGEDYYVIDPDLCTECVGHY
FT                   DEPQCKVVCPVECIELHPQWKEGQEALMAKYRRLTGGAA"
FT   misc_feature    complement(587110..587145)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00198"
FT   CDS_pept        complement(587221..587724)
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /gene_synonym="kdtB"
FT                   /locus_tag="BAV0563"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48168"
FT                   /db_xref="GOA:Q2KY40"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KY40"
FT                   /inference="similar to sequence:UniProtKB:P23875"
FT                   /inference="profile:HMMPfam:PF01467"
FT                   /protein_id="CAJ48168.1"
FT                   /translation="MITAVYPGTFDPLTRGHEDLVRRAAALFDKVVVAVAYSRNKKPFF
FT                   NIDERVEIAREVLGHYPNVEVRSFGGLLRDFVREQNGRVIVRGLRAMSDFEYEFQMAGM
FT                   NRHLLPDVETLFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQAKAKARREQ
FT                   AETE"
FT   CDS_pept        complement(587746..588366)
FT                   /transl_table=11
FT                   /locus_tag="BAV0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48169"
FT                   /db_xref="GOA:Q2KY37"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY37"
FT                   /inference="similar to DNA sequence:INSDC:BX321859.1"
FT                   /inference="profile:HMMPfam:PF03602"
FT                   /protein_id="CAJ48169.1"
FT                   /translation="MKQSASGARAIRIVGGQFRRTPITVPDVPGLRPTPDRVRETLFNW
FT                   LTHLWHGEFRDKRVLDLFAGSGALGLEAASRGVAQVQMVERDRGAVSALRSLRDKLKAE
FT                   HIRIHAGDALAALERMDASRFDLVLLDPPFGQGWLARLWPLLPAVLDENALVYVESETP
FT                   AEAPEGFDVLREGKAGAVHYCLLQFAAMRKTENNPGSEDGVTP"
FT   misc_feature    complement(587965..587985)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        <588769..589779
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="BAV0565"
FT                   /product="cell division protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48170"
FT                   /db_xref="GOA:Q2KY35"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY35"
FT                   /inference="similar to sequence:UniProtKB:P10121"
FT                   /inference="profile:HMMPfam:PF02881"
FT                   /inference="profile:HMMPfam:PF00448"
FT                   /protein_id="CAJ48170.1"
FT                   /translation="VAALAPPSPPAAQAPAPAAPAPEVPAPEVPAPKKASWLSRLKQGL
FT                   ARTGQSIGGIFVGVKVDENLFEELESALIMADAGIEATDKLLTALRARVKKERIEDPAQ
FT                   VKAALRQLLADHLKPLERQFDLKRAQPLVVMIAGVNGAGKTTSIGKLAHTFQRQGASVL
FT                   LAAGDTFRAAAREQLVEWGSRNNVTVIAQDGGDPAAVAFDAVNAGRARAAGVVMIDTAG
FT                   RLPTQLHLMEELKKIRRVIGKADAAAPHEVLLVIDGNTGQNALAQIRAFDAAIQLTGLV
FT                   VTKLDGTAKGGTLAAVAAGSQGVRPVPVYWIGVGEGLEDLQPFVAEEFASALLAD"
FT   misc_feature    589180..589203
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(589833..591419)
FT                   /transl_table=11
FT                   /locus_tag="BAV0566"
FT                   /product="putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48171"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY30"
FT                   /inference="similar to DNA sequence:INSDC:AE006010.1"
FT                   /inference="profile:HMMPfam:PF05235"
FT                   /inference="profile:HMMPfam:PF01928"
FT                   /protein_id="CAJ48171.1"
FT                   /translation="MSEQELKLHVPAASVEGVRQEIAGRQATRLPLRAMYFDTPERELV
FT                   KARIALRLRQEGENWVQTVKMPGANAITRIELNHVRPGPVLDLSVYAGTAVGDALARIQ
FT                   GQLGVRYETDVQRLLCKLRSREGGVEAALDLGVLRAGGLELPICEIEFELMSGRPEAIF
FT                   SIARGWQQRHGLVLDVRSKSERGDALAQLAAQLALANDEATAQQIVARFWAPRGARAVA
FT                   LTPDLTPEQAMARVADECLEQIIRNAAMVAEVDTAGVYQAGSAEHVHQLRVGMRRLRSA
FT                   WRLFEGAIETPPETLDAGIREYFGALGASRDQDVLADTIAPLLRQAGMPDIPTEPVARG
FT                   ADARSLCSGAALQGWLLDLYQWSMTVRAAPVDLPLPVVVEGQPFEPAIIPLDAAPAQAP
FT                   LRPFLIRRLRRWHKQVVTEGMHFSELDLPTRHELRKRAKRLRYGLAFAESLLPNARLRS
FT                   YRKQLALVQELLGEINDLAVAAEHYKTQIPLHPQAWFALGWIALRLEQLAQQAQPAFEK
FT                   LAKDKRFWKAA"
FT   CDS_pept        complement(591687..592484)
FT                   /transl_table=11
FT                   /locus_tag="BAV0567"
FT                   /product="IclR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48172"
FT                   /db_xref="GOA:Q2KY27"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY27"
FT                   /inference="similar to DNA sequence:INSDC:AF135395.1"
FT                   /inference="similar to sequence:UniProtKB:P15360"
FT                   /inference="profile:HMMPfam:PF01614"
FT                   /protein_id="CAJ48172.1"
FT                   /translation="MATANDGRRSIQSVEVGFPLLAALVDAARPMTLRDLAAAAGMTSA
FT                   KAHPYLVSFIRVGLVLQDSVSGHYELGPFALQMGLVSLQRLDPVRMALPEVAQFQAGIG
FT                   HTVGLAVLGSHGPTMVHITEASYPVHVNMRQGTVMSMLNTATGLVFAAWLAPKVAEYYI
FT                   AREQNDTAVTSTLSHPLKSASPEHLQAMLADIRVHGMARAVGNPLPGVDALSVPVFDHT
FT                   GKLVLAITAIGPSGLFDVSWQGSIAQPLLQCAHAVSHKLGWRP"
FT   CDS_pept        complement(join(592495..592602,592604..592777))
FT                   /transl_table=11
FT                   /locus_tag="BAV0568"
FT                   /product="conserved hypothetical protein (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48173"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY25"
FT                   /inference="similar to DNA sequence:INSDC:AL646063.1"
FT                   /protein_id="CAJ48173.1"
FT                   /translation="MPPRSPHQARGQGASQSPLDARGLGGNRRIMRRLLEHELGQGALM
FT                   FQCFPLSVGVARPPPHRSTYKPAPVSAARGGEGFAEIAKRLRAARRNH"
FT   CDS_pept        593118..594284
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="BAV0569"
FT                   /product="putative 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48174"
FT                   /db_xref="GOA:Q2KY22"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY22"
FT                   /inference="similar to sequence:UniProtKB:P51962"
FT                   /inference="profile:HMMPfam:PF00926"
FT                   /inference="profile:HMMPfam:PF00925"
FT                   /protein_id="CAJ48174.1"
FT                   /translation="MTDQISPAAAESDFGIVSVPEIIAELRAGRIVILVDEEDRENEGD
FT                   LVMAAEFVTPEAINFMVTHGRGLVCLTLTEERCRQLDLPLMASRNGTRYGTNFTQSIEA
FT                   AEGVETGISAADRARTIQVAVARDARPSDLVQPGHIFPVRAVPGGVLVRAGHTEAGCDL
FT                   TAMAGLTPAAVICEILKPDGTMARLPDLAAFAREHGLKIGTIADLIQYRSEHESIIQRV
FT                   GERQMQTPWGTFQAIAYRDDATGSPHLALVHGKIDPAKETLVRVHEPASLLDALDTGSS
FT                   PHSWGLGQALSAIAASPAGVVVLMNCQSSTEHLFGQIAHWSDPGRQASTQDGERFGLRT
FT                   YGIGAQILRDLHVGQMRLLARPRKMPSMAGFALTITGYDCPPARNTDE"
FT   CDS_pept        594294..594815
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="BAV0570"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48175"
FT                   /db_xref="GOA:Q2KY20"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY20"
FT                   /inference="similar to sequence:UniProtKB:P11998"
FT                   /inference="profile:HMMPfam:PF00885"
FT                   /protein_id="CAJ48175.1"
FT                   /translation="MNPYILTPDLNGEGLHIGIVRARFNEEVGQTELAGCLEELAKLGV
FT                   DERDVMVVSVPGALELGVALARMAESFEFDALIALGAVIRGETYHFEVVSNEMATAITR
FT                   ISLETGIPVANGVLTVDTDEQAVARAEGKGRDCAQVAVEMANLVAALEPEEDDEDDEDE
FT                   DFDDEEDDER"
FT   CDS_pept        <594823..595293
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /gene_synonym="ssyB"
FT                   /locus_tag="BAV0571"
FT                   /product="N utilization substance protein B"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48176"
FT                   /db_xref="GOA:Q2KY17"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY17"
FT                   /inference="similar to sequence:UniProtKB:P04381"
FT                   /inference="profile:HMMPfam:PF01029"
FT                   /protein_id="CAJ48176.1"
FT                   /translation="VAARANARSARRRAREFALQGVYAWLLRGGQDTQDAGEIDAHLRD
FT                   AEDFSEADAQWFKTLLHGVLREAPTLREHFTPYIDRPLAELSPVEHGILLIGSYELVHH
FT                   VEVPYKVAINEAVELAKSFGGTDGFKFVNGVLDKLAADVRTAEVEAAAQQRR"
FT   CDS_pept        <595309..596277
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="BAV0572"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48177"
FT                   /db_xref="GOA:Q2KY14"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY14"
FT                   /inference="similar to sequence:UniProtKB:P77785"
FT                   /inference="profile:HMMPfam:PF00586"
FT                   /inference="profile:HMMPfam:PF02769"
FT                   /protein_id="CAJ48177.1"
FT                   /translation="VASEFDLIARHFTRAAPGEILGVGDDCALFPVPQGMRVAVSKDLL
FT                   IAGRHFYPDADPQSVGHKALAVNLSDLAAMGAQPLGCLLGLALPDLDDAWLAAFARGFH
FT                   DLARAHGCPLIGGDTTRSLQDLTISVTVFGAVPADAALRRDAARVDDDVWVSGALGAAD
FT                   VAYRLLDGALPADPVRLAQTRPALEWPQPRLALGLALRGLAHAAIDISDGLAQDLGHIL
FT                   AASGVGAVLRYADLPRATGLDGLDGAVLQRALLGGGDAYELCFTAPPDARAAIAQAGMA
FT                   CNTPVHRIGAVVAQAGLRVLDPQGQALAHLPGGFDHFGSQA"
FT   CDS_pept        596367..596894
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="BAV0573"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48178"
FT                   /db_xref="GOA:Q2KY12"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY12"
FT                   /inference="similar to sequence:UniProtKB:P18200"
FT                   /inference="profile:HMMPfam:PF04608"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48178.1"
FT                   /translation="MTDFHSSSMRQRSRVDYPSWAWVCARPGRFLAFGLGSGLIRPASG
FT                   TWGTLAAWVIWLMLPPIADPIMGALLLAAFAYGCWACGYAGRELRVHDHVGMVWDEMVA
FT                   FWLVLWLIPNGWIAQLAAFGLFRFFDIVKPPPIKACDARLSGGFGVMWDDILAAVYTLL
FT                   VMMLAIRIGVFA"
FT   CDS_pept        596891..597457
FT                   /transl_table=11
FT                   /locus_tag="BAV0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48179"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY08"
FT                   /inference="similar to DNA sequence:INSDC:AE016802.1"
FT                   /inference="profile:HMMPfam:PF02464"
FT                   /protein_id="CAJ48179.1"
FT                   /translation="MSLHHSGLHHNAGLAPASLTSATVFGLAEQLGPALQEQGWYLSTA
FT                   ESCTGGLLAGAVTSAPGSSGWFDRGFITYSNQAKVDELQVSADTLNHFGAVSEEVALEM
FT                   AQGVLLASPASHLAIATTGIAGPGGATAGKPVGMVCFGFARRTKAGINSRAVTHVFTGD
FT                   RAQVRLSAVEFALRGILELVPVSQR"
FT   sig_peptide     596891..>596966
FT                   /locus_tag="BAV0574"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(597473..598291)
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="BAV0575"
FT                   /product="putative orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48180"
FT                   /db_xref="GOA:Q2KY06"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KY06"
FT                   /inference="similar to sequence:UniProtKB:Q9P9M3"
FT                   /inference="profile:HMMPfam:PF00215"
FT                   /protein_id="CAJ48180.1"
FT                   /translation="MNFLQKLEHAWATQNSLLQVGLDPDPARFPAELQGRPDAILSFCR
FT                   GIVDATAPFASSFKPQIAYFAAHRAEDQLEALCGHIRDKYPHLPIVLDAKRGDIGSTAE
FT                   NYAREAFERYQAHAVTVSPYMGLDSVEPYLAWRDRGVIVLCRTSNPGGSDLQFLPMADG
FT                   QPLYLHVAGLVADKWNAHGQCGLVVGATYPNELAAVRKRVGDSLPLLVPGIGAQGGDIN
FT                   ATVQAGANSARAGMMINSSRAIIYASGGEDWREAAAEAARGLRDAINAVR"
FT   misc_feature    complement(597983..598024)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00156"
FT   CDS_pept        complement(598297..599610)
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="BAV0576"
FT                   /product="putative NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48181"
FT                   /db_xref="GOA:Q2KY03"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KY03"
FT                   /inference="similar to sequence:UniProtKB:P00393"
FT                   /inference="profile:HMMPfam:PF00070"
FT                   /protein_id="CAJ48181.1"
FT                   /translation="MIMTPSQPERIVIVGGGAGGLELAAQLGRAHGPERVLLIDSRPFH
FT                   IWKPSLHEVAAGTLDIHQEGLSYLMLARLAGFSFAQGELLSVDRQARRIRIGAVLDPKG
FT                   DEVLGPRDFGYGTLVLALGSASNFFGTPGAAEHAVTLDSTENAEAFRLTILKAMAKVDQ
FT                   EKRHNPAARLDLVIVGGGATGVELAVELTEASHVVSAYGLPDFRAERDMVITLVEGAPR
FT                   ILSALPEKISRAATARLRELGIRVETDCRVAQVTPDSVNADDGRQFSATLCLWAAGIRG
FT                   PALLKQLDMPLNRAGQLIVNERLESPDPHVLALGDCCAAPWGDKGTVPARAQAAHQEAS
FT                   YLARKLGARLRGREEPSAPYVYRDNGSLVSLGQDAGVGNLMGKLAGRGLFVSGTLARLM
FT                   YMSLHLMHHRAVLGVSRTATMALARLLMRRTHPRVKLH"
FT   CDS_pept        complement(599681..600073)
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="BAV0577"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48182"
FT                   /db_xref="GOA:Q2KXZ9"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXZ9"
FT                   /inference="similar to sequence:UniProtKB:P00556"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF01219"
FT                   /protein_id="CAJ48182.1"
FT                   /translation="MTPHPSPYKSTGGLRRILNALRYSWQGLKAAVKYEAAFRQELALA
FT                   VLMIPAAFFLGRTAVEVFLLIVSVVLVLVVELINSAIEALADALSVETHPLLGRAKDLG
FT                   SAAVMLMLIFTGAVWICVALGRFMQS"
FT   CDS_pept        complement(600275..601174)
FT                   /transl_table=11
FT                   /gene="brkB"
FT                   /locus_tag="BAV0578"
FT                   /product="BrkB"
FT                   /product="serum resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48183"
FT                   /db_xref="GOA:Q2KXZ7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXZ7"
FT                   /inference="similar to DNA sequence:INSDC:U12276.1"
FT                   /inference="similar to sequence:UniProtKB:P32146"
FT                   /inference="profile:HMMPfam:PF03631"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48183.1"
FT                   /translation="MRFSTLLQLSHPRALAQLLMDSAKQWSRHRASSKGAALALYMVFS
FT                   LAPMLILVIAVAGAFFGEDTVRSELFAQMSDLMGERGAEVIHTVLASAHESSKSWLAAL
FT                   LSLGMMVFSATTAFSELKDSLDELWETKPNQASGGIQGLVRSRILSFGLVLVLACFMLF
FT                   SLAVNAAMGVARAYYGELWSYSLVATAGVWVANLFSFSVVTALFAVIFKLLPSISLPWR
FT                   QVLPGAVVTAALFLLGKWGIGLYLSHGGVASAYGAAGSLIAFLLWIYYSSQIFFFGAVL
FT                   TRQYASQAQRIEAAAPAA"
FT   CDS_pept        complement(601336..602976)
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /gene_synonym="mopA"
FT                   /gene_synonym="groL"
FT                   /gene_synonym="cpn60"
FT                   /locus_tag="BAV0579"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48184"
FT                   /db_xref="GOA:Q2KXZ3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KXZ3"
FT                   /inference="similar to sequence:UniProtKB:P06139"
FT                   /inference="profile:HMMPfam:PF00118"
FT                   /protein_id="CAJ48184.1"
FT                   /translation="MAAKQVLFADDARVRIVRGVNVLANAVKTTLGPKGRNVVLERSFG
FT                   APTVTKDGVSVAKEIELKDKFENIGAQLVKDVASKTSDNAGDGTTTATVLAQAIVQEGL
FT                   KYVAAGFNPIDLKRGIDKAVAAAVVELKKASKPVTTSKEIAQVGSISANSDSSIGQIIA
FT                   DAMDKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINNPEKQVAALDDPFVLI
FT                   YDKKISNIRDLLPVLEQVAKSSRPLLIIAEDVEGEALATLVVNNIRGILKTTAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEETGMSLEKATLQELGQAKRIEVAKENTTIIDGAGDGK
FT                   SIEARVKQIRAQIEEATSDYDREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALLRAKQAIAGLQGDTPDQNAGIKLILRAVEEPLRTIVTNA
FT                   GEEASVVVNNVLNGKGNYGYNAATGEYTDLVEQGVLDPTKVTRTALQNAASVASLLLTA
FT                   EAAVVELAEDKPAAPAMPGGMGGMGGMDF"
FT   misc_feature    complement(601729..601764)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00296"
FT   CDS_pept        complement(603010..603297)
FT                   /transl_table=11
FT                   /gene="cpn10"
FT                   /gene_synonym="groES"
FT                   /locus_tag="BAV0580"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48185"
FT                   /db_xref="GOA:Q2KXY8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KXY8"
FT                   /inference="similar to sequence:UniProtKB:P48221"
FT                   /inference="profile:HMMPfam:PF00166"
FT                   /protein_id="CAJ48185.1"
FT                   /translation="MALRPLHDRVIVKRLDNERKTASGIVIPDSAAEKPDQGEVLAVGP
FT                   GKKTEDGKILPVDLKVGDKVLFGKYAGQGVKVDGEELLVIREEEILAVIQ"
FT   misc_feature    complement(603217..603291)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00681"
FT   CDS_pept        complement(604039..604842)
FT                   /transl_table=11
FT                   /locus_tag="BAV0581"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48186"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXY4"
FT                   /protein_id="CAJ48186.1"
FT                   /translation="MLSLRMEFPVTRIQNYFNGVADKIASSSLIASTAQHRPDIGSNRE
FT                   DIIRDFLLRHLPRRLTATLGGQIISHDSRESGQVDVIISNDLGVRFEENEKTFVTAESI
FT                   AGAVTVKSSLNQATLTDALANLATIPEPSKDLLSFKLLRPSANEGFLELHPSLYVFAYD
FT                   GISGEKCLSYVNEFYSSHPEIPLRRYPKGIIVNRQYMIRFFRNEQLSSTGYRIHKDTFF
FT                   LMQVEGSLRGYPFIQILNDLSSYADWLNHMNVSVYQYFNAGYDLG"
FT   CDS_pept        complement(join(605545..606324,606324..606770))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BAV0582"
FT                   /product="putative permease (pseudogene)"
FT                   /db_xref="PSEUDO:CAJ48187.1"
FT                   /inference="similar to DNA sequence:INSDC:AL646078.1"
FT                   /inference="protein motif:Prosite:Pseudogene."
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF07690"
FT   misc_feature    complement(606636..606770)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00430"
FT   CDS_pept        606875..607699
FT                   /transl_table=11
FT                   /locus_tag="BAV0583"
FT                   /product="AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48188"
FT                   /db_xref="GOA:Q2KXY1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXY1"
FT                   /inference="similar to DNA sequence:INSDC:AE016792.1"
FT                   /inference="profile:HMMPfam:PF00165"
FT                   /protein_id="CAJ48188.1"
FT                   /translation="MNALLQWKAITAPPDVLSPSPMTMRVQSIGARNYFAAHTHEWHQV
FT                   VYAVSGVLMVTAEGRSFAISPNQAAWVPSGTEHSVGSFLGAEYRSLWLADHPGGTLSKG
FT                   GVAVFGVSALLKALLVEAATLQGNPDESGYFGRIYRLVLDQLCRASPISLVLAWPASAA
FT                   LRTLCETLYNQPADPRGPDDWGRELGMSGRTLARKFFAETGLTLRDWRRQLKLFRAIEL
FT                   LESGLDVTAIALELGYGSASSFIFAFRSAMKCSPMAYKRIRARDPAGAPGED"
FT   misc_feature    607517..607642
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00041"
FT   CDS_pept        607899..608258
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="BAV0584"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48189"
FT                   /db_xref="GOA:Q2KXX9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXX9"
FT                   /inference="similar to DNA sequence:INSDC:AF173880.1"
FT                   /protein_id="CAJ48189.1"
FT                   /translation="MNEDQAVSALGGLAHPQRLRAFRALVVAGLPGLTPSVLADQLGVA
FT                   RNALSFHLKELAHAGLVSAEQQGRNLIYRANFSQMDGLLGYLTEHCCQGFSCEVSDSRR
FT                   CTACESGTVQAAISR"
FT   CDS_pept        608255..608584
FT                   /transl_table=11
FT                   /locus_tag="BAV0585"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48190"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXX7"
FT                   /protein_id="CAJ48190.1"
FT                   /translation="MSCASMSCLSPSAAVARFLLRSRPVLSPTLRRRAAPPVRAAMLTR
FT                   GDAAVLRRQTESAQALSALKPRVTAAKLATNDPGQASCCDCRREGGRSPGPGSRRLMTA
FT                   RALVY"
FT   CDS_pept        608614..609036
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /gene_synonym="arsG"
FT                   /locus_tag="BAV0586"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48191"
FT                   /db_xref="GOA:Q2KXX6"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXX6"
FT                   /inference="similar to sequence:UniProtKB:P37311"
FT                   /inference="profile:HMMPfam:PF03960"
FT                   /protein_id="CAJ48191.1"
FT                   /translation="MSPITIYHNPACGTSRNVLGLIRNSGEDPTIIEYLNTPPAAATLK
FT                   SLIAAMGVSVREVLRKKGTPYDDLRLSDPKWTDQELIDFMIQHPILINRPIVVTPLGTR
FT                   LCRPSEQVLDILPQGQRGAFNKEDGEPLVDAEGNRV"
FT   CDS_pept        <609029..609751
FT                   /transl_table=11
FT                   /gene="arsH"
FT                   /locus_tag="BAV0587"
FT                   /product="ArsH protein (putative NADPH-dependent FMN
FT                   reductase)"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48192"
FT                   /db_xref="GOA:Q2KXX5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXX5"
FT                   /inference="similar to DNA sequence:INSDC:AP005147.1"
FT                   /inference="similar to DNA sequence:INSDC:U58366.1"
FT                   /inference="profile:HMMPfam:PF03358"
FT                   /protein_id="CAJ48192.1"
FT                   /translation="VSKGLGNLPHLDPSCFEKPSATELFSPQRATHAPRFLLLYGSLRE
FT                   RSYSRLVAEEAARLLQALGGETRFFHPSGLPLVDDASEDHPKVRELHGLVQWAEGMVWS
FT                   SPERHGAMSGLMKTQIDWIPLSVGALRPTQGKTLAVMQVSGGSQSFNAVNQMRVLGRWM
FT                   RMLTIPNQSSVAKAYQEFDDAGRMRPSPYYDRIVDVVEELMKFTLLTRDVSPYLLDRYS
FT                   ERKETAAALSQRMEQKSI"
FT   CDS_pept        complement(609986..611488)
FT                   /transl_table=11
FT                   /locus_tag="BAV0588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48193"
FT                   /db_xref="GOA:Q2KXX4"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXX4"
FT                   /inference="similar to DNA sequence:INSDC:AP003008.2"
FT                   /inference="profile:HMMPfam:PF07171"
FT                   /protein_id="CAJ48193.1"
FT                   /translation="MTRRKRLAVARFWFEGNAFCPEPASLARFQEYEWQKGETVLATMR
FT                   GTASELGAVARFAEHHPDWQVVVLRCAAALPAGPVPDTLFDHFLHEVIEGLRAGMAEGG
FT                   WDAVYLSLHGAAITQKRETPELEFARAVRTLLPDVPLGASFDLHGNLPAEWAQILDIAS
FT                   AYRSHPHVDMEETAARVLDGLVRCATTGLRTRCVVLNEGVILPSINMRTAPGGPMYQLE
FT                   QIARDATVPPVIEVALFGGFPYADTAATGAAVLVISDKDSDPDGACAHRAARQVMAHVH
FT                   ALAAEFRVSLPTPEEAVARALASPLPGLIAVTDSGDNPLSGGSCDTPGLFAALIAARAA
FT                   VPTLFASFADASAVQAAREAGVGGTITRQLGARHGAQFGHGVTVHAEVERLTDGAFINH
FT                   GPMHAGLARSCGATALLRLTALPDVRIIVTERVVAADDPAFYALHGIEPAQLRLLCVKA
FT                   KNHFRAAFAQRCAEILDCDAPGPASQDLSQLPFKHRHIIAQY"
FT   CDS_pept        complement(611485..612471)
FT                   /transl_table=11
FT                   /locus_tag="BAV0589"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48194"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXX3"
FT                   /inference="similar to DNA sequence:INSDC:AY305378.1"
FT                   /inference="profile:HMMPfam:PF03401"
FT                   /protein_id="CAJ48194.1"
FT                   /translation="MNRLPNRIWGAALLTASLWTAAPATVRADTAWPASPIKLVVPFAA
FT                   GGTTDLLARLVAEGLGKTLNQTVIVQNKPGAGGNIGAAEVARATPDGYTLLMGTPGPLA
FT                   INPYVYPKMAFDPARDFAAVSYVADVPNVILTSPASGMKNIDDVLARARQQPGSLNWGS
FT                   PGVGSTGHIALELLKKLGKVELAHVPYKGASQASADLLAGHIDLAGDNVPSALEQIRAG
FT                   NLVALGVASDKPLDVLPGVAPVSATVPGYLLPSWFVIVAPAGTPAPVIDKISAAIDAFE
FT                   KQAATREKFRALGAVPIGGNAARLTDHLKSEQARYGELLKDIKATPQ"
FT   sig_peptide     complement(<612384..612471)
FT                   /locus_tag="BAV0589"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        612565..613920
FT                   /transl_table=11
FT                   /locus_tag="BAV0590"
FT                   /product="class III aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48195"
FT                   /db_xref="GOA:Q2KXX1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXX1"
FT                   /inference="similar to DNA sequence:INSDC:AP005945.1"
FT                   /inference="profile:HMMPfam:PF00202"
FT                   /protein_id="CAJ48195.1"
FT                   /translation="MSTGSVMTHIFHRNPRKPPSLAVRGQGSFLIDAQGKRYFDGSGGA
FT                   AVSCLGHGHAEVIEAVIEQIRNLEYAHTGFFSSEPAEALAELLARESPASLGNVYFLSS
FT                   GSEAVETALKMARQYHVERGQRERRHTIARLQSYHGNTLGALAIGGHRGRRALYQPLLP
FT                   QSSHVSACFARHYRMPGEDDHTYGDRLAAELEQRILELGPETVSAFIAETVVGATAGAV
FT                   CAVPGYFAKIRRVCDRYGVLLILDEVMSGMGRTGTYHAFEAEGVVPDLLCLAKGLGGGY
FT                   QPIAAVLAQDRVVETIVAGSGAFQHGHTYVGHPVACAGALAVQRIVARDGLVAQSARLG
FT                   DYLHTRLQAQFGGHPHVGDIRGRGLFQAIELVARRAPDEPFDAALQVHARIKLAAQALG
FT                   LLCYPGGGTIDGERGDHVLLAPPYTASTGELDFAVEGLAQALDTVIAGLSVK"
FT   misc_feature    613291..613404
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00600"
FT   CDS_pept        613945..614814
FT                   /transl_table=11
FT                   /locus_tag="BAV0591"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48196"
FT                   /db_xref="GOA:Q2KXW9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXW9"
FT                   /inference="similar to DNA sequence:INSDC:AL591985.1"
FT                   /inference="similar to sequence:UniProtKB:O68281"
FT                   /inference="profile:HMMPfam:PF01380"
FT                   /protein_id="CAJ48196.1"
FT                   /translation="MDKRMVDKRIEAQYGELPPALQRAARYAIDNPKSIALQSMRATAA
FT                   KAGVQASAMHRLARQLGFEGYEALRTVYREWLARSAGSFAERATALQSRSDKAGSLARE
FT                   LVLADSGNLAALLEPAALEAISAASEILAQARRIYVGGLRSLFPAAFYFNYACGMFRQD
FT                   TVLLSGIAGTFADDLRHAGPDDALLMFSYDPYARDAVSAVRFAHARGLRIVSVTDSVVS
FT                   PIAAPASAVILVANATPSLFPSVVPALAVAQALVGLLVARGGQANLSEVEKSEAQLREF
FT                   AVYMKDRC"
FT   misc_feature    614065..614187
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00041"
FT   CDS_pept        615012..615167
FT                   /transl_table=11
FT                   /locus_tag="BAV0592"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48197"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXW7"
FT                   /protein_id="CAJ48197.1"
FT                   /translation="MLRSRLPPHHVGIDIAGVRRITRCRRDQTGHHNPHKHCLLKPGMA
FT                   LIELLG"
FT   CDS_pept        615527..616357
FT                   /transl_table=11
FT                   /gene="bphD"
FT                   /gene_synonym="bpdF"
FT                   /locus_tag="BAV0593"
FT                   /product="2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate
FT                   hydrolase"
FT                   /EC_number="3.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48198"
FT                   /db_xref="GOA:Q2KXW5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXW5"
FT                   /inference="similar to DNA sequence:INSDC:D88016.1"
FT                   /inference="similar to DNA sequence:INSDC:U44891.1"
FT                   /inference="profile:HMMPfam:PF00561"
FT                   /protein_id="CAJ48198.1"
FT                   /translation="MRALTEEGTSKRIKTKSWDIHYHEAGQGAPLILVHGGGPGASGWS
FT                   NFHTNIPYLSEKFRVFAVDLPGWGKSQSVKYDQRDNSGALAEFIEALGLGKVALVGNSM
FT                   GGSSCIRLAYERPELISHLVTLGSSAGVPSIFDPAGLSEGVKALEAAYFHPGPESMRKF
FT                   IATMAFDTRHVTDEFVQERVSILNSRPDHIEGWISGHGKPMVKIDQARLADIKAPTLLI
FT                   HGRDDRTVPYTAALHLIRQIPDARMLLIPRCGHWVQLEHADEFNRNVASFILEH"
FT   CDS_pept        616521..617426
FT                   /transl_table=11
FT                   /gene="bphC"
FT                   /gene_synonym="bpdE"
FT                   /locus_tag="BAV0594"
FT                   /product="2,3-dihydroxybiphenyl 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48199"
FT                   /db_xref="GOA:Q2KXW1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXW1"
FT                   /inference="similar to DNA sequence:INSDC:D88017.1"
FT                   /inference="similar to DNA sequence:INSDC:U27591.1"
FT                   /inference="profile:HMMPfam:PF00903"
FT                   /protein_id="CAJ48199.1"
FT                   /translation="MITSLAYFGATSPAHADWDTFGPQVLGAERVDPGPDGAVRLRFDE
FT                   MAYRMAIHPGDRNAVAYIGWETSGEDGAGSIVQRLIDHGIAVARASQEEAALRQVLGFY
FT                   WFVDPAGIRHELAWGQMRARTAFRPGRAMSGFRTGDQGLGHVVFAVPDLDEADRFYREV
FT                   LGFHPSDTVIDGPIHAHFYHINGRHHSLAIARSPNQSAAFLHLMLEVNTLEDVGTALDL
FT                   CEARSVPITRTLGCHTNDRMTSFYLHSPSDFRIEYGWGGLEVEDLWVPRYYERTSTWGH
FT                   RHQHKELSPFLFIDPPASRS"
FT   sig_peptide     616521..>616566
FT                   /gene="bphC"
FT                   /gene_synonym="bpdE"
FT                   /locus_tag="BAV0594"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    616953..617018
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00934"
FT   CDS_pept        617492..618664
FT                   /transl_table=11
FT                   /locus_tag="BAV0595"
FT                   /product="pigment production hydroxylase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48200"
FT                   /db_xref="GOA:Q2KXV8"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXV8"
FT                   /inference="similar to sequence:UniProtKB:O69349"
FT                   /protein_id="CAJ48200.1"
FT                   /translation="MHPVVQGLQGLGEAVAKEVDQSERCGSITDEAARLLREAGVIRML
FT                   QPKDYGGDEAHPREFMEVLLELAARAPSIGWVSGVVGVHPFEFAQTSPRLQEEVWGADR
FT                   DTWIASPYAFIGRARRVEGGFMLSGQWPFSSGTDHCQWVVLGGRAEKKNGPANEFTELY
FT                   HFILPRAEYEILQDSWKVMGLAGTGSKDVVVKEAFVPDYRTLEVGLLNAREYASKYRPG
FT                   SALYQVPFDLLFPCAIAAATIGIADGVVRHFSEYSRDRVSRMGVKATQNPYHMSSLGAA
FT                   IADIDAARLQILSDITDAYDVVSRGERVSSAMQARARVHQVRSVHRAAAAAASVFKNAG
FT                   GNATRLSNPIQRQWRDLSVALGHACNVEEPVYAAFAGSLYGIAAPAGVII"
FT   CDS_pept        618672..619853
FT                   /transl_table=11
FT                   /locus_tag="BAV0596"
FT                   /product="putative monooxygenase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48201"
FT                   /db_xref="GOA:Q2KXV5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXV5"
FT                   /inference="similar to DNA sequence:INSDC:D88018.1"
FT                   /inference="similar to DNA sequence:INSDC:AB099705.1"
FT                   /inference="profile:HMMPfam:PF01613"
FT                   /protein_id="CAJ48201.1"
FT                   /translation="MEQGYIDIERFRALLGSYPTGVAVVTGLDAAGQPLGMVVGTFTSV
FT                   SLEPPLVAFLPMKSSRTFNSLRDASKRFCVNILAADQEAVCRVLATSVQDKFAGIAWRK
FT                   SPAGNPVIDGVVAWIDCDFHNVVDAGDHDIVLGAVQAMGLERDALPLLFFQRGYGRFSS
FT                   GSLVPVNEREVLWQVRLAEAARVQMDALAAELDVGCSLIASAGAESIYVAVADRPGSPQ
FT                   GQSRLGTRAPLVPPLGALFVGGAGGMSEDAWLGRLGKGSAEAAAKAREQLARVSRRGWS
FT                   ISLLGGLSPQELYLAIDLYSCTHRTPEQERRFYSTVNAMFDRHEPEDIAEDEAYDVLHL
FT                   SFPVRRSSGATLFILRISDLPAGLTGAQIGNLVERLRIAASDVESAIAGIPER"
FT   CDS_pept        619924..620814
FT                   /transl_table=11
FT                   /locus_tag="BAV0597"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48202"
FT                   /db_xref="GOA:Q2KXV3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXV3"
FT                   /inference="similar to sequence:UniProtKB:Q47005"
FT                   /inference="profile:HMMPfam:PF00126"
FT                   /inference="profile:HMMPfam:PF03466"
FT                   /protein_id="CAJ48202.1"
FT                   /translation="MEISQLRSFVAVAEAGSYIRASDLMNVPQPTLSRQVRTLELELRA
FT                   SLFHRHGRGVRLTERGGKFIDYARSVIHTVDAAVASVRDSDAVYTGSLIVGLTPSIGRL
FT                   LIPTLAPLLKERFPRASVRLTEGLSGALYEKVLLGQIDFAAVLSPAGSSHLDIEPLATE
FT                   QLYLVGPPAALPGSPDIELSELVNLPLILPHSSQWTRPALETAAARLGLRLRVDLEIDS
FT                   TASTTEIVAAGGGYSIMPGSLRKLRSLPQLSWRKIVNPHVEATVSMISPARQPRSQLSV
FT                   TAAQVVREALLDIYP"
FT   misc_feature    619972..620064
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    620737..620802
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00605"
FT   CDS_pept        <620993..621793
FT                   /transl_table=11
FT                   /gene="bphE"
FT                   /gene_synonym="mhpD"
FT                   /locus_tag="BAV0598"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48203"
FT                   /db_xref="GOA:Q2KXV0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXV0"
FT                   /inference="similar to sequence:UniProtKB:P77608"
FT                   /inference="similar to DNA sequence:INSDC:AB120955.1"
FT                   /inference="profile:HMMPfam:PF01689"
FT                   /protein_id="CAJ48203.1"
FT                   /translation="VSAKLVQELAARLRQAEQERAPIAPLRSCLAELGDRDGESLAYAI
FT                   QQANVAFALAQGRRIVGRKIGLTSPAVQKQLGVDQPDFGVLYADMLYGDDEPIPAHRLL
FT                   QPKIEAEVALVLAKDLERADTTLVELIDAVGYVLPALEIVGSRIANWDIRFTDTVADNA
FT                   SSGLVVLGGVPVALSGLDLKLVEMTLSRNGELASQGGGAACLGHPLNAAVWLARKLALL
FT                   GHPLRAGDLVLTGALGPMVQVAPGDRFEANITGVGCVRAQFAPA"
FT   CDS_pept        621855..622805
FT                   /transl_table=11
FT                   /gene="bphG"
FT                   /locus_tag="BAV0599"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48204"
FT                   /db_xref="GOA:Q2KXU8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KXU8"
FT                   /inference="similar to DNA sequence:INSDC:AJ536756.1"
FT                   /inference="similar to DNA sequence:INSDC:D16407.1"
FT                   /inference="similar to DNA sequence:INSDC:D63377.1"
FT                   /inference="profile:HMMPfam:PF02396"
FT                   /protein_id="CAJ48204.1"
FT                   /translation="MTRRLKAAIIGSGNIGTDLMIKILRHGKHIDMAAMVGIDPKSDGL
FT                   ARAARLGVATTYEGVAGLIRLPVFADIDFVFDATSAGAHVENDALLRAAKPGIRLVDLT
FT                   PAAIGPYCIPVVNGDAHLDALNVNMVTCGGQATIPMVAAVSRVARVHYAEIVASIASKS
FT                   AGPGTRANIDEFTETTAKAIEAVGGATKGKAIIVMNPAEPPLIMRDTVYTLSQPADEEA
FT                   IAESVERMVAAVQAYVPGYRLKQKVQFDRIDSPLRIPGVGDALKGLKTSIFLEVEGAAH
FT                   YLPAYAGNLDIMTSAALRTAEHMAQRMLADATVSA"
FT   CDS_pept        622805..623854
FT                   /transl_table=11
FT                   /gene="bphF"
FT                   /locus_tag="BAV0600"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48205"
FT                   /db_xref="GOA:Q2KXU5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KXU5"
FT                   /inference="similar to sequence:UniProtKB:P51014"
FT                   /inference="similar to sequence:UniProtKB:P51020"
FT                   /inference="profile:HMMPfam:PF00682"
FT                   /protein_id="CAJ48205.1"
FT                   /translation="MRTHMTANRKIYISDVTLRDGSHAIRHQYSVNDARRIAQALDEAR
FT                   VDSIEVAHGDGLQGSSFNYGFGAHTDLEWIHAVASVVKHAKIATLLLPGIGTVHDLKAA
FT                   YDAGVRVVRVATHCTEADISRQHIECARELGMEAVGFLMMSHMTTAEVLAGQAKLMESY
FT                   GATCCYVVDSGGALSMQDVRDRFRALKDVLKPETHTGMHAHHNLSLGVANSIVAVESGC
FT                   DRVDASLAGMGAGAGNAPLEVFIAAAERMGWNHGTDLYKLMDAADDIVRPLQDRPVRVD
FT                   RETLALGYAGVYSSFLRHSETAAAKYGLKTVDILVELGKRRMVGGQEDMIVDVALDLLR
FT                   QRRSGAAAV"
FT   CDS_pept        <623861..624307
FT                   /transl_table=11
FT                   /locus_tag="BAV0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48206"
FT                   /db_xref="GOA:Q2KXU2"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXU2"
FT                   /inference="similar to DNA sequence:INSDC:AB088420.1"
FT                   /inference="similar to DNA sequence:INSDC:AB095952.1"
FT                   /protein_id="CAJ48206.1"
FT                   /translation="VAMEWHTDLELGYAPMDDIHEEFVDIVARLQAAPDDRLAELLAEL
FT                   HLHLASHFGQENAWMEETAFPPRDCHIGEHDAVLKSVKDVRLLLADQGNTRICRELVAA
FT                   LADWFPGHAAHLDSALAHWLCKRRLGGSPVVLRRGQDRCNRGQA"
FT   CDS_pept        624594..625994
FT                   /transl_table=11
FT                   /locus_tag="BAV0602"
FT                   /product="putative metabolite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48207"
FT                   /db_xref="GOA:Q2KXU1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXU1"
FT                   /inference="similar to DNA sequence:INSDC:AF274045.1"
FT                   /inference="similar to DNA sequence:INSDC:AF521085.1"
FT                   /inference="similar to DNA sequence:INSDC:U29532.1"
FT                   /inference="profile:HMMPfam:PF00083"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF07690"
FT                   /protein_id="CAJ48207.1"
FT                   /translation="MLYTQGIASMTDSTTAAGQDKQKRRAILASYLGTTLEYYDFLLYG
FT                   VAAALVFPQIFFVTLDPLAATLSSFATFAVGYFARPLGAVVFGHYGDRLGRKNVLVVTL
FT                   ILMGLSSMLIGLLPSYSQIGIASPILLVVLRLLQGIAIGGEWGGATLMSMEHAKPRARG
FT                   LAVSLVSAGGPSGAVLGTLVMTPFTLLPSDQFLAWGWRIPFLLSALLMVLGLIIRVRVT
FT                   ETPEYEAARKEQAAKGVPKAIPLVIVFRHNKGQVLSGVLGGLAPLSFATFAAAFLLNYS
FT                   VEVGHTRTSALMAMTIANFLNIFTLPLFGAVSDRIGRRPMMIAGAVGGMLLIWPIFQLV
FT                   HNGSFLTLLLAMVLAMPVIQAMMGGVFNTWISEKFAADVRYSGIALTFQIASTLGAGLS
FT                   PLIAASLLAASGGTNPQWVAAYFAGICLISCVAYLLGKERFDQELPANTEGVEDAAQTA
FT                   PVTRKMLA"
FT   CDS_pept        626088..627227
FT                   /transl_table=11
FT                   /locus_tag="BAV0603"
FT                   /product="putative outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48208"
FT                   /db_xref="GOA:Q2KXT9"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXT9"
FT                   /inference="similar to DNA sequence:INSDC:U16266.1"
FT                   /inference="similar to DNA sequence:INSDC:D63823.1"
FT                   /protein_id="CAJ48208.1"
FT                   /translation="MKRVQVGLTALTAATAVFGQDCMAAEPARPSSVQIYGVADVALAH
FT                   YQTSGSSGTKMQTGGSGSRIGFFTSEGLSDGWRVNTRLEAGFNMNSGTKSSTGGVPDRL
FT                   WSRQAYVELENKALGGVRLGRLQGPTYNFFPKFDPMLVPAMDAWGVLTTLGAALPGYGS
FT                   GTGVSSGFLINPTMRTQNTIAYMSPSWRGLQAEVAYSFSNGSSVEPALLEVGLDYRSGP
FT                   LAVGLLFVHADSTSGAGTVRATKPVSEMAIGAKYDFGPFNPYVTYIHRNLTDQMVGSDG
FT                   AALNTNSESVKLVGAVVPVSSRGNIRITYGRYSSGSPGRDAKSYGLAYTYDVNPRLMLM
FT                   VAATRLTQQDKAKWPVFQSPRPDAGASVNGVITGMTWRF"
FT   sig_peptide     626088..>626157
FT                   /locus_tag="BAV0603"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        627281..627748
FT                   /transl_table=11
FT                   /locus_tag="BAV0604"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48209"
FT                   /db_xref="GOA:Q2KXT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXT6"
FT                   /inference="similar to DNA sequence:INSDC:BX294146.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48209.1"
FT                   /translation="MAAKSPWYYIIHWLRLYFGAHLLFSGIRYAATGYVPDIPGVGGEW
FT                   VQANANIYLYQTIKYLEILTGAMLFFNRYVLLALILEFPATINIFWLNTFIVATPRQLF
FT                   TGPQELFMNGVLLLAYSGWMYAAVKPKLEPLWIWDGAKAYAPQIGQRIVRK"
FT   CDS_pept        627789..627974
FT                   /transl_table=11
FT                   /locus_tag="BAV0605"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48210"
FT                   /db_xref="GOA:Q2KXT4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXT4"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48210.1"
FT                   /translation="MDKNKWIAAVVCLCLTVIAYIGSTGLFYAQFRPIRNYDLVAFFGS
FT                   WAGLIYLFIRDRNRED"
FT   sig_peptide     627789..>627843
FT                   /locus_tag="BAV0605"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    627888..627935
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00225"
FT   CDS_pept        628026..629531
FT                   /transl_table=11
FT                   /locus_tag="BAV0606"
FT                   /product="putative catabolic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48211"
FT                   /db_xref="GOA:Q2KXT2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXT2"
FT                   /inference="similar to DNA sequence:INSDC:AF325554.2"
FT                   /inference="similar to DNA sequence:INSDC:AE016916.1"
FT                   /inference="profile:HMMPfam:PF03972"
FT                   /protein_id="CAJ48211.1"
FT                   /translation="MKLTRRQFAQFSALLATGWATGSSWAQSSGKPAGAADAARHDTLY
FT                   TLIDHCLGLRYEALPADVIAATKIQILDTVAVALPARDADGIKQLYAWSKERGGKGESL
FT                   VLGTHDRLPAETAARLNASMAAALEFDDTYEPSLIHASCVNVPVAFATADAVGRISGKE
FT                   LIVAVAMGTDLACRLSRAGSPGVSPFIVGWDPTPMYGFLAAALVAGRLLGLTRDQLVGA
FT                   VGLAYHQMSGNAQAAIDGTHAKRFGSGFAAYGGLMSARLAAKGAFGPINVLDGPKGLFK
FT                   QYHGGKVAREALLDGLGTEFVGTGIAPKPYPCCRGGHVAIDGALELVEANDIRPADVAQ
FT                   VIVYSPPAEMMLLGAPLDKKQNPKTIVEAQFSNPWMVATAIQDRDVGLRHFTPEALQRE
FT                   DIRALARRVATAEDKRLVRPDGGPGFVRLEIRMRDGRVLTKEVRYAKGDPKNPMTPAEY
FT                   EKKNYECAQASGMKREQAVRIIQRFMNLDAEPDVSDLSLALAS"
FT   sig_peptide     628026..>628101
FT                   /locus_tag="BAV0606"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        629628..630326
FT                   /transl_table=11
FT                   /locus_tag="BAV0607"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48212"
FT                   /db_xref="GOA:Q2KXT0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXT0"
FT                   /inference="similar to DNA sequence:INSDC:AE017233.1"
FT                   /inference="profile:HMMPfam:PF00440"
FT                   /protein_id="CAJ48212.1"
FT                   /translation="MVSNSNNRTRRPGEHKSSAAVRARILETAFSLISKFGYSGTTMGK
FT                   VATNAALPIGSVYWHFESKDLLLAAMIEESFIRWRNETAERNRPREGETFEEHVTRIFG
FT                   STANPKYFAADFWRLGVILSVEKSVPEQTARKQFLTIREAQRKELTSWWSATLPPTLLE
FT                   TQPDLPERLSMFTLAMQDGNAIAGSSGESLDDFQAILASCLIHLVSQARQQASASTESK
FT                   KRTRAARTRS"
FT   CDS_pept        630522..631436
FT                   /transl_table=11
FT                   /locus_tag="BAV0608"
FT                   /product="short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48213"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXS8"
FT                   /inference="similar to sequence:UniProtKB:Q59787"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="profile:HMMPfam:PF00106"
FT                   /protein_id="CAJ48213.1"
FT                   /translation="MDRLKNKVAIVFGAGPNIGGTIAHFLAREGASVCVMDASEAAAQE
FT                   TVDFLQARGLTAFGVAGNARCGDDVRRAVAETVARYGRLDVAVNMAGRVHWSHVLDMDM
FT                   DDWNDSVASFVTAGLITTQHCARAMQQSGGGSIIHILSTAAHFGEADGAAYCAAKAALL
FT                   SFARSSALDLAHLGIRVNTVTPCSMEHQLWTTMRDEMFDPAWVAPARTGFYSRQEYLDQ
FT                   MPLRRFPRAADLAWATVFLASDESACMTGSDMAVDGGLRHKYPTWSPGKHYPLDVRDYA
FT                   RSIQLTKYGEPQGPLTDLLGEPV"
FT   misc_feature    630930..630965
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00962"
FT   CDS_pept        631433..632659
FT                   /transl_table=11
FT                   /locus_tag="BAV0609"
FT                   /product="putative iron-sulphur containing oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48214"
FT                   /db_xref="GOA:Q2KXS6"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXS6"
FT                   /inference="similar to DNA sequence:INSDC:AB021319.1"
FT                   /inference="similar to sequence:UniProtKB:Q44256"
FT                   /inference="profile:HMMPfam:PF00355"
FT                   /protein_id="CAJ48214.1"
FT                   /translation="MTALLPRHHQETNMNALDERRQERARQFQRLTQCDRDSDMGKLLR
FT                   KFWQPIALSESIELNAAIPVKALGEELTLYRGASGALHLVGGRCAHRRTLLHTGWVVGE
FT                   EIRCIYHGWQFDSSGACVHRPAEGDTGMPRTKIAGYPVREYLGLVFAYLGEGDAPEFDL
FT                   PRKPQAEQAGAVVANGMERWDNNWFQQVENSMDAVHVSFVHMALTVGAFGKAVTTSIPE
FT                   LSYEETAAGIRQTARRAKDNVRQSDWTFPNNNHITVPGLTPEDPWLDVFVWMLPNDELN
FT                   TTRFMIYSLPPGASEASKTRFRAYFAKYGKYDPAAHHDELFGSRVWKNPEDTFVGLTAA
FT                   QDYLSIRGQERITKREDEILGRSDLGIVTLRKLFWRELDLLRDGKETKQWVSLDEAVEL
FT                   PHQPGAIEG"
FT   CDS_pept        632663..633835
FT                   /transl_table=11
FT                   /locus_tag="BAV0610"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48215"
FT                   /db_xref="GOA:Q2KXS4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXS4"
FT                   /inference="similar to DNA sequence:INSDC:L05770.5"
FT                   /inference="profile:HMMPfam:PF02770"
FT                   /inference="profile:HMMPfam:PF00441"
FT                   /protein_id="CAJ48215.1"
FT                   /translation="MLDLIPHESLPEELLMFRSSIRRFVDKELVPLEHALGADGLLDEV
FT                   QAQAVRDRARAAGFWLMDVPEALGGQGLSLLPLAVFWEEVGRSTVASWVRHHGLFGPTV
FT                   GPILAGLSEHQRKDYLYPVVDGAKKFCFAQTEPDAGSDPSAMRTRAVRTEKGYRINGVK
FT                   RFITRAGQADFALVMAVTDPERGARGGISCFIVDMQTPGVRLAGAERTLMGDRPWEIAF
FT                   EDVDVPAENLVGEEGRGFALAQGYINHGRIRQGAHACGAAERCLGLTATYAGQRKTFGA
FT                   PLSERQGVQWMLADGFTEVYATRLLVYDAARKADAGMDAKLETFMIKTFGVEMGFRVVD
FT                   ACLQMHGGMGLTEDSPIERFWRDLRSYRITEGPTEVLRTTLARQILKHFQ"
FT   misc_feature    633692..633751
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00073"
FT   CDS_pept        633849..634985
FT                   /transl_table=11
FT                   /locus_tag="BAV0611"
FT                   /product="putative CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48216"
FT                   /db_xref="GOA:Q2KXS1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXS1"
FT                   /inference="similar to DNA sequence:INSDC:AE015943.1"
FT                   /inference="profile:HMMPfam:PF02515"
FT                   /protein_id="CAJ48216.1"
FT                   /translation="MKTALNDILVIELGTVLTAPLAGMMLADMGARVIKVEHPDGGDPF
FT                   RRHAGKLYSPHFAAYNRNKESIQLDLQTDQGKADLAKLISRADVLLDNYRSGVMQRLSF
FT                   DEARLKALNPRLIQCSITGFGASGPYRDRPCYDAVAVALSGIAAQIVNPEQPALSGPSL
FT                   SDNITGMYAAYGILGALHNRDRTGEGARVEVNMLEASVAFSPEGFAQYTGLGLVPNPLS
FT                   RVAISQSYVFRCADGRLVSVHLSSVEKFWQGFVKAIERDHLLTDPRFQTPVSRTRHYLE
FT                   LAAIAGETFAARNRDEWCRRLEANDVPFAAVNSAPEVMQDPQVRHLGIFYEVPHPEQGR
FT                   VTAIHRPVLIDGERGPSDKAAPTLGEHTAAIRREFELS"
FT   CDS_pept        635035..636021
FT                   /transl_table=11
FT                   /gene="phtD"
FT                   /locus_tag="BAV0612"
FT                   /product="4,5-dihydroxyphthalate decarboxylase"
FT                   /EC_number="4.1.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48217"
FT                   /db_xref="GOA:Q2KXR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXR9"
FT                   /inference="similar to sequence:UniProtKB:Q59727"
FT                   /inference="similar to sequence:UniProtKB:Q05185"
FT                   /protein_id="CAJ48217.1"
FT                   /translation="MSKLKLSVAIGNYDRCRPLIDGAVQIDGVDPTIMTLSPEEIFFRA
FT                   FRGQEFDICELSLSSSTLQTAQGNFPYVGIPVFLSRAFRHTSIYCRTDRIESPEDLRGR
FT                   KIGLPEYQLTANVWARAILQDDYGIMPSDVTWVRGGISHAGRPEKIKIKLPDNLTLQDA
FT                   PAGETISSLLAQGEIDGYIAPRHPDVAPGTPNIGWLFRDPVGAAKEYYRRTRIFPIMHI
FT                   LGVRRELAEQHPWLPGAIYKAFEQAKRQAIEHLSDTSATKITLPFAEERLKEARDLMGE
FT                   DYWSYGIDANRHVLEHFFRHHHEQGLSPRLVTPEDLFHPGTFESYRL"
FT   CDS_pept        <636029..637042
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="BAV0613"
FT                   /product="1-hydroxy-2-naphthoate dioxygenase"
FT                   /note="start codon not provided"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48218"
FT                   /db_xref="GOA:Q2KXR7"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXR7"
FT                   /inference="similar to DNA sequence:INSDC:AB024945.1"
FT                   /inference="similar to DNA sequence:INSDC:D89987.2"
FT                   /protein_id="CAJ48218.1"
FT                   /translation="VMSSSSEAIRRQWREAGLAPLWESPNAHKEQDGAVPSHIWRWEQT
FT                   RPLIDLAFQETSPAAVQRRVLQMLSPQSHSVADEYTCGNVLAAFQCLLPGETARAHRHT
FT                   MNALRFMLEGRGAVTLVDGKECPMAFGDLVLTPGMAWHAHRHDGSEPVVWLDVLDVPLH
FT                   MYLGTAVFQPGPMEPRPQTMRDEAYASPNIAPCVTLGDADRSPVFRYPYEDAVRALHYA
FT                   PASRDGIRRVRYVNPLTGQGALPLLDTTMQELDAGMSSRPTRSNANLVVAVVEGQGESR
FT                   VGDARFRWKARDVFTVPQHNWVTHTAFEGKARFFVVSDADVLRRLNLLAEDVREDF"
FT   CDS_pept        637054..637908
FT                   /transl_table=11
FT                   /locus_tag="BAV0614"
FT                   /product="putative 2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48219"
FT                   /db_xref="GOA:Q2KXR4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXR4"
FT                   /inference="similar to DNA sequence:INSDC:AF173167.3"
FT                   /inference="profile:HMMPfam:PF01557"
FT                   /protein_id="CAJ48219.1"
FT                   /translation="MKICWFNDDRLGVVDGAFVADVSAALRALPAPAYPNRAGDLAIAH
FT                   LPELRAAIEKLLSQAPFYPLDSVRLLSPVANPGKIIGVPVNYLKHVEEVAADVATFTGR
FT                   ETGSVLEQGLFLKANSSLIGCGEPVRISMPQRLTHHEIELAAIIGRTARNVSEQDALAY
FT                   IAGYTIALDMTVRGAEDRSMRKSLDTYSVLGPWLVTADEIADPQRLGLRLSVNGADRQV
FT                   ANTSEMILHIAEQIAWASRFYTLEPGDVIMTGTCDGVGPVVAGDVMHAEIEGIGAMTVS
FT                   VAA"
FT   CDS_pept        637921..638889
FT                   /transl_table=11
FT                   /locus_tag="BAV0615"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48220"
FT                   /db_xref="GOA:Q2KXR3"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXR3"
FT                   /inference="similar to sequence:UniProtKB:Q52186"
FT                   /inference="similar to DNA sequence:INSDC:U12290.2"
FT                   /inference="similar to sequence:UniProtKB:P12580"
FT                   /inference="profile:HMMPfam:PF00970"
FT                   /inference="profile:HMMPfam:PF00111"
FT                   /protein_id="CAJ48220.1"
FT                   /translation="MSAFLPGSDKGLLELRVQAIRYAARDIHLVELVHPDGAELPAATP
FT                   GAHIDLYLGQGLVRSYSLVEPGAHPRSYLLGVKREAASRGGSRYVHEQLRVGTTLTVSA
FT                   PRNHFPLAEHARHSILIAGGIGITPIWCMAQQLEAVGASWELWYSARTRADAAFLDRFE
FT                   PLFAKVHLHFDDEQGCFLDLGAVVRGAAEDTHLYCCGPTPMLDAYEAAAAQRDPRTVHL
FT                   ERFGAKAAASLEGGFVVALARSGKEMAVPEGASILKVLLDNGVPVDFSCQEGICGCCEV
FT                   AVLEGEVDHRDAVLSESERAQGKTMMVCCSGAKSARLVLDL"
FT   CDS_pept        complement(639268..639729)
FT                   /transl_table=11
FT                   /locus_tag="BAV0616"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48221"
FT                   /db_xref="GOA:Q2KXR1"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXR1"
FT                   /inference="similar to DNA sequence:INSDC:BX842656.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48221.1"
FT                   /translation="MMEAQRLPWKYLIMWLRFYYAIHFLKSGINYAVFGVIPDFSKAGA
FT                   VGPYLAEMNNIGFYPFIKYLEIVLGGMLLFNIFVPLALAVMAGVAFQIAYLNLFVSPHP
FT                   RQLFTGTQELLLCGLLIIAYGKSYAGLFKLKAKPAFLWEKNRHHGQDTP"
FT   CDS_pept        complement(639730..639990)
FT                   /transl_table=11
FT                   /locus_tag="BAV0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48222"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXQ8"
FT                   /inference="similar to DNA sequence:INSDC:AP000064.1"
FT                   /protein_id="CAJ48222.1"
FT                   /translation="MSPTWYLPDFYSGILFSGILNGKPRNNNSGFHIAGMQFLYFRSCG
FT                   ERGPNLQGLHIGIPAIHFACLLDPSAAFRFWHQKKPFPKEA"
FT   CDS_pept        640000..640437
FT                   /transl_table=11
FT                   /locus_tag="BAV0618"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48223"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXQ5"
FT                   /protein_id="CAJ48223.1"
FT                   /translation="MRILSLLGGIALIAWIAHGLHTNPRWTWAPGEGELPRDVVAKYMD
FT                   LAYKQGNTDKAAELFFSPKIKDTVAATDVLPAKGAFEPKLVRVVAEGLNVVVQYRAALD
FT                   GADTEFVEIFQIQNGRIASRERVARTDAGQPGRVVATTLRD"
FT   sig_peptide     640000..>640063
FT                   /locus_tag="BAV0618"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        640452..640958
FT                   /transl_table=11
FT                   /locus_tag="BAV0619"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48224"
FT                   /db_xref="GOA:Q2KXQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXQ4"
FT                   /inference="similar to DNA sequence:INSDC:AP001516.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48224.1"
FT                   /translation="MKDSISFKLDIRTAGQLVIALMRLYLGAWMVVSGASYWLHQLGYQ
FT                   PIFPQPFGTLPASNKMLITLVEVGLFNLVKTLEIVGGLFLIGNIFVPLGLLILFPISGM
FT                   VFYNAVFLNQRYDGIFSLTYMGTLCLYMNVVLLLAYIKHYLPMLALNARSGSLSDIKRL
FT                   PEIFR"
FT   CDS_pept        complement(641108..642133)
FT                   /transl_table=11
FT                   /locus_tag="BAV0620"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48225"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXQ2"
FT                   /inference="similar to DNA sequence:INSDC:AE007292.1"
FT                   /inference="profile:HMMPfam:PF03401"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAJ48225.1"
FT                   /translation="MTHSITSATRTRLSRRRALGMLATLAGAIGLVSAPAFAQGSDNFP
FT                   NRSVTIVVPFPAGGATDITARLVAEGLSKKWGQPVVIENKPGAGGNVGSEYVSRAAPDG
FT                   YTLVLGVTGSHGINPSLYKNMRYDPLKDFEAVTQATLYPNAIIVNNDVPANNLQELIAL
FT                   LKNTDKYYSYGSDGNGTASHLGMELIKNQGKFELSHIPYRGSSPMVTDLLGGQIQVGIT
FT                   GLPAVQAYAKSGKLKIVALTTAERFASAPDYPTVAEQGFTGYAAPPWSGFFVPKGTPKP
FT                   LVEKISADIREVMADPAAKEKIIAAGSEFTPTTPEQFEVFVQQEIAKWAEAVKISGARI
FT                   D"
FT   sig_peptide     complement(<642016..642133)
FT                   /locus_tag="BAV0620"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(642188..642955)
FT                   /transl_table=11
FT                   /locus_tag="BAV0621"
FT                   /product="probable short chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48226"
FT                   /db_xref="GOA:Q2KXQ0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXQ0"
FT                   /inference="similar to DNA sequence:INSDC:AF396778.1"
FT                   /inference="profile:HMMPfam:PF00106"
FT                   /protein_id="CAJ48226.1"
FT                   /translation="MTSANPPLLDDKVVMVTGAAGGLGQAIAKHCLDAGARVALLDRDA
FT                   DMLAQGCRTLALAPSRILTLSCDITDADASRSAVEQIATHWGAIDALVNNAATVTPSAK
FT                   VADLTPDQWRLALDVNLTGAWLMSKWAIRHMTRGGVVLNIASQLGSVAAPGRGAYGASK
FT                   AGLIALARAIAVDHAADGIRALSLSPGAVLTSRLVDRYGSAQAASAALAAKYPAGRLGT
FT                   VEEIAQTAVFLISEAASFITGTDIRADGGYTAQ"
FT   misc_feature    complement(642434..642520)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        complement(642952..643671)
FT                   /transl_table=11
FT                   /locus_tag="BAV0622"
FT                   /product="probable short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48227"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXP8"
FT                   /inference="similar to DNA sequence:INSDC:AF173961.1"
FT                   /inference="profile:HMMPfam:PF00106"
FT                   /protein_id="CAJ48227.1"
FT                   /translation="MIKPKASAHCILTGAASGIGLALAERLLAEGWRVTGVDIAPPVIQ
FT                   DNTQYRHLVCDLADPAALQALCADLDGCAPTALVHCAGLVRTGGARDTRPQDTELLWRL
FT                   HGAAPMALVQALAPQLPDRRGRILLVSSRAVLGRAQRLAYAATKSAQIGLARSLAAELV
FT                   GRGITVNVIAPGAVDTPMLNDPKRGAAPSLDLPLGRLITAREVAATLAFFLSDEAGAIT
FT                   GQTLYVCGGASLGAMTP"
FT   sig_peptide     complement(<643596..643671)
FT                   /locus_tag="BAV0622"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(643680..644576)
FT                   /transl_table=11
FT                   /locus_tag="BAV0623"
FT                   /product="carboxyvinyl-carboxyphosphonate phosphorylmutase"
FT                   /EC_number="2.7.8.23"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48228"
FT                   /db_xref="GOA:Q2KXP6"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXP6"
FT                   /inference="similar to sequence:UniProtKB:P11435"
FT                   /inference="profile:HMMPfam:PF00463"
FT                   /protein_id="CAJ48228.1"
FT                   /translation="MNNPRHQFRQLLKNEPFLVSPGVYDGYSVRLVEAAGFKTACTSGA
FT                   AVSNALLGIADIGVMGLSENVTHCRHLARSVSIPITADADTGYGNPVNVYHTVQMFEEA
FT                   GVAGINLEDQVSPKRCGHMPGKDVVSEAEMVKKIEAACLARRDDDFVIIARTDSLAIEG
FT                   IEGAVKRARAYARAGADMLFPDAVRTEDDIKRLVDAAGIPVSINMGFGIRNRPTTPLIP
FT                   LPRLKEIGVKRISLPRMLPAAAIHGMRQALAVMQGVIATGEPADRPDLLVGIEDIMQLM
FT                   GYEQMRAMEKRLTTLDT"
FT   misc_feature    complement(644208..644225)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00161"
FT   CDS_pept        complement(644598..645311)
FT                   /transl_table=11
FT                   /locus_tag="BAV0624"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48229"
FT                   /db_xref="GOA:Q2KXP3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2KXP3"
FT                   /inference="similar to DNA sequence:INSDC:AE016864.1"
FT                   /inference="profile:HMMPfam:PF00392"
FT                   /protein_id="CAJ48229.1"
FT                   /translation="MNTSSPSIATKDDASGPLADVVFDRVLEAIYQGRLAPGSVINEVA
FT                   LAQEFGVSRGPVREAVRRLQGIQLVTREPYIKARVVTLSAESALELFQMRMALEGVACN
FT                   LATRRMSDEEIAQLLAELEQDRQRRLEAATGGERIFDFHERIVLASGNTRIINALCGDL
FT                   YHLLRVYRRHSGTVLERKDDAYAEHWQILRAIRARDAELAESLMRSHIERAAQHLFEHL
FT                   AEGASGIAGHPVPAV"
FT   misc_feature    complement(645120..645194)
FT                   /note="unassigned protein domain"
FT                   /inference="protein motif:Prosite:PS00043"
FT   CDS_pept        645573..648290
FT                   /transl_table=11
FT                   /gene="acnA1"
FT                   /locus_tag="BAV0625"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="Also similar to BAV1017 (44.715 38d.), BAV2514
FT                   (45.898 38d) and BAV2732 (45.224 0d)"
FT                   /db_xref="EnsemblGenomes-Gn:BAV0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ48230"
FT                   /db_xref="GOA:Q2KXP1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL: