(data stored in ACNUC10043 zone)

EMBL: AM180088

ID   AM180088; SV 1; circular; genomic DNA; STD; PRO; 3132494 BP.
XX
AC   AM180088;
XX
PR   Project:PRJNA17185;
XX
DT   22-JUN-2006 (Rel. 88, Created)
DT   19-APR-2017 (Rel. 132, Last updated, Version 13)
XX
DE   Haloquadratum walsbyi DSM 16790 complete genome
XX
KW   complete genome.
XX
OS   Haloquadratum walsbyi DSM 16790
OC   Archaea; Euryarchaeota; Stenosarchaea group; Halobacteria; Haloferacales;
OC   Haloferacaceae; Haloquadratum.
XX
RN   [1]
RX   DOI; 10.1186/1471-2164-7-169.
RX   PUBMED; 16820047.
RA   Bolhuis H.H., Palm P.P., Wende A.W., Falb M.M., Rampp M.M.,
RA   Rodriguez-Valera F.F., Pfeiffer F.F., Oesterhelt D.D.;
RT   "The genome of the square archaeon Haloquadratum walsbyi : life at the
RT   limits of water activity";
RL   BMC Genomics 7:169-169(2006).
XX
RN   [2]
RP   1-3132494
RA   Pfeiffer F.;
RT   ;
RL   Submitted (20-JUN-2006) to the INSDC.
RL   Pfeiffer F., Max-Planck-Institute of Biochemistry, Dept. Membrane
RL   Biochemistry, Am Klopferspitz 18, D-82152 Martinsried, GERMANY
XX
DR   MD5; e1bb33e4618acdc8478ef7465715ca0e.
DR   BioSample; SAMEA3138195.
DR   EnsemblGenomes-Gn; EBG00001100698.
DR   EnsemblGenomes-Gn; EBG00001100699.
DR   EnsemblGenomes-Gn; EBG00001100700.
DR   EnsemblGenomes-Gn; EBG00001100701.
DR   EnsemblGenomes-Gn; EBG00001100702.
DR   EnsemblGenomes-Gn; EBG00001100703.
DR   EnsemblGenomes-Gn; EBG00001100704.
DR   EnsemblGenomes-Gn; EBG00001100705.
DR   EnsemblGenomes-Gn; EBG00001100706.
DR   EnsemblGenomes-Gn; EBG00001100707.
DR   EnsemblGenomes-Gn; EBG00001100708.
DR   EnsemblGenomes-Gn; EBG00001100709.
DR   EnsemblGenomes-Gn; EBG00001100710.
DR   EnsemblGenomes-Gn; EBG00001100711.
DR   EnsemblGenomes-Gn; EBG00001100712.
DR   EnsemblGenomes-Gn; EBG00001100713.
DR   EnsemblGenomes-Gn; EBG00001100714.
DR   EnsemblGenomes-Gn; EBG00001100715.
DR   EnsemblGenomes-Gn; EBG00001100716.
DR   EnsemblGenomes-Gn; EBG00001100717.
DR   EnsemblGenomes-Gn; EBG00001100718.
DR   EnsemblGenomes-Gn; EBG00001100719.
DR   EnsemblGenomes-Gn; EBG00001100720.
DR   EnsemblGenomes-Gn; EBG00001100721.
DR   EnsemblGenomes-Gn; EBG00001100722.
DR   EnsemblGenomes-Gn; EBG00001100723.
DR   EnsemblGenomes-Gn; EBG00001100724.
DR   EnsemblGenomes-Gn; EBG00001100725.
DR   EnsemblGenomes-Gn; EBG00001100726.
DR   EnsemblGenomes-Gn; EBG00001100727.
DR   EnsemblGenomes-Gn; EBG00001100728.
DR   EnsemblGenomes-Gn; EBG00001100729.
DR   EnsemblGenomes-Gn; EBG00001100730.
DR   EnsemblGenomes-Gn; EBG00001100731.
DR   EnsemblGenomes-Gn; EBG00001100732.
DR   EnsemblGenomes-Gn; EBG00001100733.
DR   EnsemblGenomes-Gn; EBG00001100734.
DR   EnsemblGenomes-Gn; EBG00001100735.
DR   EnsemblGenomes-Gn; EBG00001100736.
DR   EnsemblGenomes-Gn; EBG00001100737.
DR   EnsemblGenomes-Gn; EBG00001100738.
DR   EnsemblGenomes-Gn; EBG00001100739.
DR   EnsemblGenomes-Gn; EBG00001100740.
DR   EnsemblGenomes-Gn; EBG00001100741.
DR   EnsemblGenomes-Gn; EBG00001100742.
DR   EnsemblGenomes-Gn; EBG00001100743.
DR   EnsemblGenomes-Gn; EBG00001100744.
DR   EnsemblGenomes-Gn; EBG00001100745.
DR   EnsemblGenomes-Gn; EBG00001100746.
DR   EnsemblGenomes-Gn; EBG00001100747.
DR   EnsemblGenomes-Gn; EBG00001100749.
DR   EnsemblGenomes-Gn; EBG00001100750.
DR   EnsemblGenomes-Gn; EBG00001100751.
DR   EnsemblGenomes-Gn; EBG00001100752.
DR   EnsemblGenomes-Gn; EBG00001100753.
DR   EnsemblGenomes-Gn; EBG00001100754.
DR   EnsemblGenomes-Gn; EBG00001100755.
DR   EnsemblGenomes-Gn; EBG00001100756.
DR   EnsemblGenomes-Gn; EBG00001100757.
DR   EnsemblGenomes-Gn; EBG00001100758.
DR   EnsemblGenomes-Gn; HQ_1005B.
DR   EnsemblGenomes-Gn; HQ_1027C.
DR   EnsemblGenomes-Gn; HQ_1046B.
DR   EnsemblGenomes-Gn; HQ_1056A.
DR   EnsemblGenomes-Gn; HQ_1076B.
DR   EnsemblGenomes-Gn; HQ_1078C.
DR   EnsemblGenomes-Gn; HQ_1085B.
DR   EnsemblGenomes-Gn; HQ_1111B.
DR   EnsemblGenomes-Gn; HQ_1126B.
DR   EnsemblGenomes-Gn; HQ_1132B.
DR   EnsemblGenomes-Gn; HQ_1181A.
DR   EnsemblGenomes-Gn; HQ_1195A.
DR   EnsemblGenomes-Gn; HQ_1198C.
DR   EnsemblGenomes-Gn; HQ_1201A.
DR   EnsemblGenomes-Gn; HQ_1209A.
DR   EnsemblGenomes-Gn; HQ_1274A.
DR   EnsemblGenomes-Gn; HQ_1274C.
DR   EnsemblGenomes-Gn; HQ_1277B.
DR   EnsemblGenomes-Gn; HQ_1317A.
DR   EnsemblGenomes-Gn; HQ_1320B.
DR   EnsemblGenomes-Gn; HQ_1324B.
DR   EnsemblGenomes-Gn; HQ_1324D.
DR   EnsemblGenomes-Gn; HQ_1325C.
DR   EnsemblGenomes-Gn; HQ_1326B.
DR   EnsemblGenomes-Gn; HQ_1327B.
DR   EnsemblGenomes-Gn; HQ_1327C.
DR   EnsemblGenomes-Gn; HQ_1353A.
DR   EnsemblGenomes-Gn; HQ_1355A.
DR   EnsemblGenomes-Gn; HQ_1373B.
DR   EnsemblGenomes-Gn; HQ_1391B.
DR   EnsemblGenomes-Gn; HQ_1396B.
DR   EnsemblGenomes-Gn; HQ_1396C.
DR   EnsemblGenomes-Gn; HQ_1398B.
DR   EnsemblGenomes-Gn; HQ_1419A.
DR   EnsemblGenomes-Gn; HQ_1419B.
DR   EnsemblGenomes-Gn; HQ_1427B.
DR   EnsemblGenomes-Gn; HQ_1434B.
DR   EnsemblGenomes-Gn; HQ_1459B.
DR   EnsemblGenomes-Gn; HQ_1466B.
DR   EnsemblGenomes-Gn; HQ_1472B.
DR   EnsemblGenomes-Gn; HQ_1505B.
DR   EnsemblGenomes-Gn; HQ_1522A.
DR   EnsemblGenomes-Gn; HQ_1529B.
DR   EnsemblGenomes-Gn; HQ_1531C.
DR   EnsemblGenomes-Gn; HQ_1531G.
DR   EnsemblGenomes-Gn; HQ_1566B.
DR   EnsemblGenomes-Gn; HQ_1566C.
DR   EnsemblGenomes-Gn; HQ_1567B.
DR   EnsemblGenomes-Gn; HQ_1592C.
DR   EnsemblGenomes-Gn; HQ_1593A.
DR   EnsemblGenomes-Gn; HQ_1642A.
DR   EnsemblGenomes-Gn; HQ_1668B.
DR   EnsemblGenomes-Gn; HQ_1710B.
DR   EnsemblGenomes-Gn; HQ_1713A.
DR   EnsemblGenomes-Gn; HQ_1715B.
DR   EnsemblGenomes-Gn; HQ_1717A.
DR   EnsemblGenomes-Gn; HQ_1725A.
DR   EnsemblGenomes-Gn; HQ_1742C.
DR   EnsemblGenomes-Gn; HQ_1744A.
DR   EnsemblGenomes-Gn; HQ_1745A.
DR   EnsemblGenomes-Gn; HQ_1768C.
DR   EnsemblGenomes-Gn; HQ_1778B.
DR   EnsemblGenomes-Gn; HQ_1778E.
DR   EnsemblGenomes-Gn; HQ_1816B.
DR   EnsemblGenomes-Gn; HQ_1858A.
DR   EnsemblGenomes-Gn; HQ_1860A.
DR   EnsemblGenomes-Gn; HQ_1888B.
DR   EnsemblGenomes-Gn; HQ_1891A.
DR   EnsemblGenomes-Gn; HQ_1892B.
DR   EnsemblGenomes-Gn; HQ_1892C.
DR   EnsemblGenomes-Gn; HQ_1894A.
DR   EnsemblGenomes-Gn; HQ_1895A.
DR   EnsemblGenomes-Gn; HQ_1897A.
DR   EnsemblGenomes-Gn; HQ_1898C.
DR   EnsemblGenomes-Gn; HQ_1899A.
DR   EnsemblGenomes-Gn; HQ_1899C.
DR   EnsemblGenomes-Gn; HQ_1901A.
DR   EnsemblGenomes-Gn; HQ_1902A.
DR   EnsemblGenomes-Gn; HQ_1904A.
DR   EnsemblGenomes-Gn; HQ_1906A.
DR   EnsemblGenomes-Gn; HQ_1909A.
DR   EnsemblGenomes-Gn; HQ_1909B.
DR   EnsemblGenomes-Gn; HQ_1911B.
DR   EnsemblGenomes-Gn; HQ_1923B.
DR   EnsemblGenomes-Gn; HQ_1924A.
DR   EnsemblGenomes-Gn; HQ_1924B.
DR   EnsemblGenomes-Gn; HQ_1927A.
DR   EnsemblGenomes-Gn; HQ_1934A.
DR   EnsemblGenomes-Gn; HQ_1958B.
DR   EnsemblGenomes-Gn; HQ_1973B.
DR   EnsemblGenomes-Gn; HQ_1981B.
DR   EnsemblGenomes-Gn; HQ_1983A.
DR   EnsemblGenomes-Gn; HQ_1993B.
DR   EnsemblGenomes-Gn; HQ_1995B.
DR   EnsemblGenomes-Gn; HQ_2001B.
DR   EnsemblGenomes-Gn; HQ_2009B.
DR   EnsemblGenomes-Gn; HQ_2020B.
DR   EnsemblGenomes-Gn; HQ_2021A.
DR   EnsemblGenomes-Gn; HQ_2026A.
DR   EnsemblGenomes-Gn; HQ_2048A.
DR   EnsemblGenomes-Gn; HQ_2049B.
DR   EnsemblGenomes-Gn; HQ_2054A.
DR   EnsemblGenomes-Gn; HQ_2063A.
DR   EnsemblGenomes-Gn; HQ_2084A.
DR   EnsemblGenomes-Gn; HQ_2098A.
DR   EnsemblGenomes-Gn; HQ_2099A.
DR   EnsemblGenomes-Gn; HQ_2100A.
DR   EnsemblGenomes-Gn; HQ_2112B.
DR   EnsemblGenomes-Gn; HQ_2113A.
DR   EnsemblGenomes-Gn; HQ_2114A.
DR   EnsemblGenomes-Gn; HQ_2114B.
DR   EnsemblGenomes-Gn; HQ_2116C.
DR   EnsemblGenomes-Gn; HQ_2119A.
DR   EnsemblGenomes-Gn; HQ_2120B.
DR   EnsemblGenomes-Gn; HQ_2122A.
DR   EnsemblGenomes-Gn; HQ_2127B.
DR   EnsemblGenomes-Gn; HQ_2129C.
DR   EnsemblGenomes-Gn; HQ_2137C.
DR   EnsemblGenomes-Gn; HQ_2137D.
DR   EnsemblGenomes-Gn; HQ_2139A.
DR   EnsemblGenomes-Gn; HQ_2139B.
DR   EnsemblGenomes-Gn; HQ_2146A.
DR   EnsemblGenomes-Gn; HQ_2147B.
DR   EnsemblGenomes-Gn; HQ_2155B.
DR   EnsemblGenomes-Gn; HQ_2156A.
DR   EnsemblGenomes-Gn; HQ_2163B.
DR   EnsemblGenomes-Gn; HQ_2165A.
DR   EnsemblGenomes-Gn; HQ_2166B.
DR   EnsemblGenomes-Gn; HQ_2168A.
DR   EnsemblGenomes-Gn; HQ_2176A.
DR   EnsemblGenomes-Gn; HQ_2181B.
DR   EnsemblGenomes-Gn; HQ_2182B.
DR   EnsemblGenomes-Gn; HQ_2183A.
DR   EnsemblGenomes-Gn; HQ_2188A.
DR   EnsemblGenomes-Gn; HQ_2189B.
DR   EnsemblGenomes-Gn; HQ_2194A.
DR   EnsemblGenomes-Gn; HQ_2199A.
DR   EnsemblGenomes-Gn; HQ_2201C.
DR   EnsemblGenomes-Gn; HQ_2203B.
DR   EnsemblGenomes-Gn; HQ_2204A.
DR   EnsemblGenomes-Gn; HQ_2206A.
DR   EnsemblGenomes-Gn; HQ_2208B.
DR   EnsemblGenomes-Gn; HQ_2209A.
DR   EnsemblGenomes-Gn; HQ_2209C.
DR   EnsemblGenomes-Gn; HQ_2219B.
DR   EnsemblGenomes-Gn; HQ_2223D.
DR   EnsemblGenomes-Gn; HQ_2224A.
DR   EnsemblGenomes-Gn; HQ_2231B.
DR   EnsemblGenomes-Gn; HQ_2236B.
DR   EnsemblGenomes-Gn; HQ_2239A.
DR   EnsemblGenomes-Gn; HQ_2267A.
DR   EnsemblGenomes-Gn; HQ_2268B.
DR   EnsemblGenomes-Gn; HQ_2278A.
DR   EnsemblGenomes-Gn; HQ_2285B.
DR   EnsemblGenomes-Gn; HQ_2285D.
DR   EnsemblGenomes-Gn; HQ_2289A.
DR   EnsemblGenomes-Gn; HQ_2289B.
DR   EnsemblGenomes-Gn; HQ_2290A.
DR   EnsemblGenomes-Gn; HQ_2293A.
DR   EnsemblGenomes-Gn; HQ_2322A.
DR   EnsemblGenomes-Gn; HQ_2354A.
DR   EnsemblGenomes-Gn; HQ_2400B.
DR   EnsemblGenomes-Gn; HQ_2401B.
DR   EnsemblGenomes-Gn; HQ_2418C.
DR   EnsemblGenomes-Gn; HQ_2418D.
DR   EnsemblGenomes-Gn; HQ_2420A.
DR   EnsemblGenomes-Gn; HQ_2436B.
DR   EnsemblGenomes-Gn; HQ_2437B.
DR   EnsemblGenomes-Gn; HQ_2444C.
DR   EnsemblGenomes-Gn; HQ_2445B.
DR   EnsemblGenomes-Gn; HQ_2446A.
DR   EnsemblGenomes-Gn; HQ_2453C.
DR   EnsemblGenomes-Gn; HQ_2453D.
DR   EnsemblGenomes-Gn; HQ_2462B.
DR   EnsemblGenomes-Gn; HQ_2482C.
DR   EnsemblGenomes-Gn; HQ_2483A.
DR   EnsemblGenomes-Gn; HQ_2509A.
DR   EnsemblGenomes-Gn; HQ_2509D.
DR   EnsemblGenomes-Gn; HQ_2512A.
DR   EnsemblGenomes-Gn; HQ_2514A.
DR   EnsemblGenomes-Gn; HQ_2531B.
DR   EnsemblGenomes-Gn; HQ_2532A.
DR   EnsemblGenomes-Gn; HQ_2540B.
DR   EnsemblGenomes-Gn; HQ_2551B.
DR   EnsemblGenomes-Gn; HQ_2553B.
DR   EnsemblGenomes-Gn; HQ_2555B.
DR   EnsemblGenomes-Gn; HQ_2556B.
DR   EnsemblGenomes-Gn; HQ_2570B.
DR   EnsemblGenomes-Gn; HQ_2573A.
DR   EnsemblGenomes-Gn; HQ_2613A.
DR   EnsemblGenomes-Gn; HQ_2615E.
DR   EnsemblGenomes-Gn; HQ_2615F.
DR   EnsemblGenomes-Gn; HQ_2617A.
DR   EnsemblGenomes-Gn; HQ_2617B.
DR   EnsemblGenomes-Gn; HQ_2643B.
DR   EnsemblGenomes-Gn; HQ_2683B.
DR   EnsemblGenomes-Gn; HQ_2684B.
DR   EnsemblGenomes-Gn; HQ_2734A.
DR   EnsemblGenomes-Gn; HQ_2738B.
DR   EnsemblGenomes-Gn; HQ_2749B.
DR   EnsemblGenomes-Gn; HQ_2763B.
DR   EnsemblGenomes-Gn; HQ_2763D.
DR   EnsemblGenomes-Gn; HQ_2765B.
DR   EnsemblGenomes-Gn; HQ_2769B.
DR   EnsemblGenomes-Gn; HQ_2785A.
DR   EnsemblGenomes-Gn; HQ_2803C.
DR   EnsemblGenomes-Gn; HQ_2848A.
DR   EnsemblGenomes-Gn; HQ_2852B.
DR   EnsemblGenomes-Gn; HQ_2867B.
DR   EnsemblGenomes-Gn; HQ_2875A.
DR   EnsemblGenomes-Gn; HQ_2876B.
DR   EnsemblGenomes-Gn; HQ_2912A.
DR   EnsemblGenomes-Gn; HQ_2945A.
DR   EnsemblGenomes-Gn; HQ_2951A.
DR   EnsemblGenomes-Gn; HQ_2952A.
DR   EnsemblGenomes-Gn; HQ_2953C.
DR   EnsemblGenomes-Gn; HQ_2957A.
DR   EnsemblGenomes-Gn; HQ_2968A.
DR   EnsemblGenomes-Gn; HQ_2970A.
DR   EnsemblGenomes-Gn; HQ_2976A.
DR   EnsemblGenomes-Gn; HQ_2976B.
DR   EnsemblGenomes-Gn; HQ_2978A.
DR   EnsemblGenomes-Gn; HQ_2979A.
DR   EnsemblGenomes-Gn; HQ_2979C.
DR   EnsemblGenomes-Gn; HQ_2979D.
DR   EnsemblGenomes-Gn; HQ_2980B.
DR   EnsemblGenomes-Gn; HQ_2981A.
DR   EnsemblGenomes-Gn; HQ_2991B.
DR   EnsemblGenomes-Gn; HQ_2998A.
DR   EnsemblGenomes-Gn; HQ_3009A.
DR   EnsemblGenomes-Gn; HQ_3073C.
DR   EnsemblGenomes-Gn; HQ_3081B.
DR   EnsemblGenomes-Gn; HQ_3084B.
DR   EnsemblGenomes-Gn; HQ_3089A.
DR   EnsemblGenomes-Gn; HQ_3089B.
DR   EnsemblGenomes-Gn; HQ_3098C.
DR   EnsemblGenomes-Gn; HQ_3116B.
DR   EnsemblGenomes-Gn; HQ_3120B.
DR   EnsemblGenomes-Gn; HQ_3120D.
DR   EnsemblGenomes-Gn; HQ_3120E.
DR   EnsemblGenomes-Gn; HQ_3134A.
DR   EnsemblGenomes-Gn; HQ_3136A.
DR   EnsemblGenomes-Gn; HQ_3143B.
DR   EnsemblGenomes-Gn; HQ_3224A.
DR   EnsemblGenomes-Gn; HQ_3238B.
DR   EnsemblGenomes-Gn; HQ_3295B.
DR   EnsemblGenomes-Gn; HQ_3295C.
DR   EnsemblGenomes-Gn; HQ_3298B.
DR   EnsemblGenomes-Gn; HQ_3304A.
DR   EnsemblGenomes-Gn; HQ_3308B.
DR   EnsemblGenomes-Gn; HQ_3338A.
DR   EnsemblGenomes-Gn; HQ_3340A.
DR   EnsemblGenomes-Gn; HQ_3364B.
DR   EnsemblGenomes-Gn; HQ_3364C.
DR   EnsemblGenomes-Gn; HQ_3368B.
DR   EnsemblGenomes-Gn; HQ_3370A.
DR   EnsemblGenomes-Gn; HQ_3378A.
DR   EnsemblGenomes-Gn; HQ_3379A.
DR   EnsemblGenomes-Gn; HQ_3383C.
DR   EnsemblGenomes-Gn; HQ_3421B.
DR   EnsemblGenomes-Gn; HQ_3432A.
DR   EnsemblGenomes-Gn; HQ_3434A.
DR   EnsemblGenomes-Gn; HQ_3448A.
DR   EnsemblGenomes-Gn; HQ_3449A.
DR   EnsemblGenomes-Gn; HQ_3472A.
DR   EnsemblGenomes-Gn; HQ_3490B.
DR   EnsemblGenomes-Gn; HQ_3492A.
DR   EnsemblGenomes-Gn; HQ_3493A.
DR   EnsemblGenomes-Gn; HQ_3494B.
DR   EnsemblGenomes-Gn; HQ_3495A.
DR   EnsemblGenomes-Gn; HQ_3495B.
DR   EnsemblGenomes-Gn; HQ_3497B.
DR   EnsemblGenomes-Gn; HQ_3497C.
DR   EnsemblGenomes-Gn; HQ_3500B.
DR   EnsemblGenomes-Gn; HQ_3501C.
DR   EnsemblGenomes-Gn; HQ_3501D.
DR   EnsemblGenomes-Gn; HQ_3513A.
DR   EnsemblGenomes-Gn; HQ_3516A.
DR   EnsemblGenomes-Gn; HQ_3521A.
DR   EnsemblGenomes-Gn; HQ_3523A.
DR   EnsemblGenomes-Gn; HQ_3527A.
DR   EnsemblGenomes-Gn; HQ_3529A.
DR   EnsemblGenomes-Gn; HQ_3534A.
DR   EnsemblGenomes-Gn; HQ_3551A.
DR   EnsemblGenomes-Gn; HQ_3552A.
DR   EnsemblGenomes-Gn; HQ_3553A.
DR   EnsemblGenomes-Gn; HQ_3554B.
DR   EnsemblGenomes-Gn; HQ_3557A.
DR   EnsemblGenomes-Gn; HQ_3558A.
DR   EnsemblGenomes-Gn; HQ_3559A.
DR   EnsemblGenomes-Gn; HQ_3561A.
DR   EnsemblGenomes-Gn; HQ_3562B.
DR   EnsemblGenomes-Gn; HQ_3562C.
DR   EnsemblGenomes-Gn; HQ_3564B.
DR   EnsemblGenomes-Gn; HQ_3565A.
DR   EnsemblGenomes-Gn; HQ_3566A.
DR   EnsemblGenomes-Gn; HQ_3569A.
DR   EnsemblGenomes-Gn; HQ_3572A.
DR   EnsemblGenomes-Gn; HQ_3574B.
DR   EnsemblGenomes-Gn; HQ_3576B.
DR   EnsemblGenomes-Gn; HQ_3579B.
DR   EnsemblGenomes-Gn; HQ_3589B.
DR   EnsemblGenomes-Gn; HQ_3590A.
DR   EnsemblGenomes-Gn; HQ_3594A.
DR   EnsemblGenomes-Gn; HQ_3595A.
DR   EnsemblGenomes-Gn; HQ_3602A.
DR   EnsemblGenomes-Gn; HQ_3603A.
DR   EnsemblGenomes-Gn; HQ_3605A.
DR   EnsemblGenomes-Gn; HQ_3607A.
DR   EnsemblGenomes-Gn; HQ_3609A.
DR   EnsemblGenomes-Gn; HQ_3611A.
DR   EnsemblGenomes-Gn; HQ_3612A.
DR   EnsemblGenomes-Gn; HQ_3614B.
DR   EnsemblGenomes-Gn; HQ_3635B.
DR   EnsemblGenomes-Gn; HQ_3635C.
DR   EnsemblGenomes-Gn; HQ_3637A.
DR   EnsemblGenomes-Gn; HQ_3648B.
DR   EnsemblGenomes-Gn; HQ_3684B.
DR   EnsemblGenomes-Gn; HQ_3684C.
DR   EnsemblGenomes-Gn; HQ_3691A.
DR   EnsemblGenomes-Gn; HQ_3731A.
DR   EnsemblGenomes-Gn; HQ_RRNA16S1.
DR   EnsemblGenomes-Gn; HQ_RRNA16S2.
DR   EnsemblGenomes-Gn; HQ_RRNA23S1.
DR   EnsemblGenomes-Gn; HQ_RRNA23S2.
DR   EnsemblGenomes-Gn; HQ_RRNA5S1.
DR   EnsemblGenomes-Gn; HQ_RRNA5S2.
DR   EnsemblGenomes-Gn; HQ_TRNA01.
DR   EnsemblGenomes-Gn; HQ_TRNA02.
DR   EnsemblGenomes-Gn; HQ_TRNA03.
DR   EnsemblGenomes-Gn; HQ_TRNA04.
DR   EnsemblGenomes-Gn; HQ_TRNA05.
DR   EnsemblGenomes-Gn; HQ_TRNA06.
DR   EnsemblGenomes-Gn; HQ_TRNA07.
DR   EnsemblGenomes-Gn; HQ_TRNA08.
DR   EnsemblGenomes-Gn; HQ_TRNA09.
DR   EnsemblGenomes-Gn; HQ_TRNA10.
DR   EnsemblGenomes-Gn; HQ_TRNA11.
DR   EnsemblGenomes-Gn; HQ_TRNA12.
DR   EnsemblGenomes-Gn; HQ_TRNA13.
DR   EnsemblGenomes-Gn; HQ_TRNA14.
DR   EnsemblGenomes-Gn; HQ_TRNA15.
DR   EnsemblGenomes-Gn; HQ_TRNA16.
DR   EnsemblGenomes-Gn; HQ_TRNA17.
DR   EnsemblGenomes-Gn; HQ_TRNA18.
DR   EnsemblGenomes-Gn; HQ_TRNA19.
DR   EnsemblGenomes-Gn; HQ_TRNA20.
DR   EnsemblGenomes-Gn; HQ_TRNA21.
DR   EnsemblGenomes-Gn; HQ_TRNA22.
DR   EnsemblGenomes-Gn; HQ_TRNA23.
DR   EnsemblGenomes-Gn; HQ_TRNA24.
DR   EnsemblGenomes-Gn; HQ_TRNA25.
DR   EnsemblGenomes-Gn; HQ_TRNA26.
DR   EnsemblGenomes-Gn; HQ_TRNA27.
DR   EnsemblGenomes-Gn; HQ_TRNA28.
DR   EnsemblGenomes-Gn; HQ_TRNA29.
DR   EnsemblGenomes-Gn; HQ_TRNA30.
DR   EnsemblGenomes-Gn; HQ_TRNA31.
DR   EnsemblGenomes-Gn; HQ_TRNA32.
DR   EnsemblGenomes-Gn; HQ_TRNA33.
DR   EnsemblGenomes-Gn; HQ_TRNA34.
DR   EnsemblGenomes-Gn; HQ_TRNA35.
DR   EnsemblGenomes-Gn; HQ_TRNA36.
DR   EnsemblGenomes-Gn; HQ_TRNA37.
DR   EnsemblGenomes-Gn; HQ_TRNA38.
DR   EnsemblGenomes-Gn; HQ_TRNA39.
DR   EnsemblGenomes-Gn; HQ_TRNA40.
DR   EnsemblGenomes-Gn; HQ_TRNA41.
DR   EnsemblGenomes-Gn; HQ_TRNA42.
DR   EnsemblGenomes-Gn; HQ_TRNA43.
DR   EnsemblGenomes-Gn; HQ_TRNA44.
DR   EnsemblGenomes-Gn; HQ_TRNA45.
DR   EnsemblGenomes-Gn; HQ_TRNA46.
DR   EnsemblGenomes-Tr; EBT00001555229.
DR   EnsemblGenomes-Tr; EBT00001555230.
DR   EnsemblGenomes-Tr; EBT00001555231.
DR   EnsemblGenomes-Tr; EBT00001555232.
DR   EnsemblGenomes-Tr; EBT00001555233.
DR   EnsemblGenomes-Tr; EBT00001555234.
DR   EnsemblGenomes-Tr; EBT00001555235.
DR   EnsemblGenomes-Tr; EBT00001555236.
DR   EnsemblGenomes-Tr; EBT00001555237.
DR   EnsemblGenomes-Tr; EBT00001555238.
DR   EnsemblGenomes-Tr; EBT00001555239.
DR   EnsemblGenomes-Tr; EBT00001555240.
DR   EnsemblGenomes-Tr; EBT00001555241.
DR   EnsemblGenomes-Tr; EBT00001555242.
DR   EnsemblGenomes-Tr; EBT00001555244.
DR   EnsemblGenomes-Tr; EBT00001555247.
DR   EnsemblGenomes-Tr; EBT00001555249.
DR   EnsemblGenomes-Tr; EBT00001555254.
DR   EnsemblGenomes-Tr; EBT00001555255.
DR   EnsemblGenomes-Tr; EBT00001555256.
DR   EnsemblGenomes-Tr; EBT00001555257.
DR   EnsemblGenomes-Tr; EBT00001555258.
DR   EnsemblGenomes-Tr; EBT00001555259.
DR   EnsemblGenomes-Tr; EBT00001555260.
DR   EnsemblGenomes-Tr; EBT00001555261.
DR   EnsemblGenomes-Tr; EBT00001555262.
DR   EnsemblGenomes-Tr; EBT00001555264.
DR   EnsemblGenomes-Tr; EBT00001555266.
DR   EnsemblGenomes-Tr; EBT00001555267.
DR   EnsemblGenomes-Tr; EBT00001555268.
DR   EnsemblGenomes-Tr; EBT00001555269.
DR   EnsemblGenomes-Tr; EBT00001555270.
DR   EnsemblGenomes-Tr; EBT00001555271.
DR   EnsemblGenomes-Tr; EBT00001555272.
DR   EnsemblGenomes-Tr; EBT00001555273.
DR   EnsemblGenomes-Tr; EBT00001555274.
DR   EnsemblGenomes-Tr; EBT00001555275.
DR   EnsemblGenomes-Tr; EBT00001555276.
DR   EnsemblGenomes-Tr; EBT00001555277.
DR   EnsemblGenomes-Tr; EBT00001555278.
DR   EnsemblGenomes-Tr; EBT00001555279.
DR   EnsemblGenomes-Tr; EBT00001555280.
DR   EnsemblGenomes-Tr; EBT00001555281.
DR   EnsemblGenomes-Tr; EBT00001555283.
DR   EnsemblGenomes-Tr; EBT00001555284.
DR   EnsemblGenomes-Tr; EBT00001555286.
DR   EnsemblGenomes-Tr; EBT00001555287.
DR   EnsemblGenomes-Tr; EBT00001555288.
DR   EnsemblGenomes-Tr; EBT00001555290.
DR   EnsemblGenomes-Tr; EBT00001555291.
DR   EnsemblGenomes-Tr; EBT00001555292.
DR   EnsemblGenomes-Tr; EBT00001555293.
DR   EnsemblGenomes-Tr; EBT00001555295.
DR   EnsemblGenomes-Tr; EBT00001555296.
DR   EnsemblGenomes-Tr; EBT00001555297.
DR   EnsemblGenomes-Tr; EBT00001555298.
DR   EnsemblGenomes-Tr; EBT00001555299.
DR   EnsemblGenomes-Tr; EBT00001555300.
DR   EnsemblGenomes-Tr; EBT00001555302.
DR   EnsemblGenomes-Tr; EBT00001555303.
DR   EnsemblGenomes-Tr; HQ_1005B.
DR   EnsemblGenomes-Tr; HQ_1027C.
DR   EnsemblGenomes-Tr; HQ_1046B.
DR   EnsemblGenomes-Tr; HQ_1056A.
DR   EnsemblGenomes-Tr; HQ_1076B.
DR   EnsemblGenomes-Tr; HQ_1078C.
DR   EnsemblGenomes-Tr; HQ_1085B.
DR   EnsemblGenomes-Tr; HQ_1111B.
DR   EnsemblGenomes-Tr; HQ_1126B.
DR   EnsemblGenomes-Tr; HQ_1132B.
DR   EnsemblGenomes-Tr; HQ_1181A.
DR   EnsemblGenomes-Tr; HQ_1195A.
DR   EnsemblGenomes-Tr; HQ_1198C.
DR   EnsemblGenomes-Tr; HQ_1201A.
DR   EnsemblGenomes-Tr; HQ_1209A.
DR   EnsemblGenomes-Tr; HQ_1274A.
DR   EnsemblGenomes-Tr; HQ_1274C.
DR   EnsemblGenomes-Tr; HQ_1277B.
DR   EnsemblGenomes-Tr; HQ_1317A.
DR   EnsemblGenomes-Tr; HQ_1320B.
DR   EnsemblGenomes-Tr; HQ_1324B.
DR   EnsemblGenomes-Tr; HQ_1324D.
DR   EnsemblGenomes-Tr; HQ_1325C.
DR   EnsemblGenomes-Tr; HQ_1326B.
DR   EnsemblGenomes-Tr; HQ_1327B.
DR   EnsemblGenomes-Tr; HQ_1327C.
DR   EnsemblGenomes-Tr; HQ_1353A.
DR   EnsemblGenomes-Tr; HQ_1355A.
DR   EnsemblGenomes-Tr; HQ_1373B.
DR   EnsemblGenomes-Tr; HQ_1391B.
DR   EnsemblGenomes-Tr; HQ_1396B.
DR   EnsemblGenomes-Tr; HQ_1396C.
DR   EnsemblGenomes-Tr; HQ_1398B.
DR   EnsemblGenomes-Tr; HQ_1419A.
DR   EnsemblGenomes-Tr; HQ_1419B.
DR   EnsemblGenomes-Tr; HQ_1427B.
DR   EnsemblGenomes-Tr; HQ_1434B.
DR   EnsemblGenomes-Tr; HQ_1459B.
DR   EnsemblGenomes-Tr; HQ_1466B.
DR   EnsemblGenomes-Tr; HQ_1472B.
DR   EnsemblGenomes-Tr; HQ_1505B.
DR   EnsemblGenomes-Tr; HQ_1522A.
DR   EnsemblGenomes-Tr; HQ_1529B.
DR   EnsemblGenomes-Tr; HQ_1531C.
DR   EnsemblGenomes-Tr; HQ_1531G.
DR   EnsemblGenomes-Tr; HQ_1566B.
DR   EnsemblGenomes-Tr; HQ_1566C.
DR   EnsemblGenomes-Tr; HQ_1567B.
DR   EnsemblGenomes-Tr; HQ_1592C.
DR   EnsemblGenomes-Tr; HQ_1593A.
DR   EnsemblGenomes-Tr; HQ_1642A.
DR   EnsemblGenomes-Tr; HQ_1668B.
DR   EnsemblGenomes-Tr; HQ_1710B.
DR   EnsemblGenomes-Tr; HQ_1713A.
DR   EnsemblGenomes-Tr; HQ_1715B.
DR   EnsemblGenomes-Tr; HQ_1717A.
DR   EnsemblGenomes-Tr; HQ_1725A.
DR   EnsemblGenomes-Tr; HQ_1742C.
DR   EnsemblGenomes-Tr; HQ_1744A.
DR   EnsemblGenomes-Tr; HQ_1745A.
DR   EnsemblGenomes-Tr; HQ_1768C.
DR   EnsemblGenomes-Tr; HQ_1778B.
DR   EnsemblGenomes-Tr; HQ_1778E.
DR   EnsemblGenomes-Tr; HQ_1816B.
DR   EnsemblGenomes-Tr; HQ_1858A.
DR   EnsemblGenomes-Tr; HQ_1860A.
DR   EnsemblGenomes-Tr; HQ_1888B.
DR   EnsemblGenomes-Tr; HQ_1891A.
DR   EnsemblGenomes-Tr; HQ_1892B.
DR   EnsemblGenomes-Tr; HQ_1892C.
DR   EnsemblGenomes-Tr; HQ_1894A.
DR   EnsemblGenomes-Tr; HQ_1895A.
DR   EnsemblGenomes-Tr; HQ_1897A.
DR   EnsemblGenomes-Tr; HQ_1898C.
DR   EnsemblGenomes-Tr; HQ_1899A.
DR   EnsemblGenomes-Tr; HQ_1899C.
DR   EnsemblGenomes-Tr; HQ_1901A.
DR   EnsemblGenomes-Tr; HQ_1902A.
DR   EnsemblGenomes-Tr; HQ_1904A.
DR   EnsemblGenomes-Tr; HQ_1906A.
DR   EnsemblGenomes-Tr; HQ_1909A.
DR   EnsemblGenomes-Tr; HQ_1909B.
DR   EnsemblGenomes-Tr; HQ_1911B.
DR   EnsemblGenomes-Tr; HQ_1923B.
DR   EnsemblGenomes-Tr; HQ_1924A.
DR   EnsemblGenomes-Tr; HQ_1924B.
DR   EnsemblGenomes-Tr; HQ_1927A.
DR   EnsemblGenomes-Tr; HQ_1934A.
DR   EnsemblGenomes-Tr; HQ_1958B.
DR   EnsemblGenomes-Tr; HQ_1973B.
DR   EnsemblGenomes-Tr; HQ_1981B.
DR   EnsemblGenomes-Tr; HQ_1983A.
DR   EnsemblGenomes-Tr; HQ_1993B.
DR   EnsemblGenomes-Tr; HQ_1995B.
DR   EnsemblGenomes-Tr; HQ_2001B.
DR   EnsemblGenomes-Tr; HQ_2009B.
DR   EnsemblGenomes-Tr; HQ_2020B.
DR   EnsemblGenomes-Tr; HQ_2021A.
DR   EnsemblGenomes-Tr; HQ_2026A.
DR   EnsemblGenomes-Tr; HQ_2048A.
DR   EnsemblGenomes-Tr; HQ_2049B.
DR   EnsemblGenomes-Tr; HQ_2054A.
DR   EnsemblGenomes-Tr; HQ_2063A.
DR   EnsemblGenomes-Tr; HQ_2084A.
DR   EnsemblGenomes-Tr; HQ_2098A.
DR   EnsemblGenomes-Tr; HQ_2099A.
DR   EnsemblGenomes-Tr; HQ_2100A.
DR   EnsemblGenomes-Tr; HQ_2112B.
DR   EnsemblGenomes-Tr; HQ_2113A.
DR   EnsemblGenomes-Tr; HQ_2114A.
DR   EnsemblGenomes-Tr; HQ_2114B.
DR   EnsemblGenomes-Tr; HQ_2116C.
DR   EnsemblGenomes-Tr; HQ_2119A.
DR   EnsemblGenomes-Tr; HQ_2120B.
DR   EnsemblGenomes-Tr; HQ_2122A.
DR   EnsemblGenomes-Tr; HQ_2127B.
DR   EnsemblGenomes-Tr; HQ_2129C.
DR   EnsemblGenomes-Tr; HQ_2137C.
DR   EnsemblGenomes-Tr; HQ_2137D.
DR   EnsemblGenomes-Tr; HQ_2139A.
DR   EnsemblGenomes-Tr; HQ_2139B.
DR   EnsemblGenomes-Tr; HQ_2146A.
DR   EnsemblGenomes-Tr; HQ_2147B.
DR   EnsemblGenomes-Tr; HQ_2155B.
DR   EnsemblGenomes-Tr; HQ_2156A.
DR   EnsemblGenomes-Tr; HQ_2163B.
DR   EnsemblGenomes-Tr; HQ_2165A.
DR   EnsemblGenomes-Tr; HQ_2166B.
DR   EnsemblGenomes-Tr; HQ_2168A.
DR   EnsemblGenomes-Tr; HQ_2176A.
DR   EnsemblGenomes-Tr; HQ_2181B.
DR   EnsemblGenomes-Tr; HQ_2182B.
DR   EnsemblGenomes-Tr; HQ_2183A.
DR   EnsemblGenomes-Tr; HQ_2188A.
DR   EnsemblGenomes-Tr; HQ_2189B.
DR   EnsemblGenomes-Tr; HQ_2194A.
DR   EnsemblGenomes-Tr; HQ_2199A.
DR   EnsemblGenomes-Tr; HQ_2201C.
DR   EnsemblGenomes-Tr; HQ_2203B.
DR   EnsemblGenomes-Tr; HQ_2204A.
DR   EnsemblGenomes-Tr; HQ_2206A.
DR   EnsemblGenomes-Tr; HQ_2208B.
DR   EnsemblGenomes-Tr; HQ_2209A.
DR   EnsemblGenomes-Tr; HQ_2209C.
DR   EnsemblGenomes-Tr; HQ_2219B.
DR   EnsemblGenomes-Tr; HQ_2223D.
DR   EnsemblGenomes-Tr; HQ_2224A.
DR   EnsemblGenomes-Tr; HQ_2231B.
DR   EnsemblGenomes-Tr; HQ_2236B.
DR   EnsemblGenomes-Tr; HQ_2239A.
DR   EnsemblGenomes-Tr; HQ_2267A.
DR   EnsemblGenomes-Tr; HQ_2268B.
DR   EnsemblGenomes-Tr; HQ_2278A.
DR   EnsemblGenomes-Tr; HQ_2285B.
DR   EnsemblGenomes-Tr; HQ_2285D.
DR   EnsemblGenomes-Tr; HQ_2289A.
DR   EnsemblGenomes-Tr; HQ_2289B.
DR   EnsemblGenomes-Tr; HQ_2290A.
DR   EnsemblGenomes-Tr; HQ_2293A.
DR   EnsemblGenomes-Tr; HQ_2322A.
DR   EnsemblGenomes-Tr; HQ_2354A.
DR   EnsemblGenomes-Tr; HQ_2400B.
DR   EnsemblGenomes-Tr; HQ_2401B.
DR   EnsemblGenomes-Tr; HQ_2418C.
DR   EnsemblGenomes-Tr; HQ_2418D.
DR   EnsemblGenomes-Tr; HQ_2420A.
DR   EnsemblGenomes-Tr; HQ_2436B.
DR   EnsemblGenomes-Tr; HQ_2437B.
DR   EnsemblGenomes-Tr; HQ_2444C.
DR   EnsemblGenomes-Tr; HQ_2445B.
DR   EnsemblGenomes-Tr; HQ_2446A.
DR   EnsemblGenomes-Tr; HQ_2453C.
DR   EnsemblGenomes-Tr; HQ_2453D.
DR   EnsemblGenomes-Tr; HQ_2462B.
DR   EnsemblGenomes-Tr; HQ_2482C.
DR   EnsemblGenomes-Tr; HQ_2483A.
DR   EnsemblGenomes-Tr; HQ_2509A.
DR   EnsemblGenomes-Tr; HQ_2509D.
DR   EnsemblGenomes-Tr; HQ_2512A.
DR   EnsemblGenomes-Tr; HQ_2514A.
DR   EnsemblGenomes-Tr; HQ_2531B.
DR   EnsemblGenomes-Tr; HQ_2532A.
DR   EnsemblGenomes-Tr; HQ_2540B.
DR   EnsemblGenomes-Tr; HQ_2551B.
DR   EnsemblGenomes-Tr; HQ_2553B.
DR   EnsemblGenomes-Tr; HQ_2555B.
DR   EnsemblGenomes-Tr; HQ_2556B.
DR   EnsemblGenomes-Tr; HQ_2570B.
DR   EnsemblGenomes-Tr; HQ_2573A.
DR   EnsemblGenomes-Tr; HQ_2613A.
DR   EnsemblGenomes-Tr; HQ_2615E.
DR   EnsemblGenomes-Tr; HQ_2615F.
DR   EnsemblGenomes-Tr; HQ_2617A.
DR   EnsemblGenomes-Tr; HQ_2617B.
DR   EnsemblGenomes-Tr; HQ_2643B.
DR   EnsemblGenomes-Tr; HQ_2683B.
DR   EnsemblGenomes-Tr; HQ_2684B.
DR   EnsemblGenomes-Tr; HQ_2734A.
DR   EnsemblGenomes-Tr; HQ_2738B.
DR   EnsemblGenomes-Tr; HQ_2749B.
DR   EnsemblGenomes-Tr; HQ_2763B.
DR   EnsemblGenomes-Tr; HQ_2763D.
DR   EnsemblGenomes-Tr; HQ_2765B.
DR   EnsemblGenomes-Tr; HQ_2769B.
DR   EnsemblGenomes-Tr; HQ_2785A.
DR   EnsemblGenomes-Tr; HQ_2803C.
DR   EnsemblGenomes-Tr; HQ_2848A.
DR   EnsemblGenomes-Tr; HQ_2852B.
DR   EnsemblGenomes-Tr; HQ_2867B.
DR   EnsemblGenomes-Tr; HQ_2875A.
DR   EnsemblGenomes-Tr; HQ_2876B.
DR   EnsemblGenomes-Tr; HQ_2912A.
DR   EnsemblGenomes-Tr; HQ_2945A.
DR   EnsemblGenomes-Tr; HQ_2951A.
DR   EnsemblGenomes-Tr; HQ_2952A.
DR   EnsemblGenomes-Tr; HQ_2953C.
DR   EnsemblGenomes-Tr; HQ_2957A.
DR   EnsemblGenomes-Tr; HQ_2968A.
DR   EnsemblGenomes-Tr; HQ_2970A.
DR   EnsemblGenomes-Tr; HQ_2976A.
DR   EnsemblGenomes-Tr; HQ_2976B.
DR   EnsemblGenomes-Tr; HQ_2978A.
DR   EnsemblGenomes-Tr; HQ_2979A.
DR   EnsemblGenomes-Tr; HQ_2979C.
DR   EnsemblGenomes-Tr; HQ_2979D.
DR   EnsemblGenomes-Tr; HQ_2980B.
DR   EnsemblGenomes-Tr; HQ_2981A.
DR   EnsemblGenomes-Tr; HQ_2991B.
DR   EnsemblGenomes-Tr; HQ_2998A.
DR   EnsemblGenomes-Tr; HQ_3009A.
DR   EnsemblGenomes-Tr; HQ_3073C.
DR   EnsemblGenomes-Tr; HQ_3081B.
DR   EnsemblGenomes-Tr; HQ_3084B.
DR   EnsemblGenomes-Tr; HQ_3089A.
DR   EnsemblGenomes-Tr; HQ_3089B.
DR   EnsemblGenomes-Tr; HQ_3098C.
DR   EnsemblGenomes-Tr; HQ_3116B.
DR   EnsemblGenomes-Tr; HQ_3120B.
DR   EnsemblGenomes-Tr; HQ_3120D.
DR   EnsemblGenomes-Tr; HQ_3120E.
DR   EnsemblGenomes-Tr; HQ_3134A.
DR   EnsemblGenomes-Tr; HQ_3136A.
DR   EnsemblGenomes-Tr; HQ_3143B.
DR   EnsemblGenomes-Tr; HQ_3224A.
DR   EnsemblGenomes-Tr; HQ_3238B.
DR   EnsemblGenomes-Tr; HQ_3295B.
DR   EnsemblGenomes-Tr; HQ_3295C.
DR   EnsemblGenomes-Tr; HQ_3298B.
DR   EnsemblGenomes-Tr; HQ_3304A.
DR   EnsemblGenomes-Tr; HQ_3308B.
DR   EnsemblGenomes-Tr; HQ_3338A.
DR   EnsemblGenomes-Tr; HQ_3340A.
DR   EnsemblGenomes-Tr; HQ_3364B.
DR   EnsemblGenomes-Tr; HQ_3364C.
DR   EnsemblGenomes-Tr; HQ_3368B.
DR   EnsemblGenomes-Tr; HQ_3370A.
DR   EnsemblGenomes-Tr; HQ_3378A.
DR   EnsemblGenomes-Tr; HQ_3379A.
DR   EnsemblGenomes-Tr; HQ_3383C.
DR   EnsemblGenomes-Tr; HQ_3421B.
DR   EnsemblGenomes-Tr; HQ_3432A.
DR   EnsemblGenomes-Tr; HQ_3434A.
DR   EnsemblGenomes-Tr; HQ_3448A.
DR   EnsemblGenomes-Tr; HQ_3449A.
DR   EnsemblGenomes-Tr; HQ_3472A.
DR   EnsemblGenomes-Tr; HQ_3490B.
DR   EnsemblGenomes-Tr; HQ_3492A.
DR   EnsemblGenomes-Tr; HQ_3493A.
DR   EnsemblGenomes-Tr; HQ_3494B.
DR   EnsemblGenomes-Tr; HQ_3495A.
DR   EnsemblGenomes-Tr; HQ_3495B.
DR   EnsemblGenomes-Tr; HQ_3497B.
DR   EnsemblGenomes-Tr; HQ_3497C.
DR   EnsemblGenomes-Tr; HQ_3500B.
DR   EnsemblGenomes-Tr; HQ_3501C.
DR   EnsemblGenomes-Tr; HQ_3501D.
DR   EnsemblGenomes-Tr; HQ_3513A.
DR   EnsemblGenomes-Tr; HQ_3516A.
DR   EnsemblGenomes-Tr; HQ_3521A.
DR   EnsemblGenomes-Tr; HQ_3523A.
DR   EnsemblGenomes-Tr; HQ_3527A.
DR   EnsemblGenomes-Tr; HQ_3529A.
DR   EnsemblGenomes-Tr; HQ_3534A.
DR   EnsemblGenomes-Tr; HQ_3551A.
DR   EnsemblGenomes-Tr; HQ_3552A.
DR   EnsemblGenomes-Tr; HQ_3553A.
DR   EnsemblGenomes-Tr; HQ_3554B.
DR   EnsemblGenomes-Tr; HQ_3557A.
DR   EnsemblGenomes-Tr; HQ_3558A.
DR   EnsemblGenomes-Tr; HQ_3559A.
DR   EnsemblGenomes-Tr; HQ_3561A.
DR   EnsemblGenomes-Tr; HQ_3562B.
DR   EnsemblGenomes-Tr; HQ_3562C.
DR   EnsemblGenomes-Tr; HQ_3564B.
DR   EnsemblGenomes-Tr; HQ_3565A.
DR   EnsemblGenomes-Tr; HQ_3566A.
DR   EnsemblGenomes-Tr; HQ_3569A.
DR   EnsemblGenomes-Tr; HQ_3572A.
DR   EnsemblGenomes-Tr; HQ_3574B.
DR   EnsemblGenomes-Tr; HQ_3576B.
DR   EnsemblGenomes-Tr; HQ_3579B.
DR   EnsemblGenomes-Tr; HQ_3589B.
DR   EnsemblGenomes-Tr; HQ_3590A.
DR   EnsemblGenomes-Tr; HQ_3594A.
DR   EnsemblGenomes-Tr; HQ_3595A.
DR   EnsemblGenomes-Tr; HQ_3602A.
DR   EnsemblGenomes-Tr; HQ_3603A.
DR   EnsemblGenomes-Tr; HQ_3605A.
DR   EnsemblGenomes-Tr; HQ_3607A.
DR   EnsemblGenomes-Tr; HQ_3609A.
DR   EnsemblGenomes-Tr; HQ_3611A.
DR   EnsemblGenomes-Tr; HQ_3612A.
DR   EnsemblGenomes-Tr; HQ_3614B.
DR   EnsemblGenomes-Tr; HQ_3635B.
DR   EnsemblGenomes-Tr; HQ_3635C.
DR   EnsemblGenomes-Tr; HQ_3637A.
DR   EnsemblGenomes-Tr; HQ_3648B.
DR   EnsemblGenomes-Tr; HQ_3684B.
DR   EnsemblGenomes-Tr; HQ_3684C.
DR   EnsemblGenomes-Tr; HQ_3691A.
DR   EnsemblGenomes-Tr; HQ_3731A.
DR   EnsemblGenomes-Tr; HQ_RRNA16S1-1.
DR   EnsemblGenomes-Tr; HQ_RRNA16S2-1.
DR   EnsemblGenomes-Tr; HQ_RRNA23S1-1.
DR   EnsemblGenomes-Tr; HQ_RRNA23S2-1.
DR   EnsemblGenomes-Tr; HQ_RRNA5S1-1.
DR   EnsemblGenomes-Tr; HQ_RRNA5S2-1.
DR   EnsemblGenomes-Tr; HQ_TRNA01-1.
DR   EnsemblGenomes-Tr; HQ_TRNA02-1.
DR   EnsemblGenomes-Tr; HQ_TRNA03-1.
DR   EnsemblGenomes-Tr; HQ_TRNA04-1.
DR   EnsemblGenomes-Tr; HQ_TRNA05-1.
DR   EnsemblGenomes-Tr; HQ_TRNA06-1.
DR   EnsemblGenomes-Tr; HQ_TRNA07-1.
DR   EnsemblGenomes-Tr; HQ_TRNA08-1.
DR   EnsemblGenomes-Tr; HQ_TRNA09-1.
DR   EnsemblGenomes-Tr; HQ_TRNA10-1.
DR   EnsemblGenomes-Tr; HQ_TRNA11-1.
DR   EnsemblGenomes-Tr; HQ_TRNA12-1.
DR   EnsemblGenomes-Tr; HQ_TRNA13-1.
DR   EnsemblGenomes-Tr; HQ_TRNA14-1.
DR   EnsemblGenomes-Tr; HQ_TRNA15-1.
DR   EnsemblGenomes-Tr; HQ_TRNA16-1.
DR   EnsemblGenomes-Tr; HQ_TRNA17-1.
DR   EnsemblGenomes-Tr; HQ_TRNA18-1.
DR   EnsemblGenomes-Tr; HQ_TRNA19-1.
DR   EnsemblGenomes-Tr; HQ_TRNA20-1.
DR   EnsemblGenomes-Tr; HQ_TRNA21-1.
DR   EnsemblGenomes-Tr; HQ_TRNA22-1.
DR   EnsemblGenomes-Tr; HQ_TRNA23-1.
DR   EnsemblGenomes-Tr; HQ_TRNA24-1.
DR   EnsemblGenomes-Tr; HQ_TRNA25-1.
DR   EnsemblGenomes-Tr; HQ_TRNA26-1.
DR   EnsemblGenomes-Tr; HQ_TRNA27-1.
DR   EnsemblGenomes-Tr; HQ_TRNA28-1.
DR   EnsemblGenomes-Tr; HQ_TRNA29-1.
DR   EnsemblGenomes-Tr; HQ_TRNA30-1.
DR   EnsemblGenomes-Tr; HQ_TRNA31-1.
DR   EnsemblGenomes-Tr; HQ_TRNA32-1.
DR   EnsemblGenomes-Tr; HQ_TRNA33-1.
DR   EnsemblGenomes-Tr; HQ_TRNA34-1.
DR   EnsemblGenomes-Tr; HQ_TRNA35-1.
DR   EnsemblGenomes-Tr; HQ_TRNA36-1.
DR   EnsemblGenomes-Tr; HQ_TRNA37-1.
DR   EnsemblGenomes-Tr; HQ_TRNA38-1.
DR   EnsemblGenomes-Tr; HQ_TRNA39-1.
DR   EnsemblGenomes-Tr; HQ_TRNA40-1.
DR   EnsemblGenomes-Tr; HQ_TRNA41-1.
DR   EnsemblGenomes-Tr; HQ_TRNA42-1.
DR   EnsemblGenomes-Tr; HQ_TRNA43-1.
DR   EnsemblGenomes-Tr; HQ_TRNA44-1.
DR   EnsemblGenomes-Tr; HQ_TRNA45-1.
DR   EnsemblGenomes-Tr; HQ_TRNA46-1.
DR   EuropePMC; PMC1544339; 16820047.
DR   EuropePMC; PMC2222616; 18042280.
DR   EuropePMC; PMC2800850; 19951421.
DR   EuropePMC; PMC3404096; 22848480.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01337; CRISPR-DR24.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02163; sR-tMet.
DR   SILVA-LSU; AM180088.
DR   SILVA-SSU; AM180088.
DR   StrainInfo; 681614; 0.
XX
CC   Clone requests: fpf@rzg.mpg.de
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3132494
FT                   /organism="Haloquadratum walsbyi DSM 16790"
FT                   /strain="DSM 16790 = HBSQ001"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:362976"
FT   rep_origin      49..303
FT                   /note="repeat-bounded region indicating the replication
FT                   origin"
FT   repeat_region   51..76
FT                   /note="inverted repeat at the replication origin"
FT   repeat_region   complement(276..301)
FT                   /note="inverted repeat at the replication origin"
FT   CDS_pept        723..2426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orc1"
FT                   /gene_synonym="cdc6A"
FT                   /locus_tag="HQ_1001A"
FT                   /product="Orc1-type DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1001A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51131"
FT                   /db_xref="GOA:Q18DG7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DG7"
FT                   /protein_id="CAJ51131.1"
FT                   /translation="MHNNRIHNNSSSDNLESSHENKRDSQSTSPTESGDFTLDEDMSQD
FT                   NNHSDTANSNTRNRTSSASEDDIDHSENREEQGLFDNLLSGEPIFENKEVLRPSYTPRK
FT                   LPHRTEQINQMATILVSALRGDTPSNILIYGKTGTGKTASAKFVSQELESTSQKYDVAC
FT                   EVEYINCEVTDTQYRVLAQLANKFIEKNRNQIDKRIDELKTLQSSDQYLSGSASSAESI
FT                   DSVDTADDTISKSPDESTGEYLNLSDIASPFDSARDLDDRIESLRADREEMELVPMTGW
FT                   PTDRVYSTFFDAVDYHERVAVIMLDEVDKLVEKSGDDTLYNLSRMNSELDNSRISIIGI
FT                   SNDLKFTDFLDPRVKSSLGEEEIVFPPYDANQLRDILQYRADVSFKSDALTDDVIPLCA
FT                   AFAAQEHGDARRALDLLRTAGELAERSQTNTVEEDHVRQAQDKIELDRVIEVVRTLPTQ
FT                   SKIVLYSIILLEKNGVHSINTGEVFNIYKRLCEELDTDVLTQRRVTDLISELDMLGIVN
FT                   AIVVSKGRYGRTKEISLSVPIEETETVLLSDSRLGNIENAQPFVQARFDN"
FT   CDS_pept        complement(2461..3318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sec11"
FT                   /locus_tag="HQ_1002A"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1002A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51132"
FT                   /db_xref="GOA:Q18DG6"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DG6"
FT                   /protein_id="CAJ51132.1"
FT                   /translation="MTEKSGDDESPERWDSEHATGIDDSGIEDDHTDSNVGLDARSDVN
FT                   IEYNQENDRENENNPYDRARREPKHTAESSILTRIRRGAVTTLRETLYSVIVVVAIGLI
FT                   LFAISGVWPPMVAVESGSMEPEMSRGDLILVSETTRFTPSYAHENTGVVTAEVGQSRGY
FT                   QTFGGTGSVIIYDPPQRVGSPIIHRAHFYVEDGENWYEEANSAYLTASGCDELRNCPAP
FT                   HAGFITKGDANARYDQATGIAGPVKRTWIRGAARFRIPYLGYVRLQLAGALTVNPVLWV
FT                   SGIR"
FT   CDS_pept        3557..5179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polD1"
FT                   /locus_tag="HQ_1003A"
FT                   /product="DNA-directed DNA polymerase D exonuclease subunit
FT                   DP1"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1003A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51133"
FT                   /db_xref="GOA:Q18DI9"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR011149"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DI9"
FT                   /protein_id="CAJ51133.1"
FT                   /translation="MPSELSARIVSALAQHGYNADREAVTLLAGAKYPNTALEEVLDLI
FT                   ADDTLRITAADVRPVIDSTPSDPSSITEPANKDSTRDNNAQDQSISDQKTEYLPSQSNS
FT                   PNDVTPDLDSSPEQTTGASQPPQKAHTSTPETNQSVNSFDINGDITGRSTGTGSYDDFV
FT                   SVFRDRYERLSSHLRSRVNHRPTQAIGSMSGETDTAIIGLVNDIRSTKNGHWIVELEDT
FT                   TGTFPCLVMKDRSFADVVNELLFDECIAIEGTLSGDGEILFANDIHFPDIPHNHTPNTA
FT                   DRHVQAALISDIHVGSQEFVYDAWERFAAWLHTDEADAIEYLLIAGDMVEGVGVYPDQD
FT                   DELDIVDIYAQYETFAEHLKSVPGDIEILLIPGNHDAVRLAEPQPGFDDELRSIMSAHD
FT                   ARISGNPSFVTIEGVQILMYHGVSLDEVIAELPSPKANYDEPHKAMYQLLKKRHIAPQF
FT                   GERTRLAPEDSDYLIIDEIPDVFHTGHVHKLGWGKYHDVLAVNSGCWQAQTAFQRSVNI
FT                   DPDVGYAPIIDLDTLEMTVRKFL"
FT   CDS_pept        complement(5330..5836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1004A"
FT                   /product="acetyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1004A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51134"
FT                   /db_xref="GOA:Q18DI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DI8"
FT                   /protein_id="CAJ51134.1"
FT                   /translation="MDVRDAVESDVETLGAIADLPADALRNVVHDRTVRVAERQTTDTE
FT                   SHTDAHDETNRLTTSGEQTGNEADESTAEESNENKPDIIGFVAFDVRDGTVHVTQLAGE
FT                   ATIAETLLSEPIRFAATEGFDVEFVVPMSEENATAAAENAGFEPIGRGPRFGDETTTRY
FT                   RFDAE"
FT   CDS_pept        6224..7402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="HQ_1005A"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1005A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51135"
FT                   /db_xref="GOA:Q18DI7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DI7"
FT                   /protein_id="CAJ51135.1"
FT                   /translation="MRIVTKFGGTSLGNGDRITRAADSIAAAIDAGHEIAVVASAMGST
FT                   TDYLLDEIHYDAADKDRAEIVSMGERTSVRMLKGALSARGVTAQFLEPGSDDWPIITNE
FT                   RGEVDVGETQRRAADLASNLDDVVPVLTGFLAESHDGTTTTLGRGGSDTTAVMLGHYTD
FT                   ADEVVIVTDVEGVMTGDPRVVEGARNVGQITVDELRNLSFRGAEVVAPSALTYKNDDLG
FT                   VRVVHYQHGDLLTGGTLIEGEFENLIDMQEDMLACVTVAGRSIRNSTGILADLSQSLRD
FT                   DGINIDAVASGMDSITFYISEDIASKAENLLHAKVINNQTLSSVTVDDGIAVIRVTGGE
FT                   LPNRPGVILDIVRPIAEAGINIRDVITSATSVAVFVAWDDREETLSIVQSKF"
FT   CDS_pept        complement(7454..7630)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1005B"
FT                   /note="gene truncated at the N- and C-terminus"
FT                   /note="product: MJ0936 family phosphoesterase
FT                   (nonfunctional)"
FT                   /note="EC_number: 3.1.-.-"
FT   mobile_element  join(7732..8266,8375..8394)
FT                   /mobile_element_type="insertion sequence:HqIRS60"
FT                   /locus_tag="HQ_HqIRS60A"
FT   mobile_element  8267..8374
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AA"
FT   CDS_pept        complement(8631..9218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purO"
FT                   /locus_tag="HQ_1006A"
FT                   /product="inosine-5'-monophosphate cyclohydrolase,
FT                   archaeal-type"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1006A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51136"
FT                   /db_xref="GOA:Q18DI6"
FT                   /db_xref="InterPro:IPR010191"
FT                   /db_xref="InterPro:IPR020600"
FT                   /db_xref="InterPro:IPR036795"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DI6"
FT                   /protein_id="CAJ51136.1"
FT                   /translation="MYLGRFIIIGETTAVYRVSSRSYPNRQIISRDNMLTVVPTSEAAQ
FT                   TNNPYVSYNCMRQGGEKIVIGNGSHVDPIAEKIDRGYPARDALAEALLALDYEKDDYNT
FT                   PRIAGIVGSSSYVGIIRQDAVIIRSISEPTLVSTYENDAPTTAQLSLKGDIEEIAQKAY
FT                   ELEYEHPVCAAAVTHQGQGESGDIVAQIYNGK"
FT   tRNA            9331..9403
FT                   /gene="tRNAGln1"
FT                   /locus_tag="HQ_TRNA01"
FT                   /product="tRNA-Gln"
FT                   /note="anticodon CTG"
FT   CDS_pept        complement(9618..10115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cgi121"
FT                   /locus_tag="HQ_1007A"
FT                   /product="KEOPS complex subunit Cgi121"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1007A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51137"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="InterPro:IPR016799"
FT                   /db_xref="InterPro:IPR036504"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DI5"
FT                   /protein_id="CAJ51137.1"
FT                   /translation="MKLVCGKVTIEDVDEFVSIVDKIEKGTGATIQAFDARYIVNQKHI
FT                   KRAIECADRARRRNNNIARDRSIEMLLYAAGRRQITEALEIGVSSGLNRIVVAIDGGNE
FT                   IEAAKSIESNTLDTPADEVLGSYDPDLVQPYFDITANEIDVVNGDTESLVLERVALLAV
FT                   ER"
FT   CDS_pept        complement(10112..12565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hel308a"
FT                   /locus_tag="HQ_1008A"
FT                   /product="ATP-dependent DNA helicase Hel308"
FT                   /EC_number="3.6.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1008A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51138"
FT                   /db_xref="GOA:Q18DI4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DI4"
FT                   /protein_id="CAJ51138.1"
FT                   /translation="MEPDDVSGLPPGVSDKLRTEGVTELYPPQESAVKAGLTDGESLVA
FT                   SVPTASGKTLIAELAMLAAIERGETALYIVPLRALASEKQTEFERWEEFGVDIGVSTGN
FT                   YDSSGEWLASRDIIVATSEKVDSLIRNDAPWINQLGCVVADEVHLVNDRTRGPTLEVTL
FT                   GKLRQRNTALQVVALSATIGNADAIAEWLDASLVDTDWRPIELQIGVHYGNAITFDDAT
FT                   QQRVPVANGERQTPALVADTLAGDSEDDQGSTLVFVNSRRNAESAARRLCDVTTSALTE
FT                   KEQASLAEIAASIREVSDTETSETLATCVEKGAAFHHAGLAAEHRSLVEDAFRDRQLKC
FT                   IAATPTLAAGVNTPSRRVIVRDWRRYDSEYGGMKPLDTLEVHQMMGRAGRPGLDPYGEA
FT                   VLLAGDTETRDELFDRYIDADLESVRSKLASEPALRTHALATIATGFARSRTELLAFLK
FT                   ETLYATQTDTNGRLKTVTDTVLDYLKRNEFIMQDGETLSATGLGHTVSRLYLDPMSAAT
FT                   IIDGLRWAEKNKTTQRSALQDNSTEQATGSFQPASELVNSKHDTHQDSDESTVRYPTAL
FT                   GLYHLVCRTPDMYELYLKSGDKERFTQVCYEREAELLGRTPSEYDDVRFESWLSALKTG
FT                   RLLEDWADETSEDQITEQYDVGPGDIRGKVDTASWLLGAAEQLAGELGMKTKPIADARR
FT                   RVEDGVRAELLDLVDIRGVGRKRARRLFDTGIQDSADLQTAEKKTILRALRGRRKTAER
FT                   ILENAGRTDTSMDSVDEVPNDSTNSDTGNETQSNTGGGATTEGTRQGRDIDNQDGNQAG
FT                   LGDFS"
FT   CDS_pept        complement(12683..12949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1009A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1009A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51139"
FT                   /db_xref="GOA:Q18DI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DI3"
FT                   /protein_id="CAJ51139.1"
FT                   /translation="MAAIIRLIMSDDTSQQSTLRTDGGISSIEIGFPAIAFGLHAILAL
FT                   ALIPFAWDALQAGNFPLVGSLALLSTLILILGAMIRRVAKRRF"
FT   CDS_pept        13384..13581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1010A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1010A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51140"
FT                   /db_xref="GOA:Q18DI2"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DI2"
FT                   /protein_id="CAJ51140.1"
FT                   /translation="MASIDPRDKLPLVSAAVVMALGNIIGYAVGTTIYLTILAGPVAVL
FT                   AFGAVRYFLHGSPYPESMRQ"
FT   CDS_pept        13585..15894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bac"
FT                   /gene_synonym="cdc48d"
FT                   /locus_tag="HQ_1011A"
FT                   /product="bacterioopsin-associated chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1011A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51141"
FT                   /db_xref="GOA:Q18DI1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DI1"
FT                   /protein_id="CAJ51141.1"
FT                   /translation="MKRVAATVTIDPELPPDTVRLRWPPIDATTHTYDIADSTTNDSAS
FT                   PLDADVVQLRTSNGRMTAAVVRPDSMIDPDTIAVSSNLAAALDISADVKNTSETDTGRT
FT                   VDSDQNAQTDHVATVEPASASPAHQLTVAPVAELSISGGEQTVRQALDTRPLVRGDTIP
FT                   TIFLDGSLELPVRVTETRPDGPVAITAKTELKLESGPAPDLTLPQQAPIPPSGVGGYNE
FT                   IIETCQHTIADPLIYSDAYHVDDRSAASGVLLEGQSGVGKTHLIRHTAWYADATIRTID
FT                   CATLASQSPSDLTDELDSHTAAITTGNATSTIVLIDNLDIIGEDNDTVARQISSWIEKT
FT                   LQLDSATVVAECTDADAIDSIFTRGGRLSRIISVTAPTPDDRAAIISVLFNDIPTTSHI
FT                   DYTAVAEQTLGYVAADILNLRARAIEAALTRCNVDSTEEMAETEFRVLPADIETAITKT
FT                   TPSAAETTGSVPSTSFEDIGGLAAPKRELTRAVEWPLQYPEALSRLGVDAPAGVLLYGP
FT                   PGTGKTMLARAVASTTDANFLTVDGPELLNKYVGESERRVRQLFTRARDSAPAVVFFDE
FT                   VDALGSARAGDGDSSATERVVSQLLTELDGLHPREQVTVIGATNRPDRIDDALTRPGRF
FT                   DRVVEVPLPDPEARQEIIRIHTRDRPTEPLDIDEIATKTEGYSGSDISAVLQEASLLAL
FT                   EEHLGAAESEIIDETRTIEPNSGQSTSSSATPEAIESIEAVRIHRRHVDAALDRIGPSL
FT                   SATARERYASFDGTGS"
FT   mobile_element  15973..17476
FT                   /mobile_element_type="transposon:ISHwa24"
FT                   /locus_tag="HQ_ISHwa24A"
FT   CDS_pept        16126..17406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1012A"
FT                   /product="IS1341-type transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1012A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51142"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DI0"
FT                   /protein_id="CAJ51142.1"
FT                   /translation="MAKQVVTRTYIASIRNQSQVQDDLDSLGFAASKLWNVGRWTCSRI
FT                   WDEIDHIPNHNELTTYLKTHERYDDLHSQSSQRVLQELAEAFNGWYGKRRNGDTNANPP
FT                   GYRKHGDDHPRSTVTFKAAGFKLDTQYYRVRLSKGSNLKDYWSDFILCEYQTRPDVDLS
FT                   TVENVQQVRIVWTGTEWELHFVCKVQIDVAEAPSENTVGVDLGINNFAALAYEDGHGEL
FT                   YPLNCLKQDDYYFSKRIARCDDSNSEQATRLNHKKSARRTHYFHTLSKHIVERCVEEGV
FT                   GTIVVGDLSGIREDDDTNKSKNWGKHGNLDLHSWAFDRFTDLLEYKAEMEGITVEEASE
FT                   EDTSKSCSCCGRKRDANRVERGLYVCDDCGTVANADVNGAENIRQKVSLSSLNLSVNRS
FT                   NGWLAQPSTFLFDKETGAFAPEERVRS"
FT   CDS_pept        complement(17473..17724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bap"
FT                   /locus_tag="HQ_1013A"
FT                   /product="bacterioopsin-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1013A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51143"
FT                   /db_xref="GOA:Q18DH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DH9"
FT                   /protein_id="CAJ51143.1"
FT                   /translation="MTMNQNDGEKEPLAPESLNQQALIGLILSVIIGVGGLFALPAIQV
FT                   LFQLQFFPAFTIVLMIELIATAGVVISMFRLHQQQHFG"
FT   CDS_pept        complement(18032..18796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bop1"
FT                   /locus_tag="HQ_1014A"
FT                   /product="bacteriorhodopsin I"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1014A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51144"
FT                   /db_xref="GOA:Q18DH8"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="InterPro:IPR018229"
FT                   /db_xref="PDB:4QI1"
FT                   /db_xref="PDB:4QID"
FT                   /db_xref="PDB:5ITC"
FT                   /db_xref="PDB:5ITE"
FT                   /db_xref="PDB:5KKH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DH8"
FT                   /protein_id="CAJ51144.1"
FT                   /translation="MSQLALQMSSLGVEGEGIWLALGTIGMLLGMLYFIADGLDVQDPR
FT                   QKEFYVITILIPAIAAASYLSMFFGFGLTEVSLANGRVVDVYWARYADWLFTTPLLLLD
FT                   IGLLAGASQRDIGALVGIDAFMIVTGLVATLTKVVVARYAFWTISTISMVFLLYYLVAV
FT                   FGEAVSDADEDTRSTFNALRNIILVTWAIYPVAWLVGTEGLALTGLYGETLLFMVLDLV
FT                   AKVGFGFILLRSRAIMGGGSEPTPSAQETAAD"
FT   CDS_pept        19008..19364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1015A"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1015A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51145"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DH7"
FT                   /protein_id="CAJ51145.1"
FT                   /translation="MSGDETTEVESEDETTRTDTTVKTETETETETEPETTLDIEAAAE
FT                   QEASIEALQNTVEEQGDRIEELEDLVLDLSARVASGDATGVCPDCHGPVIKSNPFFRSA
FT                   KIKCSDCGRVFHEY"
FT   CDS_pept        19917..20159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fer6"
FT                   /locus_tag="HQ_1016A"
FT                   /product="ferredoxin (4Fe-4S)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1016A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51146"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DH6"
FT                   /protein_id="CAJ51146.1"
FT                   /translation="MRIRYNRETCIGMFQCVNEWDSFEENIDAGKAELAKADEVEDGIF
FT                   EREVPEDVEFEAKFAARVCPVDAIEVYDDDGEQIV"
FT   CDS_pept        complement(20392..21132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bop2"
FT                   /locus_tag="HQ_1017A"
FT                   /product="bacteriorhodopsin II"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1017A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51147"
FT                   /db_xref="GOA:Q18DH5"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="InterPro:IPR018229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DH5"
FT                   /protein_id="CAJ51147.1"
FT                   /translation="MATPGSEATWLWIGTIGMVLGTVYFAVRGRGSTDPEQQTYYIITT
FT                   LIPAIAAAAYLAMATGLGVISMPIRGTEVIDIYWARYADWLLTTPLLIIDLALVAGARK
FT                   QTLYKLIIIDAIMILGGLAGSMMQQGAVIRIVWWAVSTAAFIILLYYLLGELSERARSR
FT                   SAETGIVFNRLRNITLGLWALYPIVWILGTGGGFGIIAVTTEIMLYVMLDIGTKIGFGA
FT                   VLLESQDVLQAASHPSSTNDIKSH"
FT   CDS_pept        21920..22678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtY"
FT                   /locus_tag="HQ_1018A"
FT                   /product="lycopene beta-cyclase"
FT                   /EC_number="5.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1018A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51148"
FT                   /db_xref="GOA:Q18DH4"
FT                   /db_xref="InterPro:IPR017825"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DH4"
FT                   /protein_id="CAJ51148.1"
FT                   /translation="MSGLSYAGFHVLFTLPPLAYLFVFGTTPTRRVARVGIILMTVVAV
FT                   IYTTPWDNYLIQRGVWWYGPGDIFARIWKAPVGEYLFFILQPILTGLWVTTLTPDATYR
FT                   NGDFDRRPRTLGALVWLGFGIIGTVLLTVESGFYLGAILAWACPVVALQWAVGGGYLTR
FT                   RWREWSLAIAIPTVYLWMIDSIAIALGVWTISDQYSTGINLLGLPIEEAVFFLITNILI
FT                   VYGLILFEWIIDYWYHHPDAIGPEVSREWL"
FT   CDS_pept        22669..23706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blh"
FT                   /locus_tag="HQ_1019A"
FT                   /product="beta-carotene 15,15'-dioxygenase Blh"
FT                   /EC_number="1.13.11.63"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1019A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51149"
FT                   /db_xref="GOA:Q18DH3"
FT                   /db_xref="InterPro:IPR022270"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DH3"
FT                   /protein_id="CAJ51149.1"
FT                   /translation="MAVSESLSDTTRQVLGRSVFIPAWLILIGCILLAPLVESLSPRLR
FT                   YLPFALSLLIFGLPHGAVDHLTPARTVNTPVTVRSMLSVGGLYLSIGGVYLGWWFFAPT
FT                   SAAIMFVFITLLHWGQGDLYAILSFLDADHLPTRFERALSIVTRGAMPMLIPLIAHPMS
FT                   YQRVLIGFIELFSVNTISIGFLFSSPIRNVVTAVIIGLTIMTIAAGAWRVYTGASARPY
FT                   LIDAGEIGLLWAFFIALPPIFAVGVYFCIWHSLRHIARLAIIDHPSRQALDSAHIRPAV
FT                   WRFVRDAAPLTAAALLFFASLYILVPRQPNNIESLAAFYLVGIAALTAPHVVIVSWMDR
FT                   MQAVW"
FT   CDS_pept        23883..26438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hef"
FT                   /locus_tag="HQ_1020A"
FT                   /product="ATP-dependent RNA helicase/nuclease Hef"
FT                   /EC_number="3.6.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1020A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51150"
FT                   /db_xref="GOA:Q18DH2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="InterPro:IPR041755"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DH2"
FT                   /protein_id="CAJ51150.1"
FT                   /translation="MAATDDSAYVDHPLLVSSFIEQRLYQIQLAGTARKTDTLVCLPTG
FT                   LGKTTVSLLVTATRLNSIGGTALFLAPTKPLVRQHIEFYRNALTIPDEDIVVFTGEVSP
FT                   DDRAALWDDAQVVIATPQVIENDLIGNRISLNSVTHLTFDECHRATGEYAYVYIAERYH
FT                   DDATNPRVTGMSASPGSDKEGIVTVCNNIGVSAVEVMTEDDADVAEYTYTTDVEWKHIE
FT                   LPDEIIQIRDALNDVIRDRLQQLKSLGVADTTQPDVSQKQLNQMRGKLQKLIDADNSDG
FT                   YAGMSTHAEVMKLRRAVELVETQSVESVRRYFERQRNAAQSSGASKASQRLIAEPKVRQ
FT                   SMQLAESFDGTHPKFSRTRILLAQTLGIEGGERVIIFTESRDTAEALTEFLSASFDVQR
FT                   FVGQNDTGRSEGMTQREQQKALTAFRSGEFEVLISTSVAEEGLDVPEVDLVLFFEPVPT
FT                   AIRSIQRKGRTGRQTEGRVVVLLAEDTRDEAYFWISRRRQKKMESELRSLKQSVDDIES
FT                   SIISPQEELTTYNHDSSTETDAKASDEDTDVETDSDSDSDSDSDSNISKQKIADSAKDS
FT                   QSGITDFAPSDSELSNTETETEAQSAETASEEVYSTDIETNTAVSESPPTPDVDISEDT
FT                   IEIVVDQRELDSTVPRSLSTRDAIQTRLETLAVGDYVLSDRVAVERKSATDFLDTLLDG
FT                   NRSLFEQTGDLVRAYGRPVLILEGELTTLYTERNIDPSAIQGALASLAVDFDISILQTR
FT                   DDSDTADMLETIATREQTSRDRSISVHGEKSAKTLQEQQEYVVSSIADIGPVTAQSLLD
FT                   AFGTVEAVMTAGEDDLTAVDGVGAVTAARIRDVVGSNYS"
FT   CDS_pept        26523..27560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pibD"
FT                   /gene_synonym="flaK"
FT                   /locus_tag="HQ_1021A"
FT                   /product="prepilin/preflagellin peptidase"
FT                   /EC_number="3.4.23.52"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1021A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51151"
FT                   /db_xref="GOA:Q18DH1"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR009655"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DH1"
FT                   /protein_id="CAJ51151.1"
FT                   /translation="MIASISDLLRLCIMPILVWAAWRDVKTRRLPSYLWPPLVMLGVVL
FT                   LVWDTSVYFSGLSPIYTPIAIAFLFRVSVSCLIIIPLSYGLWAIGGFGGADAKVLMTLA
FT                   ILIPTVPIYQFLGMTFPVVTAPLGVFSLTILTNTVVLTAAYPINLILHNITDRVWEFPA
FT                   ALFARPVSIDDLNTEHGQLAETSDRITRNGIDLDALRMYLRWRGTTLSAIRESPTTHRN
FT                   PASIIQTYAPTDGAVSITPDRSSVERTSAKSHTDMRSSNLTDFDSVDATDVWGADRFLE
FT                   AVNHRAYGSSPTQLRDTLTLLSAPDRQTVWVSPGIPFLVPICLGTVIAFTYGDILFGLV
FT                   ISLYM"
FT   mobile_element  complement(27616..27723)
FT                   /mobile_element_type="insertion sequence:HqIRS42"
FT                   /locus_tag="HQ_HqIRS42AA"
FT   mobile_element  27969..28359
FT                   /mobile_element_type="insertion sequence:HqIRS46"
FT                   /locus_tag="HQ_HqIRS46A"
FT   CDS_pept        28538..28936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="HQ_1022A"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1022A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51152"
FT                   /db_xref="GOA:Q18DH0"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DH0"
FT                   /protein_id="CAJ51152.1"
FT                   /translation="MTDDAVTGSQDDAEIEIRFNSDGLVPAIAQDADSGEVLMLAYVSP
FT                   TALKRTRETGQAHYYSRSREELWKKGETSGHTQHIREIRADCDADTILYLVEQTGGACH
FT                   TGHQSCFYRTLDGTEVTERVFDPETVYE"
FT   CDS_pept        28951..30129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1023A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1023A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51153"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DG9"
FT                   /protein_id="CAJ51153.1"
FT                   /translation="MPIADLDNDASDTVIGLLETTESVLAELQDAAEQYESITTQISDT
FT                   GHDAVVETADAYRRATGLLDRYIDSATGTGDFQAYVEFQDKFLSCVEELPDELPARGAF
FT                   ETAADRLDSRRLSKSDFASAREDLAPAKRYIEQLESYNQTVEAVKTARRNVTLHRRKLT
FT                   DAIDAHDEALSFADVNLDAPVEQLLDPIETYNDRLHSEFDEFITTESTATVIDFLEYAD
FT                   SFSLVPFQSPPPDLRRFARESPDSDEPIPTLLKFASYSGSKLDHYATDPALLQTTVAVH
FT                   QTFLERLDAEPLMIERPPPTAGTLRQFTGEAISILGRFASEKTIARLRALRDQSYDDSY
FT                   AQLRTALRAQIELSADERERLQTGTMADERDALVTARTRLTEALTQTQSQVE"
FT   CDS_pept        complement(30255..31634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmm1"
FT                   /locus_tag="HQ_1024A"
FT                   /product="phosphohexomutase (phosphoglucomutase /
FT                   phosphomannomutase)"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1024A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51154"
FT                   /db_xref="GOA:Q18DG8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DG8"
FT                   /protein_id="CAJ51154.1"
FT                   /translation="MKLFGSSGTRGVVGEGITPELVLQVAKAAGTVWEANQAIIARDTR
FT                   TSSQSFVNAAVSGLTSVGIDVIRLGVTPTPSVVHYAGETDRPGIVITASHNPPEYNGVK
FT                   LIGETGVEIGVEGLERIEACVLNEDFTPASWDNIGSITRTETVNTEYVDKLLTALEQDG
FT                   SREAIADANLTVAIDPGHGAGCLTSPQFFRKLGCDVVTVNATPDGHFPGRPSEPIASNL
FT                   TALRSLVTASNADIGIAHDGDADRAVFIDEQGKQIAGEASLAALAAAELDSNSATVAAV
FT                   NVSQRLVDVCNRVGATLELTPIGSTNIITRIQELQKSGVSVPVAGEGNGGIFFPKFRLV
FT                   RDGAYIGAKFLRLICEQPASSIIEPYTKYANARINIEHGSEKELEALMRGAEEFAEEAD
FT                   VTPNIIDGYRLDYDDAWVLIRPSGTEPVVRVYAEAKEQTQAQTLADDAAGKLYDATDDI
FT                   G"
FT   CDS_pept        31872..32609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="HQ_1025A"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1025A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51155"
FT                   /db_xref="GOA:Q18DL2"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DL2"
FT                   /protein_id="CAJ51155.1"
FT                   /translation="MSTLFESFEVIPAVDMQDGDVVQLVQGERGTETRYGDPVVAAKQW
FT                   VEAGAKTLHLVDLDGAFEGDRMNATAVDAIIDAVDIPVQLGGGIRTANDAASLLDRGVN
FT                   RVILGTAAVENPDLVAELAESYPGRIIVSLDAADGEVVVSGWTESTGIDPAVAAARFAD
FT                   YGACGILFTDVDVEGKLAGIQSSVTARVIDAVDIPVIASGGVASLDDIQTLHTTGAAAT
FT                   VVGTALYENKFTLADAMEVCESD"
FT   mobile_element  complement(32662..32921)
FT                   /mobile_element_type="insertion sequence:HqIRS35"
FT                   /locus_tag="HQ_HqIRS35AA"
FT   CDS_pept        33047..33673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="HQ_1026A"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1026A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51156"
FT                   /db_xref="GOA:Q18DL1"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DL1"
FT                   /protein_id="CAJ51156.1"
FT                   /translation="MTEDTETSSTGAGADDRTAAISRETAETTINVTLAVDGDGEATVD
FT                   TGIGFFDHMLETFAKHGLFDLTVRCDGDLDIDDHHTVEDVGIVLGKSFNNALGEKRGIV
FT                   RYADRSVPLDEAVATVIADISGRPHFEFSGSFSQPQIGGFTSDMARHFAYSFTMHSEIT
FT                   LHASIEGINAHHEVEALFKSLARTLDEATQLDPRRGDTPSTKGEL"
FT   CDS_pept        33877..34380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1027A"
FT                   /product="ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1027A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51157"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR014424"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DL0"
FT                   /protein_id="CAJ51157.1"
FT                   /translation="MFDEIMQKFEESPSQQAVIRLLLQRGFSVNDEGRVVSGGIEIPNT
FT                   GIAREIDVDRRVVDSTTTAILDDDELRRIFQNISSIPSLMDLAPVLNLSALIVEVNNAD
FT                   QPGLVAAIATRLADRNISIRQTISEDPEFTDDPKLYIVTDDPIPGELVNELTELSFVYR
FT                   ISLA"
FT   mobile_element  34382..34883
FT                   /mobile_element_type="transposon:HqIRS87"
FT                   /locus_tag="HQ_HqIRS87A"
FT   CDS_pept        34530..34883
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1027C"
FT                   /note="gene truncated at the C-terminus"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT   CDS_pept        34897..35577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1028A"
FT                   /product="IMPACT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1028A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51158"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DK9"
FT                   /protein_id="CAJ51158.1"
FT                   /translation="MTDPSPSSTNDGTQSFRTVQTRGSVSFSIRGSEFIGVVAPVKTVA
FT                   EAENFINMIQEEYTDATHVVPAYRVPDRTNTTTIKIDTESAIGSFLREYQSDDGEPAGS
FT                   AGKPALNVLVQEELRNVVTTVIRYYGGTNLGIGRLTRAYSRAVSDAIQGADVVEEEPHE
FT                   YITITVEYDDSGTVRRLLRSADIEFEASYDTVVTFSVNVPTNKTATLCDQIQSATSGRA
FT                   TIDT"
FT   mobile_element  complement(35781..35929)
FT                   /mobile_element_type="insertion sequence:HqIRS58"
FT                   /locus_tag="HQ_HqIRS58A"
FT   CDS_pept        complement(36040..36720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="HQ_1029A"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1029A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51159"
FT                   /db_xref="GOA:Q18DK8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DK8"
FT                   /protein_id="CAJ51159.1"
FT                   /translation="MPIEDRDNAYLITHALAKDTLSQLRDIETEQVAFRKGLVKLGRIC
FT                   GYEIIDGAMETEYAHVQTPLTETTGEQVSGLDNIVIVNVLRAATPFVEGLLKAFPRAKQ
FT                   GVISAGRDEAAGMNQDGMFPITIDYVKLPEITANDTVVVADPMLATGSTMCAVLDHVND
FT                   AAKSKPKNLFVLSAVSAPEGLLHVGSEFSSADLLTVAIDDYLDDEGYIVPGLGDAGDRA
FT                   FRTV"
FT   CDS_pept        complement(36859..37041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1030A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1030A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51160"
FT                   /db_xref="GOA:Q18DK7"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DK7"
FT                   /protein_id="CAJ51160.1"
FT                   /translation="METRSDGDPRVLFAMNIILSAVFGTGIIWGLSFIEIATFSPINVV
FT                   TLTLIIAAVTYAIVM"
FT   CDS_pept        37194..37541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1031A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1031A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51161"
FT                   /db_xref="GOA:Q18DK6"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DK6"
FT                   /protein_id="CAJ51161.1"
FT                   /translation="MKKSYYEYLITNRHGETVDPVPFIVITGSTWLLCLSFGPLYLDLF
FT                   GIPWTQGLLTCAILAVVASSWAYRRFVWTVDPAVQDSLPAGIRFHRLCLGGVIFGTILI
FT                   ILAFIAAVMIA"
FT   CDS_pept        37712..37930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1032A"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1032A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51162"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DK5"
FT                   /protein_id="CAJ51162.1"
FT                   /translation="MGLISTLVDTFEASTESPNRGTDNSSRGAYWCHDCNERIPASDID
FT                   EMKTPNCPECDNEMTLERSPSSTGCAC"
FT   CDS_pept        complement(37976..39295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="HQ_1033A"
FT                   /product="CobW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1033A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51163"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DK4"
FT                   /protein_id="CAJ51163.1"
FT                   /translation="MSDTSIETPVTILTGSLGAGKTTLLNRLLTKSDDRSIAVLVNDMG
FT                   ELNVDANLIAEQSALTETDDAIAELSNGCICCELRDDLERAVVQLAGEYSFDHLIVEPS
FT                   GISEPAPVARLFTGGSSAAARYQIDAIVAVVDAYQFSDIVDEGNASDDEVLKNTSNDDV
FT                   DNNQRPLSSLLVEQVEFADVVIINKTDLVDNEQQTNVNEIIETLRPDAKILTTTYSEVD
FT                   PAIILGINRFDPATAAERAGWKQILNTTHDEQIKQSVQDTHSQNHASRDNHDHEHDHSH
FT                   THPADRYGISSFSYERRRPFHPSRIATVLSNLPAAVVRSKGHLWVAGRETAQLTFSQAG
FT                   PSAIISVTGRWIASLPEFEQDAYRNNRSELEFEWDEEWGDRRTGLVFIGYDIDTEALIA
FT                   QLDDAIVTDTEFEKNNSLCGLEQFPTDPDGELTLTGPTMQ"
FT   CDS_pept        39445..39741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1034A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1034A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51164"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DK3"
FT                   /protein_id="CAJ51164.1"
FT                   /translation="MSLSTTIERYRAELRHWLRGLYHGLITHPAYEKVEKEAEDTEDTF
FT                   MLACFPEAFGIPSPVSYYTAELLPYLEDEFDAWERRMWNRGSLLERKGQQYHF"
FT   CDS_pept        39750..40733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA1"
FT                   /locus_tag="HQ_1035A"
FT                   /product="ArsA family ATPase"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1035A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51165"
FT                   /db_xref="GOA:Q18DK2"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DK2"
FT                   /protein_id="CAJ51165.1"
FT                   /translation="MRTHVFFGGKGGVGKTTVSSAYALKCARTGIDTLIVSTDPAHSIS
FT                   DVFDQNFTDEPAAVERVDNLDAMEIDPEAETERHLMETKRALSDQVSPAMVNEVDRQIE
FT                   MAHQTPGAYEAALMDRFIDVMRNSDEYDRIVFDTSPTGGTLRLLSLPDMLEGWIDRLVY
FT                   KREQSIDLYERAAIGNEEPRRIMDGDPILDRLTTRKERFEFAGETLRTNAAFFLVANPD
FT                   ELSIRETQRAIDELQSYDLEVRGLAVNRLTPEPDPNENGRGARFLRDRVATERERLNEL
FT                   HENIDPPVVAEIQTRVSEVKGTILDTVAEELSIDVDQVSPDTVSSG"
FT   CDS_pept        40822..42627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="HQ_1036A"
FT                   /product="carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1036A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51166"
FT                   /db_xref="GOA:Q18DK1"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DK1"
FT                   /protein_id="CAJ51166.1"
FT                   /translation="MVQIIWLVVAVMALFTVGYLGYSKYLSQFVDLDDSRETPAHKYED
FT                   GQEYVPSAKPVLLGHHYSSIAGGAPIVGPITAGVLWGWVPALAWIAIGNPLMGSVHDFV
FT                   SLSASLRHEGKSIGYIVGEYVGERGKNMLLWFAFLTIILVVAVFALVVAIVFNAYPQAA
FT                   TASLIYIGLAVLLGAWLYQFDLPFIAGTAIFVSLMFVGVWVGIQYPLALVPGDYPAQTI
FT                   VLLGSQPSWLPAAGAFGANTAAWIPIVLIYGAIASALPVWTLLQPRDYLSSFLLYTGVG
FT                   GALLAVIVGTVLGTANQPLTTNLAPFYGFIGQNGAPLFPLLFITIACGTISGFHSLVSS
FT                   GTTAKQISRESDARAIGYGGMLGEGLLATVALVTVALVAPDVGGGIGLALPTFATGGGI
FT                   LLTSFGIPTSFGAPFMALVLVSFLLTSTDTAVRLGRYMMEEIIGTPESSVQSFAADRYG
FT                   NAAVQTIPAYVLIASGSWATLWQLFGGANQLLAALALLTATVWLANWDESKQLLSTGGP
FT                   MAVMVGITVSGLLWLAFYSNIYTKFLNDAWMAEATIVQILSAVAQISLAFVLIYLGLSL
FT                   VRMGYENVQNIREGDGTGAFSLSDD"
FT   CDS_pept        complement(42966..43628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1037A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1037A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51167"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DK0"
FT                   /protein_id="CAJ51167.1"
FT                   /translation="MTTDTDRTMNTESDTDRVDPVAAAEEADIDLSGVPEWDDTYLDRV
FT                   SDRLLFNYDLTQNKQVNGETFNMYAEMRLESHKHFFHPALDYANHETHEHVFVTQIDRP
FT                   HVETVERFITLGHDLSDDSTWLDPDEEHFGTEFTFVVIAETVPESVESFVSSFRDRNLL
FT                   KFGYYGHYEIHLIVVAPDRQEAVASEQADTIQAFTLWQDVTDEQSGLISRIRGMLNF"
FT   CDS_pept        complement(43833..44216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1038A"
FT                   /product="cupin 2 barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1038A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51168"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DJ9"
FT                   /protein_id="CAJ51168.1"
FT                   /translation="MGYQVVDPETVTPVDGRPCELRRLSAATELSNIAINKFRAGPGDQ
FT                   LPLAYHYHESQQEAFYILHGTLSVETLTQIITVETGELLTVDTESPQRAYNSRDAEEDV
FT                   VALAVGAPAVDDDVVAYDPETEN"
FT   CDS_pept        44335..44559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1039A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1039A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51169"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DJ8"
FT                   /protein_id="CAJ51169.1"
FT                   /translation="MKTDDNTESCGRCSMSAVVDASIDTTDHNSPFGDNRIEVDDETLR
FT                   KVSPGAWLSTLTTKLDSFAWRFLDNRDTK"
FT   CDS_pept        44645..45334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1040A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1040A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51170"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DJ7"
FT                   /protein_id="CAJ51170.1"
FT                   /translation="MQESVSGFEVRGTWGDVVEHGERITRALRDADIDGEAFDEWNEWR
FT                   PKSHERLGEDVSQKTAAQASVSEGKGERAGKAPDEDLQTAGEMLSDSYDHVEAGESDSA
FT                   VERWSDSLGYVARAADSAGRRALRRVEDTVYQRVMTQLAPYYFDNTLISANIQKTTRGD
FT                   AAVAFIFEVNINDDELKTAVSNRLTDYDDEVTRWHVDTKKQTETAEAAEGVEPPTSTTN
FT                   PPKSTNN"
FT   CDS_pept        45461..45844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1041A"
FT                   /product="TrmB family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1041A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51171"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DJ6"
FT                   /protein_id="CAJ51171.1"
FT                   /translation="MSNAPAMSDLLDTDEPGFQQVLACVFGIQQHESRTYLVLLDHPES
FT                   TVAELSDVLERDRSNVNRSLTTLLDKGLAERQRRLLDPGGYVYQYTATELPEAKSLLHD
FT                   ALDQWVEHVHQSIEDYGDEHSTS"
FT   CDS_pept        46022..47287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC1"
FT                   /locus_tag="HQ_1042A"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1042A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51172"
FT                   /db_xref="GOA:Q18DJ5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DJ5"
FT                   /protein_id="CAJ51172.1"
FT                   /translation="MSLELSAAAPAIPPEATDGVWLADIETGETYAPFEEIRYTSDEDN
FT                   LLEVRYADLPTFEDFQGQGRGVWRYHAALPFENGVSLPEGDTPLHRAPSIRDAAGVRSL
FT                   RIKHEGMNPTGSFKDRGMTVGVRVAKELGVGRLACASTGNTSAALAAYGARGGMQTLVL
FT                   LPAGKVAAGKIAQAALHDARILEVDGNFDDCLDIVQDLARRGEVYLLNSLNPFRLEGQK
FT                   TIGLEILERFYEEYGRFPDRIILPVGNAGNTSALYKAFRELVQSGALRPSEVPKLTGVQ
FT                   AAGAAPMVEAVEHGWSDIERWDDVETRATAIRIGNPVNAPKALPGIRETGGTAIAVTDD
FT                   EITVAQRDLAREGIGVEPASAASVAGLKKLRGRSRIDSDEDVVCLTTGHLLKDPDEAFK
FT                   AGGNPEPVGGDTDAVLEHIGAN"
FT   CDS_pept        complement(47602..49200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA1"
FT                   /locus_tag="HQ_1043A"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1043A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51173"
FT                   /db_xref="GOA:Q18DJ4"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DJ4"
FT                   /protein_id="CAJ51173.2"
FT                   /translation="MQVLVTDPIDDAGLERLRAAGHGVETAYDIGDEALLNTITDVNAL
FT                   VVRSGTDVNEAVFEAASDLIIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRAAAEHT
FT                   VAMTFAGARSIPQAHARLRTGEWAKSEYLGTEVNGKTLGVVGLGRVGQEVAKRLESLGM
FT                   DLVAYDPYISEDRAERLGAELVEFDTCLERAEFLTVHTPLTSETAGMISTTELELMDGG
FT                   YLINCARGGVVDEDALAAAVEDGVLDGAAVDVFADEPVAPDSALLSVDNIVVTPHLGAS
FT                   TEAAQENVATSIADQIDAAFAGAPVMNALNAPSVDESVFPRIRPYIDLAETAGKIAAQL
FT                   LDGRISSVSVSYEGDIADEDVELATASALKGVFEPLEWQVNAVNAPQIAEERGIDVTES
FT                   KRLQSDDFQSLVTVEVSNGDDQLAVSGTQFTGGEPRIVKIDGYRVDAVPHGKMLVARNA
FT                   DKPGVIGFIGSVLGEHNINIAGMFNARRDIEGGEALTIYNLDDSVPTDVVERLLADERM
FT                   IDVRYLTLNGASDTK"
FT   CDS_pept        49394..50029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="HQ_1044A"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1044A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51174"
FT                   /db_xref="GOA:Q18DJ3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DJ3"
FT                   /protein_id="CAJ51174.1"
FT                   /translation="MRLIAFDFDGTLSDSEMTVLLGGRCGVADEMESITDRAMNDELSY
FT                   AQSLRRRAALLEGLDDEEAYKAFNAVQLRPSAGMVIDRLRDAGHHVAIFTGGFERGVEQ
FT                   ALDKTNTTVDTIVANRLPTSDGELTGTVDGPLIEGTKNDTLLSLATDCDVSPDRTVAIG
FT                   DGANDLPMLEVAGLAVGFTPKDAVRPACDVVVASMDQLMHVFEEHNII"
FT   CDS_pept        complement(50610..51362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA1"
FT                   /locus_tag="HQ_1045A"
FT                   /product="homolog to DNA topoisomerase 1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1045A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51175"
FT                   /db_xref="GOA:Q18DJ2"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DJ2"
FT                   /protein_id="CAJ51175.1"
FT                   /translation="MDKTIRVFAGDCTTTFEGSDDQTQRGRVVVIIKPDQTVLVHDTDG
FT                   YQPVAWLTRSDSITVESDVGGFGITARAGEQVLRIIGHEVTGHAEYPVTEAGIPVGRHP
FT                   KSGESLIQTSNMITVINSDIKYPLPKGATVQDECCESCGLPMIEATAGERFSICLDREC
FT                   ESLDDAVRERFDDEWTCPDCGAPMQIIRRSGRLLAGCSGYPACETAFAIPTGVVVDVCS
FT                   CGLPIFETSRGQQCLDGTCELLNKTDEG"
FT   CDS_pept        complement(51462..53816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1046A"
FT                   /product="DEAD/DEAH box helicase"
FT                   /EC_number="3.6.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1046A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51176"
FT                   /db_xref="GOA:Q18DJ1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DJ1"
FT                   /protein_id="CAJ51176.1"
FT                   /translation="MKVADVVPEFADAFSFDEFNQMQQEAAPGILQTESNVVVAAPTAS
FT                   GKTALAELAICRALRHNGTALFIAPLRALTNEKESEWDRFESLGYSVYVVTGERELNTR
FT                   RAERADILVMTPEKTDSATRKHDSARYSFITDIDCCVIDEVHLLDSDRRGGVLEVTVSR
FT                   LRRLCDPRIVALSATMSNVDDVAGWLDASSETTFQFGEDYRPVELHTGIQLYTHGDNTF
FT                   ADKYRRLYRALDCAEEHLRDGGQALVFVSSRQDAVRAAGKARDEIAQRDIPMGARGEYE
FT                   FHTSAKELENDALSKAAPDGVGFHHAGLAKDDRDRVESWFKSGEIQLLFSTSTLAWGVN
FT                   LPARCVVIRDTKYHDPLEGEVDISPLDVLQMLGRAGRPSYDDVGYGWVVCDRSEAEKYR
FT                   RLLAEGKEIESRLAEDLDSHLNAEIAMGTIKDLDDVLTWLETTFYYRRAESNPDAYDFD
FT                   TLKERMRSTLESLVNRGFVEMDDDLSVSGTTLGRLTSKYYLRLSTAERFDSLCDRGTLT
FT                   ATGILETVAGAGEFHAVSARQSESDAIDKVLSDASISTELEDGSKKVLAILYAGMNGAT
FT                   PADLRSDAWIIRQNARRLLSALREFLDSFAGPRAANLARRVAARVEHGVSRDAVALTAI
FT                   DGIGATRANKLATGGLHSPADIIDAGVTELQRAGLAEGVAKQIVTNAREFPDIDVRWES
FT                   LPDEITRGANEICEVTIRNVGGSGYVGIRITVNNIEMTATETYLDNTTTVPVGVFGADT
FT                   ERLKFTIEITFPAEPLHPVRAQRAVSVVDNE"
FT   mobile_element  54236..54482
FT                   /mobile_element_type="transposon:HqIRS86"
FT                   /locus_tag="HQ_HqIRS86A"
FT   CDS_pept        54236..54415
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1046B"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT   CDS_pept        54631..55851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endA"
FT                   /locus_tag="HQ_1047A"
FT                   /product="tRNA-splicing endonuclease"
FT                   /EC_number="4.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1047A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51177"
FT                   /db_xref="GOA:Q18DJ0"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR006678"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR023516"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="InterPro:IPR036740"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DJ0"
FT                   /protein_id="CAJ51177.1"
FT                   /translation="MEGTLVDGTVQVGADAKQRFHDARGYGRMRDSTIVELAPVEAAHL
FT                   LARGDLETVIIDASSCAGETVSVDDINTTPHIGASDTSGPHSADDSSTYHVGFRGFLAY
FT                   TDAARQFAVYKDLRDRGFYLSPARSSWPGVDPAVGNQIDFIVYPRGMGPHDDEVAHQIR
FT                   VIGERETVSMSALGDVVLAVVDEDGELTYFETNSNSAFHEVISHDEDNTDSKDIDLSEI
FT                   NDNQTIQDQSSLPADLSADVIHDRVVCYDATDSLYDENFYGQRLFGRNADTGPIQFSLI
FT                   EAAYLAQQGVIAVDTATIVAIGRDVEGERFDRRLRVYAALRNHDTVPKSGFKFGADFRV
FT                   YRTFDGIDSLDHSTDLIRVCQTDMKIYPRDLSLDIRLAGGVRKRMVFALTPANGDIHWL
FT                   SVARLTL"
FT   CDS_pept        55848..57692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="HQ_1048A"
FT                   /product="tryptophan--tRNA ligase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1048A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51178"
FT                   /db_xref="GOA:Q18DM8"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020653"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DM8"
FT                   /protein_id="CAJ51178.1"
FT                   /translation="MTRDTEDDITNTGSETETETKTETETKTETDADIDIETKSGYAID
FT                   IGTDVDTHNDDIDVTALSTATAVSDGGAAGADDVALDPWGSSTVSDYQKLFTEFGIETF
FT                   DDVLPAVPNPHYLMRRGVIFGHRGYDPVAEALQNNDPVAVLSGFMPTGDPHIGHKLVFD
FT                   EIIWHQQRGADAYALIADLEAHAARGLSWSEIDDHARDYLLSLLALGFDPESGELYRQS
FT                   ENRELQDFAFELGSKANFSEFEGIYGFDSETNVAYMQSVITQMADILYPQLEEPKPTVI
FT                   PVGPDQDPHVRFARDLAARMRFFKVTKAYASFELTESERELVAAVYDERETYAEDVSRP
FT                   RCAEAATWLVDNLVTPVDNGSDDARNEDTDVSPDTLGIIVPDAVIESTIKKLENAGMEP
FT                   LRPRVRFLDANATDEAFEALITAIDGEKRRYDEHIDAFDLSAADATDLAREVETNNGGY
FT                   GFVAPSSIYHRFMTGLTGGKMSSSVPASHISLLDDPETGYEKVKSATTGGRETAEKQRE
FT                   LGGKADECPVYELYAYLLANDDDTLATQVYDECVSGDRLCGSCKEQAAKLMQAFLEEHQ
FT                   EKRKEVESLLEDADISLISDRRTVAPSDTADSTDNENT"
FT   CDS_pept        57894..59456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="HQ_1049A"
FT                   /product="phenylalanine--tRNA ligase alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1049A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51179"
FT                   /db_xref="GOA:Q18DM7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DM7"
FT                   /protein_id="CAJ51179.1"
FT                   /translation="MQLPDPQLTVLTTASATAETSIEQLADDAELNPTTATQAAFELRD
FT                   AGLVTITETETTFYELTDEGQRYLVDGLPEIRLYRAAIDTDTDSDTDSVPLGLIIQSAD
FT                   LDDSEVDIALANFARKSYGSINNGEITATTSIDPDNDPEATALAQINSIDADAGESENA
FT                   AGVDSKSIADIDDTVLEQLITRSLLTQQTDTTRAVSLTDAGVTALMEGVESAETIDRLT
FT                   PELLTSGEWRDAEFAEYNVEADAPDIQNGKTHVLRQTAERVRDVLVGMGFEEMDGPHAD
FT                   ADFWINDCLFMPQDHPARTHWDRFALDVPPIDDLPADLIETVESAHRDGVGSDGDGYHS
FT                   PWDEDFARAIALRGHTTSLSMRYLSGTEIGELEPPQRYFSVEKVYRNDTLDATHLLEFF
FT                   QIEGWVMAEDLSVRDLMGTFVEFYEQFGITDIQFKPHYNPYTEPSFELFGHHPKTGELI
FT                   EIGNSGMFRTEVLDPLGVECDVMAWGLALERLAMLTTGAEDIRDLHGTLADLEFLRNAE
FT                   VTY"
FT   CDS_pept        59456..61345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="HQ_1050A"
FT                   /product="phenylalanine--tRNA ligase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1050A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51180"
FT                   /db_xref="GOA:Q18DM6"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DM6"
FT                   /protein_id="CAJ51180.1"
FT                   /translation="MPIVDINMDELRSLTGHDEKSDTEFKSDLFELGLEFEGKTDTGLL
FT                   QFEFGPDRLDRLSVEGVARSLRYHYGDDRGIAVPSTNNPEFQFIVTDTVPTRRPYVTGA
FT                   IARGVSLDKHALDSLIQLQEKLHATMGRKRAKGAIGIHDLTMLKGRTLDDSGVDITGGN
FT                   EMVDTATDSRPTADRETDTSATDSPTHSITYTGIEPTGDTFVPLDSNRELTPAAVLDEH
FT                   PTGETYADIIADYDRYPAIYDELGLFSFPPVINGRRTEVTTDSRNLLIELTGTDQWTID
FT                   RMCTIICYALTARGATIESVNVEYPEQTFSRPDLTVDTKHISHDRIETILGVSFDTAEI
FT                   IDLFERAGLAATTTDTTDTAVTSNVDIDGSDNSPVYVVSIPPYRVDVLHPLDLIDDVGR
FT                   AYGFDKLEPRYPDIGTVGGRHERSRLEAVTRTTLTGLGFEDLLNFHLTNKAEVYNRMRT
FT                   SPLSPAAFNSTPDDIDLGSAPPAEITDPYSGDYTILRPWILPSLVQVLENNTHRTYPQD
FT                   LAEVGVVANRDDSVNTHVAERRHVAGAVARHDATYEDAKAALQAVCREFDATLQTPPTT
FT                   HPSFIDGRTAAIIINDTSVGVIGEIHPEVLVEHDLAVPVAAFEFELAALASEA"
FT   CDS_pept        61567..64359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="HQ_1051A"
FT                   /product="valine--tRNA ligase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1051A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51181"
FT                   /db_xref="GOA:Q18DM5"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DM5"
FT                   /protein_id="CAJ51181.1"
FT                   /translation="MPSGEYDPDAVETKWQDRWVDEETYTYASSIVSASDSEFDPHLAS
FT                   ESESSDEHTLDNSSDGAHVDIEADPDTAFSIDSPPPTVSGNLHWGHVYGFTLQDFVARF
FT                   KRMRGSDVFFPFGYDDNGIASERLAEDELNVRHQEYERREFQQMTQEVCQQYEAEFTEK
FT                   MQQLGISIDWNQTYQTISSDVKRTSQLSFIDLYEQGREYRKRAPTIWCPECETAISQVE
FT                   TEDDEQPSHFHDIAFELINKNNPRSEHRTDTFTISTTRPELLPACVAIFVHPDDDDNQD
FT                   LVGADARVPLFDQTVPIIADERVDMETGSGIVMCCTFGDQTDIEWYQAHDLDLRIAIDE
FT                   SGTMTDVAGSYSGLDSTEARESIVADLSESDALLDRREITHTVNVHERCGTNIEFLVKD
FT                   QWYVKLLDKTDEYLTAGREMEWYPEKMFTRYKNWIEGLQWDWAISRQRSSGIPFPVWYC
FT                   DACEHVVIAEKESLPVDPLSDNPPVESCPACNHDTFIPEDDVFDTWATSSLTPLINAGW
FT                   DWNDNTETIEFGDSGLYPFNLRPQGHDIISFWLFHTVVKCYEHTGEVPFDSVMINGMVL
FT                   DENREKMSKSKGNVIAPDEVITEYPVDAARYWAAGSAVGDDLPYSEKGIRAGEKLLRKL
FT                   WNASKLVEDLTTDAPDPETMSHADLEAIDRWLLARIDTEIDRLTEKFESREFSKARDGL
FT                   RSVFWHTFCDDYLEIAKHRIREGTTGDAAAAYTLTVAHRRFLKLFAPILAHASEELWHD
FT                   MYVSNSIDKTDDISSESIHRQSWPNPLGIDANVDAGEAAMSVVGALRKYKSNAQLPMNA
FT                   TLDRVLIWGDIDGFESDIADVMHIETLESVSERPSIESVVTGVDLEYSLVGPAFGNAVS
FT                   DIETAIESGEYEVVDDQLHTEGITLDPEMFDIQKRRQYTGDGEMLDLDTDDVIVIVQNN
FT                   "
FT   CDS_pept        complement(64522..65595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="HQ_1052A"
FT                   /product="dihydroorotate dehydrogenase (quinone)"
FT                   /EC_number="1.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1052A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51182"
FT                   /db_xref="GOA:Q18DM4"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DM4"
FT                   /protein_id="CAJ51182.1"
FT                   /translation="MVIKQLYRAFRPLLFALPPETAHRLVHTGLETVQQTPIEHGFSNQ
FT                   FRVDNDRLQVEEFGQSFDNPIGVAAGFDKNAELPAILGALGFGHVEVGGVTAVSQSGNM
FT                   RPRMFRLVEDEALINRMGLNNEGADVIGERLSSHRREIDHCGPVGVNIALSESTPTDEA
FT                   PADYQYTYEQIAEGADYVAVNVSCPNSEGMQDLQQRDSLSRIMDALTNAGAETVLVKLA
FT                   PELSLSAIEDVIDLVDIFDLDGIITTNTTTERPENLESTKQTERGGLSGAPIEDHATKL
FT                   VQLVAKRTDVPIIGVGGVSDAAGAYAKIRAGASLVQLYTGLVYQGPTLARDINMGLLQL
FT                   LEDDGFDSIESAIGADI"
FT   CDS_pept        complement(65685..65882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1053A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1053A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51183"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DM3"
FT                   /protein_id="CAJ51183.1"
FT                   /translation="MVRKKKLSPSGAKDEDGEYHNVHVNLHEDELTVAGMEIGDEVFVR
FT                   VRDEKIIIQKANPESVEHDF"
FT   CDS_pept        complement(66468..66794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1054A"
FT                   /product="nonhistone chromosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1054A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51184"
FT                   /db_xref="GOA:Q18DM2"
FT                   /db_xref="InterPro:IPR008674"
FT                   /db_xref="InterPro:IPR036620"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DM2"
FT                   /protein_id="CAJ51184.1"
FT                   /translation="MVREDGKRNFVMLEDGEKTRQFTGRMPRQAALKAARRLEGYDGYN
FT                   SESAAKDNPTKIRLLERGTDRIHVYHAWAWMDDAPSDKPEWMEGEISTVTKGNVSKQEI
FT                   EHLE"
FT   rRNA            67537..69008
FT                   /gene="rRNA16S1"
FT                   /locus_tag="HQ_RRNA16S1"
FT                   /product="16S ribosomal RNA"
FT   tRNA            69279..69350
FT                   /gene="tRNAAla1"
FT                   /locus_tag="HQ_TRNA02"
FT                   /product="tRNA-Ala"
FT                   /note="anticodon TGC"
FT   rRNA            69737..72662
FT                   /gene="rRNA23S1"
FT                   /locus_tag="HQ_RRNA23S1"
FT                   /product="23S ribosomal RNA"
FT   rRNA            73152..73271
FT                   /gene="rRNA5S1"
FT                   /locus_tag="HQ_RRNA5S1"
FT                   /product="5S ribosomal RNA"
FT   tRNA            73400..73475
FT                   /gene="tRNACys"
FT                   /locus_tag="HQ_TRNA03"
FT                   /product="tRNA-Cys"
FT                   /note="anticodon GCA"
FT   CDS_pept        complement(73639..73986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1055A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1055A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51185"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DM1"
FT                   /protein_id="CAJ51185.1"
FT                   /translation="MTETPYDDQPTTHDHDDNATPSVTMDAVEQALRSAFGGSPGERRV
FT                   VARQVRDLADAGIVEMDRNETLTVATVIDNLSDAPDDLSIAERWNWWLGALETAYGGYH
FT                   EFQVTAIPDAE"
FT   mobile_element  74079..75122
FT                   /mobile_element_type="transposon:HqIRS97"
FT                   /locus_tag="HQ_HqIRS97A"
FT   CDS_pept        74284..75040
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1056A"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene is interrupted (frameshift,in-frame stop) and
FT                   is truncated at the N-terminus"
FT   misc_RNA        complement(75161..75564)
FT                   /gene="RNAseP"
FT                   /locus_tag="HQ_RNASEP"
FT                   /product="RNase P RNA"
FT   CDS_pept        75661..76263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1057A"
FT                   /product="AMMECR1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1057A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51187"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DM0"
FT                   /protein_id="CAJ51187.1"
FT                   /translation="MPKAQAVSLSYDDGARAVELARESVESYVLHGQREQPGSMRDSFY
FT                   SRTGAFVRIRSTRGRGRLRGCAGSSRTSDQLGHAIVDAAIQAASSDSCGSEVEQPELSN
FT                   LVVSVCIVCEHVSTDTPVEDVELGTHGLVIDRNDKHEWMYPTIPVENDWNKQQFFTRAS
FT                   RKAGLSPLAWQDEATTVTLFEGQVFRERPDGGSVEEL"
FT   mobile_element  complement(76907..77167)
FT                   /mobile_element_type="insertion sequence:HqIRS35"
FT                   /locus_tag="HQ_HqIRS35AB"
FT   CDS_pept        complement(77290..78450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB1"
FT                   /locus_tag="HQ_1058A"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1058A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51188"
FT                   /db_xref="GOA:Q18DL9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DL9"
FT                   /protein_id="CAJ51188.1"
FT                   /translation="MDFDIIDTEAITSGTATDAYFERTETTLQHADRNPTITAEVTADQ
FT                   FPDGNFEMIAGVKNAVALLEGRNVDVNSLLPGRLFDGGPVFRIQGKYLDFARLETSILG
FT                   FLSHASGVATAAANARKAAPSSTVLSFGARHVHPTIAAMVERSALIAGVDGFSHMAAGD
FT                   VLDRTAGGTMPHALLICFGRGEQEQAWQAFDEAVPEAVPRIALCDTYSDEADEALRAAR
FT                   TLGDRLDGVRLDTTGSRRGDFQHIIREVQWTLDTHGYEDVDIFVSGGLNPNDLLNLRDV
FT                   ADGFGIGGYISNADPVDFALDIVAVDDEPVAKRGKLAGIKSVYRTSEGGHHIGLHNQPS
FT                   PDDSESLLNPVIRDGKVVDHIDFGIDAAVERATQDRNRCKYEINIE"
FT   CDS_pept        complement(78675..80267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1059A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1059A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51189"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DL8"
FT                   /protein_id="CAJ51189.1"
FT                   /translation="MSRRISRASIALSLLIVLAGCSGGGSLFNPNVGEDSSSTESATAE
FT                   GIGQENGTGPPVAVATPDSDFSDPAGDPLGWEAGYWYNESIEVDQADGLTDAEMKAYVG
FT                   RAMARVEYLRQLEFKSSVPVSVISRSEYRSQRDESTRSSENQEFQQWNNQVWEALFAVG
FT                   ESESTQQAIEETRGSSVAGFYDPRDDAITIVTDTPDTPTIENTTLIHELVHAVQDQQYD
FT                   LTKDRYAATTQDGQLATDGLIEGDARYVESAYGDRCGSSWECVELPDDTGEDSGSSGGP
FT                   SNLGIFVTIFQPYSDGVGYINHLRESGGWDAVNDRFKSPPVASEQVIHRTDETPQPISY
FT                   TDRSSAKWERFESVGQDGSDTVGEASIFVMFWNQARTVGAETVRPQTLTQPTNQYDAYN
FT                   YIADPSTGWENDRLFPYQTQNGVSTESESESESEYGYVWVTTWESNEDATEFRNAYRSI
FT                   LTARDATTPQRVESENTGSTAKTAKTTTYVIPDGSYADAFRVTQDGTQVTIVNGPNVTS
FT                   LDNIRAQSKPSSA"
FT   CDS_pept        80336..80917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB1"
FT                   /locus_tag="HQ_1060A"
FT                   /product="isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1060A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51190"
FT                   /db_xref="GOA:Q18DL7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DL7"
FT                   /protein_id="CAJ51190.1"
FT                   /translation="MADYSFDTDTTAIVVVDMQIGFCDPSGNMYAPGSEAVVDDVRTLV
FT                   TDAQDAGARVVYTRDVHPSGQFDDAHYYDEFERWGEHVREGDSETALVDGLEVRSQDHV
FT                   VIKHTYDAFYNTELDGWLRAHGIDDLIFCGTLANVCVLHTAGSAGLRDYRPVLIEDAIG
FT                   AIEPNHHEYALDHAEWLFGEVCSRADIKFV"
FT   CDS_pept        81197..82501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC1"
FT                   /locus_tag="HQ_1061A"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1061A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51191"
FT                   /db_xref="GOA:Q18DL6"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DL6"
FT                   /protein_id="CAJ51191.1"
FT                   /translation="MPSVFKSARLPDGRIRDVRVTDETITAVSDSISPTSDETVFDARG
FT                   MLLFPGAIDVHVHFREPGGEHKETWKTGSQSAAAGGVTTVVDQPNTNPPTTTKTAYTSK
FT                   AALAADSVVDYGINGGVTPDWNPDTLFECPLFALGEVFLADSTGKMGIDETLFRQALIR
FT                   AAKTEIPVTIHAEDAAQFNTDIYGHESGGTGTDAAVDIWSQYRSATAEIKAIERAIEIA
FT                   TEVGADIHIAHTSTPAGVDAATASNVTCEVTPHHLFLSRDNAAKLGTYGRMNPPLRSEA
FT                   RRKELWDRLIAGDIDMIATDHAPHTYDEKAASLWDAPSGVPGVETMLPLLFERARRDEI
FT                   SYERIRDVTARNPASRFGLNNKGHIAVGYDADLILIDPTATQTIKGNILHSKCTWTPFD
FT                   GMNGIFPELTMVRGTVVYDGESFGSTVGMNVTTSE"
FT   mobile_element  complement(82621..82730)
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AA"
FT   CDS_pept        complement(82720..83526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1062A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1062A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51192"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DL5"
FT                   /protein_id="CAJ51192.1"
FT                   /translation="MNSADENDSEIEEDNVTQDENHDRGHHEEQMTEQDVTTQANPTDN
FT                   ESDDHNSATTVSNTPSDTQADMTETQTVPSTEADDEMNASGQSSPPDVAKYARFKKVDG
FT                   AQYDRVNNFLRDRTYITAREWAIARLCSDFRTETGVEMTKIGTNLPQLVPFMTDTYTPQ
FT                   AVNQARSSFEEKVTKAGATFLYGAMSGFFTADELDKLMYEVTETAKFLLEVEGVDLSVA
FT                   DELEAEDRISTVMREVREASDDLRTTENVDADTDADTSTESGSHSH"
FT   CDS_pept        83767..84132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1063A"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1063A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51193"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DL4"
FT                   /protein_id="CAJ51193.1"
FT                   /translation="MKILLGVDGTDTSLHALEQTVKRAKEAGDDVTVGIVTRDSDRSVA
FT                   GTRSDVDEIIESSEIDVTVQHLDGDPGSQLVELAESEDFDKLVIGGGKRSPMGKIQIGS
FT                   LAEFILLNSRITVSLIR"
FT   CDS_pept        84129..84677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1064A"
FT                   /product="GNAT family acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1064A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51194"
FT                   /db_xref="GOA:Q18DL3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DL3"
FT                   /protein_id="CAJ51194.1"
FT                   /translation="MSPDHTCPDDSAGPFPLPPRTFTDRAGRDIEIRVYDGSEDEYEAL
FT                   VEMYRGFDSKDRAQGIPPGREERIRKWLDNILSSECLNVIAWDGLAVAGHATLVPDDES
FT                   YELAIFVLQVYQQAGIGTHLIEALLGHGITSDITQVWLTVERWNNAAVGLYEKVGFEVS
FT                   DSESFELQMGINLDNAETY"
FT   CDS_pept        complement(84768..85226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1065A"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1065A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51195"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DQ0"
FT                   /protein_id="CAJ51195.1"
FT                   /translation="MTENRLLSVDLILAPIDASEESLDAVEYASVIAAKYDASVHVVHV
FT                   LDEDIVQAIETGTVDKSAVATDGQTITESAETIAAKYDISASTSVVYGFSTQIKTTHPG
FT                   RVVLDTAEDLNADFLVVPRKPLSGDPGEVLSRAAEYVLLYASQPVLSV"
FT   CDS_pept        85427..85897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1066A"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1066A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51196"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DP9"
FT                   /protein_id="CAJ51196.1"
FT                   /translation="MFETIVIATDGSESVRRAVDTGLDIASRFDATVHCLYVVDENNTD
FT                   SNKPLSDSDNDQMTLYEHGEKAVNTVAGRANHEVITAIKHGNPSDKIEAYARDIDADVI
FT                   AMGTRGRHGENRFLIGSVAEKLVRTAPLPVLTVRQLAADETDERLSGTPERM"
FT   CDS_pept        86162..87481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1067A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1067A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51197"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DP8"
FT                   /protein_id="CAJ51197.1"
FT                   /translation="MDDELINSAHLSLSRKSRLPGAGFFYPDSVDDDDEDTHEAVANAD
FT                   VVVIADADADGLGCVALLREMYDATIAWDAFEPVVANRVTRWERGTDSTHTTDETTDAS
FT                   TDDPSSELTKISQETETEVKVENEHNNKDEDEDIVSTSSPESAVALITASPYSIDDALS
FT                   TVAMEAPVGVDVYICDLCPDEFNWIETELTAVADRAETVAWYDHHQWDSSTADAVRDCG
FT                   VELVIGASDEECSTDVALRSLPYEFESQWSELATVTRDHDLWIKEDARSDDLADYAYWA
FT                   PPEEYATVVGTYGADLPTLASRYLELRRVEKNALIDAAVDRAELTTVGPWTVGITYGRC
FT                   SQNEVAETLRSQGADAAVVVKPAGSASIRGSETFERAHEVAGRLNGGGHPRAAGCKPDI
FT                   YDDMLDYAHHWTTEGSPAKHIILQAFEEVAASLETDPNSS"
FT   CDS_pept        complement(87646..88134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1068A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1068A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51198"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DP7"
FT                   /protein_id="CAJ51198.1"
FT                   /translation="MDKRESFLRGDRHEDVVLFLADGTLDADTLSRLTNPVDNGDILII
FT                   NGEDGRQAFEAATGIEAMSFAQTAMETRGHITRKLTGGECPKRTVDADTHETEFIFAFS
FT                   EPQNDAVGGLYARGDVVHAYAHCTCGCNYADKWVIGSETETGVQPGEDVSVESLTEDN"
FT   CDS_pept        88364..88747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp20E"
FT                   /locus_tag="HQ_1069A"
FT                   /product="Hsp20-type molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1069A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51199"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DP6"
FT                   /protein_id="CAJ51199.1"
FT                   /translation="MVQNMPTTWTSGLDLPNRLFGSQTNRANGTESSYELYEEDDRFVL
FT                   SIDLPGYEPEEISLRWYDGRLNVSAEHVDDERGRKQQTHRTFRMPKDVIDDSIEASYRN
FT                   GVLEITLPIEDELTAGKEIPIES"
FT   mobile_element  88953..89074
FT                   /mobile_element_type="insertion sequence:HqIRS70"
FT                   /locus_tag="HQ_HqIRS70D"
FT   CDS_pept        89157..89642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps6e"
FT                   /locus_tag="HQ_1070A"
FT                   /product="30S ribosomal protein S6e"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1070A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51200"
FT                   /db_xref="GOA:Q18DP5"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="InterPro:IPR020924"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DP5"
FT                   /protein_id="CAJ51200.1"
FT                   /translation="MAEFKVVVSDETGHTRQFEVDEQDANRFLGRNLGNEVDGNAVGLD
FT                   GATLELTGGSDDAGRPMREDVSGSDLKELLLEGGVGYEPTRDGERKRITVRGRQVSDET
FT                   AQVNAAVVGETPIAVLLGEEEPEDADDDGDSDVDADEATDTDAGSEEDNDDDIADAE"
FT   CDS_pept        89648..90091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1071A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1071A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51201"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DP4"
FT                   /protein_id="CAJ51201.1"
FT                   /translation="MAGRLPSDHDQVQSYRASLIRSGRIRRPCLQLPTEITLTEDEVIR
FT                   LLLDEQQTHARISITAADEQVIRGAFKNSRVAQAPGEGENLLEGWCEKHDLQIGDAVEV
FT                   DVLDAGFCYGLRSPGDRVVYSVPSRPNASLHSIARNLDQDTTE"
FT   CDS_pept        complement(90663..91328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1072A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1072A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51202"
FT                   /db_xref="GOA:Q18DP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DP3"
FT                   /protein_id="CAJ51202.1"
FT                   /translation="MSTIQSVDPPAEAAAVAEQYYRRSRALTYLVGIIVVGSITLSFFL
FT                   LPFLQWLLSAIIIFLGFRFPLFVTGGQTKLTTDKPPETVRAEFESSTPPVLPFYWGLAN
FT                   QIESTDSGGRYVIKYLRGLRSLEMAVECQPTSDDAADFRLVVTAGDSPWGSYQITITET
FT                   DESDSSTRTTIDIDVEADRRFGLRRLPQQLMSNSYRPTAIEAQGYDVVAFESGISVRW"
FT   CDS_pept        91700..94117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1073A"
FT                   /product="receiver/sensor box histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1073A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51203"
FT                   /db_xref="GOA:Q18DP2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DP2"
FT                   /protein_id="CAJ51203.1"
FT                   /translation="MRLSPMRSESQQQILVLHVDDDPSVTDLTGRFLEREDNRFSVETA
FT                   ISATEGLERIIESSQPPDCVVSDYDMPEMDGIDFLQTVREEYPNLPFILFTGKGSEEIA
FT                   SDAISAGVTDYLQKQPGTEQYELLTNRIQNAVQTQHQRHRAERTDELMRLTEFAGDTGG
FT                   FEINVDTGEVLMTDGCRRLVGLADDATLSLKEAIKLYHPDDQPEVRQAVNRAADTGEQT
FT                   QGSWRLQALDNTDRIVDVTLTPAIPSQISPHPSHSMSEGKTEDETETDITILRGAIHDV
FT                   TDSHQREQQLTELNRVSKDLLTAETQQEVVDIGVTAARDVLDFQANALHLSVSETGDTQ
FT                   LVPVAQTDELMSLLDEVPTLSVSESIAGRAYQRGEPDIIEDARQHPNAHNPTTNLRGHV
FT                   YFPLAEHGILIAGSTQKASFDDQDLAVGELLAGALVAALDRLDREQTARRRAKELSLFF
FT                   EESPLGAVQWDDKCQFKRVNRQAEEILGYSESELRGESWELIVADTDLERVGNAVDSFL
FT                   SADGGSHIINSNVTKAGETLTCEWHNRVVTDADGTVQSVFSSFEDISARKQRRTELQEY
FT                   KQELEAQNERLAEFTGIVSHDLRNPLAVAEGHLELAMTQTQDVGDNYTDGDANGNHIIK
FT                   ARHAIERCQRLIEDLLTLARDGDRVDDIEPIRFDTMIEECWETVETTTATLTIADQRSH
FT                   SDLYIKADKSRLKQLLENLYRNAVEHGGDRVIVSAGIMSDGFYVSDTGPGVPKSAREKI
FT                   FNAGYSTAENGTGFGLRIVKQVADAHGWEIDVTNDTEQGGARFEFTGVQFVD"
FT   CDS_pept        complement(94302..95420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepB1"
FT                   /locus_tag="HQ_1074A"
FT                   /product="aminopeptidase (homolog to leucyl aminopeptidase
FT                   / aminopeptidase T)"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1074A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51204"
FT                   /db_xref="GOA:Q18DP1"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DP1"
FT                   /protein_id="CAJ51204.1"
FT                   /translation="MDDRIHQHASVLVDWSARITAGDNVVVNVAEGAHNLAVAVADVLG
FT                   ERGASLVMTYNSAEVSRAYLRGHETDFEPAPAHERALYDAADSVLILGGDRNTTATADV
FT                   SGDTKQAAAQANKQIREARMSTDWVSTVHPTRALAQQAGMSYTQYQDFVYDAILRDWET
FT                   LAEEMERLKRCLDDGSELRVVSDNGETDLTMSIEHRTAVNSAASVAYDSHNLPSGEVFT
FT                   APVETTVSGTVQFDVPMVIRDTRIRDAELTFEDGTVVDYDATAGVETLAQILNTDPGAR
FT                   RLGEVGIGMNRGIDQITNKILFDEKMGDTVHFAVGRAYDACLPANESGNESAVHVDLIT
FT                   DIGSGAQIEIDDEIIQRNGRFKWDPEFDPSGV"
FT   CDS_pept        95702..96622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gndA"
FT                   /locus_tag="HQ_1075A"
FT                   /product="6-phosphogluconate dehydrogenase (NAD-dependent,
FT                   decarboxylating)"
FT                   /EC_number="1.1.1.343"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1075A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51205"
FT                   /db_xref="GOA:Q18DP0"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR032883"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DP0"
FT                   /protein_id="CAJ51205.1"
FT                   /translation="MQLGVVGLGRMGQIVVDRLVTAGHDIVAFDLDAEAVATAADIGAT
FT                   PADSLDTLLDTLGETKRLWLMIPAGEAVDATLTQLEPSLTETDIIVDGGNSHFEASIRR
FT                   AETSDATYLDCGTSGGPAGAELGFSLMIGGQQWAYDELIPVFDAIATGPDGHDRMGPVG
FT                   SGHYVKMVHNGVEYALMQTYGEGFELLANGRYDLDLAAVARTWNNGAVIRSWLLELCEE
FT                   AFRAEGVDLGNVADYIAGGSTGTWTVQEALEQEVPVPLIYQALAERFGSRATGATGDPD
FT                   GRFSRRVANRLRYGFGRHDVARRDE"
FT   CDS_pept        96661..97251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fer5"
FT                   /locus_tag="HQ_1076A"
FT                   /product="ferredoxin (2Fe-2S)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1076A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51206"
FT                   /db_xref="GOA:Q18DN9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DN9"
FT                   /protein_id="CAJ51206.1"
FT                   /translation="MVDINFLGVGIGATLTLLAVSLHYARGTGWTPTADISQEVLEKRA
FT                   STVPETEFPEPMNRSIGGGAIPAGSVTGGGGELEETDTEVDESEQVPGDIPDEEAEYFE
FT                   VEFEKQGSTIEVASNQTVLTAGEDESWDLPYACRQGQCVSCAGQITSGGNAEDYVEHDN
FT                   QQMLDDAELEHGYTLTCVAYPKDDFTIETGEAP"
FT   tRNA            97527..97598
FT                   /gene="tRNAThr1"
FT                   /locus_tag="HQ_TRNA04"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon GGT"
FT   CDS_pept        complement(97890..98072)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1076B"
FT                   /note="product: uncharacterized protein (nonfunctional)"
FT                   /note="gene has an in-frame stop codon and is truncated at
FT                   the N-terminus"
FT   CDS_pept        98240..98521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1077A"
FT                   /product="CopG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1077A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51207"
FT                   /db_xref="GOA:Q18DN8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DN8"
FT                   /protein_id="CAJ51207.2"
FT                   /translation="MSEAATNDDDGNDIATVNFKLTESFLEQIDDTWQGRGFNSRSEFI
FT                   RYTLRDAVEFPTFDRDELVALLETEEDIREGRTTSAEEARERFGASDE"
FT   CDS_pept        98514..98798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1078A"
FT                   /product="RelE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1078A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51208"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DN7"
FT                   /protein_id="CAJ51208.1"
FT                   /translation="MSDDGWTWELSSTTEDDLDGLSPAEQDRILDKLDEIVSSPWRDPP
FT                   DYGEPLQNSPYKKIRVGEFRLSVSFRQDDGRLVVARIKRRGGAYTADDD"
FT   CDS_pept        98890..99078
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1078C"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: uncharacterized protein (nonfunctional)"
FT   mobile_element  99784..99893
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AB"
FT   CDS_pept        complement(99979..100116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1078D"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1078D"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97800"
FT                   /db_xref="UniProtKB/TrEMBL:J7SCA2"
FT                   /protein_id="CCL97800.1"
FT                   /translation="MSAESDGTSLPDDLSSEEARRYLIRLLRKRYLDDYKEIYKELAYK
FT                   "
FT   CDS_pept        complement(100119..100550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1079A"
FT                   /product="death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1079A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51209"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DN6"
FT                   /protein_id="CAJ51209.1"
FT                   /translation="MTTAGEHVREGHFDHVPKSFHRKAFQLLHLIVVNHPFVNGNKRTA
FT                   LMSVRSFCALNGLEFAYNRQIKEVLKTLTTNERRERNRFSYLREHTEPLEPKYKTTIEL
FT                   WLTQIMDAERISNNIGPGTSESQNRNEPNDYDSDSRDSN"
FT   mobile_element  complement(101313..101363)
FT                   /mobile_element_type="insertion sequence:HqIRS81"
FT                   /locus_tag="HQ_HqIRS81A"
FT   CDS_pept        complement(102218..103021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kch1"
FT                   /locus_tag="HQ_1080A"
FT                   /product="mvp-type potassium channel superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1080A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51210"
FT                   /db_xref="GOA:Q18DN5"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DN5"
FT                   /protein_id="CAJ51210.1"
FT                   /translation="MNYTQARSFTYEIFAPRLGGRLGAAFDWGIMGLIVINIIAVLLET
FT                   VDPIAATYGRELYLIEIISVSVFTIEYLAHVWSIIETRKYDNPILGRIRFTFTPLMIID
FT                   LLAILPFYLASIFAVDTRFLRAMRLVRVIRLLKIARYSESIRSFATVLRSQKEKLVVAA
FT                   AMNLILLVLSSSIMYQLEHNAQPELFSSIPATLWWGAMTLTTVGYGDMYPVTQGGQVAG
FT                   SLIAVFGIGLFALPASILAAGFIEDSQATDDNVCPHCGEELSQNE"
FT   CDS_pept        complement(103033..130512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmu"
FT                   /locus_tag="HQ_1081A"
FT                   /product="halomucin"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1081A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51211"
FT                   /db_xref="GOA:Q18DN4"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011493"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DN4"
FT                   /protein_id="CAJ51211.1"
FT                   /translation="MSQTAKPIFAVVVALIVLISGVAFIGSVSAQQPNLVQNGSFENSS
FT                   NDFSSDNNYNTLVADSTAITGWRVSSGEVDQVGSYWSPQDGSVSIDLSGSEPGVIEQNV
FT                   TGLEAGKRYELTYYYSGHRVQEGKYEAGVEIADLNITETASSPGDWTLATHTFTADSTA
FT                   ETLTFTQITPSSGAKGMAIDNVSIVESSDPIDTAAPTVSVNQPAGGATLTTSDVALNAS
FT                   ANETGNWTYSVDGGPNQTATDANGTKTLNVTLSGLADGSHTATVYIKDDGGNIGIDTVS
FT                   FTISSAPTVTTSSGGTNYTASTGGFVVDENLTVTNPDGGTIDGATIAIGSGFNASVDTL
FT                   AIDEAVAPNNSITSTNYNGTTGVLTLDGTASAAEMQTVLRTVTYAYSGETTASARDIDV
FT                   SFALGTGGNNSSTPTTAQITVTVSSDTTAPSVTIDQPVEGSTLTTGDVAFDASANKTGN
FT                   WTYSVDGDPNQTATGANGTQTLNVTLSGLADGSHTATVYIKDDGGNVDTDTVSFTVSTA
FT                   SSLTTSSSKTDYTASDGGFVVDDSLTVTSPDDTLINGATVAIGSGFDASEDTLAVNETV
FT                   ASNNNITNTNYNSATGVLTLDGTASADEMQTVLRTVTYTYSGDATASARDLDVSFSLGT
FT                   GGNIVFDPTTGNYYELVSETVTWKTAKDEAENRSHLGLQGYLATLTSERENDETASRFT
FT                   FDKAWIGASDASTEGDWKWVTGPERGTLFWEGDESGSEQNGEYAGWASTDPNAIQGENY
FT                   AFINQNLEWIDQKNGVNYNYLVEYGGLNGSSSPTAQRTVTVDTEAPTLTTSSGSVTNTT
FT                   ASGGYLVDDKLTVTDPDGGGIDTATVSISQGFDPSADRLSVNTTLATNRGITSTYDDTT
FT                   GVLNVSANSSATVTADDFQAVLRTVTYNFTGTSVTNESDRTVPIRFALDANQEQVTAYD
FT                   GHYYEYVSDSVSFDTARSEAENRSHLGLEGYLATLTSEQEDDTIHQQFDQESWIGASDA
FT                   ETEGDWKWVTGPENGTLFWKDGSTQNGEYAGWEGGEPNSQNLDENYAEINFDDYTGWND
FT                   QVDNQGYLVEYGGLTTDSAITAQRNVTIDTGAPNVSNVTIRRIDGGGVVTTNDTIEVSA
FT                   TVTDVSSIQSVTASAIAFDAGTVNLSDDGPNSSAADDVYSATFTVGPDPIEQTQSVTVT
FT                   ATDDAGNGGTPPGDLVYDSITVNPEGTTDFRTVRLPRSFENPVVIAKPLESTSSGNVAP
FT                   DNRRGHTRIRNVQSTSFEIRVEEWSVQDDEDHPAANVSYIVAEAGTTTLDDSTKVSAGT
FT                   ITLNQNDGFQSITFEESLNSPVAFTQPQTVNDPDAVSTRNNNVGSNGLDSKIEDDQNNG
FT                   ADGNPHGTETLGYIAIEQGDSVLGETGFTAGTQGNVDETLTSINFGDSYPAGFVAAMQT
FT                   TGGTEQSYLRYDDRTDTGVRVRIEEDPVDNSDRHNSETVGYLAWNASTQVTGTRSNELS
FT                   VDTSAPQIDDLSASFTTGSPPVSAGDEFRVTATVTDAGAVSTVEADVAALDADPGTITL
FT                   DDLGNDTYEGTFEVGQNPDPTRAVAVTVTDSLGNNASATTIAGSQASWDHEVNGTVQTG
FT                   TFAGNGSAVDPYIIDSLVDLQAINKNATTRAYNYRLGTDIDASTTRSWNDGKGFAPVGA
FT                   VNGRDIGEPFSGSLDGDGYTISNLSVDQRSTDTNALGLVGKLDSDGAVRNLTLANASVA
FT                   GDDDIGAAVGKSAGTVRNVTVSGMVDGDQRIGGVVGTVTSTGTVTNTTAVANTSGNQGV
FT                   GGLIGESSGTVNNASAGGAVTATGQYAGGLIGDHQSSTAVTDVNASGAVTGASYTGGLV
FT                   GRGQAGVINASANGDVTSTTGEYVGGLVGQLQAQHGDEEVRNVTASGNVSSGGQYVGGL
FT                   IGDVRDDGTNYVAMSEAHATGNVNTTYADESGFNNAYVGGLVGHFKGSEFTDISATGDV
FT                   TSTTGNEVGGLVGRVAMEQERDIVANASATGNVTTTGQRVGGLIGYHRTGTILRNVTAT
FT                   GDVSTDGQRVGGLVGDTDASITDASATGEVTTSTSGEYVGGLVGQLQAQHGDEEVRNVT
FT                   ASGNVSSGGRYVGGLIGDVSDDGTHYVAMSEAHATGHVNTTYADESGFNNAYVGGLVGH
FT                   FEGSEFTDISATGDVTSTAGNEVGGLVGRVAMEQERDIVANASATGNVTTTGQRVGGLI
FT                   GYHRTGTILRNVTATGDVSTDGQRVGGLVGDTDASITDASATGEVTTSTTGEYVGGLVG
FT                   QLRAQHGDEEVRNVTASGNVSSGGQYVGGLMGYVDDNNNRGRYVAMSEAHATGNVNTTY
FT                   ADESGFNNAYVGGLVGHFKGSEFTDISATGDVTSTTGNEVGGLVGRVVMRNNGIVANAS
FT                   ATGNVTTTGQRVGGLIGYHRTGTILRNVTATGDVSTDGQRVGGLVGDTDASITDASATG
FT                   EVTTSTTGEYVGGLVGQLRAQHGDEEVRNVTASGNVSSGGQYVGGLMGYVDDNNNEGRY
FT                   VAMSEAHATGNVNTTYDGGSNAYVGGLVGRFKGSEFTDISATGDVTSTTGNEVGGLVGR
FT                   VAMRNNGIVANASATGNVTTTGQQIGGLIGYHQNGDGVETSYARGDVSTDGNYVGGLIG
FT                   DTNDGSITDSYARGDVNSSGDYVGGLVGEANGDVTRAYASGRVEGDGTDIGGLVGTNNG
FT                   GTLSDAYWDRGATNQTAATGSGTPPGATGYGTVGDTRALEMQGRAPTQFMAALNYTSPW
FT                   KLTSTYPIFQRESATSGSLPATVDTIEASTATVVQTQQMTVKLNATINGSRVGPGYLIT
FT                   VSDSNGLAELEGQRALTDQNGTATFTFAEQSAGTFTPTFEAVSDLNVTATATVEVNEGA
FT                   ARTYIREDGTELTAVYSGNGTVDDPYEIDSLADLQAINNNTAARDNHYELVANIDTSAT
FT                   NNTSWNNGNGFEPITEYTGSLDGNGRTISNLSINRSGANGVGLVDTLGSEGTIQNLTIQ
FT                   NASITGDNDLGVAVGINNGRVENVTASGTVSGNDRIGGLVGTVNSGGVITASTAAATTS
FT                   GSKSIGGLVGQNNGAVNNASASGTVTATGQYAGGLIGDHRSTISIVDTNASGAVTGTSS
FT                   TGGLIGRAQANVTDSSASGRVNGTTGSNVGGLIGEHDPSQVATIANVSASGDVSTSGGV
FT                   RVGGLVGSSISGSPVTMLNARAEGNVTTSDLSGTDAFTGGLIGEIQNAKNVTNVSATGQ
FT                   VNASIAGNQVVTGRVGGLIGSFEHESASRIVANASATGDVATDTNGQVGGLIGTYSGGG
FT                   TVEDSNARGNVSATGQSVGGLLGSADASIIRRSSATGDVNSTGSNVGGLIGKHDPSQVA
FT                   TIANVSASGNVSTRNQGAGGLVGAIQTSPVSISDAGASGDVTAAVGSGRGYVGGLIGEI
FT                   RNAKNVTNVSASGQVNVSANTGFNGEHVGGLIGVIDHESGANIVANASATGDVNADAAG
FT                   PTGGLIGGTEGTLGTVQDSYAQGNVSGTGPVGGLIGQTNGDTARVYASGRVEGNSGLGG
FT                   LIGDNSGQISESYWDKGATAQSDATGSGTPGGATGYGSVGDTTPAPQMQGRAATELMDG
FT                   LHYTTTWNVTRGYPVLQAQSNGTEQPPRTVDTVTATNASAIQSEQVSVSVTVTTAGTDT
FT                   GTGTAAGLIVSAQDTGGLTSLNNATAVTNETGTATLTITESDTGTFSPTFTVVGYSTAT
FT                   ANATVTVSDGAVRTYVREDGEELTAVYSGNGTADNPYLIDSLADLQAIDNSSAARADNY
FT                   RLAEDIDASATSDASWNDGSGFEPITPFTGSLDGNDTTISNLSINRSGASTAGLVGALD
FT                   SNGAIQNLTIQNASVTGSDELGVVAGTNDGTIQNLTVEDASIDGVNDLGVAVGTNNGTV
FT                   QNVTASGAVRGSDRIGGLVGTVNSGGVVTDATTTATANGSQSIGGLVGESNGAVNNASA
FT                   SGTVTATDQYAGGLIGDHQSTTPVTDVNASGAVTGTSYIGGLLGRGQADVINASAGGSV
FT                   NGTSGGYVGGLIGQAKSSSGNPITVSNAHASGVVNATNTGTDAYTGGLVGEFQNAGNVT
FT                   DVSATGDVNASEPEGGNLVGGLFGELHHDSADHILTNASATGDVDATGQRVGGLIGYYK
FT                   DGDGVETSYARGNVSTDGDYVGGLIGDTNNDGSITDSYARGDVTTSGDKVGGLVGETED
FT                   VDVTRSYASGRVKGGSTVGGLVGNNTGQLSGAYWDKGATNQTAATGSGSSGGATGFGTV
FT                   GDDTQALEMQGRAPTQFMSALDYTSPWKLTSTYPVFQRESNTSGSLLAPVDTIEATGTT
FT                   AVQTQQITVEVNATINGSPVGPGYLINVSDSNGLAELDSKTALTDANGTATFTFAGPTA
FT                   GTFEPEFEAVSNSAASATATVTVESGAVRTFIREDGTELTAVYRGNGTADSPYEVDSLA
FT                   DLQAIDNSTAAHGDQYTLVANIDASATDESSWNGGGGFEPIANATDEAFTGTLNGNGHT
FT                   ISNLSVDRSGANRAGLVGTLGSNGTIQNLTIQNASITGNNDVGTAVGTSAGTIQNVTAS
FT                   GTVNGNDRIGGVVGEVTADGLVTDSTASVNTSGNQAIGGLVGQSSGAVNNASASGEVTA
FT                   TSKYAGGLIGDHQSTTPVTDVNASGTVSGTSSAGGLIGRAQANVTDATATGDVVSTSGT
FT                   KVGGLIGNHQAGQTIVDVSATGTVSSDGDDVGGLVGFTRASVRNATASGEVESTTGANV
FT                   GGLVGRLSHDDSTHVTNVTATGTVSAGADHVGGLVGFIEDSDDNGNITMSGARATGDIE
FT                   MTSDDGGPASVGGLVGRFEHGSAITDVSATGDVSSVGGNEVGGLIGRLDQLASTDVLKN
FT                   ASATGDVTTTGQKVGGLIGFHRTGSVDNSHAQGNVSAGSGDNVGGLIGVHGRNGGRVGD
FT                   SYARGDVNTSGNNVGGLIGRSEGKVLRVYATGRVEGGSAVGGLVGKNDGGQLSESYWDK
FT                   GATDKSDATGSDTPATVSGYGSVGDTTPAPQMQGRAATELMEGLNYTTTWNVTRGYPVL
FT                   QAKSTGTEQLPRTVDTVTATNASAIQSEQVSVSVTVTTTDSNIREDFVISVQDTGGLTS
FT                   LENATAVTNDTGVATFNITESSPDTYTPTFGVAGYSTATVNATVTVDNGAVRTYTREDD
FT                   TELTAVYRGNGTPDSPYLIDTLADLQSINIDSGTRNEQYRLAADIDASATNESSWNGGR
FT                   GFEPITDFTGSLNGDGYAISNLSIDRGNEASVGLFGDTNAGSSITNVTLVQPAVTGGQG
FT                   TGPLVGSHGGSISRTVVTGGTATTEADGEAHLGGLVGILVDDAKITQSHTSAIVDANGH
FT                   NEAGGFAGDIGSNARVEQVSATGGVKNGGSEIGGLFGNASSGSEIVEAFAAGNVSGTTN
FT                   VGGLLGRQDGSAVTVDRAYWDEQSTGQTSSAGDTETALPTVKMQGTAATEFMPGLNFTT
FT                   TWNTTRDYPVLQVQTTGTEQPPRTVDTIDATNASLVQSEQVSVSITVTASEADSRNGFL
FT                   ISVQDAAGLTSLENATAVTNETGTAAFNLTESDAGTFTPTFGVAGDASATTNATLTVKQ
FT                   GAVRTYTREDGTALTAVYTGNGTPESPYEIDSLADLQAIDNSSTARNNSYRLTADIDAS
FT                   ATIESSWNDGSGFEPIANATDDDEAFTGSLDGDGHTISNLSIDRSGADTVGLFGELDTA
FT                   GVLENVTLQNASVTGGNDVGLVAGTSNGTLRNVTTTGTVTGNNRVGGLIGTTELNSVLT
FT                   ESSAAVNTSGSQRVGGLVGTAGGIVNTSTANGTVTATGQYAGGLIGESQGTIPVTNTAA
FT                   SGNVTGTADVGGLIGRTNTTVRNSSASGVVNSTSGDGVGGLIGRSLAAVHDSSASGAVS
FT                   STGGNSVGGLIGNAGADVTNSAGRGNVISSTGNEVGGLVGRLEDSSNIRDSHARGTVTA
FT                   AGSDVGGLAGTIDTGNATRVFATGQVEGNSAVGGLVGKNNGGTLSDVYWDKGATNQTNA
FT                   TGSATPTGADGYGLVNDDTPAERMQGEAATAFMSALNYTTTWNTTRGYPVLQAQATGTE
FT                   QPPRRVETIDATDASSAQTEQVAISITVTAADSESTDGFVITVRESDGLSGLEDATAVT
FT                   DQDGTATFSFSESNANSYKPTFGVAGDTAVSTTANITVKEGAVRTYTREDGTNLTGTYI
FT                   GSGTPDDPYLANSLTDLQVINKNATTRDEHYQLTDDINASATIESWNGGNGFEPIANAT
FT                   DEAFTGTLDGNGTTISNLSIDRSGADSVGLISEVGTSGVMENLTLQNASVIGSNDVGVV
FT                   AGTSNGTIRNVTATGTVAGDNKIGGLVGASNSSAVVADSSTAVTTSGTRQIGGLVGQSS
FT                   GSVTNSSASGSVTASGGFAGGLVGDLDVTTPEELANVSASGNVSSGGQYVGGLVGLGTS
FT                   TSSSGNQLTITEAQASGDVNTTYNGGNDAYVGGLAGKLSNVGNVTDVTATGDVSSTSGN
FT                   DVGGLAGELVHDSTSFTLRNATATGDVTTTGQRVGGLIGAHRNGQALTNATATGNVSTD
FT                   GNNVGGLIGYQPDDKTVSDVTATGDVSTEGNNAGGLIGQTRASLSDATASGEVQSSTGD
FT                   KIGGLVGYLKLSAEKTTNVTATGNVSTDGNNVGGLIGHAEGVESTSQTTISTARASGDV
FT                   TSTDGNDIGGLIGNASFQNDADTVTNASATGDVGTDSATGSSVGGLIGSQSSGQVRNSY
FT                   ARGNVTTSGDNVGGLVGSAAGKQIVDSYARGNITTEGTNVGGIAGKLSGDVKRVYASGQ
FT                   VTGDNKVGGLVGSGGTLSDAYWDKGASTQTNATGNKSGLGTGTPNGVAGYGSIGSDVPA
FT                   TEMQGQSPSKFMSALNYTSTWSLVNGYPQLRAETAPSFASDTTPPTLTSVTSTDGTTIQ
FT                   LTIDGGVSGIDTSSIDNTDFAVSNNSILSTDTNTSGTDTNTTQTVTLSLSSSVETRPVT
FT                   VDITSQAGGITDRSGNKLSNITTTLPGIDTVSVSDDTNDDGIVTTGDRVQVTVESNTDT
FT                   NTDTDTDTTLSSVTVNATDYDDETATLSPNGTNVETGASIHSGIIIVGSTPTDGSDQSL
FT                   TVNVTDDTGNAAVRTIQVSGVTVDTKAPEITSVSRAGGDSVDVSIQSGLSGIEKSSISA
FT                   ADFTVEPGKVASVNTSAVTDGSNQTQTVRIGLTDAIRGKTPTVTINSSSDGILDKAGNG
FT                   QGEDSTSSNESSDGTESDQGDPEDDIGGINTGIAPAVTLTTSDLDSSTLSTVDVTYNAT
FT                   GEVGSSDDIEIQLYNDNNSTTTPIATRTVGSVEGLTSLTVPSSAVGGGTFTGRATLVNT
FT                   SAGNTELANKSKQIVAYENVSTSVTAGSLGGKITVKHDFGSLDPANAQIRVSPITIGSK
FT                   FTTQTVTPAPAQKQGTVTIPVPKQANSRFNVQTEVVDTSRNRQIQSSLGYGCVGSQRDP
FT                   CSTVSETGTTVVDATTGNSVGIEVNATVDHNRGAVEWYLHPTGSPEQKDISIVDGVDAS
FT                   TPLAVTIAVDDFDPVFMLGTGNADGWEKTGVDKNTKEISINVTPAEAYVEPDIRNPDPR
FT                   EWPLSDHTASKRYGAIVDMIAVSMEGRVNPGYRNHLDGAFIGTNAQAFSVPKSSAGGSD
FT                   SAGSLSITVAAPHYETDGTTVNTGFYNARIPKSVLAAWGISPGQVTATYKGESVSGSSL
FT                   TVEDKKGAIFVSMPVTYSSGTVTVSGSQDSSDTTAPTVSNVSLDSDGTGNLTFTVDSNE
FT                   QLGVATDNVSVSIDGPNTNDVYTFNRDDLIQSGSGPYTYALDLDSAQPYDNGGGTYTAT
FT                   VDTATDSAGNDGGGSGLTDSHDHTVTGSTPTFVSSGTVTTPENPGGTLLDVNAIDGEGG
FT                   LFDSGVKYTITGGADSSSFTVDGKTGAVSFADSVDFESPADADGDNAYELDVTASTANA
FT                   NATQSISVTITDVDEQPTGQVNLTGGDPGDRTISIVGNKTGYTFDASKIVDPEGTGVSY
FT                   TWDFGIGDTSTGSTVTRDYDPGSYLEETTVSPTLTVDDGSKQTVIDVSVTFYSDIDGDG
FT                   LADDNEATGVPTDNDDDNDGIPDDEDQEPALGEMSSISGTITDTNGSRVTQGDVTIISS
FT                   DGTHRESVSLDSNGKFDTTVPAGNYRLVVENTSAPVHEREDITVGPQTPTSQNLTLEGS
FT                   GTVAGKFINPDEKSASNIPVQIASRDGGETYYTKTDSTGEYEVAVEPGDYVVAPLGNDS
FT                   GNASREVSVELGETIQQSVTLDPQPVETAASLSIASGPGSVTADGHQMVVIPEVTDGLL
FT                   QIQIANNSDPNRDISVVEDPSELENFGVTNETKFRIRVTVTNYTPHTLFWALRDAEFNS
FT                   KPNATNPTATDIIITGSPVSLATTSTQQKRVGPLVSEDPSTVSWPSGAADTADSQYNQT
FT                   VYFSVYDLSTRPESLRDRLTGLILSTNAQRISLPEVSNDRLRTWIAGPRYKTASGTKYE
FT                   GFYQAQIPQSQLEEWGVADHPTHQLFGEYKSSERNLTVEDVDGGISVDVSNISYSASYV
FT                   DIKADSTAPVPESALEDDSSNQDSGDDSSNQDSGDDSSSQNDDGDNSSNQDSGDDSSSQ
FT                   NDDGDNSSNQDSGDDSSSQNDDGDNSSNQDSGDDSSSQNDDGDDSSSQNDDGDNSSNQD
FT                   SGDDSSSQNDDGDNSSNQDSGDDSSSQNDDGDNSSNQDSGDDSSSQNDDGDNKPNSAAA
FT                   VGAESGSEMGGETGGESQAGGGDGSSGSSSDAAGGGSSGGSSSGDSGGSSSGNSGGSSS
FT                   GNSGGSSSGSGSSTGSMIADALTVITAPLRWFGSLSTAGKAAVAATTGAGAAGAAYGLG
FT                   GDRIQTPLNIARRRFQSWLRRRIRGSSRSQISKLLARLRRLKWAKIRTQIAGVRKYFTR
FT                   SYWRELIAKRRRLGSREGMKNWLKSKYRGNRKRKYRGWLRGRLRSGVNWVAGGLLRGAA
FT                   PAWLGVVSGPAATAVSVITGEIRRWIEDKAMDRFDSTRKRYAKLAIQSSAWITTVETRL
FT                   WQLLSGEDSPSSSRSLAAIAGESASELNEVGVDSVDQLASADPEQLASALEIDESAVAE
FT                   WVNRAGHASGSTERPAFIETRNGKRIQARYEQIAEIVQTGVSIPTISVGSVHSITDIGG
FT                   RQLARVTGWLQGDVSSILSGAFERIQSFSCRLLYRVSIWIYGPSGAVESIDGIGPEYSD
FT                   RLVQEGITDVAVLSACSAERLSERINVSSSQTYRWITQATAETPDTRGLHQRLVAGVVR
FT                   VESVFIAMKTKSSVQLESNRLREDHFSSQPLSEKEMNQLAVVGITTVSQLAAINPDRLG
FT                   AGVGIDTKTAEEWVEMAQVYEMHLNNNS"
FT   CDS_pept        complement(131281..132447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1082A"
FT                   /product="CapB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1082A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51212"
FT                   /db_xref="GOA:Q18DN3"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DN3"
FT                   /protein_id="CAJ51212.1"
FT                   /translation="MSDQHGILSRFQETISNSAKNMQHVIGRGRSHSERVEQTPYRVTV
FT                   SGVRGKSTVVRWLNQALVSRGFETYAKVTGNHPLSYRNLNQYKIPRSGSTRLYENEREL
FT                   RKYSPVDAIIAENQGIREHTTRLANELFKPQVVLIINIRRDHQSTLGTDLTDIARVFTR
FT                   TVPAGACVISGDRNEAINQYLREEFEKTNNEFLVATPRPEYPHKDVFGARSAFIVDETL
FT                   RALDLDPLPPAKIESYINRLHAEWGWQRLEDGGIIANGAMMNDIESTELLRQFLVERYG
FT                   DTDSSTDTITPFIYTRRDRAGRTTSFVHYLNWLTKHELIGQIHVAGSHARLLERRVDCE
FT                   FVHHPESAAPEDVLNVCLADEYPIYVMGNTVSEFMRDFISEVNQRTVE"
FT   CDS_pept        complement(132450..133682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1083A"
FT                   /product="CapC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1083A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51213"
FT                   /db_xref="GOA:Q18DN2"
FT                   /db_xref="InterPro:IPR008338"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DN2"
FT                   /protein_id="CAJ51213.2"
FT                   /translation="MIVVSIIMIIGLTLGALAAQLKSYRLGGVMVLPILAIYTLREFFT
FT                   PVIFIIGTVAAWISLWVLQEYTLNYGRRLFLSAVSTGVIATILTGFVLSQVFPNQLSFE
FT                   TAEAITSIFPGITAFNLMRVSPGNRRAELLIIGCGYLALIAVGVLLLWLFPTFVTQTPP
FT                   FLTLQISDITAWIELRPQGSPHSRVIPGWIVLIILPISIFIYEGFRQRYDHRLVGIVII
FT                   PTLGLFTVQSSSVVIFYTLGATIIYYFITYIQYMTLFYGRVLLTVSILLGTIYSLIFGV
FT                   FFSQLVLIPGVSLFFTGIFVGIGAYNLNRVSRKTRLAHIRIDAGLFVISYTLLFFLIDI
FT                   PVTGLLHDNLVFYIFVGIMIVALAVIEMYRLEQSIPDATAFASESAFARSSVDGIGSYE
FT                   SSLTADNQEDK"
FT   CDS_pept        133879..134058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1083B"
FT                   /product="probable zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1083B"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97801"
FT                   /db_xref="UniProtKB/TrEMBL:J7S5C8"
FT                   /protein_id="CCL97801.1"
FT                   /translation="MCRVPVSSGFTYTYSSILQRSSISFLNQNHGIHEMSSISYSHRLC
FT                   VMFIHTTCVSHIVY"
FT   CDS_pept        134125..134289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1083C"
FT                   /product="basic protein bp1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1083C"
FT                   /db_xref="EnsemblGenomes-Tr:CCM80486"
FT                   /db_xref="UniProtKB/TrEMBL:K0PUM7"
FT                   /protein_id="CCM80486.1"
FT                   /translation="MLVMQLVTKSVDSQLYPSRWVSLQRVILLIKKSIIDVAIVMRIAY
FT                   NLTESRGQR"
FT   CDS_pept        134289..136838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bat"
FT                   /locus_tag="HQ_1084A"
FT                   /product="sensor/bat box HTH-10 family transcription
FT                   regulator Bat (homolog to bacterioopsin activator)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1084A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51214"
FT                   /db_xref="GOA:Q18DN1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR031803"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DN1"
FT                   /protein_id="CAJ51214.1"
FT                   /translation="MTLQFPLVAYFSILLTVGLLCTGYALLRRCRQSGDYLTFRFVGII
FT                   IGVSLWWLVMSTVKFTATSLELKILFYRLSMAAWIGLPVSTCIFSFIGIYHRDASSTQL
FT                   HRGVIAFLAGLLAFIMLIPQSALFTTPHLLSVGEFVTLEHGVSVTTAVITGIAWTITLF
FT                   GIAIALSRVVHKKYVPPVVALAAVIPSLPGIIGVLKLFEIYPAGGAGFNLAPHLAGLAT
FT                   ILFAAVTHRKGLTTIILDSRHAAIENATEGYVLADETEIIRDMNTEAKRLVDATVGDQL
FT                   PSWLAESSAETAEGVNRTTPTGKEIDLQQHTVGSHRATNKVFLLRDRTEQLTRMRKLES
FT                   RDRLIADLPVGVFRIQRGTSPRFVYMNQAFAELFNISDVDQIDKHAVSDVFGAQQPQLI
FT                   GNQSNYSTPENPETTEQLFSPPGTDSFWGLVSTYPSSTQDPDMIEGVIVDITAEKQAEA
FT                   LLTEELDNISHDLELTEQLWELSVRLEGFDAFAQEALSLLTDIDTIECAEVVRSGRVCC
FT                   GEPETIVANGTTHIPDTAVSNAIEHAYTEENKRTETLSIDDERYTLITTPIMTEHVADS
FT                   ALMILSASPPDDRVEHLVTDTAEALAYKRAVNYREKYTDENKMTELRIANTDTDKPHPL
FT                   SQLLTTADVDVDIESSPLTFTNVRAEGQITWYLLRADQAVCNAVTAAATAHDSIKATTP
FT                   ISINDDENRSRCQIGIETGDIHRSLNTEGVTVVTVSANARGTELLLHLPTDLKVADIID
FT                   IFRTRFPAMHLRSRQTIERESVDTQVFTELDEYQRQAMEAATRMGFFSRPQGATAGDVA
FT                   NTLDIGRTTFTRRLKNAQTTVFNKLLDSQTDTEPADD"
FT   CDS_pept        complement(136890..138296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1085A"
FT                   /product="bis-gamma-glutamylcystine reductase"
FT                   /EC_number="1.8.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1085A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51215"
FT                   /db_xref="GOA:Q18DN0"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DN0"
FT                   /protein_id="CAJ51215.1"
FT                   /translation="MSTHVAVIGAYGSAGIATAQRLAEMSEVEVTMIDDGEPGGGLCIL
FT                   RGCMPSKEVLSAAEHRFAARHDNRIDGPIPDVDLDAVVETKNERVLNFAAHRRAGVEKL
FT                   AEKENVQFRTETAEFIDDRTLSVGETVIEPDYIVIATGSTVNEPSLPGMEDVSMMTSAD
FT                   VLDATAFEDSGIVMGFGYVGMEMVPYLAEAGEMDLTVIEHDSRPLDEADPAFGDALLSY
FT                   YRDAFDITVLTETDERRVEPTADGGVRMSVRRNGHEETIEADQLFGFTGRRPAVDNLGL
FT                   EQTSLNPEPGWVPATMQARGSDRIFVAGDANGREPILHVAKEQGVTAAENIRAHAAGDE
FT                   LTSYQNIHHHVVFSGLGVLPYARVGHSVESAEASNHDFITVTREAASDGVFKSKNVPDG
FT                   LARLVVDVDGTVLGWQGLHYHADPMAKTMQVAVELGLDVRELPDRAYHPTTPEIIDGLI
FT                   RSATEKIESV"
FT   mobile_element  complement(138461..138569)
FT                   /mobile_element_type="transposon:HqIRS94"
FT                   /locus_tag="HQ_HqIRS94A"
FT   CDS_pept        complement(138474..138569)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1085B"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT   CDS_pept        complement(138596..139069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1086A"
FT                   /product="DUF457 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1086A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51216"
FT                   /db_xref="GOA:Q18DM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DM9"
FT                   /protein_id="CAJ51216.1"
FT                   /translation="MSDLLTHVLSMYVLSTLAVWQIDWFNRRYVGITMLGAVIPDAAKG
FT                   LLLTGPEFVVFGIRGSWYALQTIGSAVAFIFAGVLLFQADERPAIVGGLSLGVVTHMFL
FT                   DLLVIRTDGTAPAYLYPLTWARLPSGDIYLSSDIWPSLIIIGITSIIWYVDRR"
FT   CDS_pept        complement(139066..139524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1087A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1087A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51217"
FT                   /db_xref="GOA:Q18DS1"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DS1"
FT                   /protein_id="CAJ51217.1"
FT                   /translation="MNSTLWIRAIVFCLLLSLNGVMMIDYAHHAERQSPYPTAEEVKND
FT                   YQTHIGDQVNFWSQVSIVQEDTVGVTYGQPLYIQTSDLSVRSGDWVQVYGELNAKQELV
FT                   VERIVVSPQSNRLYMIAVSVGGVLLALIMFVRHWKIDTKRWIIVPRDP"
FT   mobile_element  139568..139620
FT                   /mobile_element_type="insertion sequence:HqIRS47"
FT                   /locus_tag="HQ_HqIRS47A"
FT   CDS_pept        139694..140296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1088A"
FT                   /product="TrmB family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1088A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51218"
FT                   /db_xref="GOA:Q18DS0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DS0"
FT                   /protein_id="CAJ51218.1"
FT                   /translation="MSNTPSDHSPHDTDKQDVQYDPDDDSYNILQCTQCDTTALSVGRD
FT                   DPPISCHDEPMEHINQVNMTVKPPDIREVLFQVFGLPKSGLDICLCVIGEGPLSASEVA
FT                   TKLDYDRTTVTRYLNKLVDLGLLRRSELNRENGGIINVYHSVDLEQMRLETLTGFYLWA
FT                   GEAATLIENANMTKQEYLAENPDQDLPDVFWESFPHK"
FT   mobile_element  join(140376..140401,140667..141014)
FT                   /mobile_element_type="insertion sequence:HqIRS54"
FT                   /locus_tag="HQ_HqIRS54A"
FT   mobile_element  complement(140414..140667)
FT                   /mobile_element_type="insertion sequence:HqIRS35"
FT                   /locus_tag="HQ_HqIRS35AC"
FT   CDS_pept        complement(141023..142003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1090A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1090A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51220"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DR9"
FT                   /protein_id="CAJ51220.1"
FT                   /translation="MDDAVRVRDAAREAVMDIEPGPLRTALHTRLTDTAMTPAVLTLAS
FT                   ARALSSSDESGDTDDMQDKGEDQDRDGPPISDGAGNASGGTHGHIPESGVNDSEVHSHD
FT                   PNAESSGNLNKESADESSGHRRLTQQTDAAENVHRLSLVDRAAGVQLIYEGLRLTRTLA
FT                   DTEPWVGSTTAKTGIKKDIDADLEVLAADVFVSRGFALLARTDAAGRAVDVVRAFGQDQ
FT                   TLQRIKDDENTTYDGNLEADIFALAVAVGASAVGKTATQAVLEYASELSHSYTGTRTGT
FT                   GTGTIDQGLPPEEIISETVKERIHMLNTTNQEKDNPMPSSTTDQY"
FT   CDS_pept        complement(142213..143040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE1"
FT                   /locus_tag="HQ_1091A"
FT                   /product="NAD synthase, ammonia-dependent"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1091A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51221"
FT                   /db_xref="GOA:Q18DR8"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DR8"
FT                   /protein_id="CAJ51221.1"
FT                   /translation="MQQSVLSTDAPLDLRLSPEELETVESHVSQFITDIVADAGADGAV
FT                   LGLSGGIDSTTVADMAVNALGAENVHGLVMPSEVNDDANMSDAEWVAEELDIPYEVIEI
FT                   QPIAESFFEAIPEAADDQMAVGNVYVRTRAVLNYFLANHENKIVLGTGNRSEALTGYYT
FT                   KYGDQAVDCNPIGNLYKQQVRQLAASVGIPEELVMKTPSAGMWVGQTDEEELGLGYDTV
FT                   DAILALHVDGPLSVDATVRQLDVTSEDITRVVELYEKSKHKRQMPPAPPSLSL"
FT   mobile_element  143140..143189
FT                   /mobile_element_type="insertion sequence:HqIRS69"
FT                   /locus_tag="HQ_HqIRS69A"
FT   tRNA            143369..143439
FT                   /gene="tRNAGly1"
FT                   /locus_tag="HQ_TRNA05"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon CCC"
FT   CDS_pept        complement(143716..143916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1092A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1092A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51222"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DR7"
FT                   /protein_id="CAJ51222.1"
FT                   /translation="MSESDDDPTRRALTIAVVEETHANEIPDNIDSDLYTTTRPESSFT
FT                   EFSAAPDGDLADALRRNGFDV"
FT   CDS_pept        144289..145371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1093A"
FT                   /product="probable oxidoreductase (aldo-keto reductase
FT                   family protein)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1093A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51223"
FT                   /db_xref="GOA:Q18DR6"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DR6"
FT                   /protein_id="CAJ51223.2"
FT                   /translation="MHYRTLGTSGVEVSEVGFGAWVVGTDWWGDRTRSDSIELIHHAID
FT                   QGITYFDTGDVYGHGDSESIIGDALAPYRDEVTVATKVGYDFYNNPQAGHGELPKEITG
FT                   EWIRNATRRSLDRLDMEYVDVLQLHNANVDEVDADVLETLDELREEGLVDAIGWALGPS
FT                   IGWLAEGDLAITEEFDSVQLVWNLFEQDVGNHFLNTIKKTNSSTSLIPRVPHSSGILNE
FT                   QVTPETGYDLDDHRGFRPDAWYETGWEKIETLRFLERDDERTMGQAAIAYLLSHDAVPT
FT                   VTPTFHTSEDISAWAAASDVPKLSAEELSKVSSLYAENFGIDRDDGMDQLRSSVDGEDI
FT                   RAAGINKRATRGPRNTASSD"
FT   CDS_pept        complement(145427..147022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemQ"
FT                   /locus_tag="HQ_1094A"
FT                   /product="heme-binding protein HemQ"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1094A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51224"
FT                   /db_xref="GOA:Q18DR5"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DR5"
FT                   /protein_id="CAJ51224.1"
FT                   /translation="MSEVPPTDEGWFVLHDFRTVDWDAWREAPTHRREAAVGDGVEYLR
FT                   KHESIADAEEGSSAVFSVLGHKADILITHFRPTLDALSRAERQFEQTTFAGFTTQPTSY
FT                   VSVAEISGYTTPGYFENPDAADEGLRQYMQGKLTPEIPNKDYAGFYPMSKRRGETYNWY
FT                   DLPIDERAEMMEAHAETGKEYAGKIKQVIASSVGFDDYEWGVTLFADDPTDIKDIVYEM
FT                   RFDEVSAKYGEFGTFYIGQRFPPADLGALLEGKAIPTVEQDVDAPTAHGEAHGHAHGDS
FT                   PHGSGGGGGSSHGQSPGGASAGGSAHGTEDADHSDSRSTTSADTTQSDTSTNTNTQDSE
FT                   IREQLAEYDIYAGQPHGEDVYATVLYSEATTDELFSEVEGLRGNFDHYGTHVKTAVYEA
FT                   RNRHRNAVVSIWETQSAAETAAGFISELPDVVSRAGEESGFGTMGMFYTVKSEYRGEFN
FT                   DTFDTVGGILTEMDGHQQTDLMINLEDENDMFISSQWDAREDAMSFFRSDEFSETVEWG
FT                   RDVLSERPRHVFLA"
FT   CDS_pept        complement(147190..149016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1095A"
FT                   /product="M50 family metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1095A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51225"
FT                   /db_xref="GOA:Q18DR4"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DR4"
FT                   /protein_id="CAJ51225.1"
FT                   /translation="MNTLLWVLVGLAAYSAGTFFLSQRGLLPKFVQVQGPFTTIHTQRG
FT                   REFIEWIAQPKRFWRAWTNFGVGTALVIMVGMFAFLLIQGISILQNPPAPSAVNQPENF
FT                   LVIPGVNDFLPLSVAPEIIFGLLVGLVVHEGGHGILCRVEGIEIESMGVFLLTIIPLGA
FT                   FVEPDEESERFASRGGRTRMFAAGVTNNFAITIIAFVLLFGPIIGSITVAPGLAVSGAY
FT                   DESPAATAGIEQGDRITTVAGTPISNESELNNILSERSNREITVKINDGTSAAKRESQT
FT                   LTVERELIVAGSVGGNPADINVDAEGDPIGVETVNGTAVYTQAGFSNAVGTDRFIELTT
FT                   TRGTTTIPAGAYLTRVASDGPLAQAGVPSNPGVIVTAIDGQRVVSSNELTAVLDTTQPG
FT                   EEVMVEAVVSGERKEYSVRLGENPQDGSGFLGVNIFPGTSGLLLTDFGAQSYPAGTYLE
FT                   LLGGEGGPGAIGLSGTIADSPLGAVYVSLVLPLASVVLGIPNFPGFTGAVHNFYAITGP
FT                   LEPIGSGVFLIANIAFWTAWINLQLGIFNFIPGHPLDGGRILRTSAEAVVSRLPLPASG
FT                   KRRLVRTITTSVGIIMLLSLLLLVFGPTVLSG"
FT   CDS_pept        149259..149810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1096A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1096A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51226"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DR3"
FT                   /protein_id="CAJ51226.1"
FT                   /translation="MFESRYYEVRREFGFGTAYHIYENQTPILKTAYSTLQRSESFRFS
FT                   DPQTGTDQFGIRETPTATVDEANTYDIIDAQTGERVGTVRRNIISHLQHEYTLSNDDGH
FT                   IVATLREDRPPVAVARRLLSSILPFSCEIIASGGTQAGIVTGALSLRDQFSIELFTTQI
FT                   DPQLAVVGTIVADAIEDIEL"
FT   mobile_element  complement(150058..150317)
FT                   /mobile_element_type="insertion sequence:HqIRS35"
FT                   /locus_tag="HQ_HqIRS35AD"
FT   CDS_pept        complement(150375..152042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="HQ_1097A"
FT                   /product="lysine--tRNA ligase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1097A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51227"
FT                   /db_xref="GOA:Q18DR2"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DR2"
FT                   /protein_id="CAJ51227.1"
FT                   /translation="MNNDTQTAETENAESTDEDEPQTHAFWAATAADEIEETDPTDPIV
FT                   IKGGVSPSGVAHLGNFNEVMRGYYIAEVLRERGHEVRQVFTSDDRDPLRSLPQRLADDT
FT                   GEIVGLGDVDAGALGRNLGRPYTDIPDPFGESKSYAAHFTKLLAADADRLDIPVEIISN
FT                   TEYYQEGKFEESIKCILEDIDTAREVLSEYQSKVDEDYVPFNPLCQNCGKITETVTDID
FT                   LDAQTVTYHCTDMTAGERAIEGCGHEGVATFREGKLPWRFEWPAQWQILDVDFEPFGKD
FT                   HAEGSWPSGTDIAENVLDTVPPIPMVYEWFTVNDESLSSSTGNIVTVTELLTLLEPAVI
FT                   RYFFALDPRRARDLDLENLDQLVDDFDRFERAYFDGVNDESINEFAEQAYPYVVENIDS
FT                   ERVRLPYTFAAVLGMTDDRSLQIEMARNEGHIDAETPEWAVTDALNRIEKARIWAERMD
FT                   NTYNYQLQETQPAIDIDPTSDTAKALDTLAEVVAEGSDGEEIQEAIFDIARDYDIPVGE
FT                   FFEVGYQLFFNQSAGPRLGKFLGELDAEFVVQRLRREG"
FT   CDS_pept        complement(152049..152774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="HQ_1098A"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1098A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51228"
FT                   /db_xref="GOA:Q18DR1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DR1"
FT                   /protein_id="CAJ51228.1"
FT                   /translation="MRVVVSIGGSVLAPNLDARRVEDHAAVVETLAEAGYDIAAVVGGG
FT                   GVARDYIGTARDLGANEVQLDQIGIDVTRINARLLIAALGSRVDPKVARDYEDAGDAVR
FT                   RGDISIMGGIMPGQTTDAVAAALAEYVDADLLVYATSVDGVYDADPSSQDEAQKYTQLL
FT                   PTELVDVVAPMSRDAGASAPVDLLAAKLIQRAGMRTIVLDGADPQHIESAVLDGEHNGT
FT                   DIIPPDGKDDLATWVHAEQ"
FT   CDS_pept        152956..153774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaE"
FT                   /locus_tag="HQ_1099A"
FT                   /product="molybdopterin synthase catalytic subunit"
FT                   /EC_number="2.8.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1099A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51229"
FT                   /db_xref="GOA:Q18DR0"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DR0"
FT                   /protein_id="CAJ51229.1"
FT                   /translation="MQVLGILGQDAGALCSDVIAQLDGAVAVIKTQETIDQTFNDPHNT
FT                   SSDVTTRYDLADTGHWRASGENHSVVDILDELSTTVDYTLVIGASNARIPTVLLETAVT
FT                   DIDHDSTHVVLTAETATAIDTEDVVTAIESAEPHITLSTLIDRVKSSSDADRAGAIATF
FT                   TGRVRARDSDDDPETVRLRFETYDSVADDRMREIESELSERDGVFAVELFHRTGIINDG
FT                   EDIVFVVVLAGHRAEAFETVSDGINRLKAEVPIFKHETTIEEDFWVHERN"
FT   CDS_pept        154132..154398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1100A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1100A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51230"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DQ9"
FT                   /protein_id="CAJ51230.1"
FT                   /translation="MSTTATPSTNADEDRSKEERLKNYLVSKAQDGEMYFKSKFIADEV
FT                   GLSAKEIGALMVKLRDSATELSVEKWSYTSATTWRVETTTEVA"
FT   CDS_pept        154723..155862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1101A"
FT                   /product="M50 family metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1101A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51231"
FT                   /db_xref="GOA:Q18DQ8"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DQ8"
FT                   /protein_id="CAJ51231.1"
FT                   /translation="MESLDPAVDPPVDALQSVFHLYETQRDGDRILYYGESLVPEQMLI
FT                   REAWPAFREAGYEIEVASTETREDVVVARPIDTSIDGIPWKNMLLFLATIVSTLLVGAI
FT                   TWYYIPPSDLLANPLTILQALPFTAAILGVLATHELGHYVMGRYHGVNVSLPYVIPFIF
FT                   PFGTLGAIIRMRGQMPDRRALFDIGVAGPLAGLTATVIVTVIGLTQSPIQIPARAMEQS
FT                   GQMIIFNNPPLLDIIATVIGEPTAYNDPRMSVSPIIIGGWVGMFFTVLNLLPVGQLDGG
FT                   HILRAMLGTTQERVAALVPVSLIALSAYLHYGLGYAFNESVGLWAFWGVLSAFVAFKGP
FT                   ANPIDDAPLGIPRVLLGVLTFALGALCFLLVPIEVATVS"
FT   CDS_pept        155869..156213
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1101B"
FT                   /note="gene has an in-frame stop codon and is truncated at
FT                   the N- and C-terminus"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT   CDS_pept        complement(156210..157106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="HQ_1102A"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1102A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51232"
FT                   /db_xref="GOA:Q18DQ7"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DQ7"
FT                   /protein_id="CAJ51232.1"
FT                   /translation="MDERDALGQIAKTLPQAGDDAAVISLDSVSLVITTDMLHETTDFP
FT                   DGTTRYTAGWRAVGASLSDIAAMGGQATAAVAVYGAPAFDPDEIDSFIAGAIDVCDAAN
FT                   AQYVGGDLDTTSELTIATTALGTVTHPSYRHGARIGDCICVTGNLGRTAAGLKAFETGD
FT                   IAHANELFRFTPRVNTGAALAKHTTAMMDSSDGLARSVHQLASASEVGMSLHWDAIPTH
FT                   PDVKEYVDDVSTRRELTTTVGEDFELVLTLPSSELANARETTSVPLHVIGEVTESDNGI
FT                   IIDDESLPDEGYTHATK"
FT   CDS_pept        157506..158552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1103A"
FT                   /product="UPF0104 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1103A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51233"
FT                   /db_xref="GOA:Q18DQ6"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DQ6"
FT                   /protein_id="CAJ51233.1"
FT                   /translation="MNIDDIRTTIIGFGSVIIIFAALFAFAGVEELIATVRTANPQYVA
FT                   LVIGATLTWLFAWSVSLHTVLQTLDVHLSYAASFLVFAGAMFSNNVTPFGQAGGEPITA
FT                   YLISRTADAEYETSLAAIASVDTLNLIPSITIALIGVGYFTTEVALGSRSNILLGSIVV
FT                   ITLATTILIFAYTAWRYRYEIEHRVVYALTPMIHWVADIVPRLPDIAEAEIETRIEGFF
FT                   RAIERVAANPRQLAVALGASTIGWICQMTALWLAFRAIGIELRTTFILIIVPIATIAGV
FT                   TPLPGGAGGIETVLVFLLLAAPLPHVTEAIAVTAVVIFRGAIYWVPVILGGGVVAWISS
FT                   GANIGSPN"
FT   CDS_pept        158750..159205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps19e"
FT                   /locus_tag="HQ_1104A"
FT                   /product="30S ribosomal protein S19e"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1104A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51234"
FT                   /db_xref="GOA:Q18DQ5"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR027548"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DQ5"
FT                   /protein_id="CAJ51234.1"
FT                   /translation="MVSVYDVPADALIEDVADRLADRIEEPEWMAYAKSGQSRELPPQQ
FT                   DDFWYVRAASLLRKVAKNGPIGIDHLAAEYGGRKRGSNRYRVASDHSTTGSKNIIRTAL
FT                   QQLENEGLVSTAKGQGRRISPEGQQFLDNAASDVLEELDRPELERYA"
FT   CDS_pept        159294..159656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1105A"
FT                   /product="PDCD5 family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1105A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51235"
FT                   /db_xref="GOA:Q18DQ4"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR022889"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DQ4"
FT                   /protein_id="CAJ51235.1"
FT                   /translation="MSETPDDLDELRQQRMEELRDQADGQQSQTSDNTAAAQEAAREKA
FT                   EAQQEALLKQHLTDGARQRLNAIEMSKPDFAEKVKKQLVTLAQSGRIQDRIDEDQMREL
FT                   LQELKPDSKSYNIRRR"
FT   CDS_pept        159664..160269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1106A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1106A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51236"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DQ3"
FT                   /protein_id="CAJ51236.1"
FT                   /translation="MDLAVLYSGGKDSSLAALLLEKFYDIHLITGSFGITDDWQHAAVA
FT                   ADQLGYSFETIELDQDVAEAAVTTMIEDGYPRNGIQRVHEHALEMAAQLDVTAIADGTR
FT                   RDDRVPTISRAQAQSLEDRHDIDYLSPLSGFGHHAIDELVTERLSIDTGPSVEIPKSDY
FT                   ETELRTLIADRVGPEAVTSIFPAHTQSYVNHLRSNDDT"
FT   CDS_pept        160411..161715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="HQ_1107A"
FT                   /product="histidine--tRNA ligase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1107A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51237"
FT                   /db_xref="GOA:Q18DQ2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DQ2"
FT                   /protein_id="CAJ51237.1"
FT                   /translation="MYDRLKGFRDFYPPEMTARRQVIDILETTATQYGFREVGTPTLEQ
FT                   TQMYVDKSGEGIEEELYAFSDDGGRDVTLIPELTPTVARMVVDKQQALSKPIKWVSTRP
FT                   FWRYEQVQQGRFREFYQTNVDIFGTADPIADAEILAFAADALRNLGLTASDFEFRVSHR
FT                   DILSGLLASITNDDADIDTRAAIRAVDKRAKIEQAEYHGLLTDAGLSYDQAQSFDDLLT
FT                   TADLDEIATVGNDIVTTAVQNLRSVLAAVDDLGVGEFCDISLTTARGLDYYTGVVFECF
FT                   DATGEVSRSVFGGGRYDNLIESFGGQPTPAVGVAPGLAPLSLLCQRAGVWPTEELTTDY
FT                   YILTVGDTRSVATRIARELRVNKNTVEIDIADRSFGAQMGYADSINAETVIIVGERDLE
FT                   NDEITIKDMNSGDQTTVPVEAFPGDHDAPTYEDVV"
FT   CDS_pept        161799..162617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="HQ_1108A"
FT                   /product="tRNA pseudouridine synthase TruA"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1108A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51238"
FT                   /db_xref="GOA:Q18DQ1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DQ1"
FT                   /protein_id="CAJ51238.2"
FT                   /translation="MRAFRLAYDGRPFSGFQRQPSVPTVEDALFDALDSLDVFNRDTDS
FT                   KPSGYAAAGRTDAGVSALRQTVGFECPSWCTPRALNSELPTSVRAWASADVQSGFHATH
FT                   DALQRTYTYYLYGPELDMNRLNTAAEILSGKHDFHNFTSDDDGTTRKLSITLEFDDPFI
FT                   TARITADGFPRSLIRRLMSALRGVGSESMTIETLTGLLNTVPQTGPDGIPTASPEPLIL
FT                   TRVTYPDATFRIDNRAINSLKSVFTHRYQRCLTQARVAEHIVSKSGSDQN"
FT   CDS_pept        162855..163013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1109A"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1109A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51239"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DU3"
FT                   /protein_id="CAJ51239.1"
FT                   /translation="MPHCENCGSFVTAEYVRVFAPEELDRPRVCPNCDDKVRDGADVRE
FT                   ARATRHS"
FT   mobile_element  complement(163120..163401)
FT                   /mobile_element_type="insertion sequence:HqIRS63"
FT                   /locus_tag="HQ_HqIRS63A"
FT   CDS_pept        163455..165254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="HQ_1110A"
FT                   /product="oligoendopeptidase PepF"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1110A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51240"
FT                   /db_xref="GOA:Q18DU2"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DU2"
FT                   /protein_id="CAJ51240.1"
FT                   /translation="MSSIPERNEIETEYTWDLSGIYTDAAEWESAYESVQDQLTDLKEY
FT                   EGHVTESPSTLLELLEQREEIFRTLATVSTYANLRSAEDTRDQESQARQSKAESLSSRA
FT                   RSAISFIEPELQELDSEEISSFCEREPALKQYEHFFDDVLRAKPHTRSSEVESVLADLG
FT                   EIASSPSDIYGMLSNADMTFPTVDHPDPGEDTIEITLGNFTKLQKHPDRAFRQTVYEQF
FT                   YDEWKDVRNTVGTALQNSVKKDVKYARARRYESARAASLDGPNVPVTVYDTLCETVRDN
FT                   LEHLHRHARLKQAALNLNELRPWDLYISLTGDESPKIPYDRATTYITDAVAPLGSEYQQ
FT                   RVADGLESRWVDVYENRGKRSGAFSSGAYDTQPFILMNYQDDISSMFTLAHELGHSMHS
FT                   ELAKNAQPWQYADYTIFVAEVASTVNETLLTNHLLETLEDDTLRLHILDEYLERVRSTL
FT                   YRQTMFAEFESTIHEIIEEGGALTPDRFDEIYCDLKETYYEPAVLDDRIAREWMRIPHF
FT                   YYSFYVYQYATGISAAIAIVDQIDTDGEDAAEDYRSALELGGSAYPIDILQTAGVDMTD
FT                   AAPIESALTGYADYLDQMEALVK"
FT   CDS_pept        165437..165637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1111A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1111A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51241"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DU1"
FT                   /protein_id="CAJ51241.1"
FT                   /translation="MDSGILCLFSDAFHSDQLGGNTVERPDTTPDTVRYTGRMNRFDWH
FT                   YRRVVPLNILMTAGVYCLHSI"
FT   mobile_element  165828..165989
FT                   /mobile_element_type="transposon:HqIRS12"
FT                   /locus_tag="HQ_HqIRS12B"
FT   CDS_pept        165884..165988
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1111B"
FT                   /note="product: ISH4-type transposase HqIRS12
FT                   (nonfunctional)"
FT                   /note="gene has an in-frame stop codon and is truncated at
FT                   the C-terminus"
FT   mobile_element  165994..166100
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AB"
FT   CDS_pept        complement(166117..167106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1112A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1112A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51242"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DU0"
FT                   /protein_id="CAJ51242.1"
FT                   /translation="MELLPDGRLSICEMSEDNYDSSGKLSNRLDSVSRHRSEREFDINS
FT                   DIDTNIDVGPESDETKIQATCLITITDTDTDTDTDISLTMTHNNSNIDNNDSAPSFTQL
FT                   RSDGGDPSVRPPADREEPVGEPVVRSDPAITGQRAREAVEFDPTDPASITSAAQTVRAF
FT                   SENTVGADDNVYILRGAAACAALVRGVGSYKQAVERAGGDVSISFVRKWARVHDLPQAI
FT                   RRHVARGDIAPTAAKHIARVSGLDRLDLAWAVIDADLTVREVRRIASEVDNDTTAAEAL
FT                   AERGITVGSIELSLPIPLYRELRRRASVENRPPGQIVSNTLEDIFKTD"
FT   CDS_pept        complement(167121..167345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1113A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1113A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51243"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DT9"
FT                   /protein_id="CAJ51243.1"
FT                   /translation="MTGVSSDSDRQIDAIDPEQRIDSDEQDRESEESNVDTASSDAAST
FT                   SNDESSHLDDLADGAGCTEIWEHLSESRD"
FT   CDS_pept        complement(167342..167569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1114A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1114A"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97802"
FT                   /db_xref="UniProtKB/TrEMBL:J7RUH5"
FT                   /protein_id="CCL97802.1"
FT                   /translation="MTDLNPQSAINSVAAIAIKRVAIVDSGTRKANTEQTNENKLRSES
FT                   KKNLDVTSRQHASADVAPELYNADTQESSQ"
FT   CDS_pept        167788..168120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1115A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1115A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51245"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DT8"
FT                   /protein_id="CAJ51245.1"
FT                   /translation="MTVRLRVLDDGAWISVNDRREVSVSELWRVEATDFCSCDLVDFVV
FT                   ENFQTVGVNGQTIEVIVYGQCIACGATGETEWLPVGRVIDGEFAVFDESTVRRTRESRK
FT                   PETNSG"
FT   CDS_pept        168189..169937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirA2"
FT                   /locus_tag="HQ_1116A"
FT                   /product="probable sulfite/nitrite reductase (ferredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1116A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51246"
FT                   /db_xref="GOA:Q18DT7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DT7"
FT                   /protein_id="CAJ51246.1"
FT                   /translation="MPTDVERWKSEVYGQEIREHLFEFAEEGYDTIPEDERDAWFERFK
FT                   WWGLYHQRNGQEGYFMMRIGTPNGVMKPGQLRVVGEIASEYATGPGVNPIFGDGYADFT
FT                   TRQSIQLHWIELSDIPDIFEKLEENGLSTQQACGDSWRNIVGNPVAGKDAREVIDAWPV
FT                   IHDLNETFKGNDDHSNLPRKWKVSVTGTPDGSGQGDINDLAFEPAYKTIDGEETVGFNV
FT                   RVGGGLARNEPRFARDIDVWVPPADVSTVAGGLSALFRDNGDREDRYNARIKFLVDEWG
FT                   ADKVRETLQSEYVDFELHTAGRDVREEYTYNTGDGDRNDLIGVHEQHDGSYFIGLNVLV
FT                   GRMGASDVLELADLASEYGSGEVRLSQRQNIIVTDIPKDAVDEFTSEQLLENYSPDPSP
FT                   FMRGSVACTGTEFCSLSIVETKNRQVRYARWLKDNVTLPGDVDEFHIHLSGCTASCAQP
FT                   QIADISLRGMKTRKNGEPVEALDVGLGGGLGAEPQFARWVTQRVPVDEIPGAISNLIET
FT                   FAAERNDDESFRAFIDRHDNDELDSFVAPEETDYEDPMMHNTKRTWYPYAENDGLDAGP
FT                   SAPADD"
FT   CDS_pept        169943..170242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1117A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1117A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51247"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DT6"
FT                   /protein_id="CAJ51247.1"
FT                   /translation="MSDRLLRVNAYTTLDLADIRARGHDFDVNTLGVVNVTAPRKNPDH
FT                   VTLQVEIDHTTVEMLPAHADEVTLSASEARTIADDLHSYADRVENAQSSGSDDA"
FT   CDS_pept        170542..171168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1118A"
FT                   /product="Lrp/AsnC family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1118A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51248"
FT                   /db_xref="GOA:Q18DT5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DT5"
FT                   /protein_id="CAJ51248.1"
FT                   /translation="MLDETDIQILELLIEDARRSYTDIAQVVNLSPPAVSDRIDRLGES
FT                   GVIRRFTVELDRSQLRAGVPILVTLRPLTSAADSVYSAVRESPKVEHTFMTANNTITFS
FT                   AHVRGDRVRAAINDIVDPSRIDSYDVSIVDTAEWSPTVGETEFALSCAECGNTVTTEGR
FT                   SEQIGGTKRQFCCPSCLDRFRKRYNRIEADADTRQKTNAGSDDVQ"
FT   CDS_pept        171256..174084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="HQ_1119A"
FT                   /product="P-type transport ATPase (probable substrate
FT                   copper/metal cation)"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1119A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51249"
FT                   /db_xref="GOA:Q18DT4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DT4"
FT                   /protein_id="CAJ51249.1"
FT                   /translation="MPTQSTRIDIAGMSCATCSQSVQDALSSLSGVETVSVNVATDEAA
FT                   VTHDPTTVSVKQLYDTISSAGYDPLDERASIGITDLSCSSCAQTVESALESVSGVLTAD
FT                   VNAAIDEAQIQYNPAMMARSDLADIITSAGYTPIADGSNPRNSHDVSTENNSNDTDINT
FT                   ESDNTDARETARTAEIDRQRRLTIFGAVLATPLVGFLLAHLFMPNAIPATIPYLDIPFG
FT                   WVAFALATPIQLVLGREFYENSYTAVVRNRTANMDVLIALGSSTAYLYSVVALLDILPQ
FT                   AGLYFDTAALILVFITLGNYLEARSKGQASSALRTLLEMEADTATIIEDNTEQTIPVSD
FT                   ITVGDQLRVRPGEQIPTDGAVIEGSSAVDESMVTGESVPVSKSPGDTVVGSTVNQNGVI
FT                   TIEATKIGSDTAIQQIVQTVKKAQSRQPDIQQFADRISAYFVPAVIINAVVWALLWFAF
FT                   PSALASLTEFIPAIGIIAGGPVVAGGTVSTVEFAVLVFASAVLIACPCALGLATPAATM
FT                   VGTTIGAKNGILFEGGDVLERVRDIDTVVFDKTGTLTTGEMSVTDVIALNPQTDGGQLD
FT                   SEHNSLLDSNTRSSGASIDTDSDADVDAEIKTKTDIDPDPDLVRTPREMAVLRLAAAAE
FT                   QNSEHPLGDAIVSAARKCDLNIPTATEFNAIPGQGVRATVDQQTVIVGNDRLLKNAGID
FT                   IDPAASTLRELESDGKTAMLVGVIDNPDVSIFDDTDTDTEITDTRRLVGVIADADTIKD
FT                   SAMDAVETLRARGTTVHLITGDNERTAKAVASQVGIDPENVRAEVLPEAKADAVETIQS
FT                   AEDSRVMMVGDGVNDAPALAAAFVGTALGSGTDVAIEAAEVTLMRDSPADVIHAIRISE
FT                   GTLSKIKQNLFWALGYNTAMIPLASLGLLQPVLAAGAMALSSVSVLTNSLLFRGYDPNS
FT                   RYRFLNSLRRNK"
FT   CDS_pept        complement(174224..175651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1120A"
FT                   /product="flavin-dependent pyridine nucleotide
FT                   oxidoreductase (homolog to coenzyme A disulfide reductase)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1120A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51250"
FT                   /db_xref="GOA:Q18DT3"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DT3"
FT                   /protein_id="CAJ51250.1"
FT                   /translation="MTDPFVVIGGDAAGLSAASKYRRESPARDVVVFEQGSWVSYAHCG
FT                   TPYFIKGDVEHLRDLQSLSPRDIEERGIDLRRDHEVTAIDTKSDVITVVNNGESFEYPY
FT                   EELLIATGARAISAPIEGADLDTVFTLHGLPDATALRSFLTPPAEFDSANLGGGAALTT
FT                   SVAEQYGAMQPPETIAIVGGGYVGVEMAEAFSAWDCAVHLFQRPERLLPAFGTAVGDAI
FT                   ASTLKKAGVTLHLNEEVERLTETDGQLDDIVYGGGNRLNVDAVLIGIGIRPNVELLTET
FT                   SIELGTTGAVAVDEYGQTNVENVYAAGDVAELKQIVTGETTWSPLGLPANRAGRAIGAT
FT                   VGGSPTQVGHVAETAMLKAFELGCGRTGVLEHDRAEAAGFDPITKTITAGSRSGYYPGA
FT                   EETTVTLTADQKSGQLLGGSLVGADRAAVRINTIATALGAGMTVGELEQQDLGYAPPFS
FT                   PVWDPVLVAAKVLNGKL"
FT   mobile_element  join(175779..175990,176101..176146,176254..176588)
FT                   /mobile_element_type="insertion sequence:HqIRS60"
FT                   /locus_tag="HQ_HqIRS60B"
FT   mobile_element  complement(175991..176100)
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AC"
FT   mobile_element  176147..176254
FT                   /mobile_element_type="insertion sequence:HqIRS42"
FT                   /locus_tag="HQ_HqIRS42AB"
FT   CDS_pept        complement(176613..177845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1121A"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1121A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51251"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DT2"
FT                   /protein_id="CAJ51251.1"
FT                   /translation="MDIRFLGGAEEVGRSAILINDRLLLDYGMLTGNPPQFPIETPRPD
FT                   AVVVSHGHLDHVGAIPSLLSGDRRPPIHWTAPTQELALTLARDTLKLHGGTYDCPFTQE
FT                   ELHRVTQVSETHGYRETFDVADHSITFYNAGHIPGSAHVLIDDGDTRLFYTADFHTENQ
FT                   RLVSASTARPEADVVICESTYSDVQHDPRKQIETRFVESVRTTMWQGGTVIVPAFAIGR
FT                   TQELLLVCAANNIDCYVDGMGKQVTKMLKEHPQFIRGEEALGHAKSNARFVTGRDGQRK
FT                   RIAEQNTVIVTTSGMLSGGPAMTYIPEIRSNPTNKITLTGYQVEGTPGRSLLETGRAEI
FT                   NDRIMPISAQVEWYDFSAHADKDGLMELLNEYKDTRVLINHGDRCQRFADELNASEFDA
FT                   TAPTLGQEISI"
FT   CDS_pept        177949..178800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1122A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1122A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51252"
FT                   /db_xref="GOA:Q18DT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DT1"
FT                   /protein_id="CAJ51252.2"
FT                   /translation="MQRRAAAVYVALFIIVGAGAYSLIATAEAPHVEFEDPTYELSSSD
FT                   QFELGGQTYTVASISTMEQGGDHGGTATTVTQGAIQYTNESAQYAASFENNSTQTVDQQ
FT                   QWQVLVDRNGDDPTRLTFRESINQTAILEADPNVSTETVTQDSEEYVVRNGNELIPAAE
FT                   YFPEPETQSYAEGDTLAYQGNTTTINTVTNESIQLVWTAPRTNTIDVGHNDNITVGDET
FT                   YLAHFPSDSTLQLTQNFESYQQQKAAMERYQTQKNGLWGVSIASGLTVVFLIGFAYLPS
FT                   RY"
FT   mobile_element  178827..179216
FT                   /mobile_element_type="insertion sequence:HqIRS46"
FT                   /locus_tag="HQ_HqIRS46B"
FT   CDS_pept        179341..179502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1122D"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1122D"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97803"
FT                   /db_xref="UniProtKB/TrEMBL:J7SBM0"
FT                   /protein_id="CCL97803.1"
FT                   /translation="MSAQNYQDIGSHWCPDCGNEMNLNGVQPAGYAQFFCEYCRYRRDR
FT                   FVGAVADD"
FT   CDS_pept        179827..180447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1123A"
FT                   /product="glyoxalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1123A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51253"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DT0"
FT                   /protein_id="CAJ51253.1"
FT                   /translation="MVDNTDATSVTADQPDSPIQTTGTDHITIWGSNETDTIEFYQELL
FT                   GMPLVLRQPNLDDPSQTHLFFDTGDGRILTVFVGDRQSTQQQRGGIGAVHHLCFSVAPS
FT                   DFEDVMAALEADGRGYNVFDRGVFFSLYTQDNNGLIIELSTDKYDIPAERRGEVLAKAQ
FT                   ELRVADDADYAKDKHLAAALEALNIDAHAHDLPDATSGVGGIN"
FT   CDS_pept        complement(180479..181516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1124A"
FT                   /product="oxidoreductase (homolog to zinc-containing
FT                   alcohol dehydrogenase)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1124A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51254"
FT                   /db_xref="GOA:Q18DS9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DS9"
FT                   /protein_id="CAJ51254.1"
FT                   /translation="MSAAVYYGPRDIRVENVVKPTLEESTDAVVRVTHTAVCGSDLWFY
FT                   RGKTDRDIPSRVGHEPMGIVEEVGDDVQSVDVGDRVFAPFKISCGMCEFCRRGLHTSCV
FT                   NGDGWGDDNGGAQGEVIRCRHADGTLVRVPDAYANDDSALRSILPLTDVMGTGHHAAVS
FT                   AGVSAGSTCVVVGDGAVGLCGVLAARRLGAARIVAVGHHPDRLSLASEFGATDTVSARG
FT                   QEAIETVQEMTGGGAEHVLECVGATSAMETAVEVCRPGGTVGYVGVPHGLDDGLDLFSF
FT                   FGDNITLQGGVAPVRAYADELLADVLQGTLDPAPVFTKTVDLDSISEGYQAMDERDAIK
FT                   VLVEI"
FT   CDS_pept        181706..183331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cat1"
FT                   /locus_tag="HQ_1125A"
FT                   /product="transport protein (probable substrate cationic
FT                   amino acids)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1125A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51255"
FT                   /db_xref="GOA:Q18DS8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DS8"
FT                   /protein_id="CAJ51255.1"
FT                   /translation="MSQGTREPTAELGLLDATMIGMGAMIGAGIFVLTGLAAEISGPAA
FT                   LLVFVLNGIVTAFTGLSYAELAASIPKSGGGYAFVREIFDDRSSFLLGWMLWFAYMIAG
FT                   ALYALGFAPNFIELLHVYGFTPKPGAVNAIALPIISVDIPVQLGLAFIAVTFLVVVNAL
FT                   STAASGSAETFFTITKVLILLIFILFGFLSAGGGEPTSFTLQNFDPLFPDDSSALSILP
FT                   AMGLTFIAFEGYDLITTVTEEVENPRENIPKAIFLSLAATVIIYALVVSVAIGTLGASG
FT                   LAQAGEAGIAAAATSFMPTGLPIIKNGGAVIVFGAVFSTLTALNAVVIASSRVAFAMGR
FT                   EGQLIGSIGNLHHRFGTPFVAIIVSGAVMLFSVALPTASAGNMSSLFFLLSFIIVNFSV
FT                   IKLRRERPDMTRPYKIPYYPAPPIIGIILNVLLTGVLVWYLTQTDQLALLLSVGWITLG
FT                   LLAYYGLNWLRSRSNPTPSGGGGGGGSTPDGPTSGSGPGPDSDPDPTPTSDPIDAAITD
FT                   SNPSLSGDTDTQEAHTHTTAQEEV"
FT   CDS_pept        183334..183987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA1"
FT                   /locus_tag="HQ_1126A"
FT                   /product="TrkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1126A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51256"
FT                   /db_xref="GOA:Q18DS7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DS7"
FT                   /protein_id="CAJ51256.1"
FT                   /translation="MSSNQPRTVIAGGGRVGRRTANILSDRGYDIVVIEPNSDRAQTIA
FT                   DDYVATVIEGDATRPAILEQVNLDRVDVIAALTAETGTNLAICLAATRMVPDLKTILRT
FT                   DVETRGEYDDWVDEVVFPENAAARVAANTVESDVRAIEDTTGSLDLLEVTVAPSAPVAE
FT                   RTLEEVGLPRGCLVVAGTGGNRIAGPETELIPDETYTIAVEPSVSDEVLQLFRG"
FT   mobile_element  complement(join(184003..184335,184727..184782))
FT                   /mobile_element_type="insertion sequence:HqIRS78"
FT                   /locus_tag="HQ_HqIRS78A"
FT   CDS_pept        complement(184024..184212)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1126B"
FT                   /note="the underlying mobile genetic element is noncoding
FT                   but has a region of high similarity to the C-terminal
FT                   region of transposons with an IS1341-type transposase gene"
FT                   /note="pseudocoding frame (HqIRS78 element)
FT                   (nonfunctional)"
FT   mobile_element  184336..184726
FT                   /mobile_element_type="insertion sequence:HqIRS46"
FT                   /locus_tag="HQ_HqIRS46C"
FT   CDS_pept        complement(184916..186199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1127A"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1127A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51257"
FT                   /db_xref="GOA:Q18DS6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DS6"
FT                   /protein_id="CAJ51257.1"
FT                   /translation="MSTTTTDKNRWLIAVSAILIHVSIGGIYAYSIYQNPLSETLGWAV
FT                   SDVTLAFTISIFVLGLTAAFLGIFVERYGPRIAGLTAAILYGIGTVGAGVSVQLQSLPL
FT                   FFATFGVIGGMGLGIGYISPISTLVAWFPDRRGMATGMAVMGFGAGALLTGPVGNFLIQ
FT                   QYSISTAFYGLGATYFVLMTLGASYLKKPPDGWLPSGMTEDDLAAEDDEGGIWGDLEEL
FT                   TAREARKTPRFWMVWLIIFINVSAGIMLLAFASPMLQSIGGASATTAAFIVGYIGIFNG
FT                   AGRIAWSSLSDYVGRTAVYGAFFAIQIVAFFLMPQVSGVWILAGLLFLIITCYGGGFAC
FT                   LPAYLSDLFGTTEVGAIHGYSLTAWGLAGVAGPTLASVILESTGDYTTALYIINVVLIA
FT                   GLLTVGALRWRINTIEDAQTAPVTAAGD"
FT   CDS_pept        186373..187881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1128A"
FT                   /product="homolog to NADH dehydrogenase 51K subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1128A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51258"
FT                   /db_xref="GOA:Q18DS5"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DS5"
FT                   /protein_id="CAJ51258.1"
FT                   /translation="MTILTPTDGLQLRVAGVDALDNTEIDLDAAIESPVATVGSTGAIA
FT                   AEPLLMATTDGTTAFYPACSSTRLETVAHRIDETGDITVADPAAVVDHDPETPEMPTTG
FT                   LSTLQDESRRVLSGSGWRRPANVDDYDAAGGFLKDIDPDAVFDAGESIHGRGWGDACHD
FT                   SPLTKTWMDADDAEGEAAIVINAHSNPGDSLLLSSVPFTILDGAVSLAQTVDASEIVIF
FT                   ASIADESTIETARTAIDRYPNESSIAIDLVTGPAEYRAAEPTMALEAIEGNHRLEARLR
FT                   PPGPESVGLYGRPTLIHTARTLAHLAVSLREDSIDSHPSTRIMSIEGDVTDRTIIEVPE
FT                   TTTLETVCAAADTTDGIKAACVGGRFGGLAADLDISVDPETLIDANLGTEGIVHVLSED
FT                   RCVVEFVGERAQFAAEENCGRCVPCREGTTQLAELLRSLYDGTYQPEAIDELIRVMTTT
FT                   SICEFGVNAGRPTQTALNAFESEFEAHANGRCPTGSCLATMEAQ"
FT   CDS_pept        187881..188924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1129A"
FT                   /product="iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1129A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51259"
FT                   /db_xref="GOA:Q18DS4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DS4"
FT                   /protein_id="CAJ51259.1"
FT                   /translation="MSSERDNRNHAHTHSNHGHDHPDAPPLTEDIAPGTATDPDVGSET
FT                   SSTLTVDGRVVSVAAGATILDALNAVDTEEYVPALCSYEREDQIGPRSECRTCMVETET
FT                   HGIVPACSFPAEDGLTVQTDAEAAAEARDVNLDLVLSDHNLRCTACGKNGRCELQDAAI
FT                   EQEVDEPRYGVLEDRDEYEPIDDSSPFIQIDRNKCILCNRCVEACNDVQVAGVLQMEGS
FT                   GQDTRIGFQNDSPTMEDSTCVSCGHCATVCPTGSLVEKGIEDATTIPLPGFNQKNSVGK
FT                   TIEGTGEDKEPMTQKKRQHSTNTNANAQTDGGTASVEHSNSNTEDKNNTNQTDDSGWKD
FT                   ISSGEWP"
FT   CDS_pept        188921..191239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1130A"
FT                   /product="probable anaerobic dehydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1130A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51260"
FT                   /db_xref="GOA:Q18DS3"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DS3"
FT                   /protein_id="CAJ51260.1"
FT                   /translation="MSSDNDLNGVAGYMQHAKEQALSNVENIAEDIAADTFPEGKLFEI
FT                   AQAIGDKRLEELNVADTTCGYCAVGCRFDLYSDGEEILAARPTEDEDAPINGISTCVKG
FT                   KFGYDFINSDDRLTAPLVRDESGQFREATWDEALSRVADGLGEIRDTHGGEALSVIASS
FT                   KATNEENYLMGKFARQVLQTNSIDNCNRLCHSSTVAALGQTYGYGAASISTDDLEIADC
FT                   ILLTGSNTTEAHPVLATQIKQNVRDGADLLVFDPREIQMAEYASQYTQVKPGYDAVWIN
FT                   GITRYIIEHDLYDETFVAEQTTGFEEVQESVEEFTPDRVEKITGVSHDEIASAAEMIAD
FT                   ADGCVFGWTLGLTEHSHGTENVIAMANLAAITGNLGKPGAGVSPFRGQNNVQGGGGDMG
FT                   PLPDNFPGYQDIADDDVRAKFEDAWDCEIDPEYGYYTTQMFLEAAEDNIRGMYIIGENS
FT                   ALSEPGVNHAEDVLENLDFLVVQDLFVTETAKYADVVLPASSFVEKTGTFTNTDRTVQM
FT                   VNKVMEPKGDSRPDWIILQELANRMGRSWDYDSTAEVMDEINSLTPIYGGVSHERVKEN
FT                   GGLQWPCWDMDHPGTVRLYEDEFNTDNGKVNLKGVGYSEPAETPTEEYPLTLTTGRVLY
FT                   QYHTGTMTHREEGIMQYNPSDFVEINPATAAGMGISGGDPVRIESRRGETVVPAQITDR
FT                   VGPENVFVPIHFTESAINRLTDEEHLDPTAATPEYKVSAVRVEPADADALDADVDTGQE
FT                   AMSQSLSSDDRTSMSTGDD"
FT   CDS_pept        191242..192030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1131A"
FT                   /product="DUF1641 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1131A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51261"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DS2"
FT                   /protein_id="CAJ51261.1"
FT                   /translation="MAKPADEYPNSATNGTQEAITNGSINLHADDDTSSQEALDTDGAA
FT                   ALTAAIDAHGEDLAAVIERTDELNDALTTAIIVLATADEEELEYVTNSAANLIQAADGL
FT                   STEGSAALATELGKNADDLSESLDTVVTLQRDGHLDDLAMIATAFANSLSSNEVEELSA
FT                   ILENNGTEIVEALDLVLELQREGQLEELLDLAKTLSVLEIDEDTARGLNQLLQSVSEAQ
FT                   RESEPVGLFGVLGHLRGSRARAGIGYFISILKSQGRRLQE"
FT   CDS_pept        192141..194228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1132A"
FT                   /product="probable anaerobic dehydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1132A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51262"
FT                   /db_xref="GOA:Q18DW5"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DW5"
FT                   /protein_id="CAJ51262.1"
FT                   /translation="MTNNASDNSATICPRCGVGCRLRRREDTSRTGRAKGINGPANPNG
FT                   RLCRRGINAFDFSLDDPETAAKTGVDNPETGRLIHPRCALPETEPTDNADSTHMRRISW
FT                   QTAYETICDRFSAVREIHGPDALAFLGAPHCTNEENYLLQKLARTLGTNNIDNRARHCH
FT                   RETTRTLASRLGYPATSTSLDEILDADVIIAAGANPADRQPIAFNSFIRPAVSEGATLI
FT                   HIDPVGNETTRLADIHLAPRPGYDAAVFDLLSTIIVEQGGIDETFLSERTRNAERFQQS
FT                   LMTLDADDARVAADIDAESLHCVAQAIIDADHVIALTGTGVDESGHTETNQPDPNAPAA
FT                   LIHLLGLTGNLGCPGSGVIVLRGLINEQGATDTGCVPDRLPGNQSIQNPEARARVGDVW
FT                   GIDPPSTPGTSATALLDGFGNDIHAALVVGENPALSKRDPSWVKDQLNSLDTLVVIDPL
FT                   WSTTAEYADVVLPAATGVEKRGTVTNLERRVQRLTQTQAPPGQARTDFRILSDLGRRLI
FT                   GETFDYQNIEAVFTELTQVSPPHAGISYTDVGVDGQQWPFHTDSRLYDKEFLTSDGKMS
FT                   FGTVQSIPVVTDDSAQTFTLLTNGRTSEVYGETEKENPQVQLHPTDAKKHDLTDGMIVT
FT                   IENADAAVEATVTIETSVRQGTLSIAAVAADPLIRAETGDSVVTIASSSHSDDVDTTNQ
FT                   S"
FT   mobile_element  194257..194367
FT                   /mobile_element_type="transposon:HqIRS6"
FT                   /locus_tag="HQ_HqIRS6A"
FT   CDS_pept        194257..194367
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1132B"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: ISHwa2-type transposase HqIRS6
FT                   (nonfunctional)"
FT   mobile_element  194370..194477
FT                   /mobile_element_type="insertion sequence:HqIRS42"
FT                   /locus_tag="HQ_HqIRS42AC"
FT   CDS_pept        complement(194741..195016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1133A"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1133A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51263"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DW4"
FT                   /protein_id="CAJ51263.2"
FT                   /translation="MTRTHVTCVNCGEEFVRGGNYHGNYCPECHEAWLSEEPDYEGETD
FT                   EGPRPFGHRSPSSAESESSTGTEDGDESTNNDSNTSSASSGFNANE"
FT   CDS_pept        195112..195744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1134A"
FT                   /product="DUF309 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1134A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51264"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DW3"
FT                   /protein_id="CAJ51264.1"
FT                   /translation="MDETLYAAAVLFNAGEYRPAQTACHLIYQQEDLSTDDQTVCMAFK
FT                   ESATAINNAETHNWVSAATAASNASTKFAAIRASQPSIVHNQLCEYISTLSSDPVVIER
FT                   RRVPSWYIDTERPTVATLRFDAIGYAASAIASHLEDVDTDIIADAIQYGHDEVGTNSRT
FT                   HTESDGFIGTLSVFVRDSDHRRLIYDRLYNHVERRRQREQDIDGLFD"
FT   CDS_pept        complement(195878..196669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azf"
FT                   /locus_tag="HQ_1135A"
FT                   /product="glucose-6-phosphate 1-dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.388"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1135A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51265"
FT                   /db_xref="GOA:Q18DW2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DW2"
FT                   /protein_id="CAJ51265.1"
FT                   /translation="MDEPVLLTGASGRVGEAILRHAGEDFAWRLFDREPVPRDRRPSRV
FT                   AADDVFISDVTDTNALINAIEGCKAVIHLAGDPRPEAPWKSVLENNINGTQAVYEAAVN
FT                   ADVDRFIFASSNHAVGSYETNERTPAMYRSDDTYRLDGRELPRPSNLYGVSKATGEIIG
FT                   RYYHDNHGIAVANVRIGNLTEGHPPIDYERGQAMWLSYRDCAHLFSRCIDAEYEFEIIY
FT                   GISDNDRKYYSIAHAKETLGYNPQDNSAEWQGKERIVKKGE"
FT   CDS_pept        196806..197180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mptD"
FT                   /locus_tag="HQ_1136A"
FT                   /product="dihydroneopterin aldolase, archaeal-type"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1136A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51266"
FT                   /db_xref="GOA:Q18DW1"
FT                   /db_xref="InterPro:IPR007181"
FT                   /db_xref="InterPro:IPR027508"
FT                   /db_xref="InterPro:IPR036839"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DW1"
FT                   /protein_id="CAJ51266.1"
FT                   /translation="MQTTAATTAEEACFEAGIKFGTLYHQFAGTPVSPASASTLEDAIA
FT                   DAIENQPHCEAVSVTVRTDRLETALAEQSAEYTELTGKFFDVTMQIEYNGCRVQTQMTM
FT                   DGDYPLMEIVAVESPTDDSS"
FT   CDS_pept        197272..197679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1137A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1137A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51267"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DW0"
FT                   /protein_id="CAJ51267.1"
FT                   /translation="MSSQSTLSDDDLFGEAAEEMREEVEAHLDNAHAALPDAASMWQTN
FT                   ADNVLGALNGLRSALDAGDAEEHLRQAKKTFVVGTRADAFDDPDELRSEVESVEELLSS
FT                   INTADELASELTTTVPQLHDQLPEADEESDE"
FT   CDS_pept        complement(197897..199849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1138A"
FT                   /product="ABC-type transport system ATP-binding/permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1138A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51268"
FT                   /db_xref="GOA:Q18DV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DV9"
FT                   /protein_id="CAJ51268.1"
FT                   /translation="MDAVPADDDDPFESQRERVSNPMRRLFSTYGRENIPAIAVGVISS
FT                   IAARVLDLLPPVLLAVAVDAIFLDERTFSLWFVPAAWIPTDQVGQLYISVALIAGAFFG
FT                   AAGFHWTRNWGWNAFAQRVQHAVRTDTYNEMQRLSLSFFADKQTGEMMSILSNDVNRLE
FT                   RFLNDGMNSAFRLGVMVIGIAAILLYWNWQLALVTLSVVPLIGYFTYRFVKIIQPKYAD
FT                   VRSSVGQLNSRLENNLGGIQVIKSAHTENFESDRVDDTSQEYFDSNWDAIKTRITFFPA
FT                   LRILSGVGFVLTFLIGGAWVLTYQQTGQAPLFFSGSLTPGEFVGFILFTQRFIWPMSQF
FT                   GQIINMYQRAYASAARIFGLMDEPARIVNDPDAPALDVDTGTVQYSDVTFGYETDEEPT
FT                   IKDISFEIPGGETLALVGPTGAGKSTVLKLLLRMYDVDEGAITVDGTDVREITIPSLRE
FT                   SIGYVSQDTFMFYGTVAENIRYGTFNASRDEIIDAAKTAEAHEFVMNLPDGYDTEIGER
FT                   GVKLSGGQRQRLSIARAVLRDPEILILDEATSDVDTETEMLIKRSIERLTADRTTFSIA
FT                   HRLSTIKDADQILVLDDGEIVERGTHTDLLGADGLYAHLWGVQAGEIEELPETFIQRAT
FT                   QRASQTSIETDAADD"
FT   CDS_pept        complement(199926..200327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1139A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1139A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51269"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DV8"
FT                   /protein_id="CAJ51269.1"
FT                   /translation="MNNVPDEEQVGDNQIEEAAETHAGGDQSISKSANNKYENVDTVAD
FT                   NNTLDGLSELEGWSVDTYAARVHYQGESDRYSIEFYAPSNCVLYWKVKGDGETAVPVGR
FT                   MTVPDPLRTRIRSDLADAGIDPAVEDRTL"
FT   CDS_pept        complement(200634..201131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1140A"
FT                   /product="DUF192 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1140A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51270"
FT                   /db_xref="GOA:Q18DV7"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DV7"
FT                   /protein_id="CAJ51270.1"
FT                   /translation="MNRTLFLRAVIVAIGVLVVGVIVITVIPGIGPTGEYDSETVKITD
FT                   NKTGNQLERVSVRIADTPQKRYTGLSNTESLAEDEGMLFIHDSEDRYGYVMRDMSFPID
FT                   IIFIDATGTITRIYHAKVPTDTTTDELNRYSGRGRYVLEVSYNYTERHNITIGDEIQIN
FT                   RQ"
FT   tRNA            201346..201418
FT                   /gene="tRNAVal1"
FT                   /locus_tag="HQ_TRNA06"
FT                   /product="tRNA-Val"
FT                   /note="anticodon TAC"
FT   CDS_pept        complement(201481..201807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1141A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1141A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51271"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DV6"
FT                   /protein_id="CAJ51271.2"
FT                   /translation="MSDDSEPSDGVSVSMSLSGEYNEVMSKLRIDTTGADILEPLLADA
FT                   EAVLEAVEQLDGGTRSVVAEQLTDESSLSDDADAVVTLLQVLERYELVHLDGNTWKPGA
FT                   RLRE"
FT   CDS_pept        202075..202563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1142A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1142A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51272"
FT                   /db_xref="GOA:Q18DV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DV5"
FT                   /protein_id="CAJ51272.1"
FT                   /translation="MIMSEHSARLLWVALFGIVLSIGLSALTTVYLIIAITSGIITATP
FT                   LAELVVDVAIPAIIALGVFSILWIASVMSLLWALFQWIMQIESYQLATVFARVEEIIPP
FT                   ISVFHLPARFTPMPASIERDLSIETTRALASLRRQYVIGDISDATFERRMERLLMKSD"
FT   mobile_element  complement(join(202944..202980,203089..203106))
FT                   /mobile_element_type="insertion sequence:HqIRS82"
FT                   /locus_tag="HQ_HqIRS82A"
FT   mobile_element  202981..203088
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AC"
FT   CDS_pept        complement(203154..204008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1143A"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1143A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51273"
FT                   /db_xref="GOA:Q18DV4"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DV4"
FT                   /protein_id="CAJ51273.1"
FT                   /translation="MSEWGWRIDTTGWQSVARTDARRARRTPTILVLLSITIITSIGYS
FT                   IAYTYVGPSELTFMGFLDGITTLLSFIIPAIGLLLGYKSVAHARNTGSILLALSFPQSR
FT                   AGLIIGTVVSRWALLVGAISAGLTLSGAIAAILYGTNGIVAYPLAILMTLLYSAAFIGI
FT                   GVGISTLTTSERWITLSTFGSYFLLVIIWDGLTTAMLLILHRFNFNILASPPDWTLLFQ
FT                   LLSPESSYNLLLRSSVGIDVAGEYVANTAPTYIGWWIAVGVLIIWTSLPVIFGFYRFQT
FT                   ADL"
FT   CDS_pept        complement(204005..204820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1144A"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1144A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51274"
FT                   /db_xref="GOA:Q18DV3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DV3"
FT                   /protein_id="CAJ51274.1"
FT                   /translation="MTSQWQQVARQDWSQAVEQRSVKVLLALPVVVILLSAYLYPVISQ
FT                   SPITTGRFGSFVRGLLRVVIPIVGVLLGYNAIVGDFESGSLLLMLSLPQRRRTIVFARY
FT                   IARAGLLIIPTVIAVVAGAGLVVYPLGSFEPLSVLMLISIIAGFSATWVSVGVAASTLV
FT                   ATTRRALGLGFATVILFAIVWDTIENVLRGVLLSTDIISGRLPEPIQFVFALSPGNAFS
FT                   TLITGFVDTTQEVTGAWYLSEWIAAIVLLAWVVGPLAIGVFRFERRDLQ"
FT   CDS_pept        complement(204817..205902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1145A"
FT                   /product="ABC-type transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1145A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51275"
FT                   /db_xref="GOA:Q18DV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DV2"
FT                   /protein_id="CAJ51275.1"
FT                   /translation="MSAIDARDISKRYGTVTALDRVSLTVESGEIFGFLGPNGAGKSTF
FT                   LNLMLGFTHPSAGSISVFDYDCQHEGVMARERIGVLPEGYDVIDHLTGRQHIEYAIEAK
FT                   QIDDNADPLNVLDRVGLTEDAGRMATEYSKGMKQRLVLGMALTGEPDLLLLDEPTAGLD
FT                   PTGAAELRSIIREENERGATIFFSSHVLEQVEAVCDRVGILQNGTLIAVDTIQGLRGSL
FT                   GGGTKLEITVDSLQNGTLNTIQEIEGVETAVTPDNSTIEATCTNDAKMDILVGLRDAGI
FT                   DVVNFRTQEASLEDMFIEYTETDQSHNNNTNHDNADHGVTNASGKKKENNHGSQSGEQS
FT                   EPAEESTAESESGLESGVPSE"
FT   CDS_pept        206050..206817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1146A"
FT                   /product="homolog to NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1146A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51276"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DV1"
FT                   /protein_id="CAJ51276.1"
FT                   /translation="MSDPTIDSYSPPQTLFIAGASGDTGRAVLRLAGSRIPTVRALTRS
FT                   EQKRSMLYQAGADEVVVDNLLDPDDLESALLNVDAIISTVGSTVDDIRSADRFVDGAGT
FT                   RALVNAATSADVDVFCMESAIGVGDNSANPLAMLFNTVIAPIQAAKADAEAAIRNASFR
FT                   HVILRPGVLTNGPRTDIATIAEAESKTNLWGTISRADVARVLLAALGTPAVHNKTFEII
FT                   STPQPMADASNTTWQLPTRDNNTNEIPISAISK"
FT   CDS_pept        complement(207096..207908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kch2"
FT                   /locus_tag="HQ_1147A"
FT                   /product="mvp-type potassium channel superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1147A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51277"
FT                   /db_xref="GOA:Q18DV0"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DV0"
FT                   /protein_id="CAJ51277.1"
FT                   /translation="MTTFSGLSLLRKVGFLLRDRETPAGRATNASLYVLNIIFISLYVI
FT                   STYAVSTPYITLIRVIEIGLGVVFLIEYVVRVTSASNPKAEITDPYTIVDLIAVIPVFV
FT                   IFGPDIGFLRGLHILRVFRFLRLIMNEQQVFGKSIERRTIRQLEVSTTILLIFVVATGF
FT                   IYAVEAPTNQAISNFGDAFYYTVIAVSTVGFGDIVPQTVAGRWVTVTSVLVGFVLVPWL
FT                   VSRLQTPERDLTTADRIKCPHCDGSVVVVDQYCRHCGYALDNNTDAER"
FT   CDS_pept        complement(207905..208378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1148A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1148A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51278"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DU9"
FT                   /protein_id="CAJ51278.1"
FT                   /translation="MDTDSYCCHSQYELMTGKLTKRDMLRLFSISTVGILTGCMTTASE
FT                   PDERQIAVPDEPPCADDLQIRQIGATVGGGTRPVVEFRIKNQGSKPIKYELQVIFEQGT
FT                   SLGIDARTGRSTVSETLSAGEAIIQQVSDDARDIQNTDTYTVNVAVTCPDKQT"
FT   CDS_pept        complement(208570..209070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1149A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1149A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51279"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DU8"
FT                   /protein_id="CAJ51279.1"
FT                   /translation="MSDDDGNSEEEKDKSRISDPIQSPIPEFDSPQPTDEDGYPTGEPA
FT                   IGCSECQSALREATRETTAFLLLDALTIPIVGCSEHREEFASICGLTSDEAAQVVEYLP
FT                   AGGVNCPSCQLAPRTPNHPVIPIGNGGVAILACSEHQSELVNRFQTGLATRDQLTTSLD
FT                   AIR"
FT   CDS_pept        complement(209132..209443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1150A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1150A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51280"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DU7"
FT                   /protein_id="CAJ51280.1"
FT                   /translation="MDSRERPSSAMKSKQDGVNLSEGSENGYQTHRCTVDINSDTISDT
FT                   IDISTNFGCTDIRHSNDQLIWWNHPSAGTDIATTDTRGPDEYDGFNSNKQKTRILLKK"
FT   CDS_pept        209561..210232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nthB"
FT                   /locus_tag="HQ_1151A"
FT                   /product="endonuclease 3"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1151A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51281"
FT                   /db_xref="GOA:Q18DU6"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DU6"
FT                   /protein_id="CAJ51281.1"
FT                   /translation="MDIDIRELHRDLVSLHERPDPAHTTDGVRQLLGTILSQSVADAQT
FT                   ARATHALFEAYPDYRAMETAPHEELADIIEVAGLKNQKAARIQRALTAIRKETGGEYTL
FT                   MFLANQSTEAAQSWLTDIKGVGPKTASVVLNFHFEKPTFAVDTHVERLAKRFGLLDSTA
FT                   SNKRAHTELNELVPDDLKYSLHVLMITHGREYCTAQSPNCANSVCQTYCSCPACDSLDT
FT                   S"
FT   CDS_pept        complement(210511..211257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1152A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   iron/cobalamin)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1152A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51282"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DU5"
FT                   /protein_id="CAJ51282.1"
FT                   /translation="MSSTSDATPRVVAAAPSASAIISHMGAADTLVGVTAHCSVDRPVI
FT                   GGWLTPDYDRIETLDPDIICTADALQASIRDELRDRGYTVCHLEPNTLDGVINSFETLA
FT                   EAIGRPTVGSTLATRTREQLNTVRHRVASNSTVTVYAEEWADPPMAAGNWVPEAIAAAG
FT                   GHHPFCDPGERSREVTQTEIEKAAPDHVVLHHCGHGTHTNAEAFHERGWDIDASVHVLD
FT                   DDLLNQPSPALFEGIEILAERLHSES"
FT   CDS_pept        211508..212608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfbA1"
FT                   /locus_tag="HQ_1153A"
FT                   /product="transcription initiation factor TFB"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1153A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51283"
FT                   /db_xref="GOA:Q18DU4"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DU4"
FT                   /protein_id="CAJ51283.1"
FT                   /translation="MSEKTTHTCENARTRVESNNESEVTTNSAHDRIRTDGGTVGQRWV
FT                   RPGEKESEEESVSESEEETTSESLVCPECSGNVVADDEHGETICDDCGLVITEDSVDRG
FT                   PEWRAFDAKEKDQKSRVGAPTTNTMHDKGLSTNIDWRDRDAYGNSLSSNQRQKMQRLRK
FT                   WNERFRTRDSKERNLKQALGEVDRMASALGLPENVRETASVIYRRALDEDLLPGRSIEG
FT                   VSTSCVYAAARMAGVPRSLDEIAEVSRVPKSEVARTYRYIARELSLEVKPADPEQYVPR
FT                   FASELGLSDESTLRARQLLQNAKEKGVHSGKSPVGLAAAAVYAAALLTNEKTTQAAVSE
FT                   VADISEVTIRNRYHELLEAKDAVGAT"
FT   CDS_pept        212994..213731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="HQ_1154A"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1154A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51284"
FT                   /db_xref="GOA:Q18DY7"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DY7"
FT                   /protein_id="CAJ51284.1"
FT                   /translation="MTSTQAVSFDTFQLAAATADLSDESAASDYADIVEFRLDLAYADT
FT                   SLPDPLTAISAYDHSSSLPLIVTNRPEWEGGAYDGETIDRLEMLITAAKHDAVIAVDIE
FT                   LETLKSQHGKKVARDIRNSGAVIIASTHDFTSTPQQSVLHERLHTAAQLGDIGKLAVTA
FT                   QTHRDALRVLAATEQASQWGDTVATMAMGALGQHTRVVAPLYGSRIGYAPVNPTDATAP
FT                   GQYDIKTLSEMIDTLTHTKVEDD"
FT   tRNA            complement(213867..213942)
FT                   /gene="tRNALys1"
FT                   /locus_tag="HQ_TRNA07"
FT                   /product="tRNA-Lys"
FT                   /note="anticodon CTT"
FT   mobile_element  complement(214236..214344)
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AD"
FT   CDS_pept        complement(214673..215872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="HQ_1155A"
FT                   /product="3-dehydroquinate synthase, type II"
FT                   /EC_number="1.4.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1155A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51285"
FT                   /db_xref="GOA:Q18DY6"
FT                   /db_xref="InterPro:IPR002812"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18DY6"
FT                   /protein_id="CAJ51285.1"
FT                   /translation="MTESRSHSRRVWIKADSDVGDWKTRKRRITTGLEAGVDCVLVDPE
FT                   DISRVQSLGDVSIAAFTSTADSETDSSAETEGVEEADTVVIGKESESDGTDDFPETLSA
FT                   SADLSAIETHSNNTVVETGAYIRILSEEYEALAETAAADASYTIVIGEDWTIIPLENLI
FT                   ARIGSETTLIAGVTSAEEAQTAFETLEIGADGVLLDTDDPDEIRETVAVRDATERETLE
FT                   LEWATVIDIERAGMADRVCVDTANLMQHNEGMLIGSMSRGLIFVHAETAESPYIASRPF
FT                   RVNAGAVHAYLRTPDGGTAYLSELQSGDTVQVVNTDGQTREAIVGRVKIEKRPMFRIEL
FT                   EYDDDRVETLLQNAETIKVNTQSGRTAVTDLESGDEIRLFYEETARHFGEAVEESIIEK
FT                   "
FT   CDS_pept        complement(216027..216845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba2"
FT                   /locus_tag="HQ_1156A"
FT                   /product="2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate
FT                   synthase"
FT                   /EC_number="2.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1156A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51286"
FT                   /db_xref="GOA:Q18DY5"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR010210"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DY5"
FT                   /protein_id="CAJ51286.1"
FT                   /translation="MNTGAGAGARSGLIARLNRISTDGRYLIVPMDHGITLGPVKGLVD
FT                   LESTVDAITDNGADAVLTQRGVASRVHPNKNTKGYIVHLNGSTVIGPDTTDKRPTGSVE
FT                   GALRAGADVVSFHINIGSDHEPDQLTQLSNLTEEAHRYGIPVLAMNYARGPGIDEHDPE
FT                   SLAHAVRIAEELGADVVKTAYSGEPESFEQVCAATQLPVVIAGGSRGTDRQTIEMVRGA
FT                   IDAGAAGVSMGRSIFQHDNPGSITRAVSAVIHDGASVDTALDIAGLEIEV"
FT   CDS_pept        complement(217022..217870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="HQ_1157A"
FT                   /product="tryptophan synthase alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1157A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51287"
FT                   /db_xref="GOA:Q18DY4"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DY4"
FT                   /protein_id="CAJ51287.1"
FT                   /translation="MEEQGLASAFSDGPAFVPYLAAGDPDYESGLAYVEALARGGADII
FT                   ELGLPFSEPIAEGPTIQSAIVRSLEAGMTPDQFFEFVTDLDVDPTEIPLVCMTYYNLIY
FT                   QYGDEEGPRPFVKRAADVGLSGFVVPDLPAEESDPLRTACNEFGLDLVFIVAPTTKGDR
FT                   LNTIMSQVSGYVYVQARLGVTGARDDVSTQTESSLSRLDAYDVPKAVGFGIKTGEHAER
FT                   IVAGGADGIIVGSALVDIVASGTEAGDSTTTVADRLETKARELTDGAQRGYQKRMPKPD
FT                   T"
FT   CDS_pept        complement(217904..219151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="HQ_1158A"
FT                   /product="tryptophan synthase beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1158A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51288"
FT                   /db_xref="GOA:Q18DY3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DY3"
FT                   /protein_id="CAJ51288.1"
FT                   /translation="MTQRYADGKFGEYGGQYVPEALMPAIEELTDAYERYVLENEDGFM
FT                   DEFRARLRDFGGRPTPTEYAERLSERHGCDVYLKREDLLHGGAHKLNNALGQALLAKYM
FT                   GKERIIAETGAGQHGTATAMAAAHLDMPCEVYMGERDINRQRPNVFRMRLNGSEVTPVT
FT                   IGRGTLKEAISETMRDWATNVEDTHYIIGSIVGPHPFPSMVRDFHAVISEEARRQVREQ
FT                   TGGLPDAVLACAGGGSNTMGTFAHFIDDTDVDLYAVEAGGSSLEVDEDAGVAPNSASLS
FT                   TGDEGVLHGARTKLLQDSDGQIMESHSVSSGLDYAGVGPELAHLVDTDRVNPVNVDDEA
FT                   TLAAFHRVSQLEGVIPALETAHAFGYLEEQGGALGDSILINVSGRGDKDLEIAIEETAE
FT                   HDIDIAPDMSEFAGGL"
FT   CDS_pept        complement(219148..219963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="HQ_1159A"
FT                   /product="indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1159A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51289"
FT                   /db_xref="GOA:Q18DY2"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DY2"
FT                   /protein_id="CAJ51289.1"
FT                   /translation="MDASEESLAPAVQSILTAAKQRAGGTSRCSVDATSFQSAISATEA
FT                   AGQTPVIAEIKPTSPTTDGKRDDDPVALASAMVEGGATALSVLTEPEHFGGSVETLAQI
FT                   RNVVEVPILRKDFIVHESQLDAVAADMILLIARFLDRPETDSLEELYNVAQNRGFQPLV
FT                   EVHTRDELERAIEIGASIIGVNNRDLGRLAVTLQTFEQLAPHVPDDVTLIAESGIKTIE
FT                   HVQQMRAAGADALLIGTAIMHGDVQTNTRRFTTVTDTDIQDTTTETHTS"
FT   CDS_pept        220052..220522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /gene_synonym="ada"
FT                   /locus_tag="HQ_1160A"
FT                   /product="probable methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1160A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51290"
FT                   /db_xref="GOA:Q18DY1"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DY1"
FT                   /protein_id="CAJ51290.1"
FT                   /translation="MSTELGIFARYFTQIDRAIAVGLASGRVVSVDFQSTVPSDADDDH
FT                   ALLDRIDTYLNGDSDHLADVDIALTVPTDQRRVLEATRNVPYGEEVSLDRILRMAGLDE
FT                   DKTDDQSTAQRALAENPIPLIVPDHRVRDAPSGAPSDVITQLQDIEQIETVS"
FT   CDS_pept        complement(220668..221117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blp"
FT                   /locus_tag="HQ_1161A"
FT                   /product="Blp-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1161A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51291"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DY0"
FT                   /protein_id="CAJ51291.1"
FT                   /translation="MTRTDVTATTHIDAPVAVVFEYLDDPTNQPEFTPSLTRSKPIEEL
FT                   SNGGKRVAYTYSMAGIDLTGEITATTYEPESAIHWEMDGDITGEIKWAFEADGETTIFS
FT                   YTAQYDIPVPVLDSVVKPFAERYNERELTTALENLRTRIEAGSEE"
FT   CDS_pept        complement(221148..222146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1162A"
FT                   /product="Abi/CAAX domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1162A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51292"
FT                   /db_xref="GOA:Q18DX9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DX9"
FT                   /protein_id="CAJ51292.1"
FT                   /translation="MPQWATFVGFTFIITAGLLVLSHASRGAINTTSDMDASTIAGDIT
FT                   QNQTEDSEPRSHSYQDHVAEELSEPVITATHTESDSNAEQNNESDTHDTVGPTQSSTKT
FT                   TDHIVPSGDTAIADVKHADDEHESYQTRLSTIALLANVTISQGLFAMLLISGAWIARIP
FT                   VSAFGVGMGPTKALILALGVGTGVILYIGNEVGSGLGAHFGVDNGETLRSALAPETSRG
FT                   WVVLLCVVLPIIAGFEELLFRGALIGVIATGYNVSPWILAVVSSLAFALGHGAQGRIGI
FT                   AVTGVFGFVLAAVFILSNSLLIVIIAHYIMNALEFIVHEGFDIELYPVSDM"
FT   CDS_pept        complement(222290..224539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="HQ_1163A"
FT                   /product="ATP-dependent protease Lon"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1163A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51293"
FT                   /db_xref="GOA:Q18DX8"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004663"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DX8"
FT                   /protein_id="CAJ51293.1"
FT                   /translation="MSNDTDSDENPPAEGSGFTDETPDSSQHGDDGLSEEHANAEAGTD
FT                   TDTGANAGADGRSDDSGREDHDDRGDRDRGHDSYNDSVDTVDPDGPTDRENGSIEELGS
FT                   DVEVDAEVKDDVDEDDLLGGLKISSTAEIDVPDRLVDQVIGQEHARDVVMKAAKQRRHV
FT                   MMIGSPGTGKSMLAKAMSELLPKEELQDVLVYHNPDDGNNPKVRTVPAGKGDQIVDAHK
FT                   EEARKRNQMRSFLMWIIIAIVLGYSLIIAGQILLGILAAGVIYLAFRYGSRGGDAMIPN
FT                   LIVNNADTATAPFEDATGAHAGALLGDVRHDPFQSGGMETPSHDRVEPGSIHKANKGVL
FT                   YIDEINTLDIRSQQHLMTAIQEGEFSITGQSERSSGAMVQTEAVPTDFIMIAAGNLDAM
FT                   ENMHPALRSRIKGYGYEVYMDDTIEDTPDMRRKYTRFIAQEVNKDGRLPDYNAEAIEEI
FT                   ILEARRRAGRKGHLTLELRNLGGLVRVAGDIARAADADYVRRDHVLQAKGRSRSIEQQL
FT                   ADDYIERRKDYELQVSDGYQAGRVNGLAVMGEDSGIMLPVMAEVTPSQGPGQVIATGQL
FT                   KEMAQEAVDNVSAIIKKFSDENISEKDMHIQFVQTGQQGVDGDSASITVATAVISALEN
FT                   VGVDQSLAMTGSLSVRGDVLPVGGVTHKIEAAAKSGCERIIIPAANSQDVMIEEEYEEM
FT                   VEIIPVSHISEVLDIALEGEAEKDSLVARLKSITGSALSQSKNETVSGPSNPSPQ"
FT   CDS_pept        224705..225340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadM"
FT                   /gene_synonym="nadR"
FT                   /locus_tag="HQ_1164A"
FT                   /product="nicotinamide-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1164A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51294"
FT                   /db_xref="GOA:Q18DX7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006418"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DX7"
FT                   /protein_id="CAJ51294.1"
FT                   /translation="MRGFYIGRFQPYHNGHHKMVEAITTEVDELVLGIGSAGHSHTQRN
FT                   PFTAGERVMMVTKSVADFDITTYAVPIEDLDRNSVWVSHVQSMSPTFDVAYSNNPLVIQ
FT                   LFSEADVEVRQSPMFNRDILKGSTLRDRMVRNKDWQSLVPTQVIDVIEEINGIERMRRL
FT                   GATDTLKDNTEMSETVENTLNDQIETRSDDMDENSNPSPNQNPGTTER"
FT   CDS_pept        225337..226137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1165A"
FT                   /product="S-adenosylmethionine hydroxide
FT                   adenosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1165A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51295"
FT                   /db_xref="GOA:Q18DX6"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DX6"
FT                   /protein_id="CAJ51295.1"
FT                   /translation="MITLSSDFGSPYPAAMKGVILQTTDARLIDVTHELPRQDVRAAAF
FT                   WCRETIPYFPSAVHVIVVDPGVGTDRDAIMIRVGDHALIGPDNGVLRPVARQLSEQLQD
FT                   ETMGLKNNIEYFRYEYTEPQSATFHGRDVFAPAAAAIHDCGIASVETLDAVTSVPATAT
FT                   VQCKFPSATIDADDTSATGEVLVIDDFGNIITNIPGSFLADRAGEMATVGTTTAEVTST
FT                   FADVDTGDPLLTVGSHGFVECDVNHGQGTEIFELEVKDTVQIRF"
FT   mobile_element  226233..226340
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AD"
FT   mobile_element  complement(226488..226879)
FT                   /mobile_element_type="insertion sequence:HqIRS47"
FT                   /locus_tag="HQ_HqIRS47B"
FT   CDS_pept        complement(226921..228486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ths3"
FT                   /locus_tag="HQ_1166A"
FT                   /product="thermosome subunit 3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1166A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51296"
FT                   /db_xref="GOA:Q18DX5"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DX5"
FT                   /protein_id="CAJ51296.1"
FT                   /translation="MSTRMQPLAVLTEESERTRGEDAQDTNVQAGKAVASSVRTTLGPR
FT                   GMDKMLVDSGGDVVITNDGATILGEMDIEHPAAQMIVEVAESQEESVGDGTTTAAVLTG
FT                   ELLSEAESLFDDGLHPTVVAEGYSRAAELAHDAIDAQADSVEIDDELLQSVAESSMTGK
FT                   GTGDVTADRLAGLVVDAVQRVRAANDEFDADDIKTHTQTGASSSATDLLEGVVIDTERA
FT                   ADGMPTAVSDASVAVIDVELDLREGEVDAEYAISSVDQLEAAVAAEDDELREYASTLSD
FT                   AGADVVFSTDSISDRVASYLAREDIVAFEDIDDDDARTVARATGASRLGRLEELEASDL
FT                   GSVDSVSIETYGEDELTVIEGGSESTAATLLVRGSTDHVLDELSRAIDDAINATTVALE
FT                   SGVVPGAGGTEIAISDAIRSAAAGIEGRQQLAVESFADAVDAVPRTLAQNTGMDPIDAV
FT                   VDLRSTFEDQDCAGLVATEQTGEVANPLTAGIVDPAGVKHEAITAATEATTMIVRIDDV
FT                   ISSE"
FT   mobile_element  228721..229250
FT                   /mobile_element_type="insertion sequence:HqIRS61"
FT                   /locus_tag="HQ_HqIRS61A"
FT   CDS_pept        complement(229282..230214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtl4"
FT                   /locus_tag="HQ_1167A"
FT                   /product="probable glycosyltransferase, type 2"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1167A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51297"
FT                   /db_xref="GOA:Q18DX4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DX4"
FT                   /protein_id="CAJ51297.1"
FT                   /translation="MPSLSLDTSNVDLSIVIPTLNGREQLIDTLDAIAEHAPAAEVIVV
FT                   NGPSADGTSGMVQNRTDVDVLIEVSERTLNVARNAGIIEATGEAIAVLQYDLTIESTWV
FT                   DAIISGLSRAAVVTGPVHQMLAAGMTTTACEQTNIGAQTVTYFNGGNVAFTASTLENID
FT                   GFDEYLKTGGARDAAHRLAAASERVAWEPEMCVQTEYETDGGIKQQDTDWKYRSLTYRL
FT                   VKNYGIRPTVVRRILTHIGADAVDAARDVLADNRALSTYLSVERDAATGAIAGVVTGLQ
FT                   ARFADRSTTRNPHGCSARADRAVSRHDWR"
FT   CDS_pept        complement(230226..231017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1168A"
FT                   /product="probable S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1168A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51298"
FT                   /db_xref="GOA:Q18DX3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DX3"
FT                   /protein_id="CAJ51298.1"
FT                   /translation="MKGKEWYQADDVAQAYESKRFSRGGQLIDRREKRAVLDSLNPVTG
FT                   ADILEIACGTGRFTAMLAERGANIVGIDISDAMLAQGRRKARNNGVNDTLELLRGDAAR
FT                   LPFPDNHFDAVFAMRFFHLAETPGTFLTEMARVSNDIVFFDTFNHRSTRIIYNWLLPMG
FT                   SHLYSRSQVKKLLSDAELAMVDDTHDFLLPYGFYRKIPNDLAHGFRDVDKSLGESEFGD
FT                   ALASVSYWTATVDTDSATTDTAETNLETSQHTPDGTVAADD"
FT   mobile_element  231117..231141
FT                   /mobile_element_type="insertion sequence:HqIRS83"
FT                   /locus_tag="HQ_HqIRS83A"
FT   CDS_pept        231252..231530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1169A"
FT                   /product="NP_1176A family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1169A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51299"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DX2"
FT                   /protein_id="CAJ51299.1"
FT                   /translation="MSTSVVDPENAVQLSKSEFRSRLRELPPSAKLVVKVLETDSPLSQ
FT                   GQLAEESLLPDRTVRYALSRLEENELIGSRYSFKDARKQVYFLNDHV"
FT   CDS_pept        231953..232771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1170A"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1170A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51300"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DX1"
FT                   /protein_id="CAJ51300.1"
FT                   /translation="MTRVRRIPVGVDSQVPTGKTNAYVIITSNEEYQGDTGSRPEAILV
FT                   DPPAQAPEIDMVVDKLTVSHILVTHTHPDHVGGVSVYADTTDATVWCRHGRVQRFYETT
FT                   GVNPDQTFREGTILPVDESVQILDLPGHAPDHIGIETKIGILCGDIARANGSVAITSPD
FT                   GAMRAYFVALRRLHARQPACLYPGHGEVISNPRETCMRLLMHRQEREKNILTAITGNAT
FT                   SVETILEQAYDKNITSVRDLARATVVAHLEKLDADGRIAFNRETKMVREI"
FT   CDS_pept        232768..233739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1171A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1171A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51301"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DX0"
FT                   /protein_id="CAJ51301.1"
FT                   /translation="MKDAEMNELSDSEQEEVQSLEAELARAKSLSVKSLADAIESIGFE
FT                   CTRCGACCTAHHSGENNDEKTENAHEDETEPAHTQINNRSKTEAPAATAPTENGRVSHN
FT                   NGSDDQTRTVSNQDNKANTDVAMESVSTSTSTEPHTATVFPDEVRELQATADNMRDGTA
FT                   DTDAHSPTEWRDVARPMPYGLDDENSTGTTFEWALQTDACGDCVFYEEADGVGSCQAHD
FT                   NRPLICATYPFSVALGGTSQPMGEAVDTAGMVRAHECEGLGRDITREAAEELAATLRTR
FT                   AIRELEEAISLRDAYEPPGNTDGIVVHDSEGAKRPDGTAIDN"
FT   CDS_pept        233966..234364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1172A"
FT                   /product="TRAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1172A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51302"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DW9"
FT                   /protein_id="CAJ51302.1"
FT                   /translation="MEISDKLLCLFNADIRAEDDQYIVEVPKREIETGSLDPDETYRVA
FT                   LISRSATSEDESIEREQPSSEPQPPVEPEELRYVEIEDIGKQGDGIARVERGYVIIVPD
FT                   AEVGDRVKIEISEVKSNFAVGEVIEEEI"
FT   CDS_pept        complement(234637..236373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1173A"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1173A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51303"
FT                   /db_xref="GOA:Q18DW8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DW8"
FT                   /protein_id="CAJ51303.1"
FT                   /translation="MTHIHPSNLSVTLVDGYVDEPAHFGVPPYISTYPRFTAGALVDAG
FT                   VPHDQITYHTIDALRDDRGRWRDVADADLLIYLGGMTVPGKYVGGTPAEPDEVREIAWT
FT                   ADGVSMMGGPVRFGVGDENAGAQEMERQNLDYDYLAMADVEAAAYDLVESGLEGFNDRY
FT                   RSTDELDRWASKGAFIVVQHPNYPEYLICEIETSRGCAYRCSFCTEPMYGDPSFRTADS
FT                   VIREVESLADRGVAHFRIGRQADILAFGGDGEAPNPDALRRLYSGIRDVAPDLQTLHLD
FT                   NMNPITIVNWPDASRECLDIISTYNTPGDTAAFGLESADPVVQDQNQLNVTADECFEAV
FT                   RIVNEVAGWRPGEDPADAPSYGIEAPDRLPKLLPGINLLHGLTGERTETFAHNKRFLHR
FT                   VFDAGLLLRRINIRQVMAFEGTEMAETGADVAIEHKKQFKQYKQEVREEIDQPMLRRLV
FT                   PAGTVLPDVYLEYHRDGRTFGRQLGTYPLLVGIPGERPLGKMIDVAVVDHGYRSITAVP
FT                   YPLDPNAASMDELTAIPGIGSRTAGDIVINRPYDGLADVPVSDVDLSTFTHASGYDEPR
FT                   AD"
FT   CDS_pept        complement(236789..237652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1174A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1174A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51304"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DW7"
FT                   /protein_id="CAJ51304.1"
FT                   /translation="MLAHTIYGVDFSGAARAGDNIYLARGRVPTASSDETLHIETCTPA
FT                   PTLLDTTADRDAVLSGLREFIATRPTSDTGSVAFGCDFAFSIPMVHIAAVDDVTDWQSF
FT                   LQWFPGDMTDPSTFASWAGDIAAATETKRTYIQRLTDTRVGALSPYHFFIQSQTFYGIR
FT                   DVLAPLVKTNSIRVRPMQSPTSDIPWVVEAYPAATLDRFGLPDDGYKSTSDDAYNRRQM
FT                   IIEEIDARDDVTLTPEAKATALTDPDGDALDAVIAAVATFHVARDGITIPSSADDRWQC
FT                   EGWIVS"
FT   CDS_pept        complement(237971..238870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1175A"
FT                   /product="DMT superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1175A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51305"
FT                   /db_xref="GOA:Q18DW6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DW6"
FT                   /protein_id="CAJ51305.1"
FT                   /translation="MRDATLGAIFVLIAAAGFGTIGIFGELAAIVDLELAALLPIRFAF
FT                   ATIIITLLAVIRDWSLPPTRREWVITLGLGGIYTAMTLLFFFSLRSLTAGLATIVLYTY
FT                   PIFLVAFSVVLQTETMTPQKLVALTTTILGVIIVIGIDSPNIDSFGILLSLGAALCYAI
FT                   YTMGSRSVVTQATPQGLTIGVLIGTTVTMIGYGVIDGGLSLPREQTHWGIILGIVIFST
FT                   VLPHILFYQGVSRLEASRVGIISTIEPVVTVILGVIFLNEALTIPIIIGGGFVLIGVVF
FT                   AQRPSGRSSPQSDLSESH"
FT   CDS_pept        239126..239284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1176A"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1176A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51306"
FT                   /db_xref="UniProtKB/TrEMBL:Q18E09"
FT                   /protein_id="CAJ51306.1"
FT                   /translation="MPATLEVKCTDGSCTLDMFELHYTYDMPDDVGVTDFTCPYCGETE
FT                   TLEAIEL"
FT   CDS_pept        239281..239793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp20D"
FT                   /locus_tag="HQ_1177A"
FT                   /product="Hsp20-type molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1177A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51307"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q18E08"
FT                   /protein_id="CAJ51307.1"
FT                   /translation="MSRLTELGESAAQTVLDRVGRGVSEVQERTPLPYDLLESDEAYLI
FT                   IFDAPGIEQTDVQVQFLDGKVEVRLDRFRDFYEDFEMRFPGRGLSLDGSVSLPDDAAVD
FT                   PERANATLGRNGTLQIRLPKDGRHQTVAVSEADENNEHDEMIDSGDSDASTANNTDDAN
FT                   HDPDTDS"
FT   CDS_pept        complement(239967..240566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1178A"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1178A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51308"
FT                   /db_xref="GOA:Q18E07"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q18E07"
FT                   /protein_id="CAJ51308.2"
FT                   /translation="MNLSAVNTHAPTPVIDAGRRAAVIAPIVRIGAERHVLFTKRADHL
FT                   GEHPGQMSFPGGSHEPSDTDLRETALREANEEIGLDSTEAQFHGRLDDILTVTDYAVRP
FT                   FVVGVPYREYHPDEREVAEIVSLPVSALTDLSNYELTRREHPVHGAIRLHFFYVNGYTV
FT                   WGATGRMLVQLLELTTDWSAPEEVDRVIDPDSDLPI"
FT   CDS_pept        complement(240789..241358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1179A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1179A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51309"
FT                   /db_xref="UniProtKB/TrEMBL:Q18E06"
FT                   /protein_id="CAJ51309.1"
FT                   /translation="MTEEFISLDELAGIVDLFGTLTHDAVDTAIVEMAFRQGIEVESDT
FT                   RKQMITTAINQYRLIIYPSTEDEMRSIQHPSEQASDINSNIDTTKLNRIAPGPTAFPTL
FT                   PAHAEDLPRILETDGQAIDHEAATYAVINRLRDDTEQAITNNDIELMRYLRDVTYDIET
FT                   WAGVATANDDLISDVRCRLNSALAED"
FT   CDS_pept        complement(241580..242710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtl5"
FT                   /locus_tag="HQ_1180A"
FT                   /product="probable glycosyltransferase, type 2"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1180A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51310"
FT                   /db_xref="GOA:Q18E05"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q18E05"
FT                   /protein_id="CAJ51310.1"
FT                   /translation="MEYVQSSIATLHELDDPRPSAPIERASVVVPMTEREYAGLAADRV
FT                   LTTLEDLNPARVIVPLRAPPTRVTSFRQWLATYDLTLEVLWCDGPRISKLLEGAGLEGR
FT                   SGKGRDVWLALGRAAKEEFVVVHDADTVSYDSSFLTRLLFPLAHGFKFTKGYYARVEDR
FT                   QLYGRLFRLFYVPLIRALRTAHPTSYLRYLDSFRYALAGEFAATAEMVTQIRAPRSWGL
FT                   EVGTLADAFDAAGFAHTAQVDLGRYEHDHRAVSGPTGLSEMSRSVGETLFRTIAQHDIS
FT                   IDFETLPHRYRNTAKQLLDQYAIDATFNGFEYPRSREREQIETYTKSIQPPGSPDYLPA
FT                   WSDVDITPSAVVDAAVADADAVNTELTEDDTDSSIE"
FT   mobile_element  complement(242808..243614)
FT                   /mobile_element_type="transposon:HqIRS103"
FT                   /locus_tag="HQ_HqIRS103A"
FT   CDS_pept        complement(242868..243614)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1181A"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT   CDS_pept        complement(243702..244892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1182A"
FT                   /product="probable oxidoreductase (aldo-keto reductase
FT                   family protein)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1182A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51312"
FT                   /db_xref="GOA:Q18E04"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q18E04"
FT                   /protein_id="CAJ51312.1"
FT                   /translation="MATKRGTWNYREQFGEEFGRTYFRRFDPGVTSSIGIGTYLGAATD
FT                   DADNRYYRALVDAIESGVNHLDTAINYRCQRSERVVGDAIADAAVDRDAIVLATKGGFI
FT                   PFDGEKPADPGEYITEEFIQNGTLDAASLARGCHALTPAFIDSMVDQSLRNLGVDDIDC
FT                   YYVHNPETQLTVRSQTAVYEQLTAAFEQLERRCATGDIGGYGVASWNAFRVSPSHDSYL
FT                   SLPRVVACAEAAADTVGVDECGFMAIQLPFNIQMSDAFTTTAHPDPAHRDDTAVQGDTT
FT                   GIDQNQSIFDNDTNTHTETTTEISALQYAQERGINVIASATLAQGDLTNGDAIPPAVDT
FT                   ELSGETPAQRAINFTRSAPGVTTALVGTGSPEHVSENVAAGTFDPLGAQAFDAIFE"
FT   CDS_pept        complement(245027..245935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1183A"
FT                   /product="homolog to NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1183A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51313"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18E03"
FT                   /protein_id="CAJ51313.1"
FT                   /translation="MAHAVIIGCGYVGIELGTQLQAAGHTVTGVRRSKSGLNSIEAAGF
FT                   HAQQADVTHPETLSTLPDAEWVIFAASSGGRGAESARRIYVDGLRNTIAAYAERESTDR
FT                   LIYTSSTGVYGDHNGRFVDESTSLDPTTEKTQVLKTAESITLEETGDVGIDGTVARFAG
FT                   LYGPNRYRLTRYLSGPVTEGYLNMIHRDDAAGVINHVLTADVAREECVLAVDDEPADKW
FT                   TFADWIATACGRPDPPKQTVSERLAKSNLSETAQRRVRTSKRCSNDYLHELDYTFSYPT
FT                   YREGYAEPTAAVADGADPDTL"
FT   CDS_pept        complement(245935..246387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1184A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1184A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51314"
FT                   /db_xref="UniProtKB/TrEMBL:Q18E02"
FT                   /protein_id="CAJ51314.1"
FT                   /translation="MLYDAADNPGSLTPDALCAAYEQQLHDVITDVGVDTVTEETDVDA
FT                   KTIETLSNIDPDTDTPVIPDLRTEDAAAILAVHQTRPDAESVIFELRDHLLMSMTTTVV
FT                   DVDIIASNVDLDLSGQEVQQALEGRAAMTLAQLAAIQQFLAERNNQ"
FT   CDS_pept        complement(246563..249664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1185A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1185A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51315"
FT                   /db_xref="UniProtKB/TrEMBL:Q18E01"
FT                   /protein_id="CAJ51315.1"
FT                   /translation="MGRSIGSDDRARVPFALVGVLLLVGSSMITFSLATPGAAPVDRTA
FT                   DAVADRVDAETTAALRGAIRRAAHAAAREPVTIPTESAVGRALGTTATFRRALELRIYL
FT                   QTREALMNIEHQRGRSAARVTLPQYSDIEPLLTHVSVVGVDDGTELRTTVRGIQLTVMR
FT                   DNRVVNTRVINRSMTVAVPVLALHDQTVKFQRRLDADALGGPGLARRTTIGLNAITQAR
FT                   GLGQYAGAPIENVLSNSHVTLSTNAGLVDSQRAVFGRSDPDAAAGLRIATLNTGMNDVL
FT                   TPLTPPRVSAVVTGAIPGPNAPERLRVRETKSKYPDPVPSAERTITVGVNGTADEAFLA
FT                   VIRGGDTTASYKQISQTGYTAWAQLTTDVDIQWRGRPKTPTPPGANWTLAETDVSRKVT
FT                   VTPASPTWVSPRFSDGIGRQTINIAARSVTVDSTVQWTWHAPEKSPRTTTDSWRQRSHV
FT                   QIHLTGRVVPLAVPTRGISPSFEPGGAIDGPNLVETTNAAQRLLRNNGGYDDIARQAAV
FT                   NGDVTATQTVRGQRPESLSTWIYEDVSSLREQVRTISVTVSGDDIATGQANAAEQLTDI
FT                   LDRRRYSLIDPPRRYDGVADRVRVAMRGAYIDAVIAQLEEQSEQTTQQNNGITERLDVP
FT                   GISASHINKLAGLTPMTTPPPRTLGTANGISAPLTIIPDGDPAYLGVSPVNATLVDGVS
FT                   DETSYIPLAARNQNVFAIPYADTADTIVSQVFGSGGRVSLQTAGQALIAADTRLAVAPD
FT                   TTLRTRRNTLAAAINDSMEDVEQQADHTLKSETDLSNAARTAAIDDSIAMWDDGSVALA
FT                   AANGSLAKAISTKALSQGSAAYTYGHENEYEHEYEYDRVETALRVDLREVATSKSVQVP
FT                   KPAVDDTMSSLKQGAQSVASGAAANATERAVTRATKGTVTTIPAGLPVLPTFNPWVATV
FT                   NLWIVDIRGAYGRFAVGTASGSMQYVRDGSAVSLDIDGDGTAETLGRNERIDFTVRTAT
FT                   VVVVPSGPFGVGDVDGNMDERSVGWTGAGADAQCTTPTGYCPPE"
FT   CDS_pept        complement(249664..250515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1186A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1186A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51316"
FT                   /db_xref="UniProtKB/TrEMBL:Q18E00"
FT                   /protein_id="CAJ51316.1"
FT                   /translation="MNAAVDALICIILVTAAIAGVLTVEQSPPTRIDRADTVANTLTTT
FT                   TTTVEHSPRLEFNNLADQAISPDRHHLTRRTHGTLAGLITHATISGTRTQKAQITRIDD
FT                   MFRLRVRNAVRARTGGRVRVDARWIPYPGSPLFAHFSVGPRPLSDDVHTATVSIPVGVE
FT                   PLAIDTHDQFQTLGTAVAARIIAVVIPPGPARVMMRDDEPEITLTRHRYAQLQSLTNAS
FT                   LAEPLAIEDTSEANERLTAALAPEITSDLRDRYETPAVAVEAVSVSTVEIVIRTWDHGG
FT                   GS"
FT   CDS_pept        complement(250512..250994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1187A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1187A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51317"
FT                   /db_xref="GOA:Q18DZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DZ9"
FT                   /protein_id="CAJ51317.1"
FT                   /translation="MRSWTPLSILPDTWMANRDYSLHVNPDSVECRAQTSPIVALIALF
FT                   AVCVGVSLYATTLTDIFQSSSDRELAGPTADRVIDIHAPGGVLDPTNVTVAPTSASMSV
FT                   PRGYQANISIYTDSDEWQYGPHPPVDNTHTDSVTRSVGVAVDSGVDWGIIIVRVWQ"
FT   CDS_pept        complement(250996..251490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1188A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1188A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51318"
FT                   /db_xref="GOA:Q18DZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DZ8"
FT                   /protein_id="CAJ51318.1"
FT                   /translation="MFNIPVDAWYAWIGLSIAGITLIGAVSGLPTTKPPDAAAVATTID
FT                   RVGAAEYPATAEHPLTADAIRLGTYRIGLKSDAGTAHATLAFGPVTPVFSESNNSHDNH
FT                   LRDILYGSPPTYVFDSEAAFLDAVTTAQANGMNVTWRPVDGPVVIRRVSWNDEDVVLVG
FT                   V"
FT   CDS_pept        complement(251653..253488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1189A"
FT                   /product="type IV pilus biogenesis complex membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1189A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51319"
FT                   /db_xref="GOA:Q18DZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DZ7"
FT                   /protein_id="CAJ51319.1"
FT                   /translation="MQQELILDNTASRIKKLTRILANQYPGDVSVTPEFVRALAFLNVS
FT                   IRPETIIAAGYVLAVPVGILTSICLIGGIALIGTPLSPRALCVVLLLSGAIGVGVTYLT
FT                   QTLPIALATLRRTRALGAAPGLVGRIGLRLQLDGPPERASAFAARTGTGPLAESLQAHV
FT                   DQTNMGPTAGLMRFASEWKPWFRPLERSLTLLRAAVDTPPEDRTDAIESGIDAVLSGIR
FT                   STTAGFAGTVRGPASGLYAFGVLLPLALVGVLPAARAGGVSIPTGAFVLFYDFLLPIGL
FT                   LTASGWILLQRPVAFAPTQIPRSHPALPAGSVRGIVAASAGALIGWGIGSTVVPWGGPI
FT                   AACGIGVGAGLTVQYHPAAAVRKQVADIESGLADATAVIGRRVGAGEAVETSLTAAADA
FT                   TIGETSTVFKTAAGVQHRLRVDIQQAFLGPYGALSDVPSDRARATAVLIGVAAREGRPA
FT                   GETLQTLADHLRTVQQTESAARRELASITGTLSHTAALFGPLVGGATVSMATKMAEASG
FT                   STDSMSATTGPALGPSSQPPTVGSTVSGATAIPPEILGIAVGIYILLLAAILTILATGL
FT                   EQGLERSLVGYRVGLALLSGTATYFTAYIGAIAVF"
FT   CDS_pept        complement(253488..255572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1190A"
FT                   /product="type IV pilus biogenesis complex ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1190A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51320"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DZ6"
FT                   /protein_id="CAJ51320.1"
FT                   /translation="MSILSIDTASMTGINAYLRRILPSSVCEHLSSVVSASTIEMNALS
FT                   DNANSDKESRCHCCVAVETPTGTGVPDRSELVVDATDCPGSGDLASASACRETVIDALT
FT                   HNDVAIIRTISDGIERTYADDAAATLQAIGRFIERVRFHDPEIATRAREDPGKAAYHAT
FT                   GRAGPVGDIATDTGFDSLTETAVETALSPFVAPTLSRSHLERSPPPDATLLDVTDLSTD
FT                   AIARMYSTDTNVDSNTEAKQYYHLDPAFHNLDSTAIDTLAMAYECLGTGSVDGGGGDGS
FT                   RASSRAVRYVATDEDPVEALTAILTRHTQGLGVIEHLFADDRISDVIASSPVSKTPIRI
FT                   VLDGERMATNIRLRPSGAATLASRFRRESGRAFSRSTPTLDATVTAETGRQIRIAGITA
FT                   PASDGLGFAFRARDTTPWTLTRLLTVGSLTPAAAAFLSVVTARGAATIVAGTRGAGKTT
FT                   LLGALLWELPHTTRLVSVEDTPELPVEALREHGRDIQPLYTETDTTGITGATFTPTAAL
FT                   RTALRLGNGALAIGEVRGEEAAALYEAMRVGAHSHAVLGTIHGDSGVAVRERVVSDLGV
FT                   PASAFSATDLIVTCTRRGDDRFVSHVEEVRTGETTDDIQFVSLFTRIDGKLTSTGVIER
FT                   GDSRIIERLCRGTTDSYADFRTTLADRHETLERRAEIELVNPKQGAVSWDTANPQNLDE
FT                   "
FT   CDS_pept        complement(255657..256130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1191A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1191A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51321"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DZ5"
FT                   /protein_id="CAJ51321.1"
FT                   /translation="MIRLVIAVVLLLATMAIAIPAITDATQTRTTTEYDAAADRIERAG
FT                   RELVMNEDATRSRLYAATRHVDITIPVQSLTAPETEFVAIGGSPNTVGNQPVVTYALSA
FT                   TSAKTSASRRVISLPVPVRTPQGPIVFQSAGSHNIILSLVRERSRTVIVITRG"
FT   CDS_pept        complement(256127..256984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1192A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1192A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51322"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DZ4"
FT                   /protein_id="CAJ51322.1"
FT                   /translation="MDSADDALAARLDAVERAVSESTVTDAIDSTEVSSNHNSGVNLSS
FT                   VPDLQAIDMSDTIDSESSNPDSTITEETSHPAHTNSDMSSSVSGEETPIETETDTETGP
FT                   EIMNRVGEIESRLNAITGELAAIRGLIESVSAVDEAVEQRANIALAKIEAVESRLEEDG
FT                   TQNITTESETTQPNQQYKNQAPSSDRSSGVNPNQAATHDTSTCTICGGTETHHPKAHDA
FT                   VKQQSVPRSTAERDIPTRDQNNAESESRSHRNHNTSDQEDTAENHTDDSDTTSLAARLR
FT                   AAFE"
FT   CDS_pept        257398..261474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1193A"
FT                   /product="probable secreted glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1193A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51323"
FT                   /db_xref="GOA:Q18DZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DZ3"
FT                   /protein_id="CAJ51323.1"
FT                   /translation="MVNHEYGRAIVLFIIICLIAGNWYVIGSGSASTTNQSSITLDRSL
FT                   YYENDNIRVTLDDANLSTDIEYIVNVASDTEKSRSQEDSLGSTTQHTTDRPVSDTNEDG
FT                   IINKSDVTYDTLSGNSIKSTQKNRDNTVTVSFEAETGSFDDIKYESGETVTLSHAGDTV
FT                   FTGTIDISQTDALGTLNAGDGDTITVQYYDMSAQERRTDTASFSAQNSPTATPTATPTA
FT                   TATPTATSTPTATATATITSTPVSTSTPTQTPTPTPSPTPSPTPTPTQTPTPTPLPTPS
FT                   PTPTPTQTPTPTLTPTSTPTPSPTPSPTSTPTPSPTPSPTSTPTPSPTPSPTPTPTPPA
FT                   TATPTPTPTPSPTPAPTNTPPPTSAPTPTATPTPTPTPTPTPTATPTPTPTPTPTPTAT
FT                   PTPTPTPTPSPTPTATPTPTPTPTPSPTPTATPTATATSTPTPPSVEPTTPVDTEDENE
FT                   SDSDSSSGSSTDSSGGSNSNNKPDKQSTPKAPTPTPTPTPIPSERPTVGSTAGVTTAVT
FT                   ANGEGASTHLELPFTEPVMSAVDGESLAIGQSVDIYIDDQIENDAFSLLQDGSATGQLL
FT                   LSTYRRFGPETEIRVEVDAVQGTQTGGTLPSTVQSVRVYNHTIKTTADRRVIDTPGFVA
FT                   LQVGDAHSDNNDGVIGQSLRILDADETVIETVQTGVGSQIAIVDMGDYKTGIYTIIAED
FT                   GAETTMMVYNLGLDIVVDRQTVTVGSALRGHVAATIETPRVMTVTLITENDTPIAETTA
FT                   TITANGTGIFSINTTAVSNADTEAYRLLVTDPQTNLQVASEPVRFISSTGVGFTQATYA
FT                   DARGDIMEIPLSIGTEHAATVMIGNSSSNIQANVTVQDRTGDGIVTLRFNTDAAIASAL
FT                   DKSERAVFTVKPVSADDQSSGDNHDIIHSTNPSATMTTRIADNAVPLSEKHYLVSIKSE
FT                   ATETAFTNNTAMIRIDSPTIETLQVYTAPRGMAFSSVEQITNAIENGQMTPTGSVASGD
FT                   VIIYALTAEGFEGRTEQAEEQTIRTFERTATKHANRYQTPSLSVTYPNATPSISNQLNN
FT                   SWVMSNTSNHQYYIGATAGTRTNTANEQRVNDSAGTHFTATLQPGTRINDARPSGSITT
FT                   PGERLDNSESSSVGKAQKEPSGDWTVQTAVVPQQIVFDTNQTRVAPVSDQYITGTTTVA
FT                   PGSIMTITLRANASKKQSGGTYPLDKTIRTTIGINRTWSGAFDFSTFDIGQSFVIHSVI
FT                   SQSDSVITQNRMRGYIEVSPADADTVVAKEKTGASGGGGGGGGITGILTGLLDSGSERI
FT                   NPEAQPSDTVYNGNTTDAGSVVDGIITGSFIDTELGRVVDNTVKSSIQTRLMNPVAAGF
FT                   ILILSIVSLLLYRRR"
FT   CDS_pept        complement(262266..264143)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1195A"
FT                   /note="product: probable secreted glycoprotein
FT                   (nonfunctional)"
FT                   /note="gene has an in-frame stop codon"
FT   CDS_pept        complement(264219..264863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1196A"
FT                   /product="probable secreted glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1196A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51326"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DZ0"
FT                   /protein_id="CAJ51326.1"
FT                   /translation="MIRRQILTKCAVALSVGLVGCSGGGGGGSTDETVTETATPTSTPT
FT                   PTSTPTPTPTATATATPSAPTHETGEQFIVGSDDTALRFTVRELFQATELGPARSNQAT
FT                   GRFCVVILSVFNPTSSSQDVPIDRITLRTDDIIRRVDTGDSQAIGSDDRIDVSSIANQT
FT                   IGPTSSVTGAIVYDAPPDNEYQLEFAPVDSAQSHIVPVGPITGLDSLPSGY"
FT   CDS_pept        complement(265518..274175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmu2"
FT                   /locus_tag="HQ_1197A"
FT                   /product="probable secreted glycoprotein Hmu2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1197A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51327"
FT                   /db_xref="GOA:Q18DY9"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR031549"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DY9"
FT                   /protein_id="CAJ51327.1"
FT                   /translation="MMITSVMAAGVAFTGSTAADAPPDSPTTDPGNLQVSLLNESNDAN
FT                   VTFGVNTTSKTINKTNATDSDVAVGSVNSDLDNTAKAIQFAIDNATTEYSTVRVGSGIY
FT                   NGSVSIDVNDLTLEGADGASSTIIGQSSVAVTSTTPNVEIADLRIQNPDGSRAVMVTDD
FT                   ATDVVIQDNTITNINTDNDATQPRGILVIGLDGGDSADGLEIRNNTVTNIESNGGDQAH
FT                   GIQILEESNGGGLIENVVVDGNTIEDISDIRSTVAVNFNGHIEGEITNNDISGLNTEGN
FT                   PTNASPGAGFTQVIALNAGGNAVDGPQNVTIEGNDISDIETTEPEEAINFAPPFHIIIG
FT                   SDADADTISIENNDFSADSVDPRGDVYIGSDGTGDFDLQGALGANTFTPSAVQGAAGGN
FT                   RILVPETGVDVVNVDQNTGFDQIQPAVDGANPGDTIEVKSGTYNDSVTINVTGLTLEGP
FT                   NAGTAGNNSNGRGPEATIQQGVQILSDNVTLTGFDVTNDDTNGILLGTNTAPSNVTISD
FT                   TVVRDISGGTGGDKSAGNGVNLQFNGAVNETSTDVVITDNLIINVTTQGDNSDEDAIGI
FT                   QTLPRGNDVEDLQITDNVISDIEPADNDGRSEARGISIDTQFENTSNGDRGNFGQATNL
FT                   TVKNNDIDSLTADFARAITLFEDKQGPNSGSTSGQPVGPVNFTITENRVTGVNSEGTNG
FT                   NDFRDIALFVGASQTLGPDHSVSANTFASGAVVRFADTSQAGEEFDPDSADALDTSGNK
FT                   FTNDSIRFYYSDATAEADLTAVRNENTFSRNVIANDTLIFPSASVNPAASVTTSSVAAG
FT                   DQSVTADINFSRTAGGNVTLDVQDSSDNSITDQLTSTSSNGTVTVDLSRSVSGEDIDVV
FT                   VFETDDTAVELDRATVTVPSPPDPDPANFGVSLSTPDTVTAGETVTATATAENTGEQSG
FT                   SKSISFSVDGEQADSTSVSLDGGASQAVSFSYDTTANDTPSVTLQVASDDDTASSTVSV
FT                   SAPAAAAFDITTVDTPETVTAGDTVEVAATVENTGEQSRSQSITLDVGGTQVDSTSVSL
FT                   DGGASQEITLTYTTTTDDAPAVELTVASDTDSTTRSVSVTEPAVSSFTVASIDTPDTVT
FT                   AGEEIAVSTTIENTGSESGTQPVSLLVDGSEETSRSVTLAAGEQTTESFGYSVASSATT
FT                   QQLNIAVETANDTTTSQVQVSGALNRTPLRLQANETAVVRGETVEFTVTDPTGSPVDAS
FT                   VRVLDTTQQTDDDGTTTIPIETVGRLDAVATKTATNTTEFAPASISITASAPALRVDRQ
FT                   TVSFGDVAVGDTATVEVTVSNPSPTRLDVGSLRVTGPGASAVTLDQDAVSESIPANGDR
FT                   TLEVAFTPQSRGTISPTLSVDDQTVSISGTGTQPELNIDTELPIELTTAPDSSATTAVT
FT                   LSNDGNAPVTTQLTSGESFTQPDAVTVAAGGTETFDIEFAPQASDTSTISTQLTLTPAN
FT                   ETLSSTTIPVVGTITDREVTARTTAVSFDAVPVNETQRTGVVVDNTGTTTETLTATTDT
FT                   DAFELGDDDREFTLAPDTQAFLSVAATPAESGDISGSLSIESTDGELSDSVSLSVTGQA
FT                   PELSVDASDPLSFGPTPQGSTATQVIDISNPGDGTLSVRVDQQLSETAFAVPIDRSLSV
FT                   PTGESRRLPIRFTPQTAGQATAELPLVTNDPEAPQRSITLQGDGVATDVRLSTGQLEFG
FT                   IVGVGNATTETLTIANNGSSFTISDVSVEGTAYETTTNLAGTTLENGDATEVGVRFEPE
FT                   VGGTQTGTLTVSGSTDTDSTTLSAALTGSGQTADLRVGAQTLRTGVTTTDGQTTGSVII
FT                   ENTGPAGSQLSIDDVELTDTEQFSLRSDGVTEGTVISGQSEATLPVTFTPAATGSSVRE
FT                   TELTIDASSGQESFTRTLDVAGTVTSPDPTVSTDELAVGEIPTGETTRRTITVSNDGGE
FT                   PFSITAVDAGASGVRAEQVGSGEIVAGEERTIAVVVNRSVGGSFDTTVDISTTTEETLT
FT                   TSLTGTIATPTFALASESVSFEDTPTRSATQRSVDIENTGDVPLVVTAPTIEGSNADAF
FT                   SLLSGDRELRIAAGSSETVTVGFNPTTAGDKTAILSIRPRNDPAVETTQQLALSGRATE
FT                   SDVGLTNPAVSFGALNPETTQTRSVSFVNDGTAPVEITGASVTGTDSGAVAVDGLQQQR
FT                   VQPGETTSFGITVDTANRERGTLAAQVAIATTGETVTAPVSATVASPELTISPSTGATV
FT                   STVRIGETTTTNIQVANDGNAPLEVTAVSTTGGDAAAFNVVNRPTGSISSGSSDRATIE
FT                   FDPAALPNAATRAQGTPLDASTSLEVITATGERRSISLSGTAETGALTTPRTFQFGTTT
FT                   IGETRTQSFTIANSPSATTPVDITGVSISGRDAGAYDITLSDSDLPRTLAPGESATANV
FT                   RLTPASPGQKFATLTVQTADPRQSVSKVGLSNTDTVYAVEYGSIDVQYINPTPGQSLAI
FT                   NVDQGLRAANATLVSTSSVVNTSDDYAVNYTFGVTPSAVGADASLQEAREGEVAVQYLD
FT                   ATTTAQPAQFDESTLQIEVSKTAIAAQNASPENVTVYRENDGRYEPIDTTLLFETTRGY
FT                   VYEVTTGSYSVFVVGVTDETTDGETGGVDDGDGDTGGVDDGDEDTGGVDDGDGDTGGVD
FT                   DGGGGGGGDGDIGGGGNGGGGGFFGPARQATEIATETEAISGRQVSLTGLANRNDQVRA
FT                   ITLEFSTPTFQEVTADVFADAPEGYPTQRATSVSAVDITVPESVRGEPATVIISLNRDH
FT                   VQEVGPAPEDLQIERFTGSQYQPLSTEVVSVDSEEVTLRAETPGFSLFIISAPVSGAVT
FT                   TTPTLTPTPSSTVTQTVTSEPPTPTPDPTPTPETPTSTPSVIPGFGLIVALVAIISLTM
FT                   ILRYRRRQ"
FT   CDS_pept        complement(274649..274771)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1198C"
FT                   /note="gene truncated at the C-terminus"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT   CDS_pept        complement(274889..275056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1198B"
FT                   /product="homolog to antitoxin VapB N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1198B"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97804"
FT                   /db_xref="UniProtKB/TrEMBL:J7RFS9"
FT                   /protein_id="CCL97804.1"
FT                   /translation="MQYLRMSGELDRRVEVESTVNDIYASIIIAPIRHLINDAVESGET
FT                   VRLVIPDKEL"
FT   CDS_pept        complement(275115..275687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1199A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1199A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51328"
FT                   /db_xref="UniProtKB/TrEMBL:Q18DY8"
FT                   /protein_id="CAJ51328.2"
FT                   /translation="MNRRELLRVLACTSISGGTFLTAGCSENTASFNPVSETIQLGTST
FT                   PVSLDTDLHITTSTISSTYDSEEFESEVTKRASVLVHDYITRQLTDQGLRESGISPERV
FT                   RLRTDEIDTDVHTDEFKRAIPLAVVVNHRYHYANDGELIHHPTVDFDTLLSQLPRTVTV
FT                   AVSESIHFSEYEAVLPVAGHRYWTQNT"
FT   CDS_pept        complement(276008..278206)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1201A"
FT                   /note="product: S8 family serine protease (nonfunctional)"
FT                   /note="EC_number: 2.4.21.-"
FT                   /note="gene has an in-frame stop codon"
FT   CDS_pept        279015..279575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1202A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1202A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51331"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KW0"
FT                   /protein_id="CAJ51331.1"
FT                   /translation="MPNSLISDVELLWVVRAVAPARTRVIADPLPIDQNSAYLRLRSLA
FT                   KREYLTYINHNNSDYYEWELGTYGERRVKSAREDAEIPSASATDFNEYFAGRELKRVHP
FT                   RQLLTILSADSDMWHPSTTFYEELPYARVTIRDVLHELVDIGAIELDDSEQTYRWRVTD
FT                   RGSDALAAFADPEREPPEWALIT"
FT   CDS_pept        279700..280251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1203A"
FT                   /product="DUF192 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1203A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51332"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KV9"
FT                   /protein_id="CAJ51332.1"
FT                   /translation="MQSNMPLPSSRRQCLQYIAVGVTGAGFAGCVGDSPAQSETTTEDS
FT                   DITQVHAEYETTDVRIESAEGDRLGTVTAAIADTGELRYLGLSDTENLPENRGMLFIYD
FT                   SSGNRTFVMREMDFGIDIIYADSEGVITSIHHADAPGPDEDGNNQQYSGQGQYVLEINK
FT                   DWTTARDIEAGDVLVSEAIA"
FT   CDS_pept        280697..280915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1204A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1204A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51333"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KV8"
FT                   /protein_id="CAJ51333.1"
FT                   /translation="MSEAMTNDTGDDGPSETVRTNVEVDRQLWRQVRAAAITDGKNVSE
FT                   KLEEILRERFEGSDDDNKNIDANENNS"
FT   CDS_pept        281001..285881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1205A"
FT                   /product="probable secreted glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1205A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51334"
FT                   /db_xref="GOA:Q18KV7"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KV7"
FT                   /protein_id="CAJ51334.1"
FT                   /translation="MDAPQSRIRQGVQYEYNNYRCTDGESTQGDNMNGSHRKTRAALLV
FT                   LMMIGSVAALSVVAVSPAAGLSANDTVSSPGDATIVADSADSDTDAVHTVRLITDSNSF
FT                   NDGDDIDTIDIDYGSNNDGVGLGSLSTNNVDDNSAEVDVFIDGTEVTDGSATVSTDDTA
FT                   NTVTIANLDSSAAGTGTDLTNNNVNITVELGLTETINNPSSNIDTSIDVTDTGTGGSAD
FT                   TQTFSSVTLGIDEGPIEVDSGGTTSFFNTFDKAIENGATSDGDTVTVKEDLLLSHPGIS
FT                   SANVQNNNVVIQGDGSNPRIDIDESRTGFGSGDYVITVGSNDGVEISGLTFSGNDDNGL
FT                   SGVDATGSSTGITISSNTFDTFTDSHVIEYDGSGDVTITSNTLTSNNAVTTAAIDVGTD
FT                   GTVTVSENSIDNALGGNNDVILAGTSGGSQVTVFNNSITLGNAANAINIDDTGGSTDIN
FT                   ISADSSNPAEIGGNTGASNAVIITDTSGTSGNLLIDGIRVFEVGTGIDLAANDHSITGD
FT                   ITLTNLNLTKAAENSDGAILIDATDNDNLGNLVVNNTLVETVNNGPAIEIDDQTGDPEV
FT                   SQLTLENINVTSASGLVAIDITDNNDFNADSVTLNDLEFNTVGDGLNIGNILTNKAELK
FT                   VQNIVADDVTNNFLIKLGDSNARDANVTNLSVTNLDATAIDVDNAAGSGDGDVIIQDAT
FT                   ASGADAGTVISVNNGPSGNVDISGITADNVTTIADIDNGATSAVGSDLTIQDVDAVDLE
FT                   TGAEAIITDNNPRDLTVDNITIDGFSNNGIGINGLEDDPSATLSITEVSLNDSSGDGIN
FT                   VNLPSQGEISSLTLDADVSNTATGITLDLNGATLPTVPAFDSINATDNTGDGLSIDNFV
FT                   INDDLTIGSSGTQLNISGNGANGISVGSSVNVNTLGVTNVLADANSNDAINVNPSSIST
FT                   VEVSNLEASDTDDGVVVSGGPATVNVTDSTFDGQGTDAVRVGNDNSNAFSVNIDNTVMN
FT                   GSSNAGVKLDTDLQSSLNVTNSEITEAGSFGIQAIVDNDLVNTNINQNTFTTQAGDTSG
FT                   IEFEGLTGSSNVNATLNFYGDVTGPNVDREGGSGNLLAGNLRFADGVNITSTSDPDGSL
FT                   SITPFVDSNDNPVFGFEGVVNDDGGSPLSNTEVTLNYAAQNQDIDNQFTFTTSGSGEYV
FT                   AVISEHQTSDFYDVSANTQGFAESDTQQVTIDGSGTSGAFIASGTNLNLNSGAALEGFV
FT                   NNASGEQLQSTGNLQLIDASNDEVLVDGFSTNASGGFTVSLTPDTYDLRVNHPNFDSSN
FT                   TVEGVELQSGNTTTLATNFTLREDTTADLTATVEFSNETAIENTDVTFSGSGGVPSSND
FT                   ASLPVTQTTNSSGIVQFEIPASDTNDAYTITADSANFSNASTGVSPAPGDSVSRDFSLE
FT                   EAQAQEPSVSVNFTDQTVPNGTEEVTVNSANFTRADGSAGDYVVVVHVVNATKFDRGID
FT                   NSISAPVGASENLSNGAESITVDLNSSAAFEGDDALDTLSENVTLRTMLHTTDNDTAFG
FT                   TRLGNAIDGIEPGDETDDANITISEDTFVEPAPGTDAESPPQDSDGDGKFEDVNGDNAT
FT                   NFDDVVALAFVLTEKDDLTQQQRDAFDINDDGVVNFDDVVRLAFPGQ"
FT   CDS_pept        286783..290562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1206A"
FT                   /product="probable secreted glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1206A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51335"
FT                   /db_xref="GOA:Q18KV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KV6"
FT                   /protein_id="CAJ51335.1"
FT                   /translation="MNMRTFCCCFLLLNSSMAVGIADVSVSNSVEHSHATDIQQSASTA
FT                   SDIINIYSIPEYDPLVDMNSLINMSSIMELNDIGRLEPPEVPLTSTNFPSNLQANSTPT
FT                   PTPTPTQTPVAVTTGSLSPSSPPASTSIDHSLSVEFATEVPNGTTITFPPTYEVSDFRL
FT                   HSVNATQNESAKTSVRGRLTSITTTQNQTVRQPGIKLTTTGNVRDVDVDLTIQHQTVQA
FT                   QTEYDISAVAPDADPVSVSQFFVRPVGSDNRAALSGEFDRAAGRGFIYPNATVYRGERD
FT                   ISFRGELDSPLRGTGGNNDGVLLSPPIPTDIPTGTYSINGRNDTASVQLQEPEITTLRI
FT                   ENTNSADVTGGTIYTGETETATVIAQSNFEDAEQLELTVRNEDGTDITKELIETAPVRP
FT                   ETESGRPVRSISSISHTMTTTQSIQPMRSTVTSSTVTPNKRSLSLREKPANTSQLSTEI
FT                   HRDSDATVTRQTQMSNTPGPDVERTVNQSDVEPGETVAVTLKATVGSNNKLAIVDKFSP
FT                   NVQQGEITNLDIGETDATPILSVIRDNGLVFRITDVPSGTRVEINYRIKTNPVSQTYAL
FT                   DGYVKTDGVQTESDTTEIVAGTGGAGSTVVSGGQVQWQLDVSDIDAQTVTVELTGSDDL
FT                   DTNKAKSTAQLTISDASPTVSVSDSQPNRGERPTVSVSDGVYGSTYTIGINTADIKDNV
FT                   SPSGQASIFRDVGTTQEIGIITEDGTIASGSKGNTPAFIYAEVKIDTDDGTGETKIETD
FT                   HLDKITTLKLSARDQAASTLIKRGEIIAETDLSVGDRDVTLSGPDGYIPGDETTLRGNA
FT                   DSGVDTVLMYVRSTTGSQYELVDLDGTRDGSQSGLSVSGEFSKETVLSRGDAPGNRLLS
FT                   LPGTYQLALQSKAILSDTRRTVPQTISRAELLTESPSLHTIEVRQPTVTLEQPGINGVV
FT                   ADTQDVIKINGSANGRDSALLVAIGDRGTIQTKVVEGPTFNQTELSISDFSAGRVSISV
FT                   VSAGRDGRLGDGEFNQAQITGVDDQFNQLQNQLQQAAGGTTTGDQLRALLRTETDLDTA
FT                   SDDQLTTESVQIVPANIEINTPTQNTTIRSNSLIQVSGSTTVESYSGDISVLLTGESIT
FT                   QTREQSQQWDDDGWNVTLPVSNLTPGQYRIKASIEDTTAIRMIEIAAKDTPTQASSRMT
FT                   NTVKSTQRDGVSPSENTAMSDQTPTQVPSSPTEESGETTAPSSQESVEDQLTNLTSQSK
FT                   PSEDPNNNTSNVIALGGLAILLVATLVFVSTRQP"
FT   CDS_pept        291388..294354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csg"
FT                   /locus_tag="HQ_1207A"
FT                   /product="S-layer glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1207A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51336"
FT                   /db_xref="GOA:Q18KV5"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="InterPro:IPR026458"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KV5"
FT                   /protein_id="CAJ51336.1"
FT                   /translation="MSYTKQARALLLALLMVTSVLAVGVGPVAATSGSISISDAEVNAG
FT                   NTADVDVTINQTPDGVQDAEFDISLSNGSVGNITDVEDGAISFANFTEGDSVTAQGVSL
FT                   AGTTSNSSVTLGTIKVNTATQGSTDVDVTVTTLTNNSGGNINLDDNSVTATVTANAPGT
FT                   GPSPPPGGGGTPADPRDNWNPSFDDGDEPGNPASDGTVSSGAIVFQGEDNLGFSGPNAP
FT                   TSSSQLSRAGGANEGTPLDRPVAQDAPTGTYDLNGGDPGDGGFNVTVQTPRVSTLDVNN
FT                   NNGEDVNGGTLVADQTDANVLIEFNYGASEDIELTVEDSSGTEITNEILDDSQPSIISG
FT                   VDPDGNATIEIDPSQVDEGEYTFTAAGIEDLDFGDATRSTTVTIASDRNAELSLGNDEA
FT                   TQGENVGFTIDNSPEGSFHAVVVESSDFRDNIDANNADNIFREVGDTEDSGIVSPGGDV
FT                   LEIGTDIGATDAVDSDNVAYAFAIVEIDGGNGVGGIETQFIDDTSVTVDLYTSSSTAQT
FT                   PYLDSNNNHIDANLVELESNGNIQTDDDQDLDVLEGEVSLENPDNTYIVNSEIELNGTT
FT                   APGVDEVAIYARDQGDYELVQIDGSDTVTVDADNTFSEDDVSLTDGDGPGNDLLSIPGS
FT                   YRIGVIDASDAGGVGNIAAELDTSDFNGGVSSSKSIRVTDTELSGDFTFYNGQIAEEDR
FT                   FNAVDVEGLAPGQSEVGVIFVGPRGNTETELVSVDSDDTFDEEDLSLGGQIAQGTVSAH
FT                   FLSDGRDGEIGATGTDLEDFVNNDIPNFEDTAGGSATGEQVREQIIADSVDDTASDDLF
FT                   ITETFRLADGLTTIEEVNTPVSNNGTIEVTGQTNRKPDDTTIVLELLDQEDNVITTAST
FT                   DTWDTDGTYTASLSLDAVETGNYTLEADDSENTDRVPVQVVEQVTEETPTPEPTATEEP
FT                   TPTATPEPTATEEPTPTATPEPTATSTPETGTGTPGFGIVVALIALIAAALLAVRRNN"
FT   CDS_pept        295263..297122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1208A"
FT                   /product="S8 family serine protease"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1208A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51337"
FT                   /db_xref="GOA:Q18KV4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR034075"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KV4"
FT                   /protein_id="CAJ51337.1"
FT                   /translation="MRRIWEISSIGVIFLIIISTLIGFVGVGVVTSNERPPIGQAPPVN
FT                   TTTTTDVISQSQGEDMQAYTVTASNMDAIDAAQLTEYGEIGTRADRRIELTMSPSDLAA
FT                   VRNISWVIDVRPVMHPEPAQADIPGSAQAAGENNSLGVQQAHQNGVTGENIEIGIIDKG
FT                   FDADNPTIESNVVDTQSFRRSPGNPAHGTSVAEIVTQTAPDSQLYLVSTSTGTDIEAAI
FT                   SYLLSEDVDIIVHSQGIPALNDDGDHFLTDDINAATEDGSLFINAAGNEAQTHWEGEFR
FT                   DTDTDGIHEWTKSGDELNCLQNCKVEYSGSITVYIRWEDQGKESHYRPLLFNPRIDQYI
FT                   AIDDNRVFATSTGERYALLRVKNIQSQPVDLVVDHVSGPADDRIEVIIPSGPRQIQRNI
FT                   PASSIIAPGDVSDSLTTAAYEVGPRQLAPYSSRGPTDDGRTGIDVTGYTNIGVTNGLYA
FT                   SEEFRFTGTSAAAPYAGGIAALVEDNQPGDQSPAEITDTLKSSSDDILNVGTDAASGSG
FT                   VINAADAVDALETEAPTATPESTMNPFPDGIPGANAEGPPTDIDDDGKFEDVNGDNGYT
FT                   FDDVIALAFADTERLTNQQRDALDFDHDGNIDFDDVVELAFER"
FT   mobile_element  complement(297327..298260)
FT                   /mobile_element_type="transposon:HqIRS1"
FT                   /locus_tag="HQ_HqIRS1A"
FT   CDS_pept        complement(297359..298187)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1209A"
FT                   /note="product: ISH9-type transposase HqIRS1
FT                   (nonfunctional)"
FT                   /note="gene is interrupted (frameshift,in-frame stop)"
FT   CDS_pept        298589..298966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1210A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1210A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51339"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KV3"
FT                   /protein_id="CAJ51339.1"
FT                   /translation="MTLVESVNRPELQVEADTLPSDNDTVINADHLSVEVEIDAPTEHD
FT                   KPIFHSCPSADGQRSPTNTDDDGKLEDVNGDAESTFDDVIALAFVISQTGQLTEQQRDA
FT                   LNIDGEDDVDFDNVIALTFNI"
FT   CDS_pept        298971..299219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1211A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1211A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51340"
FT                   /db_xref="GOA:Q18KV2"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KV2"
FT                   /protein_id="CAJ51340.1"
FT                   /translation="MQLLIAVGNGRAERVKLSCLYYNGMNIQYRLLLITLLLLTVVTGV
FT                   AVAQFGGGGGGGGGSNLITIIENIIQFLQSITDIFSA"
FT   CDS_pept        299341..299739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1212A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1212A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51341"
FT                   /db_xref="GOA:Q18KV1"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KV1"
FT                   /protein_id="CAJ51341.1"
FT                   /translation="MSTAKRNDSSVFSPPSNNIGYVAVVAALITGILHLVLGIKFLFQG
FT                   GIPSLGALFTQTLPVLFTLNGIGFLGGIGIYLSQYWWRELHLVAAVYAVATIVAFFIFN
FT                   GAFSVLVTISKLAEVIFTLSVLYLYVNE"
FT   CDS_pept        300303..301070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1213A"
FT                   /product="TetR family transcription regulator"
FT                   /note="this gene has a TTG start codon"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1213A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51342"
FT                   /db_xref="GOA:W0TYV5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYV5"
FT                   /protein_id="CAJ51342.1"
FT                   /translation="MKDDITVLPNAPDNTHTEILRATFRVLCERGYTGVTISRIAARTD
FT                   VAKSVVYYHYEDKDDIIQTLLDQVLAELLSEYFRDSDDDPARRLENFFGFVFAVAGGEI
FT                   HPEENTAGTGECDDTHLGTEETTMCIDSETNANEDIVSSPSDTAKKEFKHCVGAHSQAY
FT                   VELRAQAAHDEVFRKTITANERKLREELRACVDAGVATGAFDIDNADHTTEFLLTLIEG
FT                   AIFRGATTGKINTAALADMLERKLGITVHQDDL"
FT   CDS_pept        301206..302834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1214A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1214A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51343"
FT                   /db_xref="GOA:Q18KV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KV0"
FT                   /protein_id="CAJ51343.1"
FT                   /translation="MRQKILTSILVLFMITAGFAGPVAAAQEIVVGSPNITASAADVQF
FT                   RASESATLSVTVNNDGQLTEGGRDEYENEVQTAQSVRIDIAEDQIDAPIEVNTGTQTLG
FT                   SLNDGQSETVDFALEIGRATPGTYQIPVEITYSHSRAIAYGQFEDTDRQNRERTVTEEI
FT                   TIRIEDRPEFDMRAAETNAVTAGDNGRIAFNLRNIGTETARDATVRLQTQTPGVFFGKQ
FT                   TSQSVDTSVFVSALEPDSREQVTVQMGVGPDVSAGTYTVTAIVEYEDENGITQQSDPLQ
FT                   AGVTVREERTFELENVELTDFRVDEPEARIEATVVNRGPTPAQNVVVSVSGTETIAVIS
FT                   GESAVGDLAVGDSAPVSFTLNIPGEAEPGSISLPFAVEYENEDGDVLQTTTPIRQSVTI
FT                   QPEQDRFEVVGTETGVTPGGSATLAVTLRYTGSEPVSDANAKLFTSDPISSADDGAFLG
FT                   AVEPGTTTTATFRVSASSDAIAKEYASSVEVRYDEADGDTRFTGSLPIGVPVSAGDSGG
FT                   LPLMPIGVAAVIAVLGGGVVLYRRV"
FT   CDS_pept        302839..305178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1215A"
FT                   /product="RND superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1215A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51344"
FT                   /db_xref="GOA:Q18KU9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004767"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KU9"
FT                   /protein_id="CAJ51344.1"
FT                   /translation="MKQSRRFFSRIGRFVQAHPVMTLLLAVALIGVAFVGAGQIESVTG
FT                   DRAFVGSNPTLDTFDDEFDYGSVATLVRGEVTDPTTMRAIDRYDQRMSAVEDVQTVNSP
FT                   ADRVREEYGRIPDSQTKIERVIGSPDTAVIGIVTDAGMTQQQSRPIYTKAVDRKGWVQF
FT                   PAGVSVTVTGSAAFSTQLSALIQQSTQQLLGLAVGLMTVALFFLFRGVRLRLLPIVAVF
FT                   VGVIYTFGAIGYAGVPNSTLTSAVFPILIGLGIDYSVQFHERYEEELETHPPKQALPLA
FT                   LGGIGPPVSIAAIAATLGFGATWISSAGTPAFVWFAQTSMFGIGLTFLSGIIVLLPILT
FT                   LYARWRGDGETTDTDADTETNSDSDPADEAIETTTPTESTTNTDLGDIGMLGRTLGRTT
FT                   RFVASHPIAVLLIAVVLLGGGLAAGDSLETLADSEEFIPQDLPAYVDLQQFRTVTGGGS
FT                   AVQYDMLVTGSNIRDPTALRWMEQYRQIATDKPLIDGMQTPATLVKQHNGGEIPATETG
FT                   VKRVLNDIPASERANYYSDGYAHITIIGERNMNTDELLDFLAIADSSSELTRPPAGLTA
FT                   ELTGQAAVSTPSIVTQIETRNVTTGLGVLFVFGALLLYYRNLIRAVAPLVPMLFVIGWQ
FT                   NLYMSALSIPVSPLGASLGAMSVGIGAEYTIIVMERYFEEFGQSGVSRLDAVEIAGARV
FT                   GKAITVSGLTTVFGFSALTLSPFPILGDFGFLTVGVIFLTLVAAILTLPPTLIVLGRLS
FT                   DLVERVVASRRDIAVQGDPDEVKADD"
FT   CDS_pept        305171..305668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1216A"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1216A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51345"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KU8"
FT                   /protein_id="CAJ51345.1"
FT                   /translation="MTESSANPSVEHILVPVDGSPQSESAVEYVTGIFPTADVTLLTVI
FT                   DPVSGFAAYDGTTEGSWKTQAQQAAESLLAEKRSMLQAETDESSNDDADIDTDTESLSR
FT                   AIETVVEFGEPVESIQEAADTYDVDQIVIGSHGRAGLQRIIVGSVAENVMRGVSIPVTI
FT                   VR"
FT   CDS_pept        complement(305828..307177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1217A"
FT                   /product="probable phosphodiesterase"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1217A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51346"
FT                   /db_xref="GOA:Q18KU7"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KU7"
FT                   /protein_id="CAJ51346.1"
FT                   /translation="MGLFDRLRGEDHPRVAFVGIDGVPFSLLADNPEEFPTFAALAEEG
FT                   AGGAIDSIVPPESSACWPSLTTGVNPGETGVYGFQDREVGSDDTYVPMGRDVQATRLWD
FT                   RVTNADRMATVMNVPVTFPPQRNIQRMVSGFLSPSVEKATHPESFADDLAAADYRIDVD
FT                   AKLGHDDDKSAFMENAYETVDRRFEAFTDIIDRDDWDLFFGVFMTTDRVNHFLFKDYEE
FT                   EREDRELFMEFYRTVDEYIGRIREQLPDDVTLVIASDHGFTTLEYELHCNAWLEEQGWL
FT                   SYANDDHDELADISSESRAYSLIPGRFYINLEGREAHGSVPESEYEDTRDELKTMLESL
FT                   EGPDGNLVADRVVEREEAFRGDHDDIAPDLVVIPNHGFDLKSGFSGHESIFDTGPRNGM
FT                   HSFDNATLYVDNPAVDIQDADIYDIAPTILELMDIEYSRTEFDGASLVRQ"
FT   CDS_pept        307442..307960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1218A"
FT                   /product="DUF2078 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1218A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51347"
FT                   /db_xref="GOA:Q18KU6"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KU6"
FT                   /protein_id="CAJ51347.1"
FT                   /translation="MNQSVIKRFESLSTQQTLALTALGGIMIGAVLFFTAVIFIEPLIA
FT                   LLRGGGPPVSAGPPPEASAPAHAGPHRAAPHGGSLSGLLLTIFGLISTVVVISLVMIYQ
FT                   TVTFAHDSNSDAEHSDDDPLRTLRHRYASGEIDDDEFKRRMSRVSETESSSTQEQSEQI
FT                   PANPDTQVE"
FT   CDS_pept        308086..308586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1219A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1219A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51348"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KU5"
FT                   /protein_id="CAJ51348.1"
FT                   /translation="MREFERKRLLERVNREAATVGVDIPDVVEVQGEEVELRDFVFEIN
FT                   RRDTIPSGERDRVNRAKKNLRRERRERLDTIETGEIPYEQGEELADSIVGIDRALNALE
FT                   QLRSVDLESETQKQTAADRKRWMNFLQQALGHEDSGVGAGRGRGGRGGRGQGSGSGTYG
FT                   GQR"
FT   CDS_pept        308586..310373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polX"
FT                   /locus_tag="HQ_1220A"
FT                   /product="DNA-directed DNA polymerase X"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1220A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51349"
FT                   /db_xref="GOA:Q18KU4"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KU4"
FT                   /protein_id="CAJ51349.1"
FT                   /translation="MRRNDEIARRFEEFADRLEADGVAYKPSAYRRAAENIRECADPIE
FT                   DLAAEGQDAVESINRVGDAIASKVIEYIETGSIDELDELRDRLPVEIDALTRVDGVGPK
FT                   TVGTLYDELGITTLDELAAAAEAEEIRDVSGFGAKTETNIRENVAFARQAGERERLGDV
FT                   RPLADEVLTFLRRREIVETSEVAGSIRRWRDTIGDIDVLAASTESNQVVDAFTDWSAAT
FT                   NVIEAGENKASLRAEGVRIDLRVVDPDEFGAALQYFTGSKDHNVALRNRAIERDLKMNE
FT                   YGVFDVSDVNTNNNADDDADIDDRNTQRIGDRIAGETEQSMYEALELPWIPPELRENRG
FT                   EIEAAAEGALSELLTVEDMCGDLHTHTTRSDGRASREQMVDAAVGRGYEYYAVTDHASG
FT                   PGMVGGIGLSDDDLREQREAIKTASETRGDEIELLAGVETNIDAEGDLSTGDDILTELD
FT                   VVVASPHTALGQERETATERLIRAVNHQSVDVLGHPTGRRINERPGLDIDIERVARAAA
FT                   EAETALEVNANPTRLDLHGTFIQVARDAGATIAINTDAHAPESLAYARYGVHTARRGWC
FT                   TPPDVLNSFDLTDLREFLH"
FT   mobile_element  complement(310453..310504)
FT                   /mobile_element_type="transposon:ISHwa23"
FT                   /locus_tag="HQ_ISHwa23A"
FT   CDS_pept        310541..311092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1221A"
FT                   /product="DUF82 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1221A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51350"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KU3"
FT                   /protein_id="CAJ51350.1"
FT                   /translation="MTDTETSRKRFLLDAMLGSLSTYLRMCGHDAACVLDITPDREVEE
FT                   DRDTINIDTTPSPSSRGLTDDEILAHASSEKRAILTRDTELAQRADDVVLLTARDVEDQ
FT                   LHELATIGYDLTLRPRLSRCGACNGRVESLSSDVVVPEYAPDPSEKDCWQCLRCEQIFW
FT                   KGSHWDDVEATLERVQSSYD"
FT   CDS_pept        complement(311119..312087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1222A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1222A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51351"
FT                   /db_xref="GOA:Q18KU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KU2"
FT                   /protein_id="CAJ51351.1"
FT                   /translation="MTSLAETYNSTKGGPSLRRLTFGLTLFLMGSMLVVSGIGVTTTQL
FT                   LYATDPAALTAKRQLGGVLAGVGVPAVLVGVFAILPSARLTKAAAAVGTGISLMGVLLF
FT                   DHAYPCQWSGAVCGAGKPDLTLLTVAVFSFGTMVTFWCLFIGVTNLRATDAESDPFESS
FT                   QNASAGNQSDATSGAFGLFTTSRDETNTTPTSDGGTEAESITSPFDPTAASESSESPRS
FT                   TQTNASPHSNPREQRSEPSPVQSKRPSPTPRSSSARTHPENEKNTWRSADVDASLGDQY
FT                   CGNCAHFEYVKTDSGIEPYCAAHDELMDDMVPCEEWASRTD"
FT   CDS_pept        312287..312658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1223A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1223A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51352"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KU1"
FT                   /protein_id="CAJ51352.1"
FT                   /translation="MADEAESDGDDEPIVELGEKTPVAGQPLARVAARLTWPHEVSRII
FT                   NQEGESMIRTPSGPQQVESIFADIDETYIDSRQTFVSLVEDVIGSGPVAAEGDDANGND
FT                   DGNNTTNTDGDVDPEAEAI"
FT   CDS_pept        312859..313548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1224A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1224A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51353"
FT                   /db_xref="GOA:Q18KU0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KU0"
FT                   /protein_id="CAJ51353.2"
FT                   /translation="MSVRTHVFDIIDRVSWLQRTLFIGALCSVLWTVWTVPSTALSQRV
FT                   FRDVFVFICIPLALAITHGRKLGYRIDRTVIRDTIILAAFVLPFYLVGSSLPSIREYYP
FT                   MWSTTLAFGDFLPHVIQQLIIVIAAETYYRGLLCVGISDEIGPVSIFISPIIYAFHHVG
FT                   KPPIELLLSGPTDILFGAVDYHAQSLLPSIVAHGLGLVLLDWLVLHDPVLPPELVLRLL
FT                   RWLPIPL"
FT   CDS_pept        complement(313928..314932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1225A"
FT                   /product="transport protein (probable substrate arsenite)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1225A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51354"
FT                   /db_xref="GOA:Q18KT9"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KT9"
FT                   /protein_id="CAJ51354.1"
FT                   /translation="MIRQSLTAMKENLIYVVIGSLLFGLAFGQIAGTETKSVLRAAVVP
FT                   VLFVMIYPMMINIDLREIVNIRHHATVIVVSLLINFGIAPILAVGLSRLFFTGQIEYTI
FT                   GLYFIALIPTSGMTAAWTGLADGDLEAALVAMSVNLLAAVGVLPLYLSVLIPGNVGFDP
FT                   SALYQQLAFIVVVPMIAGVLTRSGLLRRYGTSGFKRFKPIFGGISSLGVMLIVFIAMAM
FT                   RSQSILADPLASMSTVIPLIIFYSVILAIGAFFGRIVLDDARGVSLVYATSMRNLSIAV
FT                   AVVAAPGFPPAEAVLPIALAYVIQPPLGAVYMHYRRDIRQDDSTLREAVMQLV"
FT   CDS_pept        complement(315361..316629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nreA"
FT                   /locus_tag="HQ_1226A"
FT                   /product="DNA repair protein NreA"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1226A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51355"
FT                   /db_xref="GOA:Q18KT8"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KT8"
FT                   /protein_id="CAJ51355.1"
FT                   /translation="MRLDEYVDIEQNKRAKRRRLAKNRSYDIVEYLDDFQDRFESTVQG
FT                   DSLYGGVSPSIFVGTSNYPHVSTGVLSPVGHNDDVSQFITSDTWYNEDISISDVFERRA
FT                   SLLNSTTTRPVTNVAETWDGDGFLGTQREIAIADHPVTVEIGLVNRPNIDFDVNPADVS
FT                   TPVGPRARAESATLSENPHVPRAVEKTISDDDWNAEGAITYLYRRDFDIYDINTILSAG
FT                   ALGRTDQRRLVPTRWSITAVDDVIGRYLRGRIRTNQDINSVEIHRESFLGNAFWVILAP
FT                   GEWEYELVEMKAPGSIWNPKPEAGTAITTDWEGREGRTKYVSETAGAYHAARLGVLEHL
FT                   AQRGRRAKALILRHISADYWAPVGVWQVRETVRDTFDDTPAISETMHEAIDGVCEHLPI
FT                   SSARLHRASTIAAGRQATFDTFT"
FT   CDS_pept        complement(316777..317766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfbA2"
FT                   /locus_tag="HQ_1227A"
FT                   /product="transcription initiation factor TFB"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1227A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51356"
FT                   /db_xref="GOA:Q18KT7"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KT7"
FT                   /protein_id="CAJ51356.1"
FT                   /translation="MTRSTRQRERDSERTRWQGEREEDTNTDEAVDDIDLDNVDDKDLV
FT                   RTGDGEIIHEPTGIVVEEEQIDRGPEWRAFNHSERQSKSRVGAPTTKTMHDKGLTTTID
FT                   WKDKDAYGRSLSSEKRSQMHRLRKWQERIRTKDAGERNLQFALSEVDRMASALGVPRSV
FT                   REVASVIYRRALSEDLIRGRSIEGVSTSALYAACRKEGIPRSLEEISEVSRVERKEIGR
FT                   TYRYISQELGLEMRPVDPKKYVPRFCSELDLSKEVQSKADEIIETTAEQGLLSGKSPTG
FT                   YAAAAIYAASLLCNEKKTQREVADVAQVTEVTIRNRYQEQIEAMGIPT"
FT   CDS_pept        317977..318573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA3"
FT                   /locus_tag="HQ_1228A"
FT                   /product="ribonuclease H, type 1"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1228A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51357"
FT                   /db_xref="GOA:Q18KT6"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KT6"
FT                   /protein_id="CAJ51357.1"
FT                   /translation="MPSVDCDPGEARERLTEAGITVMAGNTEYERWRAERGAATAVAYD
FT                   ETVVVQGSRPDDLLGLLRVDTGGRAHVYFDGACRGNPGPAAIGWVLVTNEGIIADGGEE
FT                   IGKTTNNRAEYAALERAIEMARQYGFTEIDIRGDSQLIIRQVTGEYDTNEPTLREYRVR
FT                   VRELLQTFDRWSIEHVPRDVNSHADKLANEAFDHG"
FT   CDS_pept        318566..319195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1229A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1229A"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97805"
FT                   /db_xref="UniProtKB/TrEMBL:J7SCA4"
FT                   /protein_id="CCL97805.1"
FT                   /translation="MGKRDHDRDHDHDHDHGQQDDAEITDAESGDAERTSLPQSVIDEA
FT                   ERLTRLCINTTVDAEITAYRNERQSLLDEHGYAARVRDADDTLVLYPQSWLVDGIAQFD
FT                   QIDNTDRAVEISLSGPAIGADWENVETSNKTIIDMIRQEHGKAHARNIRAFADFMGNHY
FT                   LKSVTEATKDEREEFINEYYTRNVWPSEKEAAIVSESIRLLDTIEG"
FT   CDS_pept        complement(319258..319617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rosR"
FT                   /locus_tag="HQ_1230A"
FT                   /product="PadR family transcription regulator RosR"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1230A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51359"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KT5"
FT                   /protein_id="CAJ51359.1"
FT                   /translation="MSEAQSITDGSSSVRDLTAFQQNILVILSEEPMYGLAIKRDLESY
FT                   YGTEVNHGRLYPNLDDLVESGLVTKSELDKRTNQYELTDEGYDAVLDRLGWVFSKFVTD
FT                   ESRANRLLDLVEEEL"
FT   CDS_pept        319761..320294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipp"
FT                   /locus_tag="HQ_1231A"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1231A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51360"
FT                   /db_xref="GOA:Q18KT4"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KT4"
FT                   /protein_id="CAJ51360.1"
FT                   /translation="MSNLWTDLETGPDAPDVVYAVIECLKGERNKYEYDKDVPGVVLDR
FT                   VLHSNVHYPSDYGFLPQTYYDDEDPFDIMVLVEDQTFPGCIIEARPVALMRMDDDGEKD
FT                   DKVIAVPDEDPRYDHVEDLDDLTDQTTAEIAEFFETYKNLETGKQTETLGWESADAATD
FT                   AIEHAMELYEEQID"
FT   CDS_pept        320415..320561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1232A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1232A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51361"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KT3"
FT                   /protein_id="CAJ51361.1"
FT                   /translation="MSAEKPDFGVAHPTVIPGSYQGLDIVDADSDVNEDIDNRTSELEM
FT                   LTR"
FT   CDS_pept        320798..321718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1233A"
FT                   /product="rhomboid family protease"
FT                   /EC_number="3.4.21.105"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1233A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51362"
FT                   /db_xref="GOA:Q18KT2"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KT2"
FT                   /protein_id="CAJ51362.1"
FT                   /translation="MATCDECGKHENLPYQCQRCGSTFCAEHRLPENHDCPGLNGWDDP
FT                   AGVFDSGFDDSVNNPGGQSASSKLSSKLADIGGPLGYFRKNMSYVFLGIMWVTFGLQFF
FT                   ILPLLGAFPGSSLWQAIFVLSPDHVGYIWTWLTSIFAHGGFAHIAFNSIALYFFGPVVE
FT                   RYLDTKRFTALFIGAGVIAGLAQIGSTLLTMGPTGAGVVGASGAIMGVLGVLTVLNPKL
FT                   KVYLYFIIPMPLWVLTFGFAAFSIVAGFGAAGGGIIGGNVAHLAHLAGLVIGLAYGVRV
FT                   RDRVGVPNSLQLGGGGRGGGPGRRF"
FT   CDS_pept        321732..322577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfi"
FT                   /locus_tag="HQ_1234A"
FT                   /product="endonuclease 5"
FT                   /EC_number="3.1.21.7"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1234A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51363"
FT                   /db_xref="GOA:Q18KT1"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KT1"
FT                   /protein_id="CAJ51363.1"
FT                   /translation="MQPTDSKRIPDPEMSQDEMKALQRQIADAACWQDTLSVNPEMIRW
FT                   EPTETTKDTTQKTIDSSTSTTDIPNQDADETQPLVAGVDQAFRTEQSEVISAIVLTRGA
FT                   TVVDRIVAVTDLSIPYIPGLLSFREGGPILAAFEEISQKPDITMFDGSGRMHYRQAGLA
FT                   THIGVVLDIPTIGVAKSLLCGTPESDTAQRPTGWQTQINADETVEDADTETVIGHALQT
FT                   RQYDSRKIINPVYVSPGHRVSATTAVKITQALCDGYKLPEPTRRADAYADEIKREYSDN
FT                   "
FT   CDS_pept        322826..323683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1235A"
FT                   /product="probable oxidoreductase (short-chain
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1235A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51364"
FT                   /db_xref="GOA:Q18KT0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KT0"
FT                   /protein_id="CAJ51364.1"
FT                   /translation="MQQTVLITGCSSGIGRAAAHMFLEADWRVYATARNPADIETLGER
FT                   GCQIATLDVTDDDDIDRVVDRIEDESGSVSCLVNNAGFGQFGAIEDIPTSQVHRQFDVN
FT                   LYGPHRLIRAVLPKMRENEAGTIINISSVAGQVSFPTGGVYAGSKAALEAMSDALRNEV
FT                   APYDIDVVIIEPGPVETAFPDRAAREFQDETKENSIADDTQQIERSGAYESLYELLTDT
FT                   KLVGGGGFGAVSAERVAEDILDAASSTSPQPRYQTGATARVGVLARFVPSTWRDTLYQK
FT                   LQSL"
FT   CDS_pept        complement(323862..325106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA2"
FT                   /locus_tag="HQ_1236A"
FT                   /product="ArsA family ATPase"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1236A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51365"
FT                   /db_xref="GOA:Q18KS9"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KS9"
FT                   /protein_id="CAJ51365.2"
FT                   /translation="MSSIDVDAVDAVEDDSTADDTTESNHDHAVDVEIVDDATTLPESV
FT                   DAPEYVLYGGKGGVGKTTMAAATAVASATAGTDTLVVSTDPAHSLSDTFDTDIPPEPAR
FT                   IRDDIPLYAAEIDPDSVAAGPFAEGEGEGDDISDNIGGNEDASAGFGEPESGFETGIGG
FT                   DPGAETGMPFGNLDEMDDVLGGLMGPASGAGAMPGADEAAAMQQLLEYLDDPRFDRVIV
FT                   DTAPTGHTLRLLELPELMDTMLGRIASLRQQFSGMMGSVKGMFGFGDETNAQSEVDLDE
FT                   LRERIERLRSVLRDPTRTDFRVVMIPEEMSVVESERLITRLEGYEIPVQTLIVNRVMED
FT                   LVDVTEINADVDSEWVVSPNPSDCAFCQRRWNVQQTAIQRATDLFRGRDVKRVPLLAEE
FT                   VRGWNALRVVAACLN"
FT   CDS_pept        complement(325208..326329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC1"
FT                   /locus_tag="HQ_1237A"
FT                   /product="pyridoxal phosphate-dependent aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1237A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51366"
FT                   /db_xref="GOA:Q18KS8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KS8"
FT                   /protein_id="CAJ51366.1"
FT                   /translation="MNEYDEPLFFQVMQYASNADRDIVDMVSGNPDWEPPDALRDGLHE
FT                   YADADAADFQYGPSEGLTDLREQIGARRNIDSDNIIITHGAGEANYLAMAQAVECSDVN
FT                   TPEFLLTDPVYPYYPGKASLLDATATHVPVHDDGHLNIDAIQDAASTDTVAIVLNTPNN
FT                   PTGAVYNRAALNDVAAIAADIDALVIVDEVYDHFDFTGDFESALTLSSYTDRIIVTSAF
FT                   SKSMAITGFRVGYAVFPPALVDAAQTRHMLVTVSGSRPAQRAVSDALEKTPPSYYASVR
FT                   NTIRERIDTFTNALETIGAAYTEPEGAFYVMARFDDLPGTLENVEYLIDEAGVAGMPGE
FT                   AFGNAYDDWIRFSLCTDRISIAGDRLMTFFQNS"
FT   CDS_pept        326649..327167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1238A"
FT                   /product="nicotinamide mononucleotide deamidase"
FT                   /EC_number="3.5.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1238A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51367"
FT                   /db_xref="GOA:Q18KS7"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KS7"
FT                   /protein_id="CAJ51367.1"
FT                   /translation="MHDFATDPPIEARVGEILEKADATVAVAESCTGGLIGSLLTDIPG
FT                   ASAYFDRSVVTYSYDAKLTALGVSREALDDHGAVSKSVASEMAAGVRDTADVDWGVATT
FT                   GIAGPTGGTDAEPVGAAYIGVAYQGDWGSNESYRTVERTVFDGQRTAIKEQIARRALEL
FT                   LYESVQEQP"
FT   CDS_pept        327354..327941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1239A"
FT                   /product="DUF457 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1239A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51368"
FT                   /db_xref="GOA:Q18KS6"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KS6"
FT                   /protein_id="CAJ51368.1"
FT                   /translation="MNKDGHVLNAALLAIGLGLILTVDIAISAERLFTAGVTAKPSPSD
FT                   EIQTSIDFAAQLGRSVLAFSLPIILGALFPDVDTAFGRHRKTLHNLPVLLLFILFPPVF
FT                   GNLQFVWIGVATHYLLDVVGSKRGIALFYPLSASEYDLPIGVATSSRWTASVTLIVTAG
FT                   ELAVLFIIHTYIIALDTAPMVVNETVVSVLMS"
FT   CDS_pept        complement(328105..328872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1240A"
FT                   /product="PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1240A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51369"
FT                   /db_xref="GOA:Q18KS5"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KS5"
FT                   /protein_id="CAJ51369.2"
FT                   /translation="MTETTASTRVDLHVKVLSDEVVTCAKAREIDVIVYAPHFTRFDNI
FT                   RSRAAQFSDDDLLVIPAREIFTGSWQTRRHILAIGLNEPIPDFISLTGALDALDRQGAA
FT                   TLIPHPEFMNVSFSESDIQANADAVDAIEVYNFKSPGWANTRSISLITETNHQPFGSSY
FT                   AHLPGSVGRVWTTFDCAIDSEADLVEALKSGVSRRVYHERGLRYTAHELAEFVHLVYEN
FT                   SWKKLDRLFLSGMEPTHPQHIAYDGKYDDVAEY"
FT   CDS_pept        complement(329301..329753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spt5"
FT                   /gene_synonym="nusG"
FT                   /locus_tag="HQ_1241A"
FT                   /product="transcription elongation factor Spt5"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1241A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51370"
FT                   /db_xref="GOA:Q18KS4"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011590"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KS4"
FT                   /protein_id="CAJ51370.1"
FT                   /translation="MSIFAVKTTASQERTVADMIATREEPDIHAVLAPDSLTSYVMVES
FT                   DSNAAISRVLEEIPHARGLVKSGGQAGKSTIAEVEHFLSPTPDVEGIAEGDIVELIAGP
FT                   FKGEKARVQRIDETKDQVTVELYEATVPIPVTVRGDQIRVLDSDER"
FT   CDS_pept        complement(329760..329933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="HQ_1242A"
FT                   /product="protein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1242A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51371"
FT                   /db_xref="GOA:Q18KS3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KS3"
FT                   /protein_id="CAJ51371.1"
FT                   /translation="MDVKIELSSYVRVLKLASTPSWNEFSQIGLIAGAGIVFVGFLGFL
FT                   IFAIMTLLPGGV"
FT   CDS_pept        complement(330405..331721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ1"
FT                   /locus_tag="HQ_1243A"
FT                   /product="cell division protein FtsZ, type I"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1243A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51372"
FT                   /db_xref="GOA:Q18KS2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KS2"
FT                   /protein_id="CAJ51372.1"
FT                   /translation="MDSIVDDAIDEAEKTGGGDAVDGAAVEAEPESESTADTGATNDGL
FT                   SQSGTMTDDELQDVLEDLQTDITVVGCGGAGGNTVDRMHQEGIEGATLVAANTDVQHLV
FT                   EIESDTKILMGEQKTQGRGAGSLPQVGEEAAIESQEEIYNAIEGSDMVFVTAGLGGGTG
FT                   TGSAPVVAKAARESNALTIAIVTTPFTAEGEVRRTNAEAGLERLRDVADTVIVVPNDRL
FT                   LDSVGKLPVRQAFKVSDEVLMRSVKGITELITKPGLVNLDFADVKTVMQRGGVAMIGLG
FT                   ESDSESKAQDSVKSALRSPLLDVDISSANSALVNVAGGSDMSIEEAEGVVEEIHNRIHP
FT                   DARIIWGTSVDDDLDGTMRTMIVVTGVESPQIYGSSDTAAQSNAQGVEGMRVDTDGNGR
FT                   VNAAESVETDTGSNAETDEAETATRTEVPFPDEDADFIE"
FT   CDS_pept        complement(331955..333520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtdA"
FT                   /locus_tag="HQ_1244A"
FT                   /product="D-aminoacyl-tRNA deacylase"
FT                   /EC_number="3.1.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1244A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51373"
FT                   /db_xref="GOA:Q18KS1"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KS1"
FT                   /protein_id="CAJ51373.2"
FT                   /translation="MIGLVVSSADTASVTISDQLHELVEWESHRDAAGDEYEQYDDFEM
FT                   RTIDEWHLEAENASELFSTTPQIIAFLSRHSGDTGPLLTTHFTGNFGPAEYGGEPGSFA
FT                   QACPMIQQTLLEAFDRYAPSKYDVGIECTHHGPTTVGAPSLFVELGSSKAEWNDPDGAH
FT                   AVAQAILELSGEDAPANVETDRTVVGFGGGHYAPRFERIIRETDWVVGHIGADWALDSM
FT                   GAPAANRDIINHAVTASDADVALVADDRPELTKVISQADIRVVQERWLRETTGVSRPMV
FT                   SALENALVPIASGLRLGTPATEYDPATSDEFVITDRHTDNDAVGTVHTKDSTDIDTGTN
FT                   HNVDAERTESEDSHNIRDAIDRADADAVVLAFPTSLMETISGIDIETTNQVFSEHTLAF
FT                   ETTEGGTRPTGRMIVSDYLSVESITHALIDILKLKYDRVERTDETLRVRRQVFDPAKAA
FT                   TLDVPEGPAFGRLAAGESVTVAGRTIDPEAVHTTETVTFPVFSTSSSSSSSSSSSSSSS
FT                   SSSS"
FT   CDS_pept        333818..334636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="HQ_1245A"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1245A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51374"
FT                   /db_xref="GOA:Q18KS0"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KS0"
FT                   /protein_id="CAJ51374.1"
FT                   /translation="MDIYGLIGNPVEHSLSPPMHEAAYDARGIDARYVTFEPTKDTLET
FT                   AINGANALDIAGINVTIPFKQDVLNHIIPDDIAREVGAVNTIKFHDGETPRGYNTDVAG
FT                   VKRAFQHHNISIDGYDAVVVGAGGAGRAAAFALADAGAHVHIANRTVERAETIATDIGG
FT                   QATAGGLDTRDEISDADILLNATSVGMDPDSNQTPVPQSYLHDGLVVLDAVYTPIETRL
FT                   LREATAAGATTIDGAWMLLYQGVVAFEIWTEQDAPIQQMNAALRAELEDA"
FT   CDS_pept        334956..335798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1246A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1246A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51375"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KR9"
FT                   /protein_id="CAJ51375.1"
FT                   /translation="MSIFNTVISAIRSLFAESDRDRQSAAEPSSRGTVSVEYDPSDEET
FT                   NSTVGSDSDAGVDSHEEAVSTSSSGDDIIPEPKYDTEPSPDASTEATVKGTDINVESQA
FT                   SNDTDTSIDDPADSHPAATETDASASTGSLVEDATGKEPAEAVGTATSNTDTERMDDSD
FT                   TNSNTETPTDAVGTETDASASTASLINEATGKEPAETVVSTGTTEQQNETPDDAVGRSV
FT                   QEITGIGSAYEERLSDAGVDSVADLAASEPTVLAEATDIAETRIARWIDQTKTDGEAE"
FT   CDS_pept        335795..336718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /gene_synonym="ilvE2"
FT                   /locus_tag="HQ_1247A"
FT                   /product="aminodeoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1247A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51376"
FT                   /db_xref="GOA:Q18KR8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KR8"
FT                   /protein_id="CAJ51376.1"
FT                   /translation="MSRDRSTSDSPSYAHVDNELVPMEDATVSIRDRGFMYGDGVFETL
FT                   RAYGGEVFRWKAHANRLADSASAINLEHGLSQATLKNRIDETLTANNLDEAYVKLSITR
FT                   GVQPGKLNPDPTVDPTVVVQTSPLPRGGINSNPVWDDPATLQTVKTRRIPDRALPSHAK
FT                   THNYLNGILARAELRVSDADEAVMLDTDGQLAEGATGNIFFVDGDALCTPSLDGPVLPG
FT                   ITRSTVLDIAAEEGIPIREDSFDINTLREAEEAFVTNTTWEIRPVKTIDGIDIGRGPLT
FT                   TLLQQAFQNRVEKRYYDTHREVPNEE"
FT   CDS_pept        336773..337201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1248A"
FT                   /product="probable iron-sulfur protein (2Fe-2S)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1248A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51377"
FT                   /db_xref="GOA:Q18KR7"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KR7"
FT                   /protein_id="CAJ51377.1"
FT                   /translation="MSYIQQMNDSCRIAPSEDVSKDETLVFTASAGFDTTEGILTRLSD
FT                   DTIVAYTNYCPHWRDVRLDSGSGALVRDETVVCQKHGATFEKSTGHCDFGPCEGAVLDT
FT                   FDITVTDGTVYLTDNEWEEATQGVSEDRDLSSGTQIGF"
FT   tRNA            complement(337403..337477)
FT                   /gene="tRNAIniMet"
FT                   /locus_tag="HQ_TRNA08"
FT                   /product="initiator tRNA-Met"
FT                   /note="anticodon CAT"
FT   CDS_pept        complement(337547..338020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1249A"
FT                   /product="GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1249A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51378"
FT                   /db_xref="GOA:Q18KR6"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KR6"
FT                   /protein_id="CAJ51378.1"
FT                   /translation="MGRGRGRGRDHGIVNALFSRIRFGKFISVGALGAVFDIMTTTALI
FT                   VIFDLLDEYAKLLGAEVAIIVMFAVNERWTFADMGAPGIAPTISRFFRSNLVRSGGLAV
FT                   QFLIVRALRQFEITILIAGFDVWQLIPIPIAIAGSLGINYIAESLLTWRVTRS"
FT   CDS_pept        complement(338023..339087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtl3"
FT                   /locus_tag="HQ_1250A"
FT                   /product="probable glycosyltransferase, type 2"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1250A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51379"
FT                   /db_xref="GOA:Q18KR5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KR5"
FT                   /protein_id="CAJ51379.1"
FT                   /translation="MMTRSIGVVIPAYQPDPERLTSYLQQLDTQVTPSPAVLRIELDAP
FT                   SSSLLKQLYSRLSNSTFTASVEIAIADTRRGKGAAITAGFERLCACTNTTANSTTTTVT
FT                   SNNETTERSNIDPGFDRDTDVTINLTTTPPASTIDILAFADADGSTPASSFETVLRALI
FT                   NDTADVATGSRRHPSADVTAHQTLGRRYLGDGFAWLARRLLDEQLYDYQCGAKAITTDA
FT                   WQAVRSHIYASGFAWDIELLAISGGLGYQVAEVPVRWEDQPGSTVSPLRTALRLGRVLV
FT                   TARHRARALAHDPVHRLLASIERSSSQPVIDSVATSKPTALSEKATNITIDAEAEADVN
FT                   VNIDTTDQSSIEVG"
FT   CDS_pept        339376..341895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1251A"
FT                   /product="DUF2298 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1251A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51380"
FT                   /db_xref="GOA:Q18KR4"
FT                   /db_xref="InterPro:IPR018746"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KR4"
FT                   /protein_id="CAJ51380.1"
FT                   /translation="MEYIIIARWLIMYAAIFLFGLPIAARLLPMTSSRGVGLAVPIGLL
FT                   LISFPAYWVGHLPGGWGLPALLAGTVVLVVSAGLAIIDFSKLRNEQKRIQIRFTQAMRP
FT                   SRRAISDTVVVFVASFAFIILIRAFDPAVIPIGGEKFLDFGLLKTLSRSSSLPPTDFWF
FT                   AGEPVKYYYGGHLTTILLGWLTETPPRFAYNIALAGYYATLVTAAFEVSGAIAEANGHA
FT                   RRVGGTIGAFFTGIAGNLLTAARLTVASLPASLERQATGIIAQQTGDSAQNINTALQSF
FT                   SYWDASRVIDGTINEFPLFAWLNGDLHAHMLSTQTLLLGVGIGYAYYRTSRYKKRRRQI
FT                   LVFGAIPLTAAWQAVQNTWGFPSIIALGGLAILVAPTHPVTLLPWSEYPREAPRTNSHI
FT                   DRIYYEIIRIGWTVGITLICGAIAVGFAAPFLFETATGGGQRTIEFLAPTMRSSIAGLL
FT                   LVHGAFIIVILGYLYTQLSDQLSADSQSRARVVTGSILLVGGFAVLTWWLNLPVIIITL
FT                   PVLVAALIGARITHTVGYEAVLIIGGAGLITLVEIMYLNEQAGPGRMNTVFKTYAQVWV
FT                   LWAAAMGIAIPGLRRAQTPPNSSSSPSSPSSTEQLSSEPDTSSSPTATVTATTQADSPT
FT                   SIGENLQSAELFGSITQSIISVVIACLIISTSMYGVLAIGGHLAAGPPPGGPTLDATEF
FT                   VDRAHPTEAVAIDWIDNRRGQPTLLEAPGTTRYHDDSRARATYSWYGNPAASLTGVPTV
FT                   AGWNHEVGYRGQAAYRDRVSDVDLMYTSNASTRATLFDKYNITYIWVGPGEQARYDNIS
FT                   FSMNAVSVAHHSGNVTIYAVDQSDFPS"
FT   CDS_pept        complement(341900..342157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1252A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1252A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51381"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KR3"
FT                   /protein_id="CAJ51381.1"
FT                   /translation="MKKLIIRGSLGINRGAEIEVDGEEVICFSIDKQGDYHGPSRPQLW
FT                   CTVGTEDERETFEKRQYVPHFLDVIAVDAEAITVLSDQGI"
FT   CDS_pept        342278..342559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl42e"
FT                   /locus_tag="HQ_1253A"
FT                   /product="50S ribosomal protein L42e"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1253A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51382"
FT                   /db_xref="GOA:Q18KR2"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KR2"
FT                   /protein_id="CAJ51382.1"
FT                   /translation="MEMPRRFNTYCPHCDTHHEHEVEKVRTGRSTGMKWNARQTRRGKS
FT                   TIGNAGKFSKVPGGDKPTKKTNLKYICSDCGKAHMREGWRAGRLRFQE"
FT   CDS_pept        342563..342790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps27e"
FT                   /locus_tag="HQ_1254A"
FT                   /product="30S ribosomal protein S27e"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1254A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51383"
FT                   /db_xref="GOA:Q18KR1"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023407"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KR1"
FT                   /protein_id="CAJ51383.1"
FT                   /translation="MAGNFYQLQCPDCNNEQVIFGKASTVVNCAVCGTTLATPTGGDAE
FT                   FNGEVIETVERRSVENAISRVDDSPTDADS"
FT   CDS_pept        342888..343688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tif2a"
FT                   /locus_tag="HQ_1255A"
FT                   /product="translation initiation factor aIF-2 alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1255A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51384"
FT                   /db_xref="GOA:Q18KR0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KR0"
FT                   /protein_id="CAJ51384.1"
FT                   /translation="MKYTGWPEPGEPVVGEVDEIADFGVFVDLEEYADKRGLCHISEVA
FT                   SGWIKNVRDHVREGQTVVAKVLDVDESAKQIDLSIKDVNEHQRKETIQEWKNEQKADNW
FT                   MEIAFGEDIDDERYTAVANALLAEFESLYTSFEQAAIHGTEALDAVELDNEEIAAIVET
FT                   ARRNVSVPYVTVTGYVDLECPVGDGVDKVQSALQAVEGDSQTIGDEIDLDVTYVGAPEY
FT                   RIRVEAPDYKTAEGALEAAADRAKTAVTDGGTVEYHRERRSDEE"
FT   CDS_pept        343813..343995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nop10"
FT                   /locus_tag="HQ_1256A"
FT                   /product="tRNA/rRNA pseudouridine synthase complex protein
FT                   Nop10"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1256A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51385"
FT                   /db_xref="GOA:Q18KQ9"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR023532"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KQ9"
FT                   /protein_id="CAJ51385.1"
FT                   /translation="MKSNIKICASWQKKHEQPVYTLADTCPKCNSVTKNTAPAPFDPTD
FT                   AYGEYRRALKQRVRE"
FT   CDS_pept        344000..344758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1257A"
FT                   /product="PAC2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1257A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51386"
FT                   /db_xref="InterPro:IPR004426"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KQ8"
FT                   /protein_id="CAJ51386.1"
FT                   /translation="MEDIEIETVGEATLRDPVLVEGLPGVGHVGKLAVEHLVEEFDSEE
FT                   LTRVYADEFPPQVTVDDDGVTELAHASFHAVSTDGPDLLILTGDHQAQSHAGHYHLTDT
FT                   FLDIAEDMGAESVYALGGVPTGELVEEPDVLGAVATNGGIDPLSDAGVEFREGEPAGGI
FT                   VGVSGLLLGLGGRRGLSAACLMGETSGYLVDPTSAQAVLEVLETVVGFEVGYESLEERA
FT                   EEMKEVVEKIQQMQGQQQGMPTDDDLRYIG"
FT   mobile_element  344779..345284
FT                   /mobile_element_type="insertion sequence:HqIRS58"
FT                   /locus_tag="HQ_HqIRS58B"
FT   CDS_pept        345472..345948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1258A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1258A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51387"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KQ7"
FT                   /protein_id="CAJ51387.1"
FT                   /translation="MESNQLREAFIRSDTSPSGKWWIDLPVGLSIGGNDESATVDAVCL
FT                   TSRPQELPEVYPDHTGTAYVFNRDDERVGVDKSDMFDGLRKRDHFTEETVVIVGFESGA
FT                   SSVGSVGELFACRELLSADWNWTVDETVLVSDTDSDHISYVCDELSIRAMRVTE"
FT   CDS_pept        complement(346446..347399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phzF"
FT                   /locus_tag="HQ_1259A"
FT                   /product="PhzF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1259A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51388"
FT                   /db_xref="GOA:Q18KQ6"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KQ6"
FT                   /protein_id="CAJ51388.1"
FT                   /translation="MDSCRALLVDAFSTDPLAGNPAGVIPDAEGLADNQQRAIAAELGA
FT                   SETVFITDSEVAERRFRYFSPTTEVDLCGHATIAAYAYLDATGEIDPGTHTVETNVGVI
FT                   EITVDDDGTVWMRQQSPTVASIDLAYDDVADALGIDAAALRDIGDELPLAIASTGLPFI
FT                   IVPVNFLEHVGDVNPDAAAIDTLVTSYDAAGMYIFSFDTLESASTLHARAFVPSLGITE
FT                   DPVTGTAAGACTAYLDTFDAFDVFPSTVRCEQGHFCDRPGYIRAQLIQPEQQNDKPDES
FT                   NDSYAQGGVRVGGHAVMTLDGTVAIPSANDNDILEP"
FT   CDS_pept        347514..348278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gptA2"
FT                   /gene_synonym="prt2"
FT                   /locus_tag="HQ_1260A"
FT                   /product="probable phosphoribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1260A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51389"
FT                   /db_xref="GOA:Q18KQ5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KQ5"
FT                   /protein_id="CAJ51389.1"
FT                   /translation="MSDLPDQFNCTITNWEYIYDLCRDVSNQIRADSFDPDVVVALARG
FT                   GWFAGRCLCDFLGLDDLTSLKMEHYVGTAQTTNEPEIRYPMPQGSVAEKDVLIIDDIAD
FT                   TGGSIERAYEYVTDRDPNIVRTATLQLLQTSAFEPDFIGERLETWAWVVYPWNFIEDMT
FT                   DLLTGVMRKTDAETFTIPDLREGLKEYHSVERIEMEIAQPDRMEEVLDEMQRRGYVEAV
FT                   TTNEASGDTPVETGDDVSQPTWRIVETDEVGV"
FT   CDS_pept        348291..349247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1261A"
FT                   /product="auxin permease family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1261A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51390"
FT                   /db_xref="GOA:Q18KQ4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KQ4"
FT                   /protein_id="CAJ51390.1"
FT                   /translation="MVSFISVFATAILPIIGVGGVGYLLGRWRSIDTDALNTVIVYILA
FT                   PALVFYSLATTTLAQSTLFRASVAVIIYHLLAMGVAAGIGRLFNKSKTAVAALMLVTAF
FT                   PNSGNYGIPVSNFAFGSTGRATAVIYLSVQGIILYTLGVYIASRGGTKSRLAGIKRVFT
FT                   VPLVYAVIAALIARVLQIVPSTDTTAMATIKLVGDAAIPLMLLVVGIRLARTDIGSTLS
FT                   AVGLGVGLKMVIAPVIGLGTAVMIGFDDPIVARTFVLESAMPSAVTPMILVAEFGSGDV
FT                   AGVPIAEFVSAAVFVSTMISIPVLTLVIVILKSGAVI"
FT   mobile_element  complement(349261..349766)
FT                   /mobile_element_type="insertion sequence:HqIRS57"
FT                   /locus_tag="HQ_HqIRS57A"
FT   CDS_pept        349950..350855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1262A"
FT                   /product="probable 6-oxopurine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1262A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51391"
FT                   /db_xref="GOA:Q18KQ3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KQ3"
FT                   /protein_id="CAJ51391.1"
FT                   /translation="MYMTTIGFIGGSGIYEALGLQNTHTIEIETPFGEPAAPLTVGEVG
FT                   ETGREVIFLPRHGTSHEYSPTTVPYRANIFALKQAGVTHVIASNAVGSLREEISPRMLV
FT                   IPDQIYDRTKHRTSTFFSDGIVAHQQFATPYCTELRSIVTDVAMENTAADIDIVKDGTY
FT                   VCIEGPQFSTRAESEFYRSQGWDIIGMTTIPEAKLAREAELAYVTIAGVTDYDVWKEDT
FT                   QVTLEEVLSNAERNQKAIKSVLTAVINTIPAEHTCACHTSLAGTINTEKTAIPDSTRED
FT                   LDLLIGEYISEDTTGGEETG"
FT   CDS_pept        complement(350967..351911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpA"
FT                   /locus_tag="HQ_1263A"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpA"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1263A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51392"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KQ2"
FT                   /protein_id="CAJ51392.1"
FT                   /translation="MTDMGSSPHSEEPEAGVIDDIRGYADQNDDTSSDAIEPVELLVQL
FT                   AEEGRIDPWEVDIVDATDAFLNRLDKTDLRTSGRALFYAAVLLRMKSEALIEPDEPADA
FT                   SESEPWEVALEAGTRPIDEFENANMTDGSNSTPHSDSDPIDALEDEMDRRLERKKARGS
FT                   PETLDELVRELREAERESWWKRHREYDTSDSPSGYQRGTQTLDYHTADDFRDAAEPTAA
FT                   DVTDTAHGEDIETEIKAVYAALTDQYEKGRIEVLFTEVADVASTPVSTYLAVLFLSHRD
FT                   KVMLEQTDLFGDLWIQTPKTSAESSPTAVADDD"
FT   CDS_pept        complement(351904..355500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="HQ_1264A"
FT                   /product="chromosome segregation protein Smc"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1264A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51393"
FT                   /db_xref="GOA:Q18KQ1"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KQ1"
FT                   /protein_id="CAJ51393.1"
FT                   /translation="MHIKTLILDGFKSFGRATEIPFYEDFTVVTGPNGSGKSNIIDGVL
FT                   FALGLARTRGIRAEKLTDLIYNPGHATTEADGSNSSESPNEATVTVVLDNSAGTIDRTQ
FT                   VINAAGSESIGDVDEIRVKRRVKQTETNYYSYYYLNGRSCNLSDIQDLLAQAGITPEGY
FT                   NVVMQGDVTEIINMTPQQRRSIIDEIAGVAEFDAKRDDAFEELDAVEGRIEEADLRIGE
FT                   KETRLRQLADERETALKYQSLRDERTEYEEYLKAAELESKRADRDETAEQATEVEADLT
FT                   EANETFSQRQQHVSRLTAELDAVTAEIERKGEDEQLALKSEIEEIKGAIRRRENDIETA
FT                   EERITEAENTRREAFVQLDQKQEQIEELDTEIRSIKVEKASITTEIESLESDLADVEAE
FT                   IEDVDATYDERKHELEAAIDRVNEFKTKRSDAQREKDRLLDKTRRRASDIADAKEELTK
FT                   LREELSTLQATLSDFHSEVDIAEKNESTIEDALSELQNKRSELKDNLDTVRSEIQSKQS
FT                   EYATLEGHTGNDTDTSWPRAVTTILNADRTGVHGTVGQLGSVEKKYATACETAAGGRLA
FT                   HVVVDTDTVGSDCIEYLKSRNAGRATFLPITKMDDRGIPRQPNHHGVIDFAQNLVSYDD
FT                   MYRPIFSYVLGSTLIVETMETARELMGEYRMVTLDGDLVERSGAMTGGSGGGSRYSFST
FT                   SGGGRLERLAEKIETLEDRRQEYQSKIRTVDDDISDARERAASARERVRELESEIDATK
FT                   TEIEETEAAIEQTESRIANLREERAEADKTMQSVDDDIDTLNAEITTTEQEIQTIKEAL
FT                   EESPVPELTAEADELRTAIDDAESQIDDLDARQNELELERQYANEAIDELNEQVERAQA
FT                   KKADAQETISTAQEDIETYNTTLEAKRVAVDEIEDELISLKSDRSDLQATLNAAKNRRE
FT                   SARDTVDKLESKSSSLRGAIERLEWEIDELESEVGTYDSTDIPDYDTVEANIDRLTEKM
FT                   DSLEPVNMLAIDEYDDVESQLDELSSRRDILVEEREAIEERINRFESQKRETFMSSFRA
FT                   INENFTDIFERLSDGTGELHLESQDEPFEGGLTMKAQPGDKPIQRLNAMSGGEKSLTAL
FT                   AFIFAIQRHNPAPFYALDEIDAFLDAANAERVGEMVDDLATDAQFVVVSHRSALLERSE
FT                   RAIGVTMQGNNISAVTGIQLQNDESPEAPADD"
FT   CDS_pept        complement(355630..355953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1265A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1265A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51394"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KQ0"
FT                   /protein_id="CAJ51394.1"
FT                   /translation="MSNRLEELESQITELQAAVNGLTEELVETKERLHLIEDNIEIDLS
FT                   AGSRSVGHEADEAAQSQESRTTDTDANSATDAMSQDESNSTAASDSDASDDESTDDSDI
FT                   IIA"
FT   CDS_pept        356333..357823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /gene_synonym="aatB"
FT                   /locus_tag="HQ_1266A"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.6"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1266A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51395"
FT                   /db_xref="GOA:Q18KP9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KP9"
FT                   /protein_id="CAJ51395.1"
FT                   /translation="MTATALAQRDFTAVIGLEVHVQLETDTKIFCGCSTRDNNAEPNTR
FT                   TCPVCLGLPGALPVLNKAAVEAAVKVGKALNADIAEKTQFHRKNYYYPDLPKNFQISQY
FT                   DAPICSDGQLSISVEDNRREVAIRRAHLEEDPGSLTHQGGNIDTAEYTLVDYNRAGTPL
FT                   MEIVTEPDFRSPAETRAFLNKLEEVLEYLGIFDPTADGSLRVDANISLIPTEDIDNGSI
FT                   TTAALESANRTEVKNISSHKGAEKALAYEVTRQRNAVERGRAIEQETRHWDESRGITVS
FT                   MRSKEAEKDYRYFPEADLPPLAVADWKDQISIPELPDARRERFREEYKLDSESAAKLTS
FT                   TKAVADFFESVADQFDPALAATWVADNLLGELNYRDMTVGDIDDRFDEFTQLIELVDDE
FT                   DITTKNAEEVVLRRMLDDELTPEAVIESEGLGRADEDEVVTAVTGAIDESPEAVEDYHA
FT                   GEGGAINFLVGQVMQKTGGSADPSKVNTLLREQLEDKK"
FT   CDS_pept        358124..360697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA2"
FT                   /locus_tag="HQ_1267A"
FT                   /product="DNA topoisomerase 1"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1267A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51396"
FT                   /db_xref="GOA:Q18KP8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KP8"
FT                   /protein_id="CAJ51396.1"
FT                   /translation="MSQGPELIITEKDNAARRIADILSGDSATADREQGVNVYKWGGKR
FT                   CIGLSGHVVAVDFPQEYSDWRDVEPVELIDAPIEKNPTKQNIVTTLKKLARRARRVIIA
FT                   TDYDREGELIGKEAYELVRRVNESTPIDRVRFSSITEESVTTAFENPDDLDFNLAAAGE
FT                   ARQVIDLVWGAALTRYLSLSAGQLGSDFISVGRVQGPTLKLIVDREREIEAFDPEDYWE
FT                   LFVDLTQADKPIEVSTDDTAAEFEAQYFYHADDGTEAERITEESTAKTVFETLESASIA
FT                   HVDSVKRRTRTDEPPAPFNTTQFISAAGSIGYAAQRAMDIAEDLYTAGYITYPRTDNTV
FT                   YPDELDPRELIEALTNGSRFGSDARDVLDQETLSPTTGDEETTDHPPIHPTDELPKPSE
FT                   LDDDKWEVYELIVRHFLATVSNPATWEHLRIVAIVDDTYSIKSNGRRLLNPGYHAVYPY
FT                   SNATESLIPDIEDGETLRLIDSRIEAKQTQPPRRYGQSRLIETMESMGIGTKSSRHNVI
FT                   QKLYNRGYIESDPPRPTQLARAVVEAAEEFAELIVSEEMTAQLETDMQAIAEGEETLES
FT                   VTSASRSILTDVFKKLMNTDAEIGDHLQRSMKADKTIGPCPQCEGDLITRKSQAGSHFI
FT                   GCDSYPDCEYTLPLPSTGKPHILETVCDVHNLQQIKMLAGKRSFVHGCPLCEAEAADEQ
FT                   ADRVIGTCPECNAHADGELAIKRLRSGSRLVGCTRYPDCEYSLPLPRQGEIDVTDNICD
FT                   EHALPALQILEADENTTKDKTTKESDDIWELGCPICNYREYQSDQTDSSTLESVHGIGA
FT                   KTAEKLKDAGVDTVSALKSAEANTLADRVDGVSVDRLRKWQSTAD"
FT   CDS_pept        complement(361003..361197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA1"
FT                   /locus_tag="HQ_1268A"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1268A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51397"
FT                   /db_xref="GOA:Q18KP7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KP7"
FT                   /protein_id="CAJ51397.1"
FT                   /translation="MAEGKVDFFNDTGGYGFISTDDTDDDVFFHMEDVGGPDLEEGQEV
FT                   EFEIEQSPKGPRAANLIRN"
FT   CDS_pept        361607..362326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrB"
FT                   /locus_tag="HQ_1269A"
FT                   /product="(S)-3-O-geranylgeranylglyceryl phosphate synthase
FT                   1"
FT                   /EC_number="2.5.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1269A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51398"
FT                   /db_xref="GOA:Q18KP6"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR026417"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KP6"
FT                   /protein_id="CAJ51398.1"
FT                   /translation="MNGPWTEWDHVLKVDPDKPLVDGETFEDVCQTGTDAIEIGGTLDI
FT                   TTEKMQEVVDACSRYDMPLYQEPSNPAVVVESDALDGYLVPTVFNAESAFWVAGAHKEW
FT                   VRIDGPLDWERTATEAYIVLNPDASVAEVTEANTDQTAEDVAAFATVAERLFGQEIIYI
FT                   EYSGTFGDTKKVAAAAAALTESTLFYGGGIGGYDSAYEMGAHADTIVVGDLLHDEGVDA
FT                   VSETVAGVKDAHADGEI"
FT   mobile_element  complement(362323..362374)
FT                   /mobile_element_type="transposon:ISHwa23"
FT                   /locus_tag="HQ_ISHwa23B"
FT   CDS_pept        362844..364148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="HQ_1270A"
FT                   /product="aspartate--tRNA(Asp/Asn) ligase"
FT                   /EC_number="6.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1270A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51399"
FT                   /db_xref="GOA:Q18KP5"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KP5"
FT                   /protein_id="CAJ51399.1"
FT                   /translation="MQDRTLTAEVTPGDEITVAGWVHEIRDLGGIAFLILRDRSGKIQI
FT                   KFEKDEMNDEIVQTGLDVPRESVISITGVADDEPRAPTDVEIVPTAIEVLSSADTELPL
FT                   DPSGKVNADLSTRLDNRTLDLRKKEVKAVFQIRSEVLRAARDAFRELGCTEINTPKIVA
FT                   TGTEGGTELFPITYFGEEAFMNQSPQLFKQLMIGSGLERVFEIGPIFRAEEHNTPRHLN
FT                   EATSIDFESAFINHAEAMDACEYVVTAAYQGVAENCITELETLGLRDGFSVPDESFPRI
FT                   SYQEAIERINATGELDEQLVWGDDLPTDGERALGADVGSHYFITDWPSEIKPFYIKDHD
FT                   DDKTLSTGFDMMHPQMELVSGGQREHRYEHLVSGFEQQGLDPEQFDYYTKMFRYGMPPH
FT                   AGWGLGGERLVMTMLGLENIREAVLFPRDRQRLSP"
FT   CDS_pept        364149..365063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1271A"
FT                   /product="pantoate kinase"
FT                   /EC_number="2.7.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1271A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51400"
FT                   /db_xref="GOA:Q18KP4"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KP4"
FT                   /protein_id="CAJ51400.1"
FT                   /translation="MTTTATREAEVFVPGHITGFFSAHHTDDPATTGSRGAGLTITTGV
FT                   KLEVCRGPTVSPGITLNGKSISIDAVDNVIDRLDIDDINVNAQTALPLGAGFGVSGAMT
FT                   LGVAFGSNAVADKTNTRAESALITAAHCAEVRAGTGLGDVVAQARGGFPIRVEPGAPHV
FT                   GQLDGITATPRVEYCSFGTVSTESVLNADTNTLTTAGEQALETLQSTPTAAQFMTLAHQ
FT                   FGVEAELMTPKAQEVIADVQTAGGTAAMAMLGNTVFALGNDLSAAGYDPVVCQTHSGGV
FT                   SIQQQGNYQTGGQHNPRTIEHSS"
FT   mobile_element  complement(join(365103..365625,365734..365766))
FT                   /mobile_element_type="insertion sequence:HqIRS56"
FT                   /locus_tag="HQ_HqIRS56A"
FT   mobile_element  complement(365626..365733)
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AE"
FT   CDS_pept        365924..366733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1272A"
FT                   /product="4-phosphopantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.36"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1272A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51401"
FT                   /db_xref="GOA:Q18KP3"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KP3"
FT                   /protein_id="CAJ51401.1"
FT                   /translation="MNDSSPTQDPEKETETETETETEIPQDHPRYQSLITRHRIEEGVD
FT                   TGITSPQGLIAEGRGEAFDYLLGEKTTSSADDAARAAAALLLHAEHPVISVNGNVAALV
FT                   PEAIVELAEVVEADIEVNLFNRTEKRMNAIADHLYDHGAQTVKGLKADDQIPGLDHERG
FT                   TVDADGIGAADVVLVPLEDGDRAAALDAVGKREIVIDLNPLSRSALAATVPIIDNVIRA
FT                   VPNITEHASALKQADNVALTTVINRFDADEVRERAEQEIRRGELRSS"
FT   mobile_element  366794..367333
FT                   /mobile_element_type="transposon:HqIRS89"
FT                   /locus_tag="HQ_HqIRS89A"
FT   CDS_pept        complement(366801..367220)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1274A"
FT                   /note="product: IS200-type transposase HqIRS89
FT                   (nonfunctional)"
FT                   /note="gene has in-frame stop codons and is truncated at
FT                   the N- and C-terminus"
FT   CDS_pept        367265..367333
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1274C"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene truncated at the C-terminus"
FT   CDS_pept        complement(367414..368415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1275A"
FT                   /product="YqjG-type gamma-glutamylcysteinyl-hydroquinone
FT                   reductase"
FT                   /EC_number="1.8.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1275A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51404"
FT                   /db_xref="GOA:Q18KP2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KP2"
FT                   /protein_id="CAJ51404.1"
FT                   /translation="MNMLVDGEWRTDAYQTTNDDGEFDRQETSFRDEIVSDADAEFPAE
FT                   SGRYHVYISRACPWAHRVAMTRRLCGLEDDISLSVVEPERYEDGWEFSTDYPDPLYDAE
FT                   YLRDIYTRADPEFTGRVTVPVLWDEQTETIVNNESREIMRMLNTAFEGSNDVELWPEGY
FT                   REEVDRVIDEIYDPINNGVYRAGFADTQEAYNAAVEEVFDALDHWEDVLDDQRFLAGDK
FT                   LTEADLAMFVTLIRFDHVYHTHFKCNRRAIHEYPNLWNYTKELYQLPGIKSTVNIDHIM
FT                   RHYYVSHDDVNPKRLVPTGPDIDFSTPHNRDRLPADLPDTLQSETTAAVADD"
FT   CDS_pept        368587..369510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thi4"
FT                   /locus_tag="HQ_1276A"
FT                   /product="thiamine thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1276A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51405"
FT                   /db_xref="GOA:Q18KP1"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KP1"
FT                   /protein_id="CAJ51405.1"
FT                   /translation="MSFDEFADVSEAQVTRAIAKDWGNEFIDRVDTEVIIVGGGPSGLV
FT                   TAKELAERGVDVTIVEKNNYLGGGFWLGGFLMNKVTVRDPAQSVLDELDVPYEESDEAS
FT                   GLYVADGPHAVSSLIKSACDAGAEVQNMTEFTDVVTRENHRVGGIVLNWTPVHALPREL
FT                   TCVDPVAVESDLVVDSTGHDAVVISKLSERGVLNAPGIEHANEHNTGMDNTADDEYGAP
FT                   GHDSPGHDSMWVSRSEDQVVEHTGVVHPGVVATGMAVATVEGLPRMGPTFGAMLLSGKR
FT                   GAQACLNELGREATPIDFTPAAPADD"
FT   CDS_pept        complement(369729..370673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiR"
FT                   /locus_tag="HQ_1277A"
FT                   /product="transcription regulator ThiR"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1277A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51406"
FT                   /db_xref="GOA:Q18KP0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KP0"
FT                   /protein_id="CAJ51406.1"
FT                   /translation="MKFIEEVVVEEFLPTFRSMLAEDLRDRGLTQHEVAEALGISQSAV
FT                   SKYAHGDVSRRDVVVTDNDVKTLVDQIGSGLTTGDISRVQALVESEVLIRRLESGGVIA
FT                   QLHEESMPELEEYDGYSRIHDPEGGLRTSEQVRSSLRRALRRLTNITGFANLIPNVGSN
FT                   LVACLPDATTVDDVAGVPGRIFDIKGDATVPGGPEFGVSEHVASVLLTARENGFEFNSA
FT                   INICYETDLVEQLSTAGYKLVEFDPDADADADPIQTAFSSIRNNDDVQSDMTPAVCYHT
FT                   GGYGVEPIIYILAGDAEIIVEIVQELLAPEMRG"
FT   CDS_pept        complement(370670..371290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="HQ_1278A"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1278A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51407"
FT                   /db_xref="GOA:Q18KN9"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KN9"
FT                   /protein_id="CAJ51407.1"
FT                   /translation="MILSDDDILARLETQELVVEPIDDLDMQIQPASIDLRLGEEFLEF
FT                   QRTNISCIHPNRKEEVSEYVSETIVSEGDEFILHPGDFVLGTTKERVEIPSDLLATVEG
FT                   RSSLGRLAVVIHATAGVVDPGYCGQITLELSNLGTAPVALTPGMRVSQLVFTELTQPSA
FT                   RPYGAARDSKYQNQTGPQASRIGEDPEFDQTDDTAQHNKENTT"
FT   mobile_element  371548..371829
FT                   /mobile_element_type="transposon:HqIRS114"
FT                   /locus_tag="HQ_HqIRS114A"
FT   CDS_pept        371631..371774
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1277B"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene has an in-frame stop codon and is truncated at
FT                   the N-terminus"
FT   CDS_pept        372020..372358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="HQ_1279A"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1279A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51408"
FT                   /db_xref="GOA:Q18KN8"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="InterPro:IPR034759"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KN8"
FT                   /protein_id="CAJ51408.1"
FT                   /translation="MKQAIVARADLRMGKGKLAAQVAHASLSAVEDTGTRSEKQWKGGG
FT                   QKKIVLKANSEKKLFQLADEAERDGIPHAVVRDAGHTQLEPGTVTCIAIGPDSDENIDR
FT                   ITGSLSLY"
FT   mobile_element  372756..372863
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AF"
FT   CDS_pept        373020..374123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1280A"
FT                   /product="sensor box histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1280A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51409"
FT                   /db_xref="GOA:Q18KN7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KN7"
FT                   /protein_id="CAJ51409.1"
FT                   /translation="MMRELANESESESADGIFQQLLDELDDVVVIRAAETGKTLAVNDA
FT                   VEDVFGYTSAEFRSLDIADYTAGPNSPDEARAQEAYETARKVGSATFLWRAERHNGDPF
FT                   WAEVNVSQTMIDDQEYLVSVIRDITKYKTREIELERLASVLSHDLRNPLNAAKAQTTHL
FT                   REQTGCQNEFVDRLEDLHDRMLNIVDDVLTAVTEDQQITDIESIHLDSIVNDAWKIVGG
FT                   DGKLKLRDNLGVIEADRHRLQRLFENLFENAIVHSDETVTVTVSKIDGGILISDDGPGI
FT                   PEDDRDQVLKYGYTTAESGTGLGLNIVSTIADAHGWELTVGESVDGGAQFRLTGISRNH
FT                   SDEDNINPTRSSSSWSEKIDDHSHEQE"
FT   CDS_pept        374402..375856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truD"
FT                   /locus_tag="HQ_1281A"
FT                   /product="tRNA pseudouridine(13) synthase TruD"
FT                   /EC_number="5.4.99.27"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1281A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51410"
FT                   /db_xref="GOA:Q18KN6"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KN6"
FT                   /protein_id="CAJ51410.1"
FT                   /translation="MRISPSREQTVGIEYYYSDTDGTDGRLRVRPADFQVREIETIEPE
FT                   PIDASVGDYPHVLLRVTLSKWDTNDFVQQLSDNLEISRERVSWAGTKDKYAITTQLFSI
FT                   ARINPNNKSLTAIPNADIEVLGRIGRPLQFGDLGGNSFEICVRSATDTSVVDAITAELH
FT                   AYTVSNNHSQDDDTQSVYAGDTNKVSIAFPNYFGHQRFGSRRPITHRVGRAIVRNAWRD
FT                   AVLQYVANSFESEPETTQRAREFASEQAGSSRPDWEEAIERMPNALRFEQSMLHRLNEA
FT                   NANIDSDAATWRHALMAVPKNLQRLFVNAAQSDLFNRIISERLRHDIPIHRPIAGDIVC
FT                   FQDQNSPTEVIRPDPARTQLTTERRVDIMQRHCERGRAFVTAPLVGTQTNFASGKPGEI
FT                   EKSVLAEYDITPEDFDLPGTFDSRGTRRAMALQTNISTKADCNTDSDKHNIDQSGQSYK
FT                   LVFTLPPGAYATAVLREYLKVAPAKL"
FT   CDS_pept        376496..377218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1282A"
FT                   /product="DUF2103 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1282A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51411"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KN5"
FT                   /protein_id="CAJ51411.1"
FT                   /translation="MDCRRCGTPLERPGDYCLVCDTANCDTVVIEFERDRADVTMLEAE
FT                   TTIATTTVTTVPEDNPETHVVELRNFAGKVADEVRRKRPETVFATGNRDVLRETRAQVH
FT                   YEFYRVAGERPVERVLDKRGERSLEVVETPPREKIGGTHSTLIGGRPGRKAISVIADHP
FT                   HVKKIIPGPIDAGGTGSQSGLRAKVTRSDNNGNVRLLLRDGSSVQENRVVTTAMDVETG
FT                   EYIRDDLNDALTAAELRE"
FT   CDS_pept        377461..377739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl43e"
FT                   /locus_tag="HQ_1283A"
FT                   /product="50S ribosomal protein L43e"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1283A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51412"
FT                   /db_xref="GOA:Q18KN4"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KN4"
FT                   /protein_id="CAJ51412.1"
FT                   /translation="MAEEKARTTGSAGRFGARYGRVARRRVKEIESEMRNASIDGDDVT
FT                   RVGTGIWRNEETGELFTGGTYNPETPGGKQVQRSIRAALSTDGDDDN"
FT   CDS_pept        377755..377889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoP"
FT                   /locus_tag="HQ_1284A"
FT                   /product="DNA-directed RNA polymerase subunit P"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1284A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51413"
FT                   /db_xref="GOA:Q18KN3"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="InterPro:IPR023464"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KN3"
FT                   /protein_id="CAJ51413.1"
FT                   /translation="MSYKCSRCKRDVELEEYGGVRCPFCGHRVLLKERAPEIKEVPVE"
FT   CDS_pept        378104..378520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcc1"
FT                   /locus_tag="HQ_1285A"
FT                   /product="KEOPS complex subunit Pcc1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1285A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51414"
FT                   /db_xref="InterPro:IPR015419"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KN2"
FT                   /protein_id="CAJ51414.1"
FT                   /translation="MNTDSGIDGDTAKSDHSGNIGKIEMSADSSHNTITDIHSSVTTDG
FT                   ETNSVSQKCHTLELTWDYTSVQHAQVVRLAVEQEVGEIDDARSCAQVENNGTTVTVNIA
FT                   AADLIALRAGANTWTRFVAVAEQLFNSADDLKIE"
FT   CDS_pept        378743..379132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfdB"
FT                   /locus_tag="HQ_1286A"
FT                   /product="prefoldin beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1286A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51415"
FT                   /db_xref="GOA:Q18KN1"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR012713"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KN1"
FT                   /protein_id="CAJ51415.1"
FT                   /translation="MQGNLPPEAQEKLEELQDLQETAQKVAAQKDQAESTLNESEAALD
FT                   ALEDVNEETMMYREVGELLVETEYDTAHDELSDKVDSLEIRVEQLQKQEDRVRDQFESL
FT                   QEELQQMLQGGAGGGGPMGPGGAGA"
FT   CDS_pept        379125..379409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1287A"
FT                   /product="DUF3194 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1287A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51416"
FT                   /db_xref="InterPro:IPR024502"
FT                   /db_xref="InterPro:IPR035954"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KN0"
FT                   /protein_id="CAJ51416.1"
FT                   /translation="MHEHETIVMSPSTPSDEAVVQTAADAAEGVIFAEYRQSTVTDVDI
FT                   TVSFESGVLEVDVYLNIPDDVSPPADDVADEAARTAQAAVDELFDETQG"
FT   CDS_pept        complement(379628..381535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1288A"
FT                   /product="DUF2070 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1288A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51417"
FT                   /db_xref="GOA:Q18KM9"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KM9"
FT                   /protein_id="CAJ51417.1"
FT                   /translation="MTTTQSELANLSRYIFRAPRWYVSLTFAIVVAAAVGVAAFDSGAY
FT                   ATTWRGLFIFGRDAWEGVFFIGIPTVVAAFATTGVDRFVGGKLTANRSSLLALISELIL
FT                   VTIVVTAAVISVITGLGQRFIFDALVVALASIFAFRLLIVMAVSRSSLVIAALPASIQT
FT                   LVAAVLLFVYSGTLRYISFGGPLLDAYMMPYLARPERAPAELSAISMEHFALLGITSVL
FT                   YALAVYGFIIVVDRPWRRSLNVSMLDFLRGFIGHIAEGSRELEEFFQQLGEEALIPVSV
FT                   LSFKTLDDVEKARFVLPMIHPGPMGEIGGGNLPERVATAANGLAFPPHATAGHDFNLVT
FT                   EREVDTIIDAVETAANRIEYATEATRSVRTHSGESSMLGQCIGNNGLLISTYAPGFADD
FT                   IAYGVGLSASAEARTTGLSNVMLVDAHNSNNGLSGPTLGHVTPGSARAFDMISAARQCG
FT                   DRLSTAEQYPMELGTAWAETPWDPTDGIGPLGVRVAVLKVADNETAYVLVDGNNMEPGL
FT                   RGQIIEAIVDEGPVDAAEIMTTDTHIVNTVEANNQVGSAIDNDIFINTLSELTTEARRD
FT                   YETVTGGMAVERVSVTVFGSDRTETLASHANAVVSIGGAFAVTVALAAIAVSVVIFLFA
FT                   "
FT   CDS_pept        complement(381564..382118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaAa1"
FT                   /locus_tag="HQ_1289A"
FT                   /product="GMP synthase (glutamine-hydrolyzing) subunit A"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1289A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51418"
FT                   /db_xref="GOA:Q18KM8"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KM8"
FT                   /protein_id="CAJ51418.1"
FT                   /translation="MTHIAVIDNHGQFTHLEQRALRDLGVDVELVDNTTSPEQLIQTAD
FT                   GLVLSGGPDIDRVGNCPEYLELDIPILGICLGMQLLANELGGSVAAGDYGGYADVDIEI
FT                   LDDTDPLIGSLAPETRVWASHADEVKSVPEGFERTARSDVCRIEAMSNRDQERYGVQWH
FT                   PEVAHTERGEEVFKNFIARCQ"
FT   mobile_element  complement(join(382384..382403,382512..382544))
FT                   /mobile_element_type="insertion sequence:HqIRS56"
FT                   /locus_tag="HQ_HqIRS56U"
FT   mobile_element  382404..382511
FT                   /mobile_element_type="insertion sequence:HqIRS42"
FT                   /locus_tag="HQ_HqIRS42AD"
FT   CDS_pept        complement(382589..383248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1290A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1290A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51419"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KM7"
FT                   /protein_id="CAJ51419.1"
FT                   /translation="MYKTPDGTSVGVDDPYDHADICDHLTDDGRCRLALSQGDNHPEFA
FT                   TDRREDNYACLAHTYEEKNKITSTGSSDVSSSAEPSIPVSAFRECPHYRSTTAKHACVR
FT                   CGLEDVRIAHDTDAQSLLEEHHLSYRDNTTQGSGISDTSEGTDETTQNNSESQITYSHE
FT                   ITVALCRWCHSKVHQSIARLEDDVSPDPEAFATREQRRAREQQELGFSPASEKDND"
FT   mobile_element  complement(383431..383482)
FT                   /mobile_element_type="transposon:HqIRS106"
FT                   /locus_tag="HQ_HqIRS106A"
FT   CDS_pept        383599..383958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1291A"
FT                   /product="DUF192 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1291A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51420"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KM6"
FT                   /protein_id="CAJ51420.1"
FT                   /translation="MYLKHISHTDSSVDTLATDIEIAATWCTHIRGLMFRRDFSVGSAL
FT                   VFQFDRVTQRTIHMLFVYSDIDVLWLKDNIVKKCTRLSAWYGIGTAEGDTVIELPSGVA
FT                   GAISTGDTVRIVADD"
FT   CDS_pept        384154..385749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA2"
FT                   /gene_synonym="cimA"
FT                   /locus_tag="HQ_1292A"
FT                   /product="2-isopropylmalate synthase / (R)-citramalate
FT                   synthase"
FT                   /EC_number="2.3.3.13"
FT                   /EC_number="2.3.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1292A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51421"
FT                   /db_xref="GOA:Q18KM5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KM5"
FT                   /protein_id="CAJ51421.1"
FT                   /translation="MVDLFGGNPGIPLASALDSDGTVQLLDTTLRDGEQAPGISLDPDE
FT                   KAEIARELDRSGIEFIEAGSACTGEGERETIRQVTGLDLDATVTSFARGVKSDIELAVD
FT                   CGVDGVTIVVPASDQHIETKVGSTRSEVVTTTAELVEYAKDHDLWVEVIGEDGSRADIE
FT                   FLERLMREALDAGADRSCYADTVGHANPETTYEYVSRLAALGPVSTHTHDDLGLAMTNV
FT                   WVSLAAGADLVHGTVNGIGERAGNVALEEVAIALAHGYDIETATLDQLYSLAQTVSQAT
FT                   NIPLPPNKAVIGENAFTHESGIHTDGTLKDKTMYEPYSPSSVGRERRLVLGKHAGRAGV
FT                   QAALDEHRIDVSEDEVTAIVDRVKELGDRDKRVTDADLLTIAEEVQGRERDRHVELLDL
FT                   TAASGGGTPTASIRLRVGENERVASGTGSGPVDAAVEAVRAALGTDADAQLDSYHVDAI
FT                   TGGTDAVVTVEVEMSRGDRTVSVATSDSDITRCSVEAMVEALDRLLSVDTSGTSSNSES
FT                   DVDVDADDVSLADD"
FT   CDS_pept        385877..386245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1293A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1293A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51422"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KM4"
FT                   /protein_id="CAJ51422.1"
FT                   /translation="MSTFLVDIKPSARRTNGSVGEIIRDQGSRHQFNTRADAEKWAAKL
FT                   AVCGRATVWIRAANPSDRSDIDAYLLGRYTPSPLSSQPRTQPKMAVASETDGVSENDNN
FT                   NRNTTTEQYTLSMTQSLE"
FT   mobile_element  386580..386698
FT                   /mobile_element_type="insertion sequence:HqIRS39"
FT                   /locus_tag="HQ_HqIRS39A"
FT   tRNA            complement(386867..386951)
FT                   /gene="tRNASer1"
FT                   /locus_tag="HQ_TRNA09"
FT                   /product="tRNA-Ser"
FT                   /note="anticodon CGA"
FT   CDS_pept        complement(387006..387464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1294A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1294A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51423"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KM3"
FT                   /protein_id="CAJ51423.1"
FT                   /translation="MDLDRFATDTPSDDAPGDGSVCVVATQPDTFERCRDGLYPSPKSY
FT                   DRTRQSFEYLAFYRTAPISAITHYARVTDRVEQHRGTDGPMTAEDWETLIDPFSTERTV
FT                   IVFTWDELVPLESPVENDGHGVRGAWYCSLRDIREAATLSALSARAET"
FT   CDS_pept        387606..388769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1295A"
FT                   /product="ABC-type transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1295A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51424"
FT                   /db_xref="GOA:Q18KM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KM2"
FT                   /protein_id="CAJ51424.2"
FT                   /translation="MTKRNQDDNSPALVVDSVGKQFGSGDSAVTAVDDVSFSVERGSIV
FT                   GLLGPNGAGKTTLIKSILGTVLPDTGAIRVLGTDVKNERRAAYANVDAMLEGARNDYWR
FT                   LTVQENLRYFATISGINPDSVATRHARLLERLDLTTWADTPVRDLSRGMKQKVSLASVL
FT                   AGGAELLFLDEPTLGLDVEGSRTLRSELRRLAIEDGLTVILSSHDMAVIEDVCDRVIVM
FT                   ADGGIVADSDVETLVETVGGDRLQIKSNDLTPRIVSRLRERITKTALKATIDSDSDPHI
FT                   EVEISEVSLYRLFNILEGADVEIEQIQTIEVGLEEALIELTSTQSQADTRTQAGSVDES
FT                   HTKVGDPSVNKNQQEAKSPGGTEISTDSIQRSNHSESDMGRSREHDI"
FT   CDS_pept        388766..389602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1296A"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1296A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51425"
FT                   /db_xref="GOA:Q18KM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KM1"
FT                   /protein_id="CAJ51425.1"
FT                   /translation="MTDSQLFSTAHQDDTEQSDPQPATYYHLTRAVLLREFLLFIRYPA
FT                   NAVGGIVVALFFFIVLFYGGQLLAGRALADSIEGIVVGYFLWTLSSGAYASISNDIGSE
FT                   VQWGTLERHVTTPFGFAPVALLKGVAKLVRTFLTSAVILVGMLLVTGTKLAFPPVTVIV
FT                   VAGASVASVLGLGFAAGRITVLYKRVGTWLGLLQFGFVILVSAPVFSIPWLRALPLAHG
FT                   SALLQRVMVDGTRLWEFSITEISLLFAIAVVYLLGGYVVFHYATRRARRLGVLGDY"
FT   CDS_pept        complement(389711..390103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1297A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1297A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51426"
FT                   /db_xref="GOA:Q18KM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KM0"
FT                   /protein_id="CAJ51426.1"
FT                   /translation="MSFISDARSAEQRDESFLLTSAVIGVIGCLLAGVTPLIGGSSTAF
FT                   TGSIVSSSLLGLVFAVQSLRLLRRDGVVALAPAVLTTIFGGWFMAAPLLYDVGFIATAG
FT                   TQFAGLLLAAFGLYLTLARIAPSRGS"
FT   CDS_pept        390242..391633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phr1"
FT                   /locus_tag="HQ_1298A"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1298A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51427"
FT                   /db_xref="GOA:Q18KL9"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KL9"
FT                   /protein_id="CAJ51427.1"
FT                   /translation="MRLFWHRRDPRLRDNAGLAAAARADSESVLPVYVYDSDLFGAIGE
FT                   RQQAFWMHAVRELKEAYRERESDLIVRAGDPGDIIPALAEEYDIDGVHCNQHYRPGRQS
FT                   RRERVASELDKSGIAFDVRTDHVLVDPGRLDASYPNHSQFHNDWEDVPKRSAYDSPPAE
FT                   TLVDITDSKTVPVPTVEIDLPPSGYEAARDRLDRFCDRGIYDYNDTRDDLAQAAEKPTT
FT                   AVSRMSPYLSGGMIGIREVWDAASSVYEAVHGNERRNADKYRYELSWREQNYHLLYYNP
FT                   DLAVSNYKSIPNEIQWRDDDEAFKSWALGQTGYPLVDAGMRQLNREGYIHNRPRQVVAS
FT                   FLTKHLLVDWRRGARYFTKQLIDHDYASNHGSWQWIASTGTDSVDVRIFDPVSQLSKYD
FT                   DGANFVREYVPELSDTPTEKIIEWPTLSPGDRAQFAPEYPDPIVGRNEGYERAQQTFEK
FT                   ALGKR"
FT   CDS_pept        391786..392454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="npdG"
FT                   /locus_tag="HQ_1299A"
FT                   /product="F420H2:NADP oxidoreductase"
FT                   /EC_number="1.5.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1299A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51428"
FT                   /db_xref="GOA:Q18KL8"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KL8"
FT                   /protein_id="CAJ51428.1"
FT                   /translation="MRLALLGGTGDIGEGLALRFGFHTNHDVVIGSRDPDKAHDAAEAY
FT                   TDELNEQGVDTKITGFENEMAADRGEIVFLCVPPYHVADTVAVAADRLSSDDIIVTPAA
FT                   GVKRDEDGFHYHPPSAGSVTALVADAAPDSVPVIGAFHNLAAGRLTNLDADLGIDTLLI
FT                   GDDTTAKETIGDLAEDIDGLRALDAGGVANAAEVESLTPLLITVAQQNEDLHDLGVTFD
FT                   "
FT   CDS_pept        complement(392726..393028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="HQ_1300A"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1300A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51429"
FT                   /db_xref="GOA:Q18KL7"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KL7"
FT                   /protein_id="CAJ51429.1"
FT                   /translation="MTDDELPKTVFDDLFSVIESRRETLPDDSYTASLFAHEKGENAAL
FT                   EKLGEEATETILAAKDSDSAAIQAESADLIYHLFVVLAMEEITLDDLREELHGRL"
FT   CDS_pept        complement(393222..393839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="HQ_1301A"
FT                   /product="pyridoxal 5'-phosphate synthase subunit PdxT"
FT                   /EC_number="4.3.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1301A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51430"
FT                   /db_xref="GOA:Q18KL6"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KL6"
FT                   /protein_id="CAJ51430.1"
FT                   /translation="MIQAGVVAVQGDVSEHAAAIRRAGESHSISVEIVEIRQSGVVPDC
FT                   DVLLIPGGESTAISRLLDREGIDTEIQAHVEAGKPVLATCAGLIIAARDAKDDRVETLD
FT                   IIDVTVDRNAFGRQIDSFEAPLDVDGLDEPFPAVFIRAPVIDAAGEDATVLAQWEDNPV
FT                   AVQDGAVVATAFHPELTPDSRIHDLAFFANQNNNVDTAVSTD"
FT   CDS_pept        complement(393964..394128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="HQ_1302A"
FT                   /product="protein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1302A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51431"
FT                   /db_xref="GOA:Q18KL5"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR023531"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KL5"
FT                   /protein_id="CAJ51431.1"
FT                   /translation="MSSGQNSGGLMSSAGLVRYFDAEDRNSIRIDPKTIVAFGVLFGVG
FT                   VLVLNALAI"
FT   CDS_pept        395239..395583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1303A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1303A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51432"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KL4"
FT                   /protein_id="CAJ51432.1"
FT                   /translation="MSTTEDVLEHHLEVFAARDVEATMSDYADDATVITHDGTYHGTVE
FT                   IRELFETLYDEFETAVEFNLQRQVVDDDCAYIVWNAETDENVYEYATDTFVINDGNIVT
FT                   QTLAAKIDPK"
FT   CDS_pept        complement(395983..396627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1304A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1304A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51433"
FT                   /db_xref="GOA:Q18KL3"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KL3"
FT                   /protein_id="CAJ51433.1"
FT                   /translation="MTKDTRRDRIWRIALTTDGFTKQYIEDQVDASSRTVHDVLKTMVD
FT                   YRFLKQKTQYRKVEQGSSGSTSTSTSISTSTKQDVTVYHPLDIRPTPPEPGFEDDIPSE
FT                   NIFSSGATLDANADMFTGVGEKRLRKLEMERLVTLNDILDASINEIAEVDGFGEQTAKT
FT                   LKITTIEAAINKLDMSEEDLRELSVSEHEDMFNIREEYAEELKQNLNSTLL"
FT   CDS_pept        396804..397310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1305A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1305A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51434"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KL2"
FT                   /protein_id="CAJ51434.1"
FT                   /translation="MTDKVNQSPGVDTPSQDFGDHWDSILTDIETTATRYDNDGWKSLA
FT                   LHPGHITPLAGKPDNLWGFDVLLPDDEFATLENTIADVTITDYELFSTEASGGVFLMSV
FT                   MRAESETVAIIFPLYYRLGDDSISALKTHTAKTGSVRTYLRRLENDRRIEFQYDKPGLF
FT                   FPSQL"
FT   CDS_pept        complement(397452..398723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF1"
FT                   /locus_tag="HQ_1306A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1306A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51435"
FT                   /db_xref="GOA:Q18KL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KL1"
FT                   /protein_id="CAJ51435.1"
FT                   /translation="MSEDTLVSVENLKKHYTSTKTLPDRLFRRTSPPIKAVDGVSFEIT
FT                   AGKTLGLVGESGCGKSTTGETILALRSPTGGTVKFDGKKIGDLSDTEVKNFRRRTGMVF
FT                   QDPFASLNPRMTAGQIIREPLSVHDVGTQDEQRDRSKSLLKRVGLSADQYDRYPHEFSG
FT                   GQQQRIAIARALAVEPDFLVLDEPVSALDVSVQAQILNLLADLQTDFGLAYLFIAHDLS
FT                   VVRYVSDRVAVMYLGNIAEIGPTEAIFERPQHPYTKALLESVPRARLSESDREITTLED
FT                   DVPSPRNPPSGCRFRTRCPVVIPPTDIDIDQTAYREVMDLRERIEAGTLTATDVDSTTS
FT                   NTADAGTPSQQSMTANSVWPGEISSSLHGDNAVAVKTARAELRDGNRQAAIETLRDRFE
FT                   TVCEHDRPEHSNKTHHSAACHLRH"
FT   CDS_pept        complement(398720..400105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD1"
FT                   /locus_tag="HQ_1307A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1307A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51436"
FT                   /db_xref="GOA:Q18KL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KL0"
FT                   /protein_id="CAJ51436.1"
FT                   /translation="MSTHDLLRVCNVSTRFLTETGQINAVEDISFTVRDGETFGIVGES
FT                   GSGKSVTAHTIMGLIESPGRITSGEIWYRDSALADAVGVDESNGAFVNLVELDAETRRA
FT                   LRGPSFGMIFQDPMSSMDPSVTVGEQIAQAVEAQRRASTNPRSVSTRTQQYGLMRFVVD
FT                   SLIPHRGYVSTESKQRAIELLDMAGIPDPTERAEAYPHEFSGGMLQRAMIAQALAGEPD
FT                   VLVADEPTTALDVTIQAQILSLLSEIQAETDMSVILITHNLGVIARMCDRVGVMYAGEI
FT                   VERGSLADIFEDAVHPYTKGLLGSVPDIDTPGARLEPVAGSVPSLVDEEMGERCYFADR
FT                   CPKAMEACLDPPPEFDADTGTVLEDDTENRHGVKCVLAQRGYDPDASVSISNANSNSDG
FT                   DIDSDDSKNTSADNTKDIFNPIKNVIKTISSETNANANADADADADADANPSSKTPSGE
FT                   GEP"
FT   CDS_pept        complement(400110..401132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC1"
FT                   /locus_tag="HQ_1308A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1308A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51437"
FT                   /db_xref="GOA:Q18KK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KK9"
FT                   /protein_id="CAJ51437.1"
FT                   /translation="MLSPRTWQNLVGELRQSPLAKLGVSLFIVILGMAIFAPFLAPHNP
FT                   NVQHLDQKLLPPVGLSRVTTTTTTQMVNGSVTTITERTQINATWTYPLGTDPLGRDMLS
FT                   RVLYGARTSMLVGVLGTALATLIGAPIGLIAGYYGGLVDDTLMRFADIMLAFPSLVLAI
FT                   SLVGLFGRIAVTVPDPWVVFNIASATMPATFTLPGMVILVIGLVNWVWIARVARGEALS
FT                   IVEAEYIKAARSYGTSDIRIMTRHVLPNALTPILILATILVAANILLESSLAYLGFSGT
FT                   TLSWGFDISQGQQYLATSWWITTLPGVGIVIAVMGVNLIGDWLRDALDPGIEGESEGGL
FT                   "
FT   CDS_pept        complement(401132..402139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB1"
FT                   /locus_tag="HQ_1309A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1309A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51438"
FT                   /db_xref="GOA:Q18KK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KK8"
FT                   /protein_id="CAJ51438.1"
FT                   /translation="MGYSRFLLKRASQGVVVIWGVVTVVFTLRYITPGSPVTFIAPLDA
FT                   SQALREEIAMEYGLNRPLYVQYIEYVVGLLPPNIDMGQSFAAGTSVSSQVFAALPRSLE
FT                   LAVAATLVAVALSIPLGVISATNRHEPTDYAATTFSLVGISTPNFWLGLMLTLLLAVQF
FT                   DIFPTGGMARVNGTPLLLVDALRYLLSGRPQVMLRWLSHITLPAVTLGTYFTALVTRLT
FT                   RSGMLDELGKQYITALRAKGTPETLVRFRHALKNTLVPIVTVLGLQLGTLIGGAVITER
FT                   VFAWPGLGSLLIDAINARQWVILQGCLVVVGAGFVIVNTVVDAIYAYLNPEVTV"
FT   CDS_pept        complement(402140..403792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA1"
FT                   /locus_tag="HQ_1310A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1310A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51439"
FT                   /db_xref="GOA:Q18KK7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KK7"
FT                   /protein_id="CAJ51439.1"
FT                   /translation="MSDESRERDIDRRSFVKLAGTATATAALAGCGSSGGGGGAEGGDE
FT                   TAGTSQSGETAADTDESTTGSKEFPVTITQGQMPDTLDPHDHRNIPADIVMRQCYEGVI
FT                   SRNRQGQIVSMLATEWRRVEPGRARFSIREGPTFQQTDNQLTPADIAYTINRMVDDDVG
FT                   FTSPQAGQLGGVTGAEVVDDERAVDVLSDGLNPIVFAEFAIYCDVVEQAWTEENESSYV
FT                   AQNMNGTGPFELAEYEQNVQVTFDRYDEYWREPAEVTQLTFTSAQQASARVNQLIAGET
FT                   DIIVNVPPQSVNRVDSSESVSVNAVGSTRIIYNGMRSNAEPFSSLSFRRAMNFAVDLES
FT                   IITDVLQEFGEQTGQPTLQPFFGYNDDIEPYAHDPAEAERLIEESGHAGASLTLHTPVG
FT                   RYLKDLQIAQAVAGMIDDLSNVSCDVKQRDFNTLASELTDGDITTGPKFYLIGWGNATF
FT                   DASQTVNPTLTSDGVLTSFKSDQLDSLITEANQTAESEQREQLLQQANAFSHEQAPWIF
FT                   LNRQFGVYGSTNRIDWQPRNDERIDAYSISSAE"
FT   CDS_pept        403949..404338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1311A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1311A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51440"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KK6"
FT                   /protein_id="CAJ51440.1"
FT                   /translation="MNRSGKLLEHTQTSQPEDVTAWCHTASASASASADKVHPSVFDIT
FT                   VIASVSLVTQTNWNRTEHTLPFSTLVSTVLQTSTHRMVILPTTVEHSRTYTDILNHPLS
FT                   SEESRSLPRRNPRLSAPISYRMFTD"
FT   CDS_pept        404958..405650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1312A"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1312A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51441"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KK5"
FT                   /protein_id="CAJ51441.2"
FT                   /translation="MSYKVLITFDLPDTDAFPSVLIEALTATEVVALGHYKLPEQTPPG
FT                   AARDQLETDTRKTLTDLIRPFHNADIPVQTRLVFSSAREKAIDRVAPQDDCDAILSTGE
FT                   VNSLDRLFVALGDGPEFDRILSFVADLLAAVDASVILFHTREETLTNATDQLVKRGVDS
FT                   NRIYQQVSGGDNVRQRIVELEDKCDLLVIGEGTPDPLNKTPVLETASTKMPLNTNDPAF
FT                   IIRSPTQS"
FT   CDS_pept        405778..407232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cat2"
FT                   /locus_tag="HQ_1313A"
FT                   /product="transport protein (probable substrate cationic
FT                   amino acids)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1313A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51442"
FT                   /db_xref="GOA:Q18KK4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KK4"
FT                   /protein_id="CAJ51442.1"
FT                   /translation="MGSEQDTRSPAASLGLLDATMVGIGAMIGAGIFVLTGLAARIAGP
FT                   AALLVFVLNGGVTLFTALSYAELASAIPKNGGGYAYIRETFSAPIAFVMGWTRWFTYMA
FT                   AGALYALGFSSNFIEFIHLYWGGLPAGPIWQVGYALLAVVSFVMLNALSTEASGGAETL
FT                   VTLVKIGILIVFIFFGISAVSSATFFGIDPGAAPTVSDFFSKGATKVLPAMGLTFIAFQ
FT                   GYDLIATVTEEVENPKKNIPRAIFISLGVTVLIYLLVVGVAVGTLGAPRLGSAKEKAVV
FT                   EAAISFMPDVAFFGASIGAALIAFGAVFSTISALNAVVIGSSRVAYAMGREGQLPERLG
FT                   NIHHKYGTPYSALMASAAIMLVATIVAPISLVGNLASLFSLLGFIVVNLAVIKLRRDQP
FT                   NLNRPFEIPFYPAPPILGCVLNLVLAIFISWVTWAVAVGWLLVGAVIYVGLNSERTRTV
FT                   LSNTQSTDAETTPIEDSTMSETVEED"
FT   CDS_pept        407292..407957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA2"
FT                   /locus_tag="HQ_1314A"
FT                   /product="TrkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1314A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51443"
FT                   /db_xref="GOA:Q18KK3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KK3"
FT                   /protein_id="CAJ51443.1"
FT                   /translation="MSKDLQIVIVGGGRVGYHTAQRLSNRGHDLVIIEQDSDRVQFLSD
FT                   QYIASVIHGDGGRPSVLREAQLERSDVIAALTSHGAMTNVGICMTAQRIAADIKTVARI
FT                   DHGEHEEFEQIVDAVVYPEELAAHTAANDIIDVSGGGVRTIEEVTDRLELIEIEIAERA
FT                   PAAGKSLDAVSFPQGAVIVAEQHTGAFPGPDMILEPGIQYILAVQPDVTDEVVRLLRG"
FT   CDS_pept        408118..408885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1315A"
FT                   /product="Lrp/AsnC family transcription regulator / TrkA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1315A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51444"
FT                   /db_xref="GOA:Q18KK2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KK2"
FT                   /protein_id="CAJ51444.2"
FT                   /translation="MTYRPDEIDRRILYYLGANARDTSAPMIAEEVDVTPATVRNRINQ
FT                   LEESGIIRGYHTDINYEQSNGKVTTQFTCTAPVGKRSTFADKAAATPGIIHVRELLAGQ
FT                   DNLVITAVGEDTNDINRIAHQLSAAGLSIQREDIVIDERFQPYHRFAPEEDRAPSAVTD
FT                   FQAVAGGGELVEFTVSETAGIAGMTLADAHREGLLPEKVLVVGIERDGSHITPNSDAEI
FT                   EPGDLVSVFSPEALPEQLVTAFDSDTRSASEQA"
FT   mobile_element  complement(408881..408929)
FT                   /mobile_element_type="insertion sequence:HqIRS81"
FT                   /locus_tag="HQ_HqIRS81B"
FT   mobile_element  408930..410757
FT                   /mobile_element_type="transposon:HqIRS90"
FT                   /locus_tag="HQ_HqIRS90A"
FT   CDS_pept        complement(408949..409386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1316A"
FT                   /product="IS200-type transposase HqIRS90"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1316A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51445"
FT                   /db_xref="GOA:Q18KK1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KK1"
FT                   /protein_id="CAJ51445.1"
FT                   /translation="MIIKVKVRIEEYGSHADSISLCKYHFVWCRKYRHGMLELVQDELA
FT                   ELFEGIAERFGHEIVSVEVEIAPDHVQLFVEADSKWSPAEIAKQFTGYSGRTILKGHPE
FT                   IKQRYFCGSGLWKDGYDVGTTGGVSEDVVRYIEEKEKETDH"
FT   CDS_pept        409406..410764
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1317A"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene has an in-frame stop codon"
FT   mobile_element  complement(410758..410812)
FT                   /mobile_element_type="insertion sequence:HqIRS82"
FT                   /locus_tag="HQ_HqIRS82B"
FT   mobile_element  411154..411707
FT                   /mobile_element_type="insertion sequence:HqIRS57"
FT                   /locus_tag="HQ_HqIRS57B"
FT   CDS_pept        complement(411986..412426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1319A"
FT                   /product="thioesterase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1319A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51448"
FT                   /db_xref="GOA:Q18KJ9"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KJ9"
FT                   /protein_id="CAJ51448.1"
FT                   /translation="MAVSVLDSYVESTERIQPDQANNDGNIHGGETVRLMDELAAIAAM
FT                   TIAGTTCVTAHIGSVDFQHPIPVGDVAKLSAYVYETGNRSLGVRVTVESRNPRDTEAMP
FT                   ATSACFTMVAVNENEDDNDSVALPSIVPQTDRGEHLVETVPC"
FT   mobile_element  412947..413511
FT                   /mobile_element_type="insertion sequence:HqIRS71"
FT                   /locus_tag="HQ_HqIRS71A"
FT   CDS_pept        413263..413442
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1320B"
FT                   /note="the underlying mobile genetic element is noncoding
FT                   but has a region of high similarity to the C-terminal
FT                   region of transposons with an IS1341-type transposase gene"
FT                   /note="pseudocoding frame (HqIRS71 element)
FT                   (nonfunctional)"
FT   CDS_pept        complement(413660..414283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1321A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1321A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51450"
FT                   /db_xref="GOA:Q18KJ8"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KJ8"
FT                   /protein_id="CAJ51450.1"
FT                   /translation="MRDRVWKTVHQFKNGDIERVVEPLRGETIDGFTKREVDNAVDAST
FT                   RTVHDVLKTMVQYGILTETNQRVKVPKGDSGSAIHGTVIYSADSADRHTDMEEIKMNDT
FT                   VKSDSDNIASTYICNVCGDGFETKDALTAHVTRSENHPRVSQMDSCPKCGDEQILKVKR
FT                   IDDNSPTDNETVLMIDHKTEMKEMGGVKTLDITNYCLVRGDYEA"
FT   CDS_pept        complement(415018..415800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1322A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1322A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51451"
FT                   /db_xref="InterPro:IPR024992"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KJ7"
FT                   /protein_id="CAJ51451.1"
FT                   /translation="MRWGNDDFESLDSKGSLVTAAFLHDIGWQEFDQQPRLKSDEKTEN
FT                   PTPVNFHELSPQTWIDMYEQGIDATAAIDPYAGLVVSLHGVGLQNRRYGLTPEWSNPRS
FT                   EFDGFIQTEQKRQRQLMEQISEQDGFSMSSKDRTTLKQLQEDAHNPEQYEGQLWCNYKL
FT                   LQIWDTLSHILCATTNPTGETSIENVPVSTSTDITISIHSETANTYRIVPYPFQTDPLV
FT                   VSVTGRTVSEQTVKSGETSAVAREYFLNTDEVEFRIHS"
FT   CDS_pept        416508..416771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA1"
FT                   /locus_tag="HQ_1323A"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1323A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51452"
FT                   /db_xref="GOA:Q18KJ6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KJ6"
FT                   /protein_id="CAJ51452.1"
FT                   /translation="MTVKLLDFYADWCGPCKTQDPILDELESDYNEVAFEKIDVDSKQD
FT                   IANQYEVRSLPTVVIENDDGVVDRFIGVTQREDIETAIQQAL"
FT   CDS_pept        417121..417270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl40e"
FT                   /locus_tag="HQ_1324A"
FT                   /product="50S ribosomal protein L40e"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1324A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51453"
FT                   /db_xref="GOA:Q18KJ5"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023657"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KJ5"
FT                   /protein_id="CAJ51453.1"
FT                   /translation="MARNEAAIKRTLEKQICMRCNARNPQRASECRKCGYSNLRPKSKE
FT                   RRAA"
FT   mobile_element  417387..417822
FT                   /mobile_element_type="transposon:ISHwa6"
FT                   /locus_tag="HQ_ISHwa6A"
FT   CDS_pept        417478..417822
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1324B"
FT                   /note="product: ISH4-type transposase ISHwa6
FT                   (nonfunctional)"
FT                   /note="gene has an in-frame stop codon and is truncated at
FT                   the C-terminus"
FT   mobile_element  417827..418125
FT                   /mobile_element_type="transposon:HqIRS31"
FT                   /locus_tag="HQ_HqIRS31A"
FT   CDS_pept        417827..418125
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1324D"
FT                   /note="product: ISH14-type transposase (nonfunctional)"
FT                   /note="gene is interrupted (frameshift,in-frame stop) and
FT                   is truncated at the N- and C-terminus"
FT   CDS_pept        complement(418121..418240)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1325C"
FT                   /note="gene truncated at the C-terminus"
FT                   /note="product: homolog to sensor box protein
FT                   (nonfunctional)"
FT   CDS_pept        complement(418409..419245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1326A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1326A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51454"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KJ4"
FT                   /protein_id="CAJ51454.1"
FT                   /translation="MSWRVFAAIAVACLLAFAGYGYVAPDDPTPTTSPALNSTAISDET
FT                   LADAEFPEGFSRSEIDIATARRLSITFLRTEPVSGVALERFRPGAYADYQYEAGATRAR
FT                   FRLDVHNGYADVSQNDVYVESNVRHSRSGRNGRIAFKMTNGSVGETRFRAADSMWAVVS
FT                   RILTIGEFRVIQVTENTGERRIRYAITDVAVRNATDVRGYLTVDEDGVVREAQLLYGQA
FT                   GEPKRFQYSVTSRSASGVAPPAWLPAARADNHFERGFEANTGSIVDATNDSENGSQ"
FT   CDS_pept        419501..419758
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1326B"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: transcription regulator (homolog to
FT                   phosphate uptake regulator) (nonfunctional)"
FT                   /note="gene: phoU6"
FT   CDS_pept        420180..420347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1327A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1327A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51455"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KJ3"
FT                   /protein_id="CAJ51455.1"
FT                   /translation="MTDDERIQRLFDVEIINSLVNDYYQERAQNAIKLWKLYTLCLWIQ
FT                   ESDVTISGRA"
FT   mobile_element  420571..420680
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AE"
FT   mobile_element  complement(420734..420987)
FT                   /mobile_element_type="insertion sequence:HqIRS35"
FT                   /locus_tag="HQ_HqIRS35AE"
FT   mobile_element  421210..421299
FT                   /mobile_element_type="transposon:ISHwa6"
FT                   /locus_tag="HQ_ISHwa6B"
FT   CDS_pept        421212..421271
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1327B"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: ISH4-type transposase ISHwa6
FT                   (nonfunctional)"
FT   mobile_element  join(421491..421822,421931..422294)
FT                   /mobile_element_type="transposon:HqIRS114"
FT                   /locus_tag="HQ_HqIRS114B"
FT   CDS_pept        421668..422210
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1327C"
FT                   /note="see the associated misc_feature for pseudogene
FT                   details"
FT                   /note="part of the region does not belong to this CDS as
FT                   coordinates speficy only the outer boundaries"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene has an in-frame stop, has been targetted by a
FT                   mobile genetic element, and is truncated at the N- and
FT                   C-terminus"
FT   misc_feature    join(421668..421757,421803..421820,421932..422132,
FT                   422133..422210)
FT                   /note="locus_tag: HQ_1327C"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene has an in-frame stop, has been targetted by a
FT                   mobile genetic element, and is truncated at the N-terminus"
FT   mobile_element  complement(421823..421930)
FT                   /mobile_element_type="insertion sequence:HqIRS42"
FT                   /locus_tag="HQ_HqIRS42AE"
FT   CDS_pept        422427..424856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="HQ_1328A"
FT                   /product="type IV pilus biogenesis complex ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1328A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51456"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KJ2"
FT                   /protein_id="CAJ51456.1"
FT                   /translation="MSQNKTDITDTTLCAVPAPLPPNSPEAWYAPQVRSQHEVTPGVII
FT                   TIIDQADHVGFRYQIREPLLDTDSEDALAEIRAYFAGANLESGRPLTREGTTERATHGL
FT                   RSKYRRVINRILDKSIIGGRRRRITYYVLRDFQLLGSVTPIALDEQIEIVDLDDEIDDV
FT                   LVVHTEDYAPVVTSLSANVRFASRVASERLKSYVVTFAGFDVDVVIHRDHLLGDDRFYA
FT                   KYAVLEPALLPGDETLISECKKHIWGANVDELVADRTAFVQKIAREFLSRRLAVKNTQT
FT                   WIARAAHRSRQALARIDVAAPPVGRRYAKGRLDDLIYYILRDLIGEGVLTVPIRDSNLE
FT                   DIEANRVGERIKVVPRADVVDAGERVPTNLSFENETTFVNVVTQLAAADGVELSSSRPS
FT                   AKVNLEPDGIDDTVHEHSETIRCAVALPVISESGPHVSIRKQAAKPLTPVDLIKSGSIP
FT                   TELVALLWLLYEYHRVVLFSGPTGAGKTTLLNAHMPFIPYDHRPISIDEGSREVYLPHE
FT                   TGVSLTTREHEDEFKRVSMADLMTEANYLNPDIEVIAEVNTPASFQTYADILNTGHGAV
FT                   GTTHAEDIHTLVNRVVEQGLPVYLLRELDLVVFPRRVDGERYVGSVVELLSAADYETLP
FT                   SSARTGVIEKAGTTLYYNTILWRETDGSFAMAYDHPSLGGPHAATEGTQDRLAHRVFHR
FT                   IATATDQDIDKIARSFRNRHRYVQYLVREDVTDADRLFGFLADLRTDEAATIERVRRRQ
FT                   ATPDDNHTYEATAQDTPDKKQSDQERNEDCNQETNTNTNTNKTSMSAESDNAEQGI"
FT   CDS_pept        424856..426793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="HQ_1329A"
FT                   /product="type IV pilus biogenesis complex membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1329A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51457"
FT                   /db_xref="GOA:Q18KJ1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KJ1"
FT                   /protein_id="CAJ51457.1"
FT                   /translation="MGSSSRSWYKLPDQIAYALFADHADGRAHDQHRRTYRGTDFAVAF
FT                   DVYLARVYALAWASSLAAGVTTGIMLITAPASLFAIIISQGTSVITQLGLITVLNSLIT
FT                   MTGAYTTTSVYQIHVQFVVAVILSLSAVGTVRWSVIYMGGRYLRWVTTARRAAIDRTLP
FT                   SAVRYLNVLSSGSDNRRAMLRRVADTDAYGETATSIRTVLNTAAMTGNINEGLRRVARD
FT                   TPAQETLGPFLLKFREHADQGEDALGNYLSMESRMLRYRQDSERQRAQGFLELLAELFV
FT                   VLLVLPALVVIIITVMSLLSPGLAAPIQTIVGVVTIQEVIVYGSAVFILAVGIGAASLV
FT                   ESLRPADQKQQYVHPPSLIGTLTTATQNPSSAMIVFTLIGVVGAGLSVGLDVDLLVASL
FT                   VGYVSYSIPVGVVAVRRARSDDAKDHELKDFVHAISGHINLGRPFVDAVTHVASDVDLG
FT                   PLSNDVTDLASNLQLTTAHGGVETDLRTAALDRFVTRVGTPLAEQTVGLVIGAMDAGSD
FT                   TGVVFETLQAEVGRLYHEKRSLRSGMLVYVAVGWTTALLVIGITVATSTQVFAGFARLA
FT                   ITSDVAGVAGGEAIDLVRDQYRLYIVTQSTMLAAGWFAGVASRGRYEALLHSGCLVAIC
FT                   HLVFVGTGVI"
FT   CDS_pept        426793..427599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1330A"
FT                   /product="probable secreted glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1330A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51458"
FT                   /db_xref="GOA:Q18KJ0"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KJ0"
FT                   /protein_id="CAJ51458.1"
FT                   /translation="MPPDRSSDSSGTDSIGGCLRDSLHPSGQSAIRGQSSIIGVALLLG
FT                   ITVVAISALTASTGALVADGVAAADTTRVSTDLNQVFDPRNNRHTTEMRLSRGTVSVRN
FT                   RSIRLLTDGDDVVWSGHAGALVYQSGSRTLTAFAGAIIRQDRQTATMPGESRISVSPDA
FT                   LYLGVPVLNVSGADAVSTRGHRLVISFQTAARSNRIVLPAAAYKIAIETTTPGIWEQHL
FT                   RERGAETTTQRDIDNDGLISVIATFDGTRRTHIVVHDIQVNVAVGQ"
FT   CDS_pept        427596..428402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1331A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1331A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51459"
FT                   /db_xref="GOA:Q18KI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KI9"
FT                   /protein_id="CAJ51459.1"
FT                   /translation="MSGDRRRDMNSDDRGISPVAGKTLELGIGVILIALITTSLLGGVT
FT                   PGYQSAVGIEIADRVVINVADRIESTADGTADTLTADRRIRVTVPQNIRQKPYRVIANT
FT                   TADKTHIRLQHPDPAISASTHIVSHNLITVTGSIRSETPSWIRLQAHTAISNNRSRSAI
FT                   GSMGTITRMSMDLSPNENMNLDNKSRTNINTIQAVDMNGSSDSISGISNPMRMHSGDVI
FT                   NDILNTGTEEISSDDFVKITIILTDESDEIESTEINTTSNYMQIHS"
FT   CDS_pept        428399..429085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1332A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1332A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51460"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KI8"
FT                   /protein_id="CAJ51460.1"
FT                   /translation="MNARAQANLVSFAAAVVLISVVTVAGVVVAEEALSDVAGQSQNER
FT                   VASVTATYLVSDSAPHTHRHGVLHASAIESLTITNLTTAVPSLAGRSARVSIHDTPIID
FT                   RGTPTKSLIRRRVLIESYTTRSHDIVLANVSGSESSNISIPEHLGDVTVSILPTTNRTV
FT                   QTIRADGRIVRHNPAGLSVQKHHISSSRHPLNLSIVSTGNTSGKLLIAWQTADTTLAWV
FT                   EVRVGE"
FT   CDS_pept        429078..429605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1333A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1333A"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97806"
FT                   /db_xref="UniProtKB/TrEMBL:J7S5D1"
FT                   /protein_id="CCL97806.1"
FT                   /translation="MSNVCWLLFDIQNSNPAPVDNIDECSQCGNQAATLTDQRRVDSRA
FT                   QLATSLIESGVGALLILAVVSGFLWAPIDTANSTPELDQLAADTLYILDKETSSNSGQT
FT                   RLAAMCHSSSMSMSEQTLLRDRIETILPPTVFAEIKTPHGTIGPTAPVGGYTGRAVSVG
FT                   NHCTVAIEIWYV"
FT   CDS_pept        429608..430183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1334A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1334A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51462"
FT                   /db_xref="GOA:Q18KI7"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KI7"
FT                   /protein_id="CAJ51462.1"
FT                   /translation="MIRSSGDTRGQVVLVAATVVAIALLTMVFAYTQLGSISFDTADEA
FT                   SSRIDTGGTIVNPGSPVIALDTVHNQLTASVQAAVFDDRKKHNWNERQRVIERVRTDVT
FT                   EDFHRIELYHIQEGRSLTLNFAASHAHERAHMQCPGGPNRMFGQCQSVNGIIIQSRAEE
FT                   VTIVAIAVEVQVISPTETTNATFMITVE"
FT   CDS_pept        430681..431910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tif2c"
FT                   /locus_tag="HQ_1335A"
FT                   /product="translation initiation factor aIF-2 gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1335A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51463"
FT                   /db_xref="GOA:Q18KI6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KI6"
FT                   /protein_id="CAJ51463.1"
FT                   /translation="MTQQTQQPEVNIGLVGHVDHGKTTLVQALSGSWTDQHSEEMKRGI
FT                   SIRLGYADATFRMISNINPPEGYTVDETGPDGEPTETLRTVSFVDAPGHETLMATMLSG
FT                   AAIMDGAVLVVSATEDVPQAQTEEHLMALDIIGIENVVIAQNKIDLVDRERAIESHNQI
FT                   QSFVEGTVAEDAPIVPVSAQQAVNIDLLIDAIEREIPTPERDADTSPRLYAARSFDINR
FT                   PGTTWKNLSGGVIGGSVSRGRLETGAEIELRPGREVDQGGQVEWQPIITDVRSLQAGGE
FT                   SVSEVTPGGLCGVGTGLDPSLTKGDSLAGQIVGEPGTLPPTRESFTMTVELLDRVVGDE
FT                   AGEVETISTGEPLMLTVGTATTVGAVTSARSGEAEVSLKRPVCAEEGSKIAINRRVGAR
FT                   WRLIGIGTLE"
FT   CDS_pept        432086..432715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1336A"
FT                   /product="DUF188 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1336A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51464"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KI5"
FT                   /protein_id="CAJ51464.1"
FT                   /translation="MIAVILDTNALMLPVERDVRLFEELDRILTESYISLVPRPVVAEL
FT                   HHLSDGAGVEATAANVGSDLLDRCSIIDTEADFADDAIVELATTETVLGQTEICADTTA
FT                   VDSTHNHQSGEKDIGTHTNVHNNIHAGRQINVEADAHSDDRNADLIEISDRESTAEATT
FT                   EIAEDEYSTIKQYVVTEDRPLRNRLYEHDVRVIGIRGRNTLEITEP"
FT   CDS_pept        432719..433303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE1"
FT                   /locus_tag="HQ_1337A"
FT                   /product="DNA-directed RNA polymerase subunit E"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1337A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51465"
FT                   /db_xref="GOA:Q18KI4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KI4"
FT                   /protein_id="CAJ51465.1"
FT                   /translation="MYKRVQLTDTVEVPPRHLADVTPQRVKRLLQDKLEGRMDEDIGSV
FT                   VSVISVLDIGEGAVLPGRAGVYYEAKFDAITFDPAMQEVVDGEVVEVVEFGAFVGIGPV
FT                   DGLLHVSQISDEYLAYDGENQQLASTESNRTLGVGDSVRVRVVTKSIDERNPRDSKIGL
FT                   TAKQPGLGKHGWLQADRQANAATTEAGAEGK"
FT   CDS_pept        433304..433501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spt4"
FT                   /gene_synonym="rpoE2"
FT                   /locus_tag="HQ_1338A"
FT                   /product="transcription elongation factor Spt4"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1338A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51466"
FT                   /db_xref="GOA:Q18KI3"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KI3"
FT                   /protein_id="CAJ51466.1"
FT                   /translation="MVQTRLSCRECHYINHADSQTCENCGSSSLTEDWAGYVVVTHPDD
FT                   SAIAEEMNVKEPGGYALKVR"
FT   CDS_pept        433512..434072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1339A"
FT                   /product="UPF0218 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1339A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51467"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KI2"
FT                   /protein_id="CAJ51467.1"
FT                   /translation="MDRLPLELPSSLRQEFKSPFGPVYTDVTQFLTDAGRPIIAVGDIV
FT                   TYHLQTVDYTPAVAVIDGQTKRESVDETVKAALSKHNKRIDVENQPGTISIALLEALQT
FT                   AVETPESVMIVVDGEEDLATLPAVLVARPGGTVVYGQPDQGMVRIAVTPETKITMSRLL
FT                   KRMDGDAAAAFDRLGVDRSGDKK"
FT   CDS_pept        434504..434821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps24e"
FT                   /locus_tag="HQ_1340A"
FT                   /product="30S ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1340A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51468"
FT                   /db_xref="GOA:Q18KI1"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KI1"
FT                   /protein_id="CAJ51468.1"
FT                   /translation="MEVDILSEDENSMLHRTDIQFEIAHEDATPSRLSVRDSLAAKINK
FT                   DSDEVVVHKLDTKFGMRKTIGYAKVYDSPQSARQVEQDYMLKRNKIEIESEDEDSAAEG
FT                   A"
FT   CDS_pept        435032..436633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kae1"
FT                   /locus_tag="HQ_1341A"
FT                   /product="KEOPS complex subunit Kae1/Bud32"
FT                   /EC_number="2.3.1.234"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1341A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51469"
FT                   /db_xref="GOA:Q18KI0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR009220"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KI0"
FT                   /protein_id="CAJ51469.1"
FT                   /translation="MRILGIEGTAWAASAALYNTHDETIVIESDPYQPDSGGLHPREAA
FT                   EHMSTALPEVISTILERAVSSGNTDAIGIDAIAFSRGPGLGPCLRVVGTAARTLTQALS
FT                   VPLIGVNHMIAHLEIGRHQSGFTTPVCLNASGANAHLLGYHRRQYQVLGETMDTGVGNA
FT                   IDKFTRHLGWNHPGGPKVEAAATDGSYHDLPYVVKGMDFSFSGIMSAAKDAVDNEVPVV
FT                   DVCTGLQETIFAMLTEVAERALSLTGSNELVLGGGVGQNDRLREMLSTMCTARGASFYA
FT                   PESRFLRDNAGMIAVLGAAMYEAGQTISVNDSAVDPTFRPDAVTVTWRDDETSVTRTPA
FT                   TLDKTPVRGAEAIVRRINDHVVKRRVEKSYRHPKLDRRLRAERTRAEARLTSAARRLGV
FT                   PTPLIFDADPETGTLVFEYVGETDLAADLTVSRCHAVGQHLGRIHNAGFVHGDPTTRNV
FT                   RVDSAQNYLIDFGLGYHTDHVEDHAMDLHVFIQSVTGTASDPAPLITAFESGYAETGIS
FT                   TVQSRLRDIESRGRYH"
FT   mobile_element  complement(436630..437185)
FT                   /mobile_element_type="insertion sequence:HqIRS56"
FT                   /locus_tag="HQ_HqIRS56B"
FT   CDS_pept        437337..437600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1342A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1342A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51470"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KH9"
FT                   /protein_id="CAJ51470.1"
FT                   /translation="MDEETKQGDIFGVPYNFERPSLGRLIAARWQPDAGMIVKKPFGIG
FT                   YTLNLANWRSWVALLVVGLLLFQEERGNSESEDDSPVEVIVD"
FT   CDS_pept        437637..438317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ham1"
FT                   /locus_tag="HQ_1343A"
FT                   /product="non-canonical purine NTP pyrophosphatase"
FT                   /EC_number="3.6.1.66"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1343A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51471"
FT                   /db_xref="GOA:Q18KH8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KH8"
FT                   /protein_id="CAJ51471.1"
FT                   /translation="MEVHANSIPSEITAVTNQHTVALFVSADILRYVTTNSGKVREARQ
FT                   YLDPDAIKSLSYDYTEIQATSLRPIAATGAHEAYHYTDSPVLVDDAGLFIDDFDGFPGP
FT                   YSAFVENTLGVKTVQRVVESESEISRDATFRCVLAYCDGEAIEPSDDEYLNTNTDTETP
FT                   PVKLFTGEVSGRIVPPRGNGGFGYDPIFEYDGMTLAERDAAEKNEISHRGRALTAFAEW
FT                   FQAR"
FT   CDS_pept        complement(438397..439158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1344A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1344A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51472"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KH7"
FT                   /protein_id="CAJ51472.1"
FT                   /translation="MNTDSWSTLLKRAADLMNEHGDIGRTQIKQLLDDRRTDRLESSEN
FT                   SEYQTDTERQTGDNKPPTPPESASISAQEPKTEPELSITEPATDPMPTSVVVDADVFVA
FT                   DFLCGSDTDARQAIEILWTHSWMTLFASNTLLTDAQALIATLATDQLAREWRAHMTDWC
FT                   SIVTHPPDDHPALATAYRGGAMHILSFNDQLRSVQAGASLRGQFPVSVRDPAAYTAVFS
FT                   PDRLYNATVSDTDTDTDTDTYPGPDRGSRMQ"
FT   mobile_element  complement(439277..439438)
FT                   /mobile_element_type="insertion sequence:HqIRS53"
FT                   /locus_tag="HQ_HqIRS53A"
FT   CDS_pept        complement(439507..440166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA3"
FT                   /locus_tag="HQ_1345A"
FT                   /product="TrkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1345A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51473"
FT                   /db_xref="GOA:Q18KH6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KH6"
FT                   /protein_id="CAJ51473.1"
FT                   /translation="MSFVVVGYGRVGARTAQILETDGYNVVVVDNDPDKITHADNAGFD
FT                   VIEGDGSNASVLKQAGIDEAVALGGLTDDPTVNFAACLTGKQHGCRVVMRISEDINSNV
FT                   YEQYESDVDDVIDPERLGAAGAKTALLGGNFNVLDELTEGLSLTSLSVPVDAPIIDQTV
FT                   NEIELGDHGRIYAHGRANEPMTIPLPATIIKSGDRLALVVEQNNLTEVRQTLMGDN"
FT   CDS_pept        complement(440296..440958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1346A"
FT                   /product="probable secreted glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1346A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51474"
FT                   /db_xref="GOA:Q18KH5"
FT                   /db_xref="InterPro:IPR018911"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KH5"
FT                   /protein_id="CAJ51474.1"
FT                   /translation="MSLERLISATIDRDHIKSVLLLTLIVLSLTVGFIGSTTAVTGIEL
FT                   TQANVEIERINENQSAQTVTVGSDFTVSGVTNRDPDNAVIIVELRRDGGDIVTVASDEQ
FT                   WGESGEWRVTIELGDIEPGSYTIEASTGDETDIKAVNIVASTPTPTATPDMTPTATPTA
FT                   TSTSTSTSTPTPTPTRSTITAAPSPTQTTETPGFTAITAIAAVGIILIAASFRLHRR"
FT   tRNA            complement(441134..441214)
FT                   /gene="tRNASer2"
FT                   /locus_tag="HQ_TRNA10"
FT                   /product="tRNA-Ser"
FT                   /note="anticodon GGA"
FT   CDS_pept        complement(441243..441446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1347A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1347A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51475"
FT                   /db_xref="GOA:Q18KH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KH4"
FT                   /protein_id="CAJ51475.1"
FT                   /translation="MRRIISALLWGLLGILLFGVLIQAYYLLIGPVNIGLWILVAIAVM
FT                   IGIIVASTAYTFEVRLLSNRRF"
FT   CDS_pept        complement(441633..442844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA1"
FT                   /gene_synonym="tdcB1"
FT                   /locus_tag="HQ_1348A"
FT                   /product="threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1348A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51476"
FT                   /db_xref="GOA:Q18KH3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KH3"
FT                   /protein_id="CAJ51476.2"
FT                   /translation="MLEVADIEAARDRIMSVVRRTPMQRSPTFSSMTGADIHLKLENTQ
FT                   RTGAFKIRGATNRIATLSADEQAAGVVTASAGNHAQGVALAASRAGVDATIVMPEQAPV
FT                   SKIEATERYGGDTVLQGTDYDEAQAYAHQLAEESGQTYVHAFDDKAVMAGQGTIGLEII
FT                   EDCPDVETVVVPIGGGGLIAGIATAVTAHNPDIRVIGVQAEGAASARKSLASGSIHKLE
FT                   TVNTIADGIATRRIGDRPFAVIDDRVDDVVTVTDDEIAVAVTYILERSKTLVEGAGAVA
FT                   MAAVLADAFDYSNDETIVPALCGGNIDMNRLTTVLIRGLVETGRYLRIRTVLEDYPGAL
FT                   EELVAILADYQANIYAIQHDRTSRTVEMNEADVEIDLETRGHDHIDTILSALRESGYTV
FT                   EVLV"
FT   CDS_pept        complement(443125..444261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citZ"
FT                   /locus_tag="HQ_1349A"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1349A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51477"
FT                   /db_xref="GOA:Q18KH2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KH2"
FT                   /protein_id="CAJ51477.1"
FT                   /translation="MSDEVKRGLEDVLVAESELSCIDGDAGELVYRGYSIEDLAQKASY
FT                   EEVVYLLWHGRLPTGDELQSFTDAMIEERTINTGVYEQIERLAAADESPMAALRTIVST
FT                   LSAYDPDADAEVIDHEANARKARRIAAKLPTALAALQRCREGNDPVTPRSDLDHAANFL
FT                   YMLNGSEPDPVLAETFDMALVLHADHGLNASTFSAKVTASTLSDLHCAITTAVGTLSGS
FT                   LHGGANANVMRMLKEVHASDADAVTWIEDALESGRRVPGFGHRVYNVKDPRARILGERS
FT                   KELAEAAGEMCWYNYSITIEEYIDDHKGLAPNVDFYSASTYYQMGIPIDIYTPIFAMAR
FT                   TAGWIAHTFEQYDENRLIRPRARYVGNEDATFKSVEKR"
FT   mobile_element  444519..444772
FT                   /mobile_element_type="insertion sequence:HqIRS35"
FT                   /locus_tag="HQ_HqIRS35AF"
FT   CDS_pept        445191..446414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pchB"
FT                   /locus_tag="HQ_1350A"
FT                   /product="PhoU/TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1350A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51478"
FT                   /db_xref="GOA:Q18KH1"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KH1"
FT                   /protein_id="CAJ51478.1"
FT                   /translation="MDRDVEYEPVNVKTILAEMKDTAELLIDLSYSAVLHESDEIADEV
FT                   LDLEARMDRLQLQGRMSLLMAARRPEDAEQLAPVLGVMAAAEKISNAAGDIAKVVVEDI
FT                   GLPNAIRGSLPGAVEVLIRATVESGSRYADHTLAEINMETESGVRVIAIRRNAVTGKQQ
FT                   WLINPGADTHLYEGDSILLRGPQDGVATVYAAATGESYEPPVVTKEPIDDLERAVNSIT
FT                   LMKDMSELAVDLAYGAVLFESTGVAEEVKELEAEVDALKSRFEAWTLRAATRLADPVRL
FT                   RGLVHIASATEVISDAALEISEGVLRGIDAHPVVAAAVEESDEVIVRLSVGVESQLSGR
FT                   TLGAEQVKTETGMRVIAVRRGNDDGGWVVQPGPKTELRAGDTIIAKGTRAGAQLLGDAV
FT                   DDPQSFEV"
FT   CDS_pept        complement(446441..446731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1351A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1351A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51479"
FT                   /db_xref="GOA:Q18KH0"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KH0"
FT                   /protein_id="CAJ51479.1"
FT                   /translation="MSNEIPERPEQSGLITALQVPRNAIIGVAVGIVLAIIVYLARIFE
FT                   ILGPFAGTQQYPVIGPEGWFIVLAFVLATSTALLVTTILTVVSAVRLIREL"
FT   CDS_pept        446876..447832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1352A"
FT                   /product="AstE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1352A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51480"
FT                   /db_xref="GOA:Q18KG9"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KG9"
FT                   /protein_id="CAJ51480.1"
FT                   /translation="MTTLGTASAAPGEIDTGRLEIGETRDGTTVGLPCAVVEGASDGQT
FT                   LYVQAASDGDELNGIGVLNRVIPQVDPAVLSGTVLAVGIVNYHGFQIAEHRNPIDDTKM
FT                   NRAYPGNESGTSSERIAAVTFAAAKRADLILDLHQGSTSQMIDEVRVRCGRRHRLHDEC
FT                   LGLAKTFGCGYVFDQKGPNGQLARVAPDEGIPTVDPELGGCIGWDGESIDIGVRGVFNV
FT                   LREYGFLEGTVSKSRQTRARGFDQYGSPAGGLIQFEAELGERIKTGDVLFEVTDIFGEL
FT                   KARITADNDGVFWRSRRLPQVATGEYVCSVGTSVDSY"
FT   CDS_pept        447840..450549
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1355A"
FT                   /note="see the associated misc_feature for pseudogene
FT                   details"
FT                   /note="part of the region does not belong to this CDS as
FT                   coordinates speficy only the outer boundaries"
FT                   /note="product: threonine synthase (nonfunctional)"
FT                   /note="gene: thrC3"
FT                   /note="EC_number: 4.2.3.1"
FT                   /note="gene has an in-frame stop codon and has been
FT                   targetted by a transposon"
FT   misc_feature    join(447840..448076,449659..450549)
FT                   /note="locus_tag: HQ_1355A"
FT                   /note="product: threonine synthase (nonfunctional)"
FT                   /note="gene has an in-frame stop codon and has been
FT                   targetted by a transposon"
FT   mobile_element  complement(448080..449669)
FT                   /mobile_element_type="transposon:HqIRS84"
FT                   /locus_tag="HQ_HqIRS84A"
FT   CDS_pept        complement(448131..449435)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1353A"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene is interrupted (frameshift,in-frame stop)"
FT   CDS_pept        complement(449441..449569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1354A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1354A"
FT                   /db_xref="EnsemblGenomes-Tr:CEQ38553"
FT                   /db_xref="GOA:A0A0C7U046"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0C7U046"
FT                   /protein_id="CEQ38553.1"
FT                   /translation="MSQMECYPTIRQRGVVTIPEEVREGLDLEEGDQLKLTVETLE"
FT   mobile_element  join(450666..450702,450957..452523)
FT                   /mobile_element_type="transposon:ISHwa21"
FT                   /locus_tag="HQ_ISHwa21A"
FT   mobile_element  450703..450956
FT                   /mobile_element_type="insertion sequence:HqIRS35"
FT                   /locus_tag="HQ_HqIRS35AG"
FT   CDS_pept        451087..452460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1356A"
FT                   /product="IS1341-type transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1356A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51484"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KG6"
FT                   /protein_id="CAJ51484.1"
FT                   /translation="MLEVHRTHRVKILNHAQVEGSLDRHGWSASKLWNVANYHSRQQWE
FT                   ATGEIPDHGDLKNELKTHNNYKGLHSQSSQRVLEELAEGFNSWYGKRKSDTRANPPGYR
FT                   KRNYYDQQGRRVHEEHPRSTVTWKQNGIKHDVKNNRVRLSKGANHKQHPKAWEYILVEY
FT                   ETRSSVTVENVQQVRAVYDKAKQRWELHLVCKHEIETPTAPGTETAGIDLGICNFAAVA
FT                   YSTEEADLYPGNRLKQDGYYFPKEIAKCDDSGGEEATRLHAKWSERRTHFFHSLATHIV
FT                   ERCIENSVGRINIGKLAGVREDNNGNGNSKNWGKHGNLDLHGWAFDRFSNILEYKAKVE
FT                   GIEVGEVSEHDTSNTCCVCGRKDESQRVERGLYVCEEHDDGDGDGDGDGDGDGDAFNAD
FT                   VNGAENIRLDINHTESNSESAPDLGGDRSTGWLAQPGVYFHDLSRGFQPRIEVVDCKP"
FT   CDS_pept        complement(452564..453403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pimT"
FT                   /locus_tag="HQ_1357A"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1357A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51485"
FT                   /db_xref="GOA:Q18KG5"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KG5"
FT                   /protein_id="CAJ51485.1"
FT                   /translation="MDPAVLREDMVNSVETQLDVSVAAPVSHAMRTVPREPFVEDAPYQ
FT                   NSSSEHIGTTILAPSVVARLLTALHISTEPDINVQMNSPESTENPESADKSIAKGESTH
FT                   ETASDDVLVVGAGVGYTAAVLAELIDERHVHAIDINRRVVHTARSNLEVAGYEGVLVDT
FT                   RDGAHGLPEYAPFNRILVEAASLEPPKALLNQLTANGRLVIPLGGPSQTIATVDAQGNI
FT                   LTEQGAVALDPLLVEGESGDGPARNRTVREDAEFDESGYFAPTGWEQEWIDWDKNQQ"
FT   CDS_pept        complement(453494..454147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1358A"
FT                   /product="UCP015877 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1358A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51486"
FT                   /db_xref="InterPro:IPR012041"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KG4"
FT                   /protein_id="CAJ51486.1"
FT                   /translation="MSQNRRGVGCPSCSPSEPTVHEVLSKGGGRHTVRCTACGHVHKVS
FT                   AETQQVIERDVIISQDGDSFATTTEVSPEEQIAVGDEFIVDSDAAIMLVRVTGIEVGPE
FT                   QRAEDASVGDIRTIWTRAIDNVAVSATVNPKEGTGARESTRSFEIQLPGDHEFTVGETV
FT                   SFGDEEFLIKAIQVRRDAPEYRHGKLEHDGDMVYARDIKRVYGTDQTTSAWSAW"
FT   CDS_pept        complement(454465..455421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepB2"
FT                   /locus_tag="HQ_1359A"
FT                   /product="aminopeptidase (homolog to leucyl aminopeptidase
FT                   / aminopeptidase T)"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1359A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51487"
FT                   /db_xref="GOA:Q18KG3"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KG3"
FT                   /protein_id="CAJ51487.1"
FT                   /translation="MPQSKSKLAAAATTAVEKCASLQPTESCVIITDHNRRPIAEALFD
FT                   VAQTISDTVSLIQYPPGSQHGEEPPAFVATAMKNADVFFAPTTKSISHTRARGEACDAG
FT                   ARGATLPGITQDVFTTGLDADYQTISDHSRNIYDQVADANEIRITSPAGTDLRVTPGER
FT                   EWYQDTGSIDTAGSFSNLPAGEVFTAPVTATGTYVVDGTMRPHGRVDPDDLLEFEVEDG
FT                   TVSRISDDAIRNQIETAAETAGDAAYNLAELGIGTNVGVSTLGGSVLLDEKAAGTVHVA
FT                   IGDNLGIGGETDAPLHLDGIIQDPTVYADGEKVSLPS"
FT   CDS_pept        455564..456637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap1"
FT                   /locus_tag="HQ_1360A"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase (NAD(P))
FT                   (phosphorylating)"
FT                   /EC_number="1.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1360A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51488"
FT                   /db_xref="GOA:Q18KG2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KG2"
FT                   /protein_id="CAJ51488.1"
FT                   /translation="MIRVGVNGYGTIGKRVADAVALQPDMEVVGVAKTKPNFEAHTADQ
FT                   RGYEMYAAIPDRAPLFGDAGVELAGAVDELVAAADIMIDCTPSGIGAENKSLYESYDTP
FT                   AIFQGGEDATIAEVSFNARANYAAACGTDSVRVVSCNTTGLSRVIAPLQEAYGIEQVRT
FT                   TLVRRGGDPSQNSRGPINDILPNPISIPSHHGPDVNTIFPDLAIDTLGLKVPATLMHVH
FT                   ALNVTLKSDVTVAHVRQLLEEESRIYVISEGMGIDGAGKLKDFAHDAGRPRGDIWENCV
FT                   WGESIAISGRDLYFFQAIHQESDVIPENIDAIRAMTESATAAESIELTNRTLGVGITGS
FT                   PVGVVDTDHSGVEAADD"
FT   CDS_pept        complement(456865..457278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1361A"
FT                   /product="MJ0936 family phosphodiesterase"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1361A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51489"
FT                   /db_xref="GOA:Q18KG1"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KG1"
FT                   /protein_id="CAJ51489.1"
FT                   /translation="MRIGCCSDTHDNLKLAQQAIETFTSANVDMIVHCGDIVSPFTASL
FT                   FDTGIPLHAVRGNNDGEWALASTIEGFENGSGTYHGESAHLSLENHANESSDSTVDIAV
FT                   YHGTSERLVDALLGCGQYDYVLRGHTQTNSRTV"
FT   CDS_pept        457594..457890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1362A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1362A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51490"
FT                   /db_xref="GOA:Q18KG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KG0"
FT                   /protein_id="CAJ51490.1"
FT                   /translation="MSLGILDMIGIAGTLIFALPVGIFGVEQLATGQFGLGSALIGIAA
FT                   LMIILPQRLISPKQIPVAMSKRFIGIVGTSTEEQSADGTDTTDEPDSAVSKNH"
FT   CDS_pept        complement(458045..459439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1363A"
FT                   /product="peptidase M24 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1363A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51491"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KF9"
FT                   /protein_id="CAJ51491.1"
FT                   /translation="MNDNTSLKSATDAGFGINGPSVVVTPSRTPVVTAIESHDAIGFVN
FT                   INTTESEYPTASFRYLTAISSSNNSAYVHTDSGPVLCVQSEATKKAMQAEYRALSKQIE
FT                   YSDSLIACDEISAASEPGDNRVNSDIAIPIYQDSRPIGVQAAAVLDSARTTDAECADTQ
FT                   TVLVPSTIPHDSAIHLEQAGYTLQSTSAVTNARVKKDAAERQAIKIVQSAGLAAIARIE
FT                   TQIADMTVSDGQLLLQGEPATTRHLEQIAAAELAHRGVGSGDCVCVITTESAVSRLSRN
FT                   IGSGVLSSTSIQSGVPVQIGVCPRGPNGYHGLVWRTIVVESEGGWERRAHIAVEAALET
FT                   AIETAEPGISPTTVYNEALAELAAFGFNPSASEGSAKKSEDINIMIHGIGLSKRERPYI
FT                   DSEMTMDPGTVVSIALGVFNIEYGGVRLCDVVTISEDGVSVAGSRATSPDDMNRSLTPT
FT                   TNSYSS"
FT   CDS_pept        complement(459436..461292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD1"
FT                   /locus_tag="HQ_1364A"
FT                   /product="repair helicase UvrD"
FT                   /EC_number="3.6.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1364A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51492"
FT                   /db_xref="GOA:Q18KF8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KF8"
FT                   /protein_id="CAJ51492.1"
FT                   /translation="MSDANPEITRLFGGPGSGKTTALLDEVDKILDADDVSIRDILVVS
FT                   YTRAAAAEVRERLAERLDISPRALQGNVATMHAKAYELLNLSRGDVIDDSDKQEFCEEY
FT                   GVEFEDKYGGAGRRTARSTTLGNKIIATSQWLQRTRRDVADWYEVPFQWNVEEVRLPPD
FT                   VDPNAQEGNKYTPTWPSDDDRIHVPEVIQAWRAYKGDHGLVGFADMLERVKQRSLVPQV
FT                   DYLVIDEFQDITTLQYDVYEKWRSSVDRVLIAGDDDQVVYAWQGADPNLLLDANRDEDV
FT                   VLPNSYRLPSKVLSVVNQEIRHIDKRQEKDLHPRKQGGTVEGIESPSMLDLARNVRHTV
FT                   ERSDGEETLMILFRARYQMFQFIDEFLPLGMPFSALTDQRMWTDRLTQYVRGIEQLDRD
FT                   ETLTGLQARRLADMLQASAFGTKERDALFDYIDDKKEAADVDDLTELSIEPDIISEHAP
FT                   FAPNTAAAGDMLRKVTSFQRKSVEAYFDGDYGGMDPSRIRVGTIHSAKGREADHVFVAT
FT                   DLTEKVVEQMAASVDESAVPGVDEFTARTDPVPILTDNERRVFYVGMSRARERLVLLEN
FT                   LVGGAPTLPISVLLHNETRHESVDDLLAATQEESVPAPEPDA"
FT   CDS_pept        complement(461411..461596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1365A"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1365A"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97807"
FT                   /db_xref="UniProtKB/TrEMBL:J7RUH8"
FT                   /protein_id="CCL97807.1"
FT                   /translation="MASAPPSDDALFDQFLSDRGHEVESASWEESYNKKQCPDCGALHD
FT                   MSATVCSVCEWTPESN"
FT   CDS_pept        461776..462258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1366A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1366A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51494"
FT                   /db_xref="GOA:Q18KF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KF7"
FT                   /protein_id="CAJ51494.1"
FT                   /translation="MSFTPSRDSNTNRASSSSNTTNIDSRQNSKPDPDPDPDPDPDSTG
FT                   IWHAFVPFGFVAAEVGVLFDFTPIAVGGLVLFGRSIAGVLVEMRFVRGPVYLLTAIGLL
FT                   YALVGSGLIYVFGGSAGAFELGFRGIALAVAGGVTTALAAWRWFETETSAGPGVGS"
FT   mobile_element  462341..462732
FT                   /mobile_element_type="insertion sequence:HqIRS46"
FT                   /locus_tag="HQ_HqIRS46D"
FT   CDS_pept        complement(463457..465046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cxp"
FT                   /locus_tag="HQ_1367A"
FT                   /product="metal-dependent carboxypeptidase"
FT                   /EC_number="3.4.17.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1367A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51495"
FT                   /db_xref="GOA:Q18KF6"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KF6"
FT                   /protein_id="CAJ51495.1"
FT                   /translation="MIHHQSTSGGLIALPWYILIMSTDAYATLCEQYEQIANIQHAQSV
FT                   LSWDQQVTMPEGGTPARTAQLSALSTVAHNALTDDIIADALETLRANSDSLSSDEKATV
FT                   REIRRKHERAAAVPESLVAEMSETASEALSVWESAKANNDFNAFAPYLQRHVELNREYA
FT                   EYIDPTRDAYAVLLEEFEPCLPLDHVESVLREIREALIPMIDAIRASDTTLATDAFTRQ
FT                   GTYSSANQEALCRDVLTTLGYPWERGRLDTAPHPFSMGTSFDARVTTRFDETDPLGSLF
FT                   STIHEFGHATYTLGLSDDAYATPLGEDRDLSVHESQSRLWENHVGRSRAFWNVLLPQIN
FT                   THFPKTDALSVNEAYEAANQVYKDNLIRVNADELTYHLHVLIRYEIERALIAGDIDVAE
FT                   VPAIWDDKYEEYLGIRPETDAEGCLQDIHWSHGNIGYFPTYSLGSAMAAQLYAAAEESI
FT                   VELDSKVAAGSFDEIRRWLQTNVHQHGARYETDKLITQATGSSFTADAFISYVSEKYGS
FT                   LYDLDQEFRVGN"
FT   CDS_pept        complement(465527..466669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1368A"
FT                   /product="peptidase M20 family protein (homolog to
FT                   succinyl-diaminopimelate desuccinylase)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1368A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51496"
FT                   /db_xref="GOA:Q18KF5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KF5"
FT                   /protein_id="CAJ51496.1"
FT                   /translation="MSLEHTNVRDELVSLTRTLVSIPSHRDATAVGDVIYNWIENNTDA
FT                   VAQRDSHGNIIARRGIGSVSIALTGHHDVVDPDEQQVTDNGEYQLTKQNRRLYGRGTAD
FT                   MKGSLAAALLAFRDIVPADGIEVVFASFIGEEDGGIGAQAAIENGFSPEYAIVGEGSTN
FT                   YAGVKQTDVVVAHKGRRGSTLTAHGEAAHASEVDCGINAIYRASDAIDILQELAADAPV
FT                   ASVGETEISGSVAVTEIDGGTAWNTIPDTCQITIDERTVPGKRAPIERAAVEGVTWSID
FT                   QDLPPMACDDPTFATAVTNVAANIHSETTPRKVTKPHATDAGWLSDAGTTCVIVGAAEP
FT                   GEAHTAQESVSIDAIERCYQIYRAVPSQHCIDNNECWSSD"
FT   CDS_pept        466800..468707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1369A"
FT                   /product="arNOG04375 family protein (homolog to PilT-type
FT                   ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1369A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51497"
FT                   /db_xref="GOA:Q18KF4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KF4"
FT                   /protein_id="CAJ51497.1"
FT                   /translation="MKVVPDTSAVVDGRVSERVESAETATVVVPEVVVGELESQANDGR
FT                   ETGWDGLEELQQLASLADAGNVDVQYVGDGNTQNELTNGDAASIRDGPADIDAIIRDVA
FT                   DVENATLLTSDVVQSEVAKAKGITVEYVEPRPRGTASTSGDLAVEDFFDEQTMSVHLKT
FT                   DTIPKAKRGAIGDMHYQQIAESPTDEPTMKQWADDIEATARSSSDGFVELSESGMKIVQ
FT                   FRDYRIAVARPPFADGIEITAVRPIVKTELDDYEFADDLRERLEAKQRGVLISGSPGAG
FT                   KSTFAQAVAEFLTDSDYAVKTMEKPRDLQVGSDVTQYTALGGDMAKTADSLLLVRPDYT
FT                   IYDEVRKTKDFSVFADMRLAGVGMVGVVHATEAIDALQRLVGRVELGMIPQVVDTVVYI
FT                   EDGHVETVYDVTTEVKVPEGLAAEDLARPVIQISDFETDIPAYEIYTFNRQVITVPLDG
FT                   ESSNEETGVGRLARQEIEREIRSIARGHVDVELKGQNDAIVYVEEDDISYVIGKGGGRI
FT                   ADVEDRLGIDIDVRTHEENSSNHRGDGGSSQGTASSDSNPRDTADDTMTVTPEVTSRHV
FT                   VVRLDEHVGETVEIRADNEYLFTATVGRGGDIQVSRGSAIADDLETAIDRRAQITVHPT
FT                   "
FT   mobile_element  complement(468760..468866)
FT                   /mobile_element_type="insertion sequence:HqIRS42"
FT                   /locus_tag="HQ_HqIRS42AF"
FT   CDS_pept        complement(469155..469502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1370A"
FT                   /product="NP_1176A family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1370A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51498"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KF3"
FT                   /protein_id="CAJ51498.1"
FT                   /translation="MAKGEEERLDDLPPSAKLVFKVLEYSGPLTQKGIVEESMLSARTV
FT                   RYALERLEDIDIVDEDVYFADARQNLYQLTEAVPKAATSTDGGESGSTSSLSDSESDSE
FT                   PDSEVEPRHAE"
FT   CDS_pept        469624..469938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1371A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1371A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51499"
FT                   /db_xref="GOA:Q18KF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KF2"
FT                   /protein_id="CAJ51499.1"
FT                   /translation="MATETGRNLSGHLRGITVTTLACLAGVGAAITSGQVIGTSVAAAG
FT                   SQQTLILVGAFVLLQFPVLKLAGIDVNEFGAKDHLYVVFMTFTLWFITFSILLTEGVTL
FT                   "
FT   CDS_pept        469943..471790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1372A"
FT                   /product="ABCE1 family ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1372A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51500"
FT                   /db_xref="GOA:Q18KF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KF1"
FT                   /protein_id="CAJ51500.1"
FT                   /translation="MADDSIAVVDLDRCQPDRCNYECANYCPPNRTGKECIVTRSDYYD
FT                   DDEPFDGDPNQIRISEEVCLGESCGICVEKCPFDAIEIINLPVELEDDPVHRYGENAFA
FT                   LYGLPVPDPGTVTGILGPNGIGKTTAVRALAGELVPNLGEYTAEAAETATWDAVLDRYR
FT                   GTKLQTYIERIRSDDISIAQKPQYVDQIPGQFDGTTGELLESTDERGALDSYIDRLDIR
FT                   PVIDQPLSTLSGGELQRVALAATLARDRDFYFLDEVSPYLDIAQRVTAARLIRELAEDA
FT                   NRAVLVVEHDLAILDLLADSLHVAYGEPGAFGVITDPKSVRNGINEYLKGFLSNENMRI
FT                   RPNKIEFQEHAPRKTAKSTPLIEYPAISKSYGTDEFSLEVESGTIYESEVLGVVGPNGI
FT                   GKSTLAKLFTGALESDPDSQSLSFQLDIAYKPQYIEIDQPMRVDAFLSSITNDFGTSYW
FT                   KTEISQPLQLEQIMERNLDDLSGGERQRVAIAACLSDDADLYVMDEPSAHLDVEQRVQA
FT                   TSAIRRYAENNDETVLVIDHDIYMIDLLADRLMVFDGQPSEYGHASAPQEMRAGMNDFL
FT                   SDLDITFRRDERTQRPRINKPGSQLDRRQKQQGEYYYAP"
FT   CDS_pept        472088..472549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1373A"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1373A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51501"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KF0"
FT                   /protein_id="CAJ51501.1"
FT                   /translation="MMNYLVAVDGSESSMDAIEHAVDLITQTGGSLLIVHAVEARVLVD
FT                   DAESVGAAPTNTEVGERIYTEDITDAEARGKSVLADAEETIEIGDDVDIETTLLYGDPV
FT                   ECISSHATEIAVDGIIVGHRSLSGRVEGLVGSVAKGLVERASVPVTVVK"
FT   mobile_element  join(472690..473201,473310..473339)
FT                   /mobile_element_type="transposon:HqIRS105"
FT                   /locus_tag="HQ_HqIRS105A"
FT   CDS_pept        472690..473224
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1373B"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene has a frameshift and is truncated at the
FT                   N-terminus"
FT   mobile_element  complement(473202..473309)
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AG"
FT   CDS_pept        complement(473342..473863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amzA"
FT                   /locus_tag="HQ_1374A"
FT                   /product="archaemetzincin"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1374A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51502"
FT                   /db_xref="GOA:Q18KE9"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KE9"
FT                   /protein_id="CAJ51502.1"
FT                   /translation="MLVDIVPIGDLPAQVKREASAALRGVYECDVTVHEEQSIPDGAFD
FT                   HSRSQYRAEQFIELASRIGSGEKNIGITAEDLYYRRRNYVFGLAYLNGNGSVISTYRLQ
FT                   TSSDGGLKSKSPDAVFADRIRKEVVHEIGHTFGLEHCDNSKCVMSFSPTVREVDVKEEN
FT                   LCGSCNRLLY"
FT   CDS_pept        473903..474316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1375A"
FT                   /product="UPF0146 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1375A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51503"
FT                   /db_xref="InterPro:IPR005353"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KE8"
FT                   /protein_id="CAJ51503.1"
FT                   /translation="MHSLAQDALVERFSSYTSAVEVGIGNRPAVAAALVSCGVDIVATD
FT                   IVSCPVPPTVTFAYDDIVTTSEQRAPDSVYDVELVYALNLPPELHRPFRDVADTVGADC
FT                   RLTTLGYDAPIVPCHPVSLPGGETLYIVESESS"
FT   CDS_pept        474453..475316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1376A"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1376A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51504"
FT                   /db_xref="GOA:Q18KE7"
FT                   /db_xref="InterPro:IPR006438"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KE7"
FT                   /protein_id="CAJ51504.1"
FT                   /translation="MDADAVVLDIDGVLIDVSQSYRRAIVDTVDRCYNQTIKRTDIQEF
FT                   KNAGGFNNDWDVTNAVALYILTTRHESVSVDQFTTQIAAHGGGLESALTVVDNYLSTAD
FT                   YEMVLDAWNSDRLRDMFQALYLGSERYRELEDGEPPIDTQGYIIDEPVIIETETVDLLR
FT                   ETTKIGILTGRPAAEASIALDRVQFSIPSSHQFTMDDWEEGKPHPRALQMLADRLEANT
FT                   IVFVGDTLDDIKTAVNANMADSSRTYHGVGVLTGGLSGDAGRDAFMSVGAHTVIDSVND
FT                   ISDLVQ"
FT   CDS_pept        complement(475620..476258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1377A"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1377A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51505"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KE6"
FT                   /protein_id="CAJ51505.1"
FT                   /translation="MTDVHAITADAEVFTCNAYLVSGDRPVLIDAGAMPGAVDIIDNIV
FT                   DDLEAVYLTHQHTDHVAELDSILDKFDAELYAYSDHPRQDSTLEDTDTVEIGDEPFEVV
FT                   YTPGHASDHVAFVGNTRVFSGDVVVYNDGAFDDGSFGRTDMTGQSRERLITSLQRLLER
FT                   LPQTVNELYAGHGDVYYGSPGDDTIDSVKTIIERALMRAERRKLKYPNN"
FT   CDS_pept        476662..476838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1378A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1378A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51506"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KE5"
FT                   /protein_id="CAJ51506.1"
FT                   /translation="MGFGSYDESEQENQDFETDLEDDDGVSTSQSDHSGEVEYEIGASN
FT                   DELLNRLKDIKDN"
FT   CDS_pept        477012..477605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1379A"
FT                   /product="UPF0215 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1379A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51507"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KE4"
FT                   /protein_id="CAJ51507.1"
FT                   /translation="MTSIKPGTRALGIAESTAEHTNKCVIGGAVVRRDRVTDGFAFSSA
FT                   TVGGVDATSAMQTIITELCRPDIQYVLLSGVAPAWFNLIDIFSLAHAAECPVIAVSYEQ
FT                   STGLESALRKHFEGNALERRLTQYEKLPDREQLTIAADSSENNRNDDNTLFFRAVNIDV
FT                   STAKTVIRAYTPVGGRPEPVRVARLAARGARQWS"
FT   CDS_pept        477681..478379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udg"
FT                   /locus_tag="HQ_1380A"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.27"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1380A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51508"
FT                   /db_xref="GOA:Q18KE3"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KE3"
FT                   /protein_id="CAJ51508.1"
FT                   /translation="MTGDDNHDQDTSSDLNTATDAPGSASTVNGLDVTACKRCQGLVES
FT                   RSQIVNGVGPADAELVFIGEAPGANEDEYGEPFVGRSGDVLDDALNEAGVSRDSIRITN
FT                   CVRCRPPENRNPTTEELSNCRRYLEHELSALNPAVIVTLGKVPSEHLLDRQIAVTTAAG
FT                   DVTDVRLGDQSYRVIISVHPAATLYDQSQSTTFVDTIKSAASLAGVQSDIDNPTDTTSG
FT                   GQSRLGEYED"
FT   CDS_pept        complement(478381..479382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE1"
FT                   /locus_tag="HQ_1381A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate phosphate/phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1381A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51509"
FT                   /db_xref="GOA:Q18KE2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KE2"
FT                   /protein_id="CAJ51509.1"
FT                   /translation="MSTDTVDEILSRIERAVLIRRIFWSIAVTLAVGAIYFGTGFLGAR
FT                   PVPELLRFAQFEFFAAELIKYVQPNFVDLTFYTQNNNINGLAAIIASVTHPGSIVTTIS
FT                   SLRSSLIISAVVMTLTIGAVGTILGFPFALFFGVLGSERVTPFPFNFVFRGVMSAIRAI
FT                   PALVWVFIYAALVPLSPLTAMLAVATDTVGNLGRLFTDELEEIDDGPIEAIRSTGASRV
FT                   QVINFGMLSQVSSSFVAWTLYILEINTRIAISLGVVGAGGLGQYIQQNLNLFNSFRAGA
FT                   GLVTLLILVLSIELLSSRLRARLRPSEHDAKGLVQSIRELGDPDRWLGRTTD"
FT   CDS_pept        complement(479379..480293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC1"
FT                   /locus_tag="HQ_1382A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate phosphate/phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1382A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51510"
FT                   /db_xref="GOA:Q18KE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KE1"
FT                   /protein_id="CAJ51510.1"
FT                   /translation="MPHVSLQNVTKLFGEDTIALDDVSIEITAGEFVVILGPSGAGKST
FT                   LLRILNGLTEPTTGTAQIGGSPVSESGSDVGMVFQMHYLIESLSAYRNALTGALSRTTN
FT                   LKSILTLNQTDDKRAALRALDTVGLLKDAEQRAGTMSGGQKQRVGIARALVQNPSLLLA
FT                   DEPVSSLDPKAARDVMRYMKQAARERELTTVASLHQVNIAREFGDRFIGVRDGTVIFDG
FT                   SRAELSMDVIDDLYYAGSESTPVSHGDIEGQGEGLTKPDDTSVSSDMETTSGRDHSTGT
FT                   DTGTDTGTDTETDTETDTGEAQL"
FT   CDS_pept        complement(480324..481307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnD1"
FT                   /locus_tag="HQ_1383A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   phosphate/phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1383A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51511"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KE0"
FT                   /protein_id="CAJ51511.1"
FT                   /translation="MSSRRRFLQGIGAVSTVGLVAGCTGSTNNSNNNTDSVDQTTATTT
FT                   SDSVPFGDNRATFYMSPSEPQQLMEAQYAPVRTTLENELPVETATLRYAAGYSAVLQSL
FT                   AGGTGDIAETGPFAAALGVDNDRCNIILQRYGYGSWTYASVIATREDSSIESLSDLENE
FT                   RVAFADRLSASGALYPLFMLKQAGLTIGDLPTDTGDASFTPQFSSHAEAFAALERGQVA
FT                   AAGVGKFITLDDNRELKDGFRYIETTTDIPRAPIVVSPELSADEQTAVKDALLTASESI
FT                   YFGEDGESDTEDDLWFSNVREADDDTYQPVVEVASELGVTTDLLDS"
FT   CDS_pept        481417..482127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="HQ_1384A"
FT                   /product="imidazoleglycerol-phosphate synthase subunit
FT                   HisH"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1384A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51512"
FT                   /db_xref="GOA:Q18KD9"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KD9"
FT                   /protein_id="CAJ51512.1"
FT                   /translation="MNVIIQLVYVRNNFSNVCENFCVSTQTTADIILVDYGLGNLRSVT
FT                   RGLERAGASVTLSTDPETLADADGIVLPGVGAFSEGMENAGPFRNALAAAVDRSQPVFG
FT                   ICLGMQMLLTSSEEADHAGEGEVKGLDFISGRNRRFDGNQKVPHMGWNELSISRDHPLV
FT                   DDVDGKYAYFVHSYYADPDDSNAVVATADYAREFPAVVADESGSVFGTQFHPEKSGETG
FT                   LQILKNFVEFCRTA"
FT   CDS_pept        482167..482973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="HQ_1385A"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1385A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51513"
FT                   /db_xref="GOA:Q18KD8"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KD8"
FT                   /protein_id="CAJ51513.1"
FT                   /translation="MQIVTLGPAGTYSHRAARAVDNNVGFKESVSAIVAAVDTEEYERG
FT                   VVPIENSIEGSVTETLDSIADSDVAVTQEIVTPIRHALLAQSSEFELIASHSQALAQCR
FT                   SYLEDTYPDVRAEAVASTARGVERAREDPGVAGIGHPDNAGDVLAVISEDIQDRSSNAT
FT                   RFFVVAPESERVTAGGRSTVVVYPNANYPGLLLELLEAFADRDINLSRIESRPSGNRLG
FT                   DYLFHIDFEAGLYESRAQEALKSIESIATDGWVKRLGSYDRRHVVE"
FT   CDS_pept        complement(483287..484291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ala"
FT                   /locus_tag="HQ_1386A"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1386A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51514"
FT                   /db_xref="GOA:Q18KD7"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR028609"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KD7"
FT                   /protein_id="CAJ51514.2"
FT                   /translation="MQRETLLLNATDVKQNAPMAEVVPAIEDAFAAFQRGDAQMPAKSY
FT                   IELPQYNGDFRSMPAYLDAGTWDAAGIKWVNVHTDNRDNFDLPTVLGTMIYSDPETAFP
FT                   LAILDGRELTMQRTGAAAAVATDYLAVPDASSLGIVGAGVQSYTQLEAISQVRPIETVV
FT                   VADRDDTRVAEFIEAFDTEFDVHAGSVSDAAGCDVLSTVTPVEDPIIPREAVGDHTHIN
FT                   AMGADAPGKHELADEILFDAMIIIDDHEQTTHSGEINVLWQANQLDESDINASIGEVVL
FT                   NQHQGRDQKTGISVFDSTGLAIQDVATAHVVYEHACANGNGYNFDLLGFAEAD"
FT   CDS_pept        complement(484527..486203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ths2"
FT                   /gene_synonym="thsB"
FT                   /locus_tag="HQ_1387A"
FT                   /product="thermosome subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1387A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51515"
FT                   /db_xref="GOA:Q18KD6"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KD6"
FT                   /protein_id="CAJ51515.1"
FT                   /translation="MSQRMQQGQPMIIMGEDAQRVKDQDAQEYNIQAARAVSEAVQSTL
FT                   GPKGMDKMLVDSMGDVTITNDGVTILQEMDIDNPTAEMIVEVAETQEDEAGDGTTTAVA
FT                   IAGELLKNAEELLEQDIHPTAAIRGFNLASEEARSEIGEITQAVEPGETELLQKVAETS
FT                   MTGKSSELDKELLAELVVKTVEAITVEANDGSYVVDLENLNIETQTGRAAAESELLNGA
FT                   AIDKDPVHDDMPTAAAEANILLLNEPIEVEETDVDTQVNIESPDQLQQFLDQEEKQLKE
FT                   KVEKIADAGADVVFCQKGIDDLAQHYLAKEDILAVRRAKKSDVGFLKNVLEASVVSDLD
FT                   SVTESDLGYGSVRRDGEDELFYVEGLGSETHGVTLLLRGSTDHVVDELERGINDAIDVV
FT                   STTVSDGRVVAGGGAIEVEVARRLRDYADSVSGREQLAVEAFADALELVPRVLAENAGL
FT                   DSIDTLVNLRKAHENGDANAGLNVYSSDVEDSFDAGVVEPAHSKEQAIASAAEAANLVL
FT                   KIDDIIAADELSTSGDDEEGGPGGAGGMGGMGGMGGMGGAM"
FT   CDS_pept        486496..486690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA2"
FT                   /locus_tag="HQ_1388A"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1388A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51516"
FT                   /db_xref="GOA:Q18KD5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KD5"
FT                   /protein_id="CAJ51516.2"
FT                   /translation="MAQGTVDFFNDTGGYGFISTEDADEDVFFHMEDIGGPDLEEGQDL
FT                   EFEIVQADKGPRAKNVERL"
FT   CDS_pept        486813..487220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1389A"
FT                   /product="VanZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1389A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51517"
FT                   /db_xref="GOA:Q18KD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KD4"
FT                   /protein_id="CAJ51517.1"
FT                   /translation="MWLFVQLSKENRYRRWVPSICCAIIIFAVSIIPLQNRGHTTMGIG
FT                   FILRMDIILHAVGYTVLAWTIVCARKVGLTDYGEILLILIFVTVFGAGIEGIQAIIPTR
FT                   QSSITDMIANAVGATTIFIPSVFDCVRQRYQ"
FT   CDS_pept        487228..487941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucS"
FT                   /locus_tag="HQ_1390A"
FT                   /product="endonuclease NucS"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1390A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51518"
FT                   /db_xref="GOA:Q18KD3"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KD3"
FT                   /protein_id="CAJ51518.1"
FT                   /translation="MTTTRLYRPTHRDAFELLESAFEDERLLTMFGLCEVQYEGRASST
FT                   LAPGQRLVIYKPDGTALVHTGENHEPVNWQPPGSTHNASVRDGQLRIRSTRSNPTEQLD
FT                   VMFERVETISAYAVTDRSDLKLTGSEEDLRQWILDQPEVIEEGFDPIATERQTTAGPID
FT                   IFGTDNAGHPVVIELKRRRVGPSAASQLQRYVEAITAELSDTSTRGILVAPSITDRTAS
FT                   LLNKWDFEYCSVDIE"
FT   CDS_pept        488010..488540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl16"
FT                   /locus_tag="HQ_1391A"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1391A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51519"
FT                   /db_xref="GOA:Q18KD2"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KD2"
FT                   /protein_id="CAJ51519.1"
FT                   /translation="MSDKPASMYRKLSKPSYTRRDYVTGIPGSKIAQHNMGNLQTGPQD
FT                   YPVQISLRIEEECQIRHGSLESARLSANRTMLKQVGQDNYKMVLRKFPHQILRENKQAT
FT                   GAGADRVSDGMRQAFGKPVGTAARIQQNERVFTIYCEVDDASVAKDGLRRAYNKMSPPC
FT                   RIDVEKGQKLLIS"
FT   mobile_element  complement(488563..489065)
FT                   /mobile_element_type="insertion sequence:HqIRS57"
FT                   /locus_tag="HQ_HqIRS57C"
FT   mobile_element  complement(489140..489682)
FT                   /mobile_element_type="insertion sequence:HqIRS71"
FT                   /locus_tag="HQ_HqIRS71B"
FT   CDS_pept        complement(489209..489388)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1391B"
FT                   /note="the underlying mobile genetic element is noncoding
FT                   but has a region of high similarity to the C-terminal
FT                   region of transposons with an IS1341-type transposase gene"
FT                   /note="pseudocoding frame (HqIRS71 element)
FT                   (nonfunctional)"
FT   CDS_pept        489831..490700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1392A"
FT                   /product="ATP-grasp fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1392A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51520"
FT                   /db_xref="GOA:Q18KD1"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KD1"
FT                   /protein_id="CAJ51520.1"
FT                   /translation="MLTLAVTTASTTFDRMQEPLTNHDITVEHLQATQRTVDLTQSPTT
FT                   EYDVGFVYPGRLMEGGVVSARHNIPWVNGRDAILTSRNKAGVLAMLERAEIPVPETRVI
FT                   SNPVEYDAVTAAVDTLSFPVVIKPNSATRGIGVTKVDDIDSLLGTIDYLDLIHDYQATD
FT                   DKSYLIQEFLPNARDYRIMVVDGTVVGGVERRISRSHANTDDTRWKHNVHRGATAHGVQ
FT                   IPDQYQELALKTAAALDISYLGVDILVTEHRVVVSETNARPTIDDTKKYDADFWDRLAA
FT                   LIHQTARE"
FT   mobile_element  490741..490850
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AF"
FT   CDS_pept        complement(490962..491324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp20A"
FT                   /locus_tag="HQ_1393A"
FT                   /product="Hsp20-type molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1393A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51521"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KD0"
FT                   /protein_id="CAJ51521.1"
FT                   /translation="MRDDPDDPFDDFFDGIERMMNEMTSDDAAGFASETHIDVYNTDGQ
FT                   LQLIADLPGVTKDAITLQCDGTVLTISAASDRREYDERVQLPTRVDEHSADASFNNGIL
FT                   QVTFQISDDSAAIDVE"
FT   CDS_pept        491650..492717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap2"
FT                   /locus_tag="HQ_1394A"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase (NAD)
FT                   (phosphorylating)"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1394A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51522"
FT                   /db_xref="GOA:Q18KC9"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KC9"
FT                   /protein_id="CAJ51522.2"
FT                   /translation="MSEKSNLSANPSTNPIRVGLNGFGRIGRSVLRAIITNPSIELVGI
FT                   NDVMEFDDMGYLAKYDTVMGRADDISQDGNMLSVGETTVPLYNIQDPTELPWGQLEVDV
FT                   TLECTGIFRTRSDAAAHLEAGADKVIISAPPKGDEPVKQIVYGVNHHEYTGEDILSNAS
FT                   CTTNSVSPVAKVLDDEFEIESGLLTTVHAYTGSQALIDSPMTKTRRGRAAAENIIPTST
FT                   GAAQATTEVLPQLDGKLDGMAMRVPVPNGSITELVVNLSTAPSVEVVNDAFRNAADDGP
FT                   LAGVLGYTDDEVVSSDIIGLPFSSMVDLNSTNQVNAGGLYKILTWYDNEFGFSNRMLDL
FT                   AQFITNTNTNTSTNT"
FT   CDS_pept        492823..494058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="HQ_1395A"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1395A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51523"
FT                   /db_xref="GOA:Q18KC8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KC8"
FT                   /protein_id="CAJ51523.1"
FT                   /translation="MPSFDTIDTLNDDTDAPAEKRVLLRVDINSPVSDGIVQDNRRFER
FT                   HARTIQELSNAGYHTILLAHQGRPGGDAFISLEGHTAVLEKYLDCEVNFIDDTHGKRVA
FT                   KAINATESGDVLLLENTRMCEDELPEADPNIKANTAFVQSLSKHVDAYINDAYSSAHRS
FT                   HASLVGFPSMLPSYAGRVMETEYHANTAIGQKEFDGTVVMTLGGTKATDVIDVINNLAG
FT                   SVDRFLLDGVVGELFLRASNVPVGFDITSETDRYDAQWKHNSKVIKSILTEHSDQITLA
FT                   SDLAYNEAGERAEIAVDSIIEKSVSFMDIGTTTAESYAEVIRDADAVFVKGALGVFETE
FT                   AFAKGTVRVLEAIADSNCFSVVGGGDTSRAIGMYDMNRADFDHVSIAGGAYIRALTGQP
FT                   LVGVEVLKSESI"
FT   CDS_pept        494213..494842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /gene_synonym="ribC"
FT                   /locus_tag="HQ_1396A"
FT                   /product="riboflavin synthase"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1396A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51524"
FT                   /db_xref="GOA:Q18KC7"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KC7"
FT                   /protein_id="CAJ51524.1"
FT                   /translation="MFTGIIEGTGVITAATADEGGRRLRIEPPAAINAKQLEHGQSIAV
FT                   SGACLTVESSEARTTDTNGYFEVFLAAETIDKTYLGEINVGDRVNIERALAADDRFDGH
FT                   LVQGHVDMTAQITSIDRIGDDWTFGFDLPTSIAPYVVQKGSITVDGISLTVAERNSTEF
FT                   SVAIIPTTYEVTTLSEKAVGDPVHLEVDVVAKYVEQLTSGYRESLE"
FT   mobile_element  join(494933..495008,495203..495398)
FT                   /mobile_element_type="transposon:HqIRS114"
FT                   /locus_tag="HQ_HqIRS114C"
FT   mobile_element  complement(495009..495202)
FT                   /mobile_element_type="insertion sequence:HqIRS71"
FT                   /locus_tag="HQ_HqIRS71P"
FT   CDS_pept        complement(495024..495140)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1396B"
FT                   /note="the underlying mobile genetic element is noncoding
FT                   but has a region of high similarity to the C-terminal
FT                   region of transposons with an IS1341-type transposase gene"
FT                   /note="pseudocoding frame (HqIRS71 element)
FT                   (nonfunctional)"
FT   CDS_pept        495261..495398
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1396C"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene has an in-frame stop codon and is truncated at
FT                   the N- and C-terminus"
FT   CDS_pept        complement(495499..496503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1397A"
FT                   /product="PrsW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1397A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51525"
FT                   /db_xref="GOA:Q18KC6"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KC6"
FT                   /protein_id="CAJ51525.1"
FT                   /translation="MVRPQDPIEEAADDSLDLYDIATWEVRSRTDRIASVLWWLLAGSA
FT                   RVTVILIALTLLLAVGGLAALTDPQTGILTALSAIPAVGLAVYVSLTDITETEPILLLV
FT                   ATFLLGVLTANFAAVLNTVLRPYFRGLGFISSIVFFFLVVGPIEESVKLLAVRLYAYSD
FT                   DRFNSVLDGAVYGAMAGLGFAVIENALYIARQLPSSGLDLGLGLIGAGGGITAIRALAG
FT                   PGHVIYSAIAGYYLGLAKFNPGQRGPIVMKGILLAAIIHATYNATVGIGSGVIASITGL
FT                   SGIVSYLIYVVFYDSIFGLILFIKIQRYRNSYQRVHSADKDNEVTPDENDITQ"
FT   CDS_pept        496864..498381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aubA"
FT                   /locus_tag="HQ_1398A"
FT                   /product="RNA-binding protein AU-1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1398A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51526"
FT                   /db_xref="GOA:Q18KC5"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016730"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KC5"
FT                   /protein_id="CAJ51526.1"
FT                   /translation="MGTDNHSVRVSVRGIYATALTKRLLDADYEIVQASPVIRERFDID
FT                   FDTVYNTVTVTTTDDHQGVGIHGTESAVRSVADVLTSCGRDTLAWDDLTPPGVIFTAQI
FT                   TETQGSGAICALIPAENPDTESKTEPDLNDVHIPDESVATGYLPYDSTDKHIEQGDIMT
FT                   VQSHRSMPPWDNTDQRADAVVGTTLRANGGLATLIQGHEGVTVDTYDDEDARELAGMIE
FT                   LIDIDLPTGWGIEVNHAATQASLTALKSGLERAIDRAEDISDGAVAEEVTSTGRWLWFG
FT                   RESRFALDEIRRSVITTIHGHHRIKAAGETASAGVDLAEALCGDIGDGNVQIQHNEFPF
FT                   EVVTQQFGPTEGERVELYHGKPEGHAFSLGQGEVTDWDANGTIEVTRRISGHGSGTYDE
FT                   LGTPRESGDTAVTRVREGRWWYPTVYRSRDGEHKGTYVNICTPIECFPKSIRYVDLHVD
FT                   VVKYPDGTVERVDDDELNTAVTAGHIPPALAEKAQSVASSLERALDK"
FT   mobile_element  complement(498628..499206)
FT                   /mobile_element_type="insertion sequence:HqIRS71"
FT                   /locus_tag="HQ_HqIRS71C"
FT   CDS_pept        complement(498702..498881)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1398B"
FT                   /note="the underlying mobile genetic element is noncoding
FT                   but has a region of high similarity to the C-terminal
FT                   region of transposons with an IS1341-type transposase gene"
FT                   /note="pseudocoding frame (HqIRS71 element)
FT                   (nonfunctional)"
FT   CDS_pept        complement(499223..499675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1399A"
FT                   /product="thioesterase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1399A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51527"
FT                   /db_xref="GOA:Q18KC4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KC4"
FT                   /protein_id="CAJ51527.1"
FT                   /translation="MSTVTATYIENRERVQPDDVNNYGTAHGGNVAKWMDEVGAMSAMR
FT                   HAGNTCVTARIDRLDFERPIPQGDTCIIESYAYATGESSIRVRLRAYRENPQTGSRERT
FT                   TESYFVFVAVDEDMNPTTVADLSVESERCRKLRTEALDGERDMSQE"
FT   CDS_pept        complement(499936..500097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1400A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1400A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51528"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KC3"
FT                   /protein_id="CAJ51528.1"
FT                   /translation="MCHFGDYTDDWAYESAREDEEAEDEIDEPESPFADMDEAEDVRIV
FT                   TDGGDDDE"
FT   CDS_pept        500236..500541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1401A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1401A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51529"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KC2"
FT                   /protein_id="CAJ51529.1"
FT                   /translation="MKNPICSSEDNESENKNAKRGAKFGSQVGAAAGARVGPFVTGLSS
FT                   GLGGAVGYLVGSAVDDVADTAKPMTDGGHQQSDNYPHEEPDTGDEIDIPVQMETPE"
FT   CDS_pept        complement(501226..501951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1402A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1402A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51530"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KC1"
FT                   /protein_id="CAJ51530.1"
FT                   /translation="MVFYEQIPTGDLCRSRTDADIAETLISALNRSLTGYVVFEPQQSI
FT                   LAGEDDRAVITFEQGVPMAAYHTDNDVVGSEAIDALSDSGTPHVDVHTLPAAALMSIHR
FT                   DVTDAFAVAPTAPARHLTNDATLVERTRNVAPQTRVDGTDTQTAVEAFLADTDRIESIK
FT                   QEARAEAAARAAEWGFTDQLGPPETTENENIDDEDRTLEDSAQQKGDNVYESESDVNAR
FT                   HNRTSSDDSKQNQSNSPDE"
FT   CDS_pept        complement(501953..502726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA1"
FT                   /gene_synonym="minD"
FT                   /locus_tag="HQ_1403A"
FT                   /product="ParA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1403A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51531"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KC0"
FT                   /protein_id="CAJ51531.1"
FT                   /translation="MVEAFAVASGKGGTGKTTSTLALGMALAADYDVTVIDADTGMANL
FT                   LFHAGLDDVEITLHDLLLTDCDLPASAAVYDRFGMSVVPCGTSLADFEAADPTVLRDVV
FT                   ADLAADTDVLLLDSPAALGSKSAVLPIVLADRIVIILQPTVPSLSDGLKVQEYARAYGT
FT                   VTGGVIFNRVRQDEDVATIAEQATRYFDGRTLATVPESDAVRMARRVGKPLLAHAPETT
FT                   AASAFRSAAATLDIHDGDAIGVADRFRNAVVPERL"
FT   CDS_pept        complement(502805..504589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiP"
FT                   /gene_synonym="cobQ"
FT                   /locus_tag="HQ_1404A"
FT                   /product="adenosylcobyrate synthase"
FT                   /EC_number="6.3.5.10"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1404A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51532"
FT                   /db_xref="GOA:Q18KB9"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KB9"
FT                   /protein_id="CAJ51532.1"
FT                   /translation="MSERSTPTILVAGTASHVGKSTVVTGLCRRFANADVRVAPFKAQN
FT                   MSNEARAVVRPTADTDMKSVTADENDSTAVNSSEQEETNTITAGVLNSELNPTYGEIGV
FT                   SQSVQAQAAGVQSVTDHNPVLLKPRGDAESQLIIDGVAVGHYTAESFYAEHWEQARSAA
FT                   VTAHTRLAADHDVIIAEGAGSIAEINFHDHDLANIETARFTDARIIIVADIERGGVFAS
FT                   IIGTLELLPDDVRNQVIGIVITKFRGDKSLLAPGIQTIEDRTGIPVLSVIPYDDPGLPA
FT                   EDSVSLPAVGERSVRGADDDAPAEQTVTVAVPRLPRASNTADLDPLAAVPGVRVAFVPL
FT                   DVSLSRADIDAVVITGTKNTVDDLRALRASGFDDELREFEGPIVGLCGGYQLLGERLTA
FT                   IHVEETDSNEKTEIEPAPSNDSNDDDSGHQTLSGLGILPVETQFSPTKRVAPVTWTLDG
FT                   FGPLADATGMVTGYEIHAGQTTACGPVQTPFESLTTERIESTDNTADLSQGMTNHHSRD
FT                   PVALGAATDSVIGTYLHGLFDNEAVCEAFVESVFSAANTDRPDIDTTSRSDPYERAAHL
FT                   VSSISFESILGHPLTELK"
FT   CDS_pept        complement(504758..505489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA"
FT                   /gene_synonym="cobO"
FT                   /locus_tag="HQ_1405A"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1405A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51533"
FT                   /db_xref="GOA:Q18KB8"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KB8"
FT                   /protein_id="CAJ51533.1"
FT                   /translation="MIGPLNYVMTDEANESSTINPKKTRQQTPGGGERPAAETITPTAP
FT                   EEFGRVQVWWGSGKGKTTAALGMAFRAVGHGFRVHMLQFMKGGADSVEGARGEYNAIAA
FT                   VPGISYENTGHYGWHGLLDGSDDDEHHAKAKGAMRRTRALLDGISDASLDTPIDLSGDP
FT                   EDGVHLLILDEVLYAVEQELITQDDVLSLIEQKPDNLELVLTGSHTEPTYLFDDVDLIT
FT                   NVRKQKHLFDDGIRARKGTEY"
FT   CDS_pept        complement(506233..507255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiZ"
FT                   /locus_tag="HQ_1406A"
FT                   /product="adenosylcobinamide amidohydrolase"
FT                   /EC_number="3.5.1.90"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1406A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51534"
FT                   /db_xref="GOA:Q18KB7"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KB7"
FT                   /protein_id="CAJ51534.1"
FT                   /translation="MTEENTESDTTSDVTDCTDHNISSENDDMTFFDLTVRDGVCRLYR
FT                   PDTRWLSTGYNGGVSRGDVAYLLSVPHGWTETAVSAYVAERCATAGFEYISTFTDGRGR
FT                   SLTDTQTETPHNTTHAGTDDTIWMNAETRTYAPALLTGVDLQHARRARLDPVEVIVTAG
FT                   VSNPATLPMSETINDNQSTENAMTDTEPDTKIDTSGELDDSQINKSDRDDFGTVNIILG
FT                   TTRSLTPGALSNLVAVVSEAKAATLMTQTGFTGTTSDAVLIASDPTGNMKRFSGSATAV
FT                   GNAARVCVRDALCAALASRYKSEPLPTSVEMASHGIVTDDRAFVSPVQISEETDTTTES
FT                   "
FT   CDS_pept        complement(507267..508322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /locus_tag="HQ_1407A"
FT                   /product="L-threonine-O-3-phosphate decarboxylase"
FT                   /EC_number="4.1.1.81"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1407A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51535"
FT                   /db_xref="GOA:Q18KB6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KB6"
FT                   /protein_id="CAJ51535.1"
FT                   /translation="MNPEAVADVDRVPHGGSEDTSRLDFSANTNPDRPPGVAGVYESAL
FT                   SDATRYRDDFSAFTQAAASYVNCDASMVTPVPGGLAALRLAVAVTVSSGDRVFIPEPGF
FT                   SEYAREVKLQGGIPVGIAHDTIVTADTTPNDIAAVIICTPNNPTGDCIDPEVIDAFRQR
FT                   CIETDTTVIIDEAFMDFIDAPSMAGARGTIVARSLTKIFGLPGLRAGFAVADGVLGDRL
FT                   ESARPTWSLSTPAAAVGQYCLTQDDFVRATRERVSTERERLRTALETEYTIFPSDAPFL
FT                   LLGVDTTVSAIADRSPTTKTDAVDALLAHARENGIELRDARTFETLDAHVRVAIRRPHE
FT                   NDRLLSVLLED"
FT   CDS_pept        complement(508510..509544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="HQ_1408A"
FT                   /product="nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1408A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51536"
FT                   /db_xref="GOA:Q18KB5"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KB5"
FT                   /protein_id="CAJ51536.1"
FT                   /translation="MRVILVAGTTKTAAIEGISAAGATSRLLMHTPSADAEIISYGLPI
FT                   QAPVTPISPSGCPTPAVITRAIRERIGFDLTIIDAGLARPTGAPTVSVGARPGRDIRES
FT                   EPVPTAPELFINAREFGQSLPDDQIVIGETIPGGTTTALAVCRALGVDVPTSSSIPTNP
FT                   LRLKQNVTDKALSTAGISPGQFAHNPKHAIRAVGDPVLAVAAGTTVGAIESNTDVILGG
FT                   GTQLLTVAALVRHAGVSERATLATTSYLAADVTGLNETATALNLDLIVTNPEFGAHDVD
FT                   AGPLSEYANGVAKEGAGMGGALALIAEADRLNEVIPAVQHVLNRIEQQQSHENTVTYTD
FT                   TKSP"
FT   CDS_pept        complement(509535..510263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobY"
FT                   /locus_tag="HQ_1409A"
FT                   /product="adenosylcobinamide-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1409A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51537"
FT                   /db_xref="GOA:Q18KB4"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KB4"
FT                   /protein_id="CAJ51537.1"
FT                   /translation="MCGGHGTRLRGRRNDSSDNETRPPDEVLNIETNDNSADHGDGSRP
FT                   DNSVTNRSSAVSDQSIIDCEKPLIEINGTAMLSHVANALTASPVETVWAVTSPNAPRTA
FT                   TAVREASRFESIASIETPGDGYVADLQHALSMLDTPVVTTPADLPLISSDHIAKVINTA
FT                   RLNDDNDPTSTMLCVPAALKKQLGVSVDTVFEHDHLQVAPSGINIVAGDTDTVQLSYDA
FT                   RLAINVNRPTDKRVAEKLCE"
FT   CDS_pept        complement(510266..511030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="HQ_1410A"
FT                   /product="adenosylcobinamide-GDP ribazoletransferase"
FT                   /EC_number="2.7.8.26"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1410A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51538"
FT                   /db_xref="GOA:Q18KB3"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KB3"
FT                   /protein_id="CAJ51538.1"
FT                   /translation="MVISAIRGGIGFLTRVPIGHDKKAWDAFRQTPVAFTVIGYPLGTI
FT                   VALPFVLLSIVPVPTLIGVYLLILIGVTGITHIDGIADIGDAAVVHDTDDEHSRRRSVL
FT                   HDSQVGVGGALAVTVTVVSLALGVLGATRTTPQVTFILVLTAEVGAKSAMALLVCTGDA
FT                   AHDGLGAALIDESTPLSLFPVILALTPLLLAIPYLGASPTAAVVLTPLIVALVIKQWAD
FT                   NALGGISGDVLGAVNEVSRAAAIHAGVVVWML"
FT   CDS_pept        complement(511021..511941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiB"
FT                   /locus_tag="HQ_1411A"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1411A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51539"
FT                   /db_xref="GOA:Q18KB2"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KB2"
FT                   /protein_id="CAJ51539.1"
FT                   /translation="MITLGSIAVIVAIGLDTIIGEPPAFIHPVALFGQLVDIVDRSYDS
FT                   PNIVGILIATTLPIGFGIVTATSVYVVFSVNSQLGAFAAGCVLFTLISLRLLLRTVHDV
FT                   VMMTTADVSAARYELRALAGRDASELDAAHIRSAAVESAAENLADGFIGPLLAFTLFAP
FT                   VSVSIGVASAAWVKAINTLDSMLGYRSKPIGTASARLDDIIMWVPARLTAALLSVAAGH
FT                   PLLPLRQQVRADAAQTASPNAGWPMATIAALLPARLHKPDTYELRTSASLPDKSVATYA
FT                   IQITRRAGVIAIVLTITILEGITWL"
FT   CDS_pept        complement(512004..512651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1412A"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1412A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51540"
FT                   /db_xref="GOA:Q18KB1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KB1"
FT                   /protein_id="CAJ51540.1"
FT                   /translation="MAVTFDLFDTLVTVSRPADPAAAVASELQTRGVTVPSDWETAYRT
FT                   VHVESQRGSEVPLSTHINAALESRDVSAPAEYIRHAVTAAFDPTVQTRPNAITAVETAV
FT                   ANGPVGILSNCSVSQLVHRTLMRSDIDRSLFDAIVTSVDCGWRKPHPRAFQAVAKSLRV
FT                   DPTSLIHIGDNPETDGGINDVGGHFHNITKTSLGQISTALDGEFNNNDSNIN"
FT   CDS_pept        512793..513344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1413A"
FT                   /product="DZR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1413A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51541"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KB0"
FT                   /protein_id="CAJ51541.1"
FT                   /translation="MSKITFRADDDLVGQLEEFEGSKSEVMREALRTYLENTEAMHEGG
FT                   NGSLNNDLNSDTTHHTTGNKNHTGESAGRKVTVNIVLDDESGIVYANKQEDAVATAAGK
FT                   PDTAIDAEVNRKTSSSEEISECNKCGKALIDGHVYCPNCGEKAAHRVFCECGDEIQSDW
FT                   AFCPSCGRRTSAADVLEKSS"
FT   CDS_pept        513546..513725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1414A"
FT                   /product="CopG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1414A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51542"
FT                   /db_xref="GOA:Q18KA9"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KA9"
FT                   /protein_id="CAJ51542.1"
FT                   /translation="MERVTLRIPKQQIEEVEQMVETGEFPNRSEAIRSAVREMINEQQD
FT                   DRHESSSKHTWAKV"
FT   CDS_pept        513730..514932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ2"
FT                   /locus_tag="HQ_1415A"
FT                   /product="cell division protein FtsZ, type II"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1415A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51543"
FT                   /db_xref="GOA:Q18KA8"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KA8"
FT                   /protein_id="CAJ51543.1"
FT                   /translation="MQDIVEEAMQRDEEERDVAAEAGDDPEGFGSPRIVIVGAGGAGNN
FT                   TVNRLYNIGVDGADTVAINTDKQHLKMIEANTKILVGKSLTQGLGAGGDPSMGERATEM
FT                   AQGTIKDVLGEADLVFVTAGMGGGTGTGAAPVISKIAKEQGAIVVGMVSTPFNVERART
FT                   VKAEEGLEKLRNEADSIIVLDNNRLLDYVPNLPIGKAFSVMDQIIAETVKGISETITQP
FT                   SLINLDYADMSTIMDQGGVAVMLVGETQDKNKTQEVVNDAMNHPLLDVDYRGASGGLVH
FT                   ITGGPDLTLKEAEGIADSITERLEASANVIWGARIQEEYKGKVRVMAIMTGVQSAQVLG
FT                   PSTQKQADASRRSLEGSASEFNSTQGNTANGSTSGSESTGWQSDGGRAPREKQHGLDVI
FT                   R"
FT   CDS_pept        complement(515131..515943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1416A"
FT                   /product="probable S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1416A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51544"
FT                   /db_xref="GOA:Q18KA7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KA7"
FT                   /protein_id="CAJ51544.1"
FT                   /translation="MREFSSEYLTHTRRELWADSRAALTPLSLEDRTRILDVGTGTGEF
FT                   AQVLDTESPGDIVCLDMDPELLTIARSKTDLTTIIADATQLPIKSDAVDLVTCQALLSN
FT                   LPDPVNILQTFARVSSELVAAVEPDNAAVSVASTVDTEAQIERRAREAYIAGIQTDVAL
FT                   GDRLSTAFDNAGLDDIVRRRHYHRRTTEPPYDDTALTAAARKAHATALRDHRTELRREL
FT                   SDDAYDTLRHDWREMGRAVVDQIHSETYRRVEIIPFDVVVGRVSSDQA"
FT   CDS_pept        complement(515951..516787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apn1"
FT                   /gene_synonym="nfo"
FT                   /locus_tag="HQ_1417A"
FT                   /product="endonuclease 4"
FT                   /EC_number="3.1.21.2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1417A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51545"
FT                   /db_xref="GOA:Q18KA6"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18KA6"
FT                   /protein_id="CAJ51545.1"
FT                   /translation="MLVGAHESIAGGVANAVDRQLENGGNCGQIFTHSPQVWQDPSIDD
FT                   TDAEAFRDRSQMHDIGPWVIHSSYLVNLCTPKDDLRAKSIDSMQQEVDAAAQLSIPYVN
FT                   VHLGAHTGAGKQQGLDNAISALDELTIPDSVTVLLESDAGSGTKLGNKFDHLAYVLEES
FT                   THELEVCLDTAHVFAAGYDLSTPAAVNTTIKEFDTTVGVDNLACVHLNDSKHACGTNKD
FT                   EHAHIGEGKIGESGMEAFINHSAIDPIPLVLETPNENGKGFAWNIDRVQNLAENPA"
FT   CDS_pept        complement(516933..518294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /gene_synonym="aldH1"
FT                   /locus_tag="HQ_1418A"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1418A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51546"
FT                   /db_xref="GOA:Q18KA5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KA5"
FT                   /protein_id="CAJ51546.1"
FT                   /translation="MDVINPATNEQIDRYEPDTSDDVEATLSRAQTTFQTWRNRSVRER
FT                   EQLLAAAGDILENRIEEYAQLMTTEMGKPITQARAEIEKCARVCEYYATHASAHLQPDG
FT                   HPSPPGSSVQTVYEPLGPVLAVMPWNFPFWQVFRFAAPYLTAGNVGILKHAENVPGCAE
FT                   AIAEVFDDAGYPDGAFETLLIEVDQVSDVITDDRIRAVTLTGSGPAGRAVASTAGENLK
FT                   KTVLELGGSDPFIVLDDADITAAAEAGAWARTLNNGQSCIAAKRFIVHSDIYDVFLDRL
FT                   RDEMISYTIGDPLDETTDVGPQARNDLCANLHSQVERSVEAGATLEIGGEPLDREGSYY
FT                   PPTILTDIPVPSPAANEELFGPVAAVFEVKDENEAITTANDTEFGLGASVWTADRDRGQ
FT                   AVGQRIDAGCVYINQLVKSDPRVPFGGIGKSGYGRELAEAGITEFTNRKTLWVE"
FT   mobile_element  complement(join(518469..518488,518597..518629))
FT                   /mobile_element_type="insertion sequence:HqIRS56"
FT                   /locus_tag="HQ_HqIRS56V"
FT   mobile_element  complement(518489..518596)
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AH"
FT   CDS_pept        519003..520460
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1419A"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: TrkA domain protein (nonfunctional)"
FT                   /note="gene: pchA3"
FT   CDS_pept        520602..520947
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1419B"
FT                   /note="product: ISH7-type transposase (nonfunctional)"
FT                   /note="gene is interrupted (frameshift,in-frame stop) and
FT                   is truncated at the N-terminus"
FT   CDS_pept        521230..522147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rio2"
FT                   /gene_synonym="pkn1"
FT                   /locus_tag="HQ_1420A"
FT                   /product="RIO-type serine/threonine protein kinase Rio2"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1420A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51548"
FT                   /db_xref="GOA:Q18KA3"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KA3"
FT                   /protein_id="CAJ51548.1"
FT                   /translation="MVRNVAGVMTELEPEDFYLLSGVEQGMRFSEWVNRGKLPQLSGLS
FT                   PEEVGYRLDRCATRELIERKTIQYEGYTLKAEGYDALALRTFSKRETVDGVGAPLGVGK
FT                   ESDVLEVKSYKPLALKFHREGYTNFREVMRERDYTADNEHVSWLYTARKAAEREYEVLE
FT                   ALYPDVSVPQPIDQNRHAIVMDKFESVELNRAQLPQQQAVGVLELILREMQCAYENGYV
FT                   HADMSEYNVAVSEDGVTVFDWPQAVSTDHENAHERLCRDISNLLTYFERKYPNSTDRID
FT                   AESDAVRIANSIAAGQFESVDAIP"
FT   mobile_element  522675..522726
FT                   /mobile_element_type="insertion sequence:HqIRS46"
FT                   /locus_tag="HQ_HqIRS46E"
FT   CDS_pept        complement(523070..524122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1421A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate sulfate/thiosulfate/molybdate)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1421A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51549"
FT                   /db_xref="GOA:Q18KA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KA2"
FT                   /protein_id="CAJ51549.1"
FT                   /translation="MTLTLTDITTTYEDFTLGPLSLVVDNEVLAVLGPSGSGKTTILSS
FT                   VAGIVQPDTGSIYLNERSLIDCPIEHRDIGVVFQDGALFPHMTAYENIAYAATTPEHID
FT                   KYTTLLDIAQILDRKPAALSGGERQRVALARTLAADPSALLLDEPLSSLDTPIRRRLRG
FT                   DLRALFQTLDIPVIYVTHDQQTATALGDRLAIVQAGMIKQIGTPQMIRNAPNSAFVARF
FT                   TGNENLFTATVTDHNEHGAIIRIGEQTVQTTVTWTGDDCVTASVHPARIQVGSQLMNDL
FT                   TDPSHSFTGTVVQQLTEGSMTRVTIAVQTADIALTATVHPPMTHQLSLIPDETVEITFS
FT                   STAVHLFARE"
FT   CDS_pept        complement(524119..524934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1422A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate sulfate/thiosulfate/molybdate)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1422A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51550"
FT                   /db_xref="GOA:Q18KA1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KA1"
FT                   /protein_id="CAJ51550.1"
FT                   /translation="MPPSQTNTTSKLSSLQRDWLSIALSLGGVLLLYYSIPLVSLLLSV
FT                   QPTTIFAELANPAVQRAIVTSVFGASLSTFLATVLGLPLAYWLARRKTIWQQVTLGFVV
FT                   LPLVLPPTVSGVVLLTVIGPTTLLGDVASVSGISLTRSLAGVVLAQTFVASPFVVVTAK
FT                   AAIERVDETLEHASRALGKSRLQTTHKITLPLAGPGILAGVTLAFARAMGEFGATMMLA
FT                   YYPRTMPVQIWVSFVSAGVERAYPVAIILLAVALISLIVLHTIAHNPWT"
FT   CDS_pept        complement(525089..526177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1423A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   sulfate/thiosulfate/molybdate)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1423A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51551"
FT                   /db_xref="UniProtKB/TrEMBL:Q18KA0"
FT                   /protein_id="CAJ51551.1"
FT                   /translation="MSQDAPTSRRGFLGMITGGLTTTVAGCTASDDSIITGWTQNTPSA
FT                   VKSETITSDTASSITSPTIAILAAGSLQYAIENGLRSSLEVPIQVESHGSATVARLIAD
FT                   GQRDPDIVTVADTALFDQPLSPRWHSIFTSNAIVLAYNPDTAGGRRLAAADAWYEPLLN
FT                   ETIRFGRTDPDQDPLGYRTLFMLELASRYYDDASRLIPAFKNRNNIYPETGLISRFETG
FT                   SIDAAVTYRNMAIERDYAYVDLPDQINLSNPQYVDSWYSTVSYTLPSGQTINGNIINYG
FT                   STIRHMSKAAVAVFNIHTTGQYLTDAGFIQRAQFPQYVGDVPVTVEQAIPSNATSTNGE
FT                   SPAKSSLGSLTNVEIDSLRILR"
FT   CDS_pept        526579..527169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl15e"
FT                   /locus_tag="HQ_1424A"
FT                   /product="50S ribosomal protein L15e"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1424A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51552"
FT                   /db_xref="GOA:Q18K99"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR020925"
FT                   /db_xref="InterPro:IPR020926"
FT                   /db_xref="InterPro:IPR024794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18K99"
FT                   /protein_id="CAJ51552.1"
FT                   /translation="MARSFYSHIKEAWKQPGDGKLAELQWQRKQEWRDQGAIVRIDRPT
FT                   RLDKARELGYKAKQGVIIARVAVRKGGARKKRFTSGRRSKRQGVNRLGRRTSIQRIAEE
FT                   RAARKYPNLRTLASYWVGEDGSQKWHEIILIDPEHAAIENDDDLNWICDDTHKGRAFRG
FT                   LTNAGRSNRGLQNRGKGAEHTRPSAGSGSRRGK"
FT   CDS_pept        527238..528125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubaA"
FT                   /gene_synonym="moeB"
FT                   /locus_tag="HQ_1425A"
FT                   /product="SAMP-activating enzyme E1"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1425A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51553"
FT                   /db_xref="GOA:Q18K98"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K98"
FT                   /protein_id="CAJ51553.1"
FT                   /translation="MSPPPAPRPNDGSESTSNSDESTRVPGGLSLDSTQLDRYSRHIIM
FT                   DELGPEGQAQLLNADVLIVGAGGLGSPVIQYLAAAGVGTIGIVDDDIVERSNLQRQVIH
FT                   RDEDVGDSKVDSAARFITDLNPDITVVTHRTRIDKQSISEVIPGYDMVVDASDNFPTRY
FT                   LLNDFCQLQKIPIAHGAIYKFEGQLTTLIPDGPCYRCLFPEAPEPGTIPDCAATGVLGA
FT                   LPGTVGCLQATEAMKVILNAGNPLTGKLIFYDALEATFEQISYQPDPTCPVCGDTPIQS
FT                   IESVEYTGSCEVSE"
FT   CDS_pept        complement(528292..529248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA2"
FT                   /locus_tag="HQ_1426A"
FT                   /product="prenyltransferase (homolog to
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase)"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1426A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51554"
FT                   /db_xref="GOA:Q18K97"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K97"
FT                   /protein_id="CAJ51554.1"
FT                   /translation="MCRVALIHRSLMNSMAAVAQYIGQLRPLLSVSRPPFLALPVTLIT
FT                   LGAAASVANTGFISVVRTGIALIGLISLHVSVNALNEAADYESGIDKRTDATPFSGGSK
FT                   TLPAGNVDPTTVYRFGYLTAAVGAIIGVWFLVIIGPILVPIYIVGGASVLAYTEYLTKF
FT                   GLGEVAAGLGLGGLPVIGAALVQSGEISSIELLAAVPAFILTFNLLLLNEFPDISPDRY
FT                   GGRANLIHRLGRVWGGRLYAVATVSVPIIIIIGVISNVFPRTALLALLGIVAAFRPVIW
FT                   SIQTPKQRPPMAVLRNNVIFILSTNVLLAIGLILPII"
FT   CDS_pept        complement(529272..529787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1427A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1427A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51555"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K96"
FT                   /protein_id="CAJ51555.1"
FT                   /translation="MHDTAGPDPTAPTDVMRDAILSEDNEYRYRLDRTWDSKAPTMAFV
FT                   LVNPSQADAEKDDRTTTRCMTYANGMGFGRVIIGNLFAIRSTDPTVIKSHPAPVGPRND
FT                   QYLRDICYESDRIVAGWGIHGTIDGRGHEITAALDVNWYAITTTIDGHPAHPSRTPYDT
FT                   TLQRFSYD"
FT   mobile_element  529828..530440
FT                   /mobile_element_type="transposon:HqIRS86"
FT                   /locus_tag="HQ_HqIRS86B"
FT   CDS_pept        530038..530440
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1427B"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene is interrupted (frameshift,in-frame stop) and
FT                   is truncated at the C-terminus"
FT   CDS_pept        complement(530508..530639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1427C"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1427C"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97808"
FT                   /db_xref="UniProtKB/TrEMBL:J7SBM2"
FT                   /protein_id="CCL97808.1"
FT                   /translation="MSTSTDKESAETENRPEFSGCVFCYSAEWAYYGAKKGIKAIRQ"
FT   CDS_pept        530887..531108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1428A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1428A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51556"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K95"
FT                   /protein_id="CAJ51556.1"
FT                   /translation="MDGSGGNIALSERQKEAWKLVEHENMSYGVAAEMMGITKDTLEKH
FT                   LIACRQRKQDWQHTIEWMNGNSSNTEHE"
FT   CDS_pept        complement(531123..531458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1429A"
FT                   /product="DUF1486 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1429A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51557"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K94"
FT                   /protein_id="CAJ51557.1"
FT                   /translation="MTLSSRQIEATRAYYQSIDQDNYTKLTSLLTPEFTHQRSDQTLAG
FT                   REQFVQFMRDERPVTDTTHVVESIYTDNNEVAVRGRLVQDGELLFEFVDIFSFDEDSMS
FT                   GLQTYTQ"
FT   CDS_pept        complement(531620..532039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1430A"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1430A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51558"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K93"
FT                   /protein_id="CAJ51558.1"
FT                   /translation="MTELRVKDVMTTPMLTLEAETLVSEAADAMRKATIKSVVVVSDGC
FT                   QPAGIFTSTDALSVIADGVPTDETTVKEYMTTGVETVSPDVALAAAAEQMHEGGYSHLP
FT                   VADADGDGVGILTKTDIAEVISDPVIDDAISTVNE"
FT   CDS_pept        532392..533501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1431A"
FT                   /product="ABC-type transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1431A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51559"
FT                   /db_xref="GOA:Q18K92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K92"
FT                   /protein_id="CAJ51559.1"
FT                   /translation="MDAQTVVELSGLTKRYGDVTAVHDLSFSVQRGEFFSILGPSGCGK
FT                   STTLRTIAGFENASEGTIKIDGEDITGTPAHQRETGMVFQNYALFPHKSVGENIGFGLK
FT                   MDSVPKPEREDRVAEILATVDLDGFEQRMPNELSGGQQQRVALARALIIQPSVLLLDEP
FT                   LAALDLQLRQNMRFELQQIQDRLDITTIYVTHDQEEALSMSDRILVLDGGTAQQIDTPR
FT                   ELYNNPRNRFVADFIGEANILQTRFKSSTHDTIELEPEFSSMNTVSLEKNGLDTDAFSK
FT                   GEQIYLNIRPEDIMIRPPDEDLTNGLTAKITNKTFIGKTTQFVATVGNNQEILAEATGL
FT                   AAQQSIATGDTVSLTWSRDDCTIIGEHRE"
FT   CDS_pept        533498..534439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1432A"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1432A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51560"
FT                   /db_xref="GOA:Q18K91"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K91"
FT                   /protein_id="CAJ51560.1"
FT                   /translation="MSSVEPRQWVTDLYMLISDPIETWFDQQKSYIPLLQLAPGLIWVL
FT                   GLLGSSVGIILMYSFLESAPLSAETPVITIANYQTVFATTYYLTVLLRSLLIAVTVTMI
FT                   SLLIAYPAAYHIAFMNSRFRNLYLLMLILPFWINLIIRTFAWQLILGQSGLINYVLVSL
FT                   VGIFETPLQLLYSPWAVIIGLVHVFMPFAVIPVYTSIQRIDHSHIEAARNLGANRLQTF
FT                   YEVTFPQTLPGIAASSVIVFVLSFGSFVIPNMLGGQGNLMIGNIIAQLFGESFDWALGS
FT                   AMATLFIITVIILVYIFNRIIGLRSLYGSDAA"
FT   CDS_pept        534436..535287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1433A"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1433A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51561"
FT                   /db_xref="GOA:Q18K90"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K90"
FT                   /protein_id="CAJ51561.1"
FT                   /translation="MSRITQLLGRVSFSSKTGSKILRFETIALFIFLYLPILVVIILSF
FT                   SADSVPSFPISGLSIEWYLALIPIGRTFDAQLIRAFLMSVQIGIIAAIGSAVIGTAAAI
FT                   GMVRNEYARWLFDVDTLNTLFITPMMVPWVVTGIAVLSLYSMVNIAGSFISLILGHILI
FT                   TLPFMIVVVAGQLYGFDRSLEDAARNLGAGPLRTFYEVTLPIISPGVIAGMMFAFTISF
FT                   DNFTQTFFWTSSTLNTLPVVIFSRINFSLTPVVNAMGTVIVGVSLTMAFLAERLSSRVI
FT                   TD"
FT   CDS_pept        535334..536455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1434A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1434A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51562"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K89"
FT                   /protein_id="CAJ51562.1"
FT                   /translation="MSNNQSQAQTTSTSRRRFLQSTAAVSTVTGLAGCITGSSTGSQAN
FT                   SLTFMQWSGEFGETAERVLKEPFEEEFDVTINQVPLPSPSDMLSKLQAGSADFDLVSHW
FT                   DYTLYRGVQNDLFQEIPLGEVPNVRDRVRDQFNPTSVQYDPGNEPHHAPYSVSGWGMTY
FT                   NSNAMDEPSSWQALLTDEMQDNVSLASWMSCWLGVAAKRAGVPFAEIPNRMDEIWAAIG
FT                   EFDDASQTWWGTGQEMERLLTNESVLAGSFWFARTYRLRVDNDVPVRYTVPEEGAPAWI
FT                   ETYTIPNGVDESKKQLALEFIDYINREEVQERFGRELRYAVPYDFNDIPSDHIYNDHPE
FT                   LPLLNTERLEPMLQNIYNSNYNDYTNEFQQRTG"
FT   tRNA            complement(536732..536804)
FT                   /gene="tRNAArg1"
FT                   /locus_tag="HQ_TRNA11"
FT                   /product="tRNA-Arg"
FT                   /note="anticodon GCG"
FT   mobile_element  536889..536909
FT                   /mobile_element_type="insertion sequence:HqIRS35"
FT                   /locus_tag="HQ_HqIRS35BR"
FT   mobile_element  complement(537205..537402)
FT                   /mobile_element_type="transposon:HqIRS86"
FT                   /locus_tag="HQ_HqIRS86C"
FT   CDS_pept        complement(537205..537402)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1434B"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /db_xref="PSEUDO:CCL97809.1"
FT   CDS_pept        537725..539281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpa2"
FT                   /locus_tag="HQ_1435A"
FT                   /product="replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1435A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51563"
FT                   /db_xref="GOA:Q18K88"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K88"
FT                   /protein_id="CAJ51563.1"
FT                   /translation="MSSLTDIYDELDTDVSREEFESAVEDKVEQMGGLADEETAAKLIA
FT                   HELRNEEVEGVADIEPGMDEAKFLAKVLQIGDCRTFERDGDAEDGRVINIEVADASGQI
FT                   RVTMWDDMADDAIDQLEVGQVLRIGGRPKDGYDDVEIDVDTVEPAPDAEIDVDIHTVNT
FT                   HRVEDLSLGLSDVNLRGRVLSTDKIRTFDRDDGSEGRVANLSVGDPTGRIRVTLWDGSA
FT                   SLVDSVDPDDSIEIVDGYVREQDGALELHVGDRGTIESIDEDVEYVPDTDPIETVVIDE
FT                   TADIAGGVIETDTKRTFDRDDGSKGQVRNVRIRDDTGDIRVALWGDKADLDIDLADYVV
FT                   CTDVEIQEGWQDDHEASAGWRSAVYRLDERPEDATTTVESSSDQQQTETGKASGLDAFA
FT                   ETNSDETTVTASPTSQDSNITSSDSMRDNADHNHEQAASDGGASTIESPQTSEDDNTTD
FT                   SDVESFTGTVVQAGSPVVLDNGTDTRRVETDASLRLGEVVTVTGSTDGQTITPTEIDRS
FT                   S"
FT   CDS_pept        539507..539938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hstA"
FT                   /locus_tag="HQ_1436A"
FT                   /product="archaeal histone"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1436A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51564"
FT                   /db_xref="GOA:Q18K87"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K87"
FT                   /protein_id="CAJ51564.1"
FT                   /translation="MSVELPFAPVDTIIRGKAGELRVSAGAAEELAHRIQTHGATLAVT
FT                   AAEEADTDDRKTLMAADFGVRQVVPRRELELPIAPIDRIARLRIDNQYRVSMDARIALA
FT                   DILEDYANNVADAAAILARHADRRTIQAEDIETYFQLFE"
FT   CDS_pept        539943..540956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hda1"
FT                   /locus_tag="HQ_1437A"
FT                   /product="HdaI-type histone deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1437A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51565"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K86"
FT                   /protein_id="CAJ51565.1"
FT                   /translation="MQFGYSEICLAHDTGNRHPETADRLRAIRRALAKRHGASYIDPKP
FT                   ATDTDIASVHDTEYITEIREFCECGGGNWDPDTVASIDTWDAALASAGLAQWAARVAVN
FT                   GASGRQTPFSVGRPPGHHAVVDDAMGFCFINNAAVAAQTLIDDPSSDVDTAAIFDWDVH
FT                   HGNGTQDIFYDNANVLYVSTHEEGLYPGTGEIEETGTGDAEGTTLNIPLSAGAGDAEYL
FT                   HMINTIIRPVIESFNPDLFIISAGFDAHRHDPISRMRVSTEGYALLTDRVRSLANDVDA
FT                   GLAFVLEGGYGLDTLADGVSIVHETFDGRTPLAHDDEPDEEVKTLADDIRTIHNIA"
FT   CDS_pept        complement(541037..542434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="HQ_1438A"
FT                   /product="tRNA adenylyltransferase, CCA-adding"
FT                   /EC_number="2.7.7.72"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1438A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51566"
FT                   /db_xref="GOA:Q18K85"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR006116"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K85"
FT                   /protein_id="CAJ51566.1"
FT                   /translation="MSKGDAKDGFESEHQMVIEQIRDRIDPDSAEREAMQRVMSQLRNR
FT                   ITTEVESFPVSADVVQVGSTARGTWLAGDRDIDIFVRFPTELNREALEEYGLKVGSSVL
FT                   PSGHEEYAEHPYITGTFEGFEVDLVPCYDVDAGSELQSAVDRTPHHNQYLQTRIDERIA
FT                   AAVRVLKKFLKGIGAYGSDLRTRGFSGYLTELLVIEYGDFEAVLKAAARWQPPVEIDPE
FT                   AHGTAAHDDPLIVVDPTDPARNVAAVCSATNISRFQHYARQFLEEPKQTYFESPTEMAA
FT                   EMDIETVRTHLQRRGTSPMALVFDSPDIVDDQLYPQLRKSVQGIRTALETEGFDVIRTA
FT                   AFADDQAVLFIELMHRHCPAIERHTGPPITVREHASEFYTAYETDADTYGPFIDGDRYV
FT                   VERERTWTDAAAFLQSESIFNAGLGAQIEEALADTYTVLVEDEIIALTSEFGESLTQYF
FT                   EPTASGV"
FT   tRNA            542584..542656
FT                   /gene="tRNAAsn"
FT                   /locus_tag="HQ_TRNA12"
FT                   /product="tRNA-Asn"
FT                   /note="anticodon GTT"
FT   mobile_element  542699..542751
FT                   /mobile_element_type="insertion sequence:HqIRS47"
FT                   /locus_tag="HQ_HqIRS47C"
FT   tRNA            542881..542955
FT                   /gene="tRNAIle1"
FT                   /locus_tag="HQ_TRNA13"
FT                   /product="tRNA-Ile"
FT                   /note="anticodon CAT, wobble-base C modified to agmatine
FT                   and codon read as TAT; the modification thus changes
FT                   decoding from Met to Ile"
FT   mobile_element  complement(542966..543130)
FT                   /mobile_element_type="insertion sequence:HqIRS36"
FT                   /locus_tag="HQ_HqIRS36A"
FT   CDS_pept        complement(543445..543999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1439A"
FT                   /product="DUF457 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1439A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51567"
FT                   /db_xref="GOA:Q18K84"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K84"
FT                   /protein_id="CAJ51567.1"
FT                   /translation="MHREGHYGTTLLVGAGCVLGLGIVTGMIATAVMMMYARIPDQDQY
FT                   IPESIISHRGPTHSIVFTLTLAFISASTITYPFHFGQQLAVEHNLITTVLIVPSTVWAF
FT                   FAGVVAISLFTHIITDTLTKGGGFRVKPLWPVSSWGPALGLCTADDERWNAALLASGVT
FT                   AFVATILHELYYSVLPSFAGF"
FT   mobile_element  join(544171..544596,544705..544724)
FT                   /mobile_element_type="insertion sequence:HqIRS60"
FT                   /locus_tag="HQ_HqIRS60C"
FT   mobile_element  544597..544704
FT                   /mobile_element_type="insertion sequence:HqIRS42"
FT                   /locus_tag="HQ_HqIRS42AG"
FT   CDS_pept        544876..545106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1440A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1440A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51568"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K83"
FT                   /protein_id="CAJ51568.1"
FT                   /translation="MMIGLAIFAVSVIELWQTNPGFIFRVEAIVEQVTIGAIPGVGYST
FT                   FAEDVTLQIETREVEQLNVNSRETIHEYGYH"
FT   CDS_pept        545235..545501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1441A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1441A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51569"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K82"
FT                   /protein_id="CAJ51569.1"
FT                   /translation="MSDILGAIAGTAVYEKVRIEVQNSRYKITGEYQASEVTYNIPHGC
FT                   LQIERMDVELEQDSVLILNAPDETFIWIDRIEDNVNITRENPI"
FT   mobile_element  complement(545699..545749)
FT                   /mobile_element_type="insertion sequence:HqIRS81"
FT                   /locus_tag="HQ_HqIRS81C"
FT   CDS_pept        546031..547056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1442A"
FT                   /product="TRAP-type transport system periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1442A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51570"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K81"
FT                   /protein_id="CAJ51570.1"
FT                   /translation="MTSDQTRRRFISVVGAAGITGLAGCSGGGDAGDEGSETEADESTE
FT                   AAESTEADSGNENTRLSWHAGGTGGTYFPLSNEFKTVVEDNTDFSLNVQSTGASVENVG
FT                   SLTDGSADFALIQNDIAFFAKNGTGIDAFDGNPIENLRGVATLYPETITVVTLADSNIS
FT                   TLSDLSGKTINTGDLGSGTQVNANQILEAVGITEFTEQNAGFSQASEQLANGDIDAAFV
FT                   VGGWPVGAIEDLATTNDVQIVPIQGENRQTVKGAASWFADDTIPAGTYNGVDEATETIA
FT                   VQAMIATRAGLDAGTVETVTAALFENVDALTIKTEFISTGSAQDGMSIELHEGATAFFE
FT                   N"
FT   CDS_pept        547352..547846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1443A"
FT                   /product="TRAP-type transport system protein small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1443A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51571"
FT                   /db_xref="GOA:Q18K80"
FT                   /db_xref="InterPro:IPR014451"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K80"
FT                   /protein_id="CAJ51571.1"
FT                   /translation="MQHTTNIRFITGLLVIVLLASTIGTSIAPGFVLIIEDIDTDETYI
FT                   RHPVGNGTTFAVEYTHSVEKTRVYDEYQVSGQQFVNTRMEFESYGWGLPATANVTNRNG
FT                   TFVYNPSGPITTMSELLLSPGRIANHTLIVNDERYNLVIQTNANDVRIHIERQSPMERV
FT                   V"
FT   CDS_pept        547843..550551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1444A"
FT                   /product="TRAP-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1444A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51572"
FT                   /db_xref="GOA:Q18K79"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K79"
FT                   /protein_id="CAJ51572.1"
FT                   /translation="MSADTPSDNPRSSTETDNDNVIQSASDTEDTTELIDEIERRRSLT
FT                   GIAAVITAAIGVLFSIFQLLLAAQSFTITLWAPIVGTVNISLQLLQANAIHVTFALVLT
FT                   FLLFPATMGEGFISQTFSRAHTTVVETLGESNPLSKVITHLATVLRWAFLDPNRRRITP
FT                   FDVISIIAAILTTTYFITDFEEIQRMRVFGLESGRPVVEIYPILNPVLGGLPIIGDISY
FT                   ALLLGVIGILLVLEATRRTLGLPLMLIVATFIIYARWGYLISTTTPLLGLLAIPELTWP
FT                   DIIQNLWYNTENGVFGIPVTVSVSFIYIFILFGAFLEMSGAGQWFIDLAYALTGRRKGG
FT                   PAKASILASGFMGTISGSSIANTVTTGAFTIPLMKQSGYSAEFSGAVESSSSSGGQILP
FT                   PVMGAAAFLMVQYTATPFADIIILATIPAVVFFFGVWVMVHLKAVEEGIGGVDAAELIS
FT                   LREHLLDGWYYIIPIALLLFYLIIERLSVSRSAWFTLVSLVALITLVGAYNKDTRGVLT
FT                   LSLAAIIGVELLSHSFAGVSVVEFISGTRANDMPASVAIDTVLPRIGWYIIAASILTLL
FT                   YKPKAVSAHLELNPSVLNTVEDVSSRTNANIGDYQLFRLGAFIFESMEDGARTAVPVVI
FT                   AVAAAGIIPGVISVSGLGPNLTSLLLVLSGGSVVIMLVVTAFASILLGMGMPTTVTYII
FT                   LISMLASPLVEFGIPLLAAHLFILYFGVIADITPPVAVAAYAASGVAKSDPFETGVKAF
FT                   SLSLNKAIVPFAFVLAPGIVLLRKKSNAAELPLRERYRVIEFADLLDLSYAIPEIAIPI
FT                   IGVFIGVVALGVTVIGTLYTEVSTIERIGFATSSLILMSPQLLWTLIIDILTLLGTSLM
FT                   MTGSVIELILRGIGLALFVILATRNRKDAAI"
FT   CDS_pept        550701..552860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phr3"
FT                   /locus_tag="HQ_1445A"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1445A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51573"
FT                   /db_xref="GOA:Q18K78"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K78"
FT                   /protein_id="CAJ51573.1"
FT                   /translation="MSDDAGVDSDITSVPVLSDIPTPTEATTTDTDVDPATAPSDVNGC
FT                   VVWHRKHLRTADHRALADAVADADIICPLFVFDPTFYDNDGLACDARIRFLHEAVDSLN
FT                   QLYENSPTQSITHQASASHDYLAEETPVEPQQIQSITGEYQISADSDSGSDSTSNTPLN
FT                   TNNSESDTIQSSPRASEYSSGLTVGYGDPVDILSHFVDRGWSILTMETPTSRYGKRRDT
FT                   RAQSVCGDALRFISGDGLIRDAEWSRANWKSHITEWLAAEQHTPEWSGDTTQLTIPTGI
FT                   TPSVVEKTHKINPTKKMVPTGTHRAATTQLRAFVDQIGSYPSNISAPQDARTGTSGLSP
FT                   YFNFGLLSIRQVHQYVNNNTPECRGRRMFTSRLIWNCHYNQKLADWAGWTDRAVNPAFE
FT                   EFNADRHNPALVDAWKHGQTGFPMVDASMRCLRETGWLNFRMRAMCVSIFTHILQQPWW
FT                   IGADWFHHHLIDSDVGINYTQWQSQAGLIGKPSQRVYNPRKQVRDHDSDGEWITKWVPE
FT                   LSDLPAQHFPRPERTPLAVQSECNVIIGDDYPRPVVDFDARRETFWSRYERRRPEAARE
FT                   LARPEIAKRASFSGGYDAAQAIAQRYAVDESDDEADNIQLSFSEITTIDTDSDSTGENT
FT                   PAINELNDTTYTVPDSSMTLQESVISIPTGTGDYAGEPSPDDREAVSNAVDLSTTDKTG
FT                   DSSNDNINTDRSTETDEQTTIEGFM"
FT   CDS_pept        552993..553148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1446A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1446A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51574"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K77"
FT                   /protein_id="CAJ51574.1"
FT                   /translation="MLGLRFFACNVCETVMAAPVEPSQCHDCHDEDIAEISEMLQSDAY
FT                   FTRAQN"
FT   CDS_pept        553341..553736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1447A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1447A"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97810"
FT                   /db_xref="GOA:J7SCA6"
FT                   /db_xref="UniProtKB/TrEMBL:J7SCA6"
FT                   /protein_id="CCL97810.1"
FT                   /translation="MDSKYRDGILAVIASGALIGAALILKTESGVNTELTATILTIWPA
FT                   MIGIFGMIAIELICLYNPNRTQAIWSRRSIQFSSVILVIITGGFALVSDIQWIFTALVW
FT                   GLTAYLILLIIVIVLGTNPLLRLVSSR"
FT   CDS_pept        complement(553900..554322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1448A"
FT                   /product="UPF0047 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1448A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51576"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K76"
FT                   /protein_id="CAJ51576.1"
FT                   /translation="MQRSQAQTRFEISTKDQLSVTDITAQVHAAVPDDLTGIITVFVEH
FT                   TTAAIAVNEAEKRLQGDLETALNELIDDTGWRHNEIDGNADSHIRAMLIGASATIPIED
FT                   GELATGTWQSVLLIECDGPRTRTVSVTATPAVNSHT"
FT   CDS_pept        complement(554334..554888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adkA"
FT                   /locus_tag="HQ_1449A"
FT                   /product="adenylate kinase (ATP-AMP
FT                   transphosphorylase),archaeal-type"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1449A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51577"
FT                   /db_xref="GOA:Q18K75"
FT                   /db_xref="InterPro:IPR023477"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K75"
FT                   /protein_id="CAJ51577.1"
FT                   /translation="MSITIIAGVPGVGLSTLVRTARRQLTDEYQLINFGDVMLEQAAMD
FT                   DLATSRAELGKLERRETLRLQRRASEYVADATQEMAVLLTTHLAVRTDAGYLPGLPDDV
FT                   LRELAPDQFVLVEAQVGTIQTRREKSERTYGSTSDVTIEFEQDLNRTAGMQYASSVNVP
FT                   IHLVENEDDVNEAATELIKMI"
FT   CDS_pept        complement(554901..555191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1450A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1450A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51578"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K74"
FT                   /protein_id="CAJ51578.1"
FT                   /translation="MRLPETRDLFVRELEFPTSCETVIELIGEQELEAPNGDDESIEAI
FT                   LGRSGVEQFTHADELYDTLLTCVGDAFIGRKYYDDRSGISSNTDDDEIVHF"
FT   CDS_pept        555911..557719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1451A"
FT                   /product="FNT family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1451A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51579"
FT                   /db_xref="GOA:Q18K73"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K73"
FT                   /protein_id="CAJ51579.1"
FT                   /translation="MADSRPTAQSQVDNETDDGIPKQGEVVPERFSSDEVFQRIVADAD
FT                   HEVTSSVRELFFSALAAGFAITITFLVYASMSATTETPLVAALLYPLGFIYIIIGGYQL
FT                   YTENTLPPVALTFERLSSVPTLLRHWSIVLIGNFLGGGIGALALAYGGVFSPEATSVAV
FT                   DIAQKGISTPPEQLFFKAAFAGFIVAGVVWLDFAAQETISRLFVVYIAFLAIPLGDLFH
FT                   VVVSFTEAVFLIAHGGVGVIAGFGGFVLPVLLGNTIGGVLLVTVVNYYQTSERRLEIDQ
FT                   FTNVRRLSSREMLLGNVAGRSYVPVIDTLENFTRDPDSFRVLVPIANPRTETELVELAA
FT                   RLASARDNGRVHVVHVIQADKNLVLDHEHDRRDEITAQSEQLLDGIESIVDQRNASFES
FT                   STIVSPRSFEEIFDFAARTRPDMVVMGWGEEKLWNSARAERPIDELTNRLPCDFLIAND
FT                   RGLDCSDVLLPTVGGPDAALAAETAHALQETGKSTLSLLTVVDNPDERAAGEQFLDDWA
FT                   ETHDISDAERIVDVTGDVEAAIEREAKESTMVMLGATEQGLLSRLLSNSLHMQVVNKVD
FT                   ASVVLAERPHERSLTQRLIGSGRRDQ"
FT   CDS_pept        557832..558272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1452A"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1452A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51580"
FT                   /db_xref="GOA:Q18K72"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K72"
FT                   /protein_id="CAJ51580.1"
FT                   /translation="MAQRRPRRPWVVLLLGMLATGLGHIYLRRWARGIGWFAATIAVSA
FT                   LFIPPEAIQTIWSANSDISTFAPAIGVALASVADAYVLARNDQRSWDDPSTAGSLPDSD
FT                   TGDGPPSCPNCSRDLDTDIDFCPWCTTKLPSDIETDANSNIE"
FT   CDS_pept        complement(558279..559103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1453A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1453A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51581"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K71"
FT                   /protein_id="CAJ51581.1"
FT                   /translation="MGLTTTARYRVLGYPHEPTQLVLIACDETDEELQDSSVNADAHET
FT                   DTDDNNMMIDEETSQHNANAVSIDKFEPVYIDISAHDTAIQSAVDTLAAGYLIEATLKW
FT                   TADGPQIAAVDIIAETEFIFYEDITGIFEAATSTWNNAVAEGEGMGSRLTRGTDAKPNG
FT                   ALYVFAKQQGARNLIREFQTGITPLEPLIRRIDEEEAASVSVPPESTQPRAVFILEPAT
FT                   KSFVIVYVVFRRDGMLAGTLHSTYGEDANGGANNHDRSKTAPSGPLRFDQSK"
FT   CDS_pept        559305..559793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1454A"
FT                   /product="PsiE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1454A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51582"
FT                   /db_xref="GOA:Q18K70"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K70"
FT                   /protein_id="CAJ51582.1"
FT                   /translation="MSVDAWASRSEGVMQWLELGAAYFLVVLFAIGVFDLGISLYELIN
FT                   SGAFTDPNSLIDLIDTVLVLLIIVEVFETVVASSRREPVVRIVINAALIAIARKVISYR
FT                   PSEYESVQQAFIAAASFTLLLVSLIGALYAIRRITSLGIDKANRDMKTPEASKYRSEE"
FT   CDS_pept        complement(559871..560863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="HQ_1455A"
FT                   /product="2-keto-3-deoxygluconate kinase"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1455A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51583"
FT                   /db_xref="GOA:Q18K69"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K69"
FT                   /protein_id="CAJ51583.2"
FT                   /translation="MDTALDIVTIGETMLRLSPPPGVRITQANEFDVHVGGAESNVAAV
FT                   ASQLGCQTGWISKLPASPLGRRITTALQSYDVELDIIWDHDDDGRVGTYYFEPGGKPRG
FT                   DTVQYDRAGSSVTTLTTAEISLEMIKSASICYVSGITPALSETLQTTVETVLQIAQSAG
FT                   TKTAFDLNYRSKLWNTTMAKNAYQSLLPDVDILIGAERDVNTCLDRSADPESIVRDLAS
FT                   TFNLETVILTRGKNGVVALSNDTVFEQPVYDAKTIDAVGTGDAFVGGFLTQKLNDGHNG
FT                   TTCSSIEHALATGAATAALKRTIKGDIAAITPAEVAAVRDTDTTEGISR"
FT   CDS_pept        complement(560981..563299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL1"
FT                   /locus_tag="HQ_1456A"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1456A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51584"
FT                   /db_xref="GOA:Q18K68"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K68"
FT                   /protein_id="CAJ51584.1"
FT                   /translation="MSSNENAITALDTETVRQIAAGEVVERPASVVKELIENSLDADAT
FT                   RISVAVESGGADGIRIRDDGIGMDEDAVQRAIKEHTTSKIDDINDLASGVGTLGFRGEA
FT                   LYTISAVSKMTIRTKPRDGNRGTELHIEGGTVVDVEAAGCPEGTVVEIRDLFFNTPARR
FT                   KFLKTTATEFDHINTVVTHYALANPDVAITLEHNDREVFATTGRGNLESAVLSVYGREV
FT                   AESMISITTGDIESDRITAIEGLISHPEKTRSTRQYLSTFINGRYVEARALREAIINAY
FT                   GDQLAANRYPFALLFLDIDPGSIDVNVHPRKMEVRFDNETGVRDAVTNAIREALLSAGL
FT                   IRSRAPRGQSAPAETEITQSSPDVTTKSANDDTNVDNNEITETSVHTSAEKSEPDNNIK
FT                   KTTQAQSDAEDERTDITESDVGDKNQQGETSIDSSRDTTVEGADVDSETARHVDPRSDA
FT                   AWTVDNNRRSEDADIDSSINQQSSQSSETIGASTPNATADTTVQSQSKSTEDVDNGHKD
FT                   AGEECDAVVSGNNHNKNQSKKADPNDSVNEQSVQHDLGGDVATLEPTVESLPSLRILGQ
FT                   IDETYIIAESDDGLVLIDQHAADERINYEQLQATLAETVTTQALAEPVKIELTAGESAQ
FT                   VEEYADALERVGFRVTDGDGDNIVVTAVPAAFASALDPALVRDVLAETAESLNSHDRSE
FT                   TIKTLTDDILADLACYPSLTGNTALTEGSTVNLLEQLDTCENPYACPHGRPVLIEFDRT
FT                   ELDARFERDYPGHKDRRLE"
FT   CDS_pept        complement(563296..563814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1457A"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1457A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51585"
FT                   /db_xref="GOA:Q18K67"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K67"
FT                   /protein_id="CAJ51585.1"
FT                   /translation="MTEDHLEATVSLRGVIVAPDKEVLIMARSSDGEWELPGGRLGRHE
FT                   DAVDGVHREITEETGLDATIGQPVHAVAWRNDDDCGRFAVYYDCTVNSKEVQLSHEHTD
FT                   ATWLSPTAAKDQVSEAQRTAINIVATGQGQCTAISTEESRSVDSPAESESSIESDPEAD
FT                   IGPEPERSS"
FT   CDS_pept        complement(564232..565116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1458A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1458A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51586"
FT                   /db_xref="GOA:Q18K66"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K66"
FT                   /protein_id="CAJ51586.1"
FT                   /translation="MSSEQQGPAQQLMDEGAGPNFAAFLLTVGGVTVLFIAIFIFAFPG
FT                   TIGRFFAAAVVTVTIITLMLGMVLDLLGYFGSRASILVESEEEQTAGGVPDSVSRKPNK
FT                   PLPKQINFDSEIKTLQEYFDGELPSQMNSFLTEYEQLKKSTSNRKVTAGSLRAALNPVQ
FT                   TIVDDSEMEELVEDMGDRLFRYIKSDPVDNIVVSEYAFYQDGNQKSVEALQAEKARIRA
FT                   TVHNQGEGAKAEVAVQFKNTDDVPVKTAYLPVGNLVPEGRKDLDTNVYIPSLATEADVF
FT                   VIRATPDTEVLTM"
FT   CDS_pept        complement(565113..565346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1459A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1459A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51587"
FT                   /db_xref="GOA:Q18K65"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K65"
FT                   /protein_id="CAJ51587.2"
FT                   /translation="MKSMFTNIDPLTKIQYGLMVVFGTLTAAVSFAPLGMELRIMGAGT
FT                   LFGVTVGLWLSHLLTMTYTATQTLRQGAGSNA"
FT   CDS_pept        565469..565543
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1459B"
FT                   /note="gene truncated at the C-terminus"
FT                   /note="product: uncharacterized protein (nonfunctional)"
FT   CDS_pept        complement(565843..568638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS1"
FT                   /locus_tag="HQ_1460A"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1460A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51588"
FT                   /db_xref="GOA:Q18K64"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K64"
FT                   /protein_id="CAJ51588.1"
FT                   /translation="MTSQGIVDEFFSLRAETDADLLTMQCGDFYEFFAEDAELVSAELD
FT                   LTVSEKSSHGSSYPMAGVPIDDLTPYLKSLVERGYRVAVADQYEADDGDHYRRISRVVT
FT                   PGTLLSTDDADARYIAAVVGDLTATETTETTIGIAFAEVTTGSFFIGDVADAETAYAEL
FT                   TRFDPVEILPGPTVRNADEFIRRLRDGTDATVSSFETAAFALGRARHILSEQFGTTAID
FT                   SLNIETDVAIQAAGAILTYIDETDTGVRAAITRLQPLDSDTHLALDTTTRRNLELTETM
FT                   HGDRGGDGTLLGTIDHTATSAGHRQLREWIMRPQREQTEITRRLDCIEALVDAPLARER
FT                   IAETLNGSYDLERLAARCISERADATDLLRIRETLEILPTLDEVITESILSESPLMQVV
FT                   TRPTEDTVKVVRDELTAALVDEPPKTIRDGGLFQYGYDAELDSLRERHETAQEWMDKLA
FT                   QRETETHNLNHLSVDRNKTDGHYIQVGKSVADQVPEHYREIKTLKNSKRFKTDELAERE
FT                   RDILRLEESRGEMEYELFCELREQIADYAAMLQTVGQVIAEIDALHSLATHAVENDWTR
FT                   PTLRADHTVDIEAGRHPVVEQTTEFVPNDLQLEDERNFLLVTGPNMSGKSTYLRQVALI
FT                   TLLAHAGSFVPAAAATIGAVDGIYTRVGALDELAQGRSTFMVEMQELSKILHSASSESL
FT                   VILDEVGRGTATYDGISIAWAATEYLSAAQSTAPSPRVLFATHYHELTTLADRIAGVSN
FT                   VHVAAEERNGDVTFLRTVESGPADRSYGIHVAELAGVPDPVLTRARDVLSTLRADEAIE
FT                   VETQNHADTSKRDQEENMTGGDKSAETTQQVVFDVNSGDIRVAEAGENTENQTTPTSDN
FT                   RKLKNNRATSESPEHARVDSDTKEVINELQSLDIESTAPVTLLQTVEQWQKQLTDADNE
FT                   E"
FT   CDS_pept        complement(568952..569698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1461A"
FT                   /product="probable oxidoreductase (short-chain
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1461A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51589"
FT                   /db_xref="GOA:Q18K63"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K63"
FT                   /protein_id="CAJ51589.2"
FT                   /translation="MADINLTPTLDGRTALVTGSAKRVGREVLLALADAGADVAVHYRQ
FT                   SGEAAAATAETAREYDVAATTVQADVTVPDEVDTMIARCEAELDTIDILVNAVGPLPQG
FT                   RWDELSLAEWRRTIEGCLYGTYLCTQAVLPTMRDTHWGRIINFGVADARDDRAVPMNFP
FT                   YFAAKKAVLLFTRTVAYDTQDNGITVNAVSPFAVENTVVDVSGYPRGRPARFNDVIAPI
FT                   LFFCTDAAEYISGQNIAIDGGRLQEA"
FT   mobile_element  569761..570271
FT                   /mobile_element_type="insertion sequence:HqIRS58"
FT                   /locus_tag="HQ_HqIRS58C"
FT   CDS_pept        570491..571312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1462A"
FT                   /product="AstE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1462A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51590"
FT                   /db_xref="GOA:Q18K62"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K62"
FT                   /protein_id="CAJ51590.2"
FT                   /translation="MRTEILGPMDVDDAPDIAVIGGIHGDEPCGVQAIERFCSGALIDA
FT                   IQRPVKLIIANERALEANMRYIEGDLNRLFPGDPESELYEERLAFDLYQEIKDCTTLGF
FT                   HSTISFDQPFGTFANLTPQKATIMQALPLEHAADFSGHVTGRGVNLSEFVNVEAGYQGS
FT                   EAAVENAYACLIAYLRVMDALPAEADITPTTHYQVQHTIEKIPNEIYDVHVNNFEQVSP
FT                   GMEYATTGTGKSLLADSAFWPVLMSSHGHDTLLGYAAKRTGEISATVTDSD"
FT   CDS_pept        571697..572497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1463A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1463A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51591"
FT                   /db_xref="GOA:Q18K61"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K61"
FT                   /protein_id="CAJ51591.1"
FT                   /translation="MISVPMWILTGVIAVCARAVMSPYQKRLLADASESEVLFVRDTVA
FT                   LGLFLPVVGWTAIKYGFSGTPRSAVAMVLTGALNVIGAFMIFAALSREDASVVIPLTSL
FT                   SPVITSLVEPLLRDTAITPLVIAGAVLSACGAAVVNSKQNTIQSILYGSDTTAVALAVS
FT                   VNFVFGVTSTLDGIATASINPLYVSSIIVLFVGIGSAGRLWRAGAVHEPSQRRQLLALY
FT                   KGDKGILGILQFGGLAATLFTFGAAPSATQASILFRASIILVSL"
FT   CDS_pept        572705..573910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="HQ_1464A"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /EC_number="2.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1464A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51592"
FT                   /db_xref="GOA:Q18K60"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18K60"
FT                   /protein_id="CAJ51592.1"
FT                   /translation="MSPAHGNRLGTPESPNATTLLLLGSGELGKEVVLAAQRLGIETVA
FT                   VDRYEHAPAMQVAHRDYIIDMTDATALREVVQQEDPTIIIPEIEAIATDELKRLETQGY
FT                   DVVPTAQATRLTMDREWIREFAAEEVGVTTNEYAFADNYDTYRKAVEDIGIPVVVKPTM
FT                   SSSGKGQSIVRESAEINGAWETARAGSRSDTGRVIIEELVEFDSEFTLLTVRHADGTTF
FT                   CPPVGHTQQDGDYRTSWQPHSLTTEQRTTAQQMAQKVTDGLGGYGIFGVEFFVQDGTVI
FT                   FSELSPRPHDTGLVTLSSQRLSQFDLHLRAILGLPIPDIDVERPGASAALVVDEPLTRP
FT                   AFTGVDEALSMSDVDIRLFGKPEAYPGRRMGAAVATAIDIETAQERASEAVDCIHVSDD
FT                   KT"
FT   CDS_pept        complement(574031..575725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB2"
FT                   /locus_tag="HQ_1465A"
FT                   /product="probable NAD kinase / phosphatase (homolog to
FT                   bifunctional inositol monophosphatase / fructose
FT                   1,6-bisphosphate)"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1465A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51593"
FT                   /db_xref="GOA:Q18K59"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K59"
FT                   /protein_id="CAJ51593.1"
FT                   /translation="MHGRRLATLDEIVGLAAPESAKIIDMVESWAKSNDIGLTVLDVGE
FT                   DITDEHIEREKTTLGISIGGDGTFLEAARSFAPFQIPLMGINSGTLAFLARVEPLDVED
FT                   ALTAVYRGRASINARQQYEVTAGDINTTGINEMFLQKHPPEDRYGTKVGSLHVFVDKEY
FT                   VGKYFGSGLIVSTPTGSTGRAYSNGGPVHYPQNNRTLQIIPHETISAAVDPIVVSQDSE
FT                   IDIVLDSDFDIDIDGGRQFERLESDTVVHISGANQPVQTVRTPYDDAFISAMVDKLDWG
FT                   LRTVDNDGPRSALEDNITSSDFKERAARVAREAARSAGEPLQELHGQVENIQYKTDKSD
FT                   IVTEADYQANDIIETAINSEFPDHIVQSEENDQTVPTEGYAWIIDPLDGTGNFAHGNPN
FT                   YSISIALLKDRIPVVGVVYAPEPADMFYAIDGRGAYQNDHKIEPTSRSQLDESMLLSGY
FT                   DPSGEFLQAFYHETQGVRRLGSAALNLAYVASGSADAVWEHDTHPWDVAAGLCLLREVG
FT                   GRTTDQYGSSYELSFNATDQRTPLLASNGSVHEQLISHIDTSDLMSE"
FT   CDS_pept        575978..576379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ridA2"
FT                   /locus_tag="HQ_1466A"
FT                   /product="enamine/imine deaminase"
FT                   /EC_number="3.5.99.10"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1466A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51594"
FT                   /db_xref="GOA:Q18K58"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K58"
FT                   /protein_id="CAJ51594.1"
FT                   /translation="MERQRASTGTEWEAQNGYSRALRAGNTIYIAGTTAVDLDGNVVAE
FT                   GDPYAQTQHILDIIADALADVGANLDDVVRTRMYITDIAHQDAVGRAHGEIFADIRPAA
FT                   TMLQIEGLAEPELLVEIEAEAKLEDINGS"
FT   mobile_element  576727..577301
FT                   /mobile_element_type="insertion sequence:HqIRS71"
FT                   /locus_tag="HQ_HqIRS71D"
FT   CDS_pept        577053..577232
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1466B"
FT                   /note="the underlying mobile genetic element is noncoding
FT                   but has a region of high similarity to the C-terminal
FT                   region of transposons with an IS1341-type transposase gene"
FT                   /note="pseudocoding frame (HqIRS71 element)
FT                   (nonfunctional)"
FT   CDS_pept        complement(577298..578530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1467A"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1467A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51595"
FT                   /db_xref="GOA:Q18K57"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K57"
FT                   /protein_id="CAJ51595.1"
FT                   /translation="MEVFESTEKTSIIFWRVVTIATGWLVLLFVGSYLITPASILTVVM
FT                   NDLDITEATAAALVSMPQVTATVVGIPVGLYLDRVQTRGVVPAAAVVLLIGSVGDWFAG
FT                   GAGNILLLIASRLFAGAGMFVLWVVCINVASSTVPPTRRATATSVIISGYPAGYALGQF
FT                   SAPRVAEIVGWPGVFPLFGAAVLVSSVVFYFAVGNVTRFETPAESPTFAEFRQVFVNRN
FT                   IWSIVIVTVLAYSLYMVFNSWMPTYIIQQYDISLAESGTFVALFPAVGIIARPVGGWVS
FT                   DVVLNQRRRPIFAASFVGAIVVTVALFYTVRVTILVMMLILAGVVIQLQIGLLYQSAQE
FT                   FVDPKAAGTAVSIASVAGWLGSFVAPVIAGELVAITGSYVIILWFAGSLGVAGGFSVWR
FT                   MSESGIDMAPS"
FT   CDS_pept        complement(578878..579801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="HQ_1468A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1468A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51596"
FT                   /db_xref="GOA:Q18K56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18K56"
FT                   /protein_id="CAJ51596.1"
FT                   /translation="MSETTYTTTEDTDDTNSTDSMVGTTTGETDEYVREEWREYSFDVP
FT                   TKLGVDDLDVYYGDDQALEGVSMEIPEKSVTALIGPSGCGKSTFLRCLNRMNDRVSSAR
FT                   IDGSVTLDSQEIYQDGVNLVELRKRVGMVFQSPNPFPKSIRENIAYGPEKHGDIDTGVL
FT                   ARLLGRSDEEQREELVERCLRDAALWDEVHDRLDDNALGLSGGQQQRLCIARCLSVDPE
FT                   VILMDEPASALDPIATAKIEDLIAELSKEYTVVIVTHNMQQAARISEQTAVFLTGGELV
FT                   EYGDTDQVFENPQSERVEDYITGKFG"
FT   CDS_pept        complement(579794..581401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="HQ_1469A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1469A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51597"
FT                   /db_xref="GOA:Q18K55"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K55"
FT                   /protein_id="CAJ51597.1"
FT                   /translation="MAGATETRLISRDTSGVDAIAAVTIGLSALLFALSLAALFEIITI
FT                   SDPVAGIPIVTLLGGILVLLGGVVIGFGIGSYVGVVETQPSSSAGLVASATFSLVWFAL
FT                   GGIMAQVIGVGGITWLPIALIIGGAAFAVTAVLREDIGSTLPAGAVTLFIGIVYLTGTI
FT                   GPAWIWELSWEQQASLTAEFVIPVGTLFCALLTGWAAAKTYGGFGARGRRMGAYLLIYL
FT                   NASSIVGVLFILIAFTTLKGVPGLFTGATVGLGVGPTVLGVTLPISLPFVMNGASLFNE
FT                   FQGVLPAIVGTIWLVIGAVLFAVPLGVGAAVFLTEYAERGRFTQVVEVATNGLWSTPSI
FT                   VFGLFGFAFLVPRFGGNKSLISGMLTLGFMLLPLVLITSREAILAVPDEYRDASAALGV
FT                   SKWQTIRSVVVPAALPGVVTGVILGVGRIAGETAPILLTMTGGTFVPGGQTADVIGGFQ
FT                   FTATPPFVANPELLQATTALPFQLYALITAGVGLGDTVSSPEQFQWATAFVLLFIVLSF
FT                   YAVGIGARYYFRRKLQHE"
FT   CDS_pept        complement(581401..582525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="HQ_1470A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1470A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51598"
FT                   /db_xref="GOA:Q18K54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K54"
FT                   /protein_id="CAJ51598.1"
FT                   /translation="MIGTQVVAARNALTHRWQRLSSFVGDQEPLAVATVGIMTIALVSA
FT                   LVGFLLVSPFTIIPFGIFLIAASYGWLNYQGLTARMLTLSMTVSTILILLLITLFIFMK
FT                   SVPVIQYESQSVLGVSVPGLRMFTQVQWDAVSPPIRYSMVPMIHGTVMVTTIATVVAAP
FT                   LGVSAALFLSEIAPTTVRELVKPGVEILAGIPSIVYGFIGFTILSPWAADQFQITGQGS
FT                   YLFVGIVVGLMALPTVVSVAEDALNSVPESMKSGSLAMGTTDWQTMTSITLPAAFSGVS
FT                   AAVLLGVGRAIGETMAATVMLRGVPQLTKPLYNAFYGQATLTSLIANNYGEADGLQMDA
FT                   LFAAGVILFITVIVISIGSQYIEWQMQRKLGGES"
FT   CDS_pept        complement(582584..583756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="HQ_1471A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1471A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51599"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K53"
FT                   /protein_id="CAJ51599.1"
FT                   /translation="MSKANAGDTQVSRRKFLLTSGAIGAAGLAGCSSSEGNSSEESDGG
FT                   DSSDSSDSSDSSGGSEISLLNAEGSSTVYPISNKGSSYWNANAPPSDGEYWGSTDESTV
FT                   PGWSEFDNTDMNLADYFASLYGFDPTETRSDPPYPTTVSLSHSGTGCKAVRDGLVDIGN
FT                   SSGPITAELGISDEKASEEYVDHVVGRDGQPVVVSKEIFDAGVTQITGEQVRGIYQGEI
FT                   TNWSEIGGPDQEIFVIGRAEGSGTDTSFRLNMLGAADASMSGVSSRFGQNQQVAEAVAN
FT                   NEGAIAYMALAFTSDQVPPVAIDFDGTVYKPDKDAENTIFDSAYPLNRDLHMYTRITEE
FT                   TPGGTDMQEGAFLNMFLTSFGQQVFVEQNNYIPLPTKDIQAEAEKLPDQV"
FT   CDS_pept        583887..584873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1472A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1472A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51600"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K52"
FT                   /protein_id="CAJ51600.1"
FT                   /translation="MKLIKSYPLETQTANMHTEKSSRVTVSDVVTAVDDPDADADTVRD
FT                   ALRPVTNDGMVTQTAIETTVSDVSKLLATAETRIELAGDAYDDIARVAEPVEDIPTVRA
FT                   RLNRFSERLSAIESRIPELRPGISIPEDVESQPVEVYKFAVHIREIIVIAQEAIEAAED
FT                   FSFDAEQFESWLNRPDRRYDEFVEDLEVVVDAADELATTVDELVDESMTMTVDPAVQWA
FT                   DATMRTQVLLLLLTDLHAELADLRTLADRTDAYIRTGLADRINRAEEQVTDLNSALDTH
FT                   ATPAWRDRFGDDVEAFDATLKGFDPPVDWGAIDRALTEHQPNCPDKE"
FT   CDS_pept        585370..585507
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1472B"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: uncharacterized protein (nonfunctional)"
FT   CDS_pept        complement(585813..586034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1472C"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1472C"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97811"
FT                   /db_xref="GOA:J7S5D4"
FT                   /db_xref="UniProtKB/TrEMBL:J7S5D4"
FT                   /protein_id="CCL97811.1"
FT                   /translation="MGGVLGNTETLDEELSSTNHFLRVVGTSQRNYNIHGNASAPSIAP
FT                   IVLSLFCFVFWDTIGEDSYQRYQSEILR"
FT   tRNA            complement(586403..586476)
FT                   /gene="tRNAPhe"
FT                   /locus_tag="HQ_TRNA14"
FT                   /product="tRNA-Phe"
FT                   /note="anticodon GAA"
FT   CDS_pept        complement(586735..587367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gptA1"
FT                   /gene_synonym="prt1"
FT                   /locus_tag="HQ_1473A"
FT                   /product="probable phosphoribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1473A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51601"
FT                   /db_xref="GOA:Q18K51"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K51"
FT                   /protein_id="CAJ51601.2"
FT                   /translation="MAKSNQFEDRVDAGEQLAAALHTYEIDADITLAIPRGGLPLGRVV
FT                   ANTVSTPLDIIVAKKIAAPRNTEYAIGAVASDGSVWRNDTAIQQTGASETYFEQEQAAI
FT                   AKQANQKAIRYRENDDFPDLTNSHVIIVDDGAATGATIQACLDRVGKINTTSVTVAVPV
FT                   APPDTVKMLEQSADSVICLNTPQQFRGVGQFYQTFEQVSDAEAMSYL"
FT   CDS_pept        complement(587511..588587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1474A"
FT                   /product="ribokinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1474A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51602"
FT                   /db_xref="GOA:Q18K50"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K50"
FT                   /protein_id="CAJ51602.1"
FT                   /translation="MPDVISLGSINVDRIHHVSADVLKGLTSAHAWFPDQGETIIHDVE
FT                   SLPSSIPTPPDMVQYGGKGANQAIAATKAGAQTTLLGVVGSDAESTDVCEHLSEFGVNI
FT                   DNVRSAAMPTGTADIFIDPDGNNRIIVRPGANKKVDIDYIDTHFETIIESNCLLIQNEI
FT                   PPDPVTHLLDRLAASNNSPTVLFDPAPAGGADKLLHPGAIDYVTPNETEYTALKPALSE
FT                   YDGVLIRKAGGDDVIVEIPDYLTLSPPRIIPDESESDIPDQIHVTTNPEDETQTEGRIP
FT                   DSTRLSITPPAVETVDTTGAGDVLSGYLAARLPVEKSLLQAVEKAIIAGSLSTQHAGAQ
FT                   NGIPALSTVQEFQSNNRH"
FT   CDS_pept        complement(588832..589545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1475A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1475A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51603"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K49"
FT                   /protein_id="CAJ51603.1"
FT                   /translation="MGNIQADAQSYTDIMRIGPDSGIPGEQSREHDMSGSPVHIAAAAD
FT                   AVRDGWKATIEDTYRMVDDREADGYRTALVVAAETMPRGPTNDDHKINTENMSGDINVA
FT                   SSIIMAPPECSSAPKWGISHVVPRNAEDSIEFIDPPFTVDETLVYQRVVKGTVFIVTEC
FT                   ICIEEVSPPRSLFIAGAYSITHAASLVRVAMNCNRMISHLHYLDGTHIATLLHADATTF
FT                   FPNPERFLNAGLSGE"
FT   CDS_pept        complement(589616..590077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1476A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1476A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51604"
FT                   /db_xref="GOA:Q18K48"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K48"
FT                   /protein_id="CAJ51604.1"
FT                   /translation="MLQTSKLVLQLTEFLLWVFIASTVTVILSGVTAFVIWTNLVAVKN
FT                   ALFLVGILLFGIGSVGIQPKRVRRRAMNTRSEHKGSSDRTHRQISLGQFSADTNTEYGF
FT                   ETRIQTIPPLRNNRLSINERVSRDWKLFATSLLVLATSLYFEIGLDIHI"
FT   CDS_pept        complement(590102..591535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF2"
FT                   /locus_tag="HQ_1477A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1477A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51605"
FT                   /db_xref="GOA:Q18K47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K47"
FT                   /protein_id="CAJ51605.1"
FT                   /translation="MSKTVDSRPDESARSPQLESDVTTDPLVTVKDLKTYYGGDGAFAD
FT                   PPVKAVDGVSFQIERGETLGLVGESGSGKTTLGRTLVQLETATAGDITFDGTDVTTLHG
FT                   DSLTEWRQRAQIVFQDPESSLNDRMTVGEIIREPLDAHEWGTKSERRNRVQTLLADVGL
FT                   QPEHYVRYPHQFSGGQRQRVGIARALALEPEFLVLDEPVSALDVSVQAKIISLLDDLQA
FT                   KFGLTYLFIAHDLSVVRHICDRVAVLYLGKIMEIGETEQLYQNPQNPYTRALLSAIPNP
FT                   DPQDETARITLPGTPPSPRDPPTGCQFATRCPAKLRPSELDHLDATTWERIERFREVVR
FT                   ERSRVDPGVRGRITRQLGVFSAHDDIDSAVTDLFGDLQEFPPAVVNPIESAVEHIKSGY
FT                   PEKARELLRDTFGSICDREEPTLQAVNDTDTSQNSKVSSIATTQRSYCHCHKSEHDDVS
FT                   TIFDRRLNDPDAGTHSSVD"
FT   CDS_pept        complement(591528..592667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD2"
FT                   /locus_tag="HQ_1478A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1478A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51606"
FT                   /db_xref="GOA:Q18K46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K46"
FT                   /protein_id="CAJ51606.1"
FT                   /translation="MESSAGSNSDSMIPDVDRKTSTSAQPDDDVVLSVHNLTTVFRTDR
FT                   ETIYAVDGIDFDVRRGETVGIVGESGSGKSVTARSIMGLIDAPGEILPASSIRFNNDEL
FT                   TDYSDDEYRAIRGDGIGMVFQDPQQSLNPVYTIGNQIREALAVNQNIRGEEARRQAIEL
FT                   LEAVAIPDPARRLSEYPHEFSGGMRQRAVIAMMLACDPEFLICDEPTTALDVTIQAQIL
FT                   DLLSEIQQKRDLSILFITHDMGVIAQIADRVNVVYAGEIVEQAPVERLFQSPQHPYTRG
FT                   LLDAIPGRRSGDDGLRTIEGDVPTPNAPASNCRFAPRCPKAFDECEAVPPQHVSVDDNS
FT                   THTAACLLYPAEMEESPRVAKHRRRAETEADANTGEYHE"
FT   CDS_pept        complement(592667..594229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC2"
FT                   /locus_tag="HQ_1479A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1479A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51607"
FT                   /db_xref="GOA:Q18K45"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K45"
FT                   /protein_id="CAJ51607.1"
FT                   /translation="MCARSHTTSTVETTADDPFQRDGQSVRARITAEPTPAIRWAVVAA
FT                   GLLALELGAFLGGLLTILDGVVIGLTAFIDIAVGVINPQLAATVVDIQTTASNAITTAR
FT                   DAAEGIPTLLSRETVPNQGHLMGPDGPWAGPIFGVEPGLAWVLRALLIIGYSLFVFYWI
FT                   FRGWTIFRDHYRHAEWTPTDDIVDRLSEHRWGQFGIIIIALFLTMALFGPALGPTTVEQ
FT                   NIISPYSHEITYLNTDTQTVETITAGDANFDSKSKGSSEQNVGPMSYDEFNRFHPFGTL
FT                   PNGRDLFTFMMGGARITLIVAGLAIGLSSLIAATLAMMSAFYGGRIDLGILTTADGVVS
FT                   VPQLLLLIMISAVFADHWLATVLDGGFLLALIFAFTGWPFLWRAVRGPALQVARESWVD
FT                   AARSFGQTPRTIMRKHMLPYVTGYLLVYASLSTGGIIIGLAALSFLGNGLGITPPTPAW
FT                   GRAVSLGQSYVSSSSWHISLLPGLMIVLLVTGLNAFGDGLRDAIDPESNGSDQTEGVTG
FT                   GGA"
FT   CDS_pept        complement(594372..595463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB2"
FT                   /locus_tag="HQ_1480A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1480A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51608"
FT                   /db_xref="GOA:Q18K44"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K44"
FT                   /protein_id="CAJ51608.1"
FT                   /translation="MNRFIYILKRFALAIPVLLFGLTMSFLIMYKGPIDPVLSILGRDA
FT                   NPEAARQLRISLGIIRPNGTPIPLWEQYGMVLRDLVTFQFGQSWIIQRGASVQSVILGR
FT                   MAPTLWLGWWSVVIALLIGIPVGLYAGLKANTWGDYVASGGGIIWRAMPNFWLAVMIAG
FT                   SLSAGGVLSWYRAFGVNTDVIGTPAAVRQLFTVIDPFGAAPIIGLVIIPIPNVENFIIA
FT                   FKWILPAALVLGSASMGNEIRIGRTAVLESLNSKYIETAKAKGLSARRIIIKHVGRNAI
FT                   VPLLPVIMGEFYLLIGGSVLVEQVFSINGLGNLFFRAVLGPDIPVVMTLVFVFIIIQVL
FT                   FNITQDILYTVVDPRITLEDTEQ"
FT   CDS_pept        complement(595590..597446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA2"
FT                   /locus_tag="HQ_1481A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1481A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51609"
FT                   /db_xref="GOA:Q18K43"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K43"
FT                   /protein_id="CAJ51609.1"
FT                   /translation="MVDDSEVNRRRFLRATGAVAATVGVAGCSQGSDGETETETQTPDD
FT                   SGGPSSMEFSRPSSYPYSPGETDVQSARSVMEEAGFGPDNRYELSWTQYTSPTWKEIAN
FT                   TVRARLESAYIDMSISEADFGALLETTEKGSHEAFTLGWIADYPAPQNFLQLVDPENTV
FT                   YDADGYTPNGARLFWSEDANTDTPIREYIASQFNRIQDNPGLNESAVQTRNDAVGNIEA
FT                   GLWESAALLPIYHSVSEQFWYDRVSYNPPSGMGGSRSKENVSVDGIMGKDRLSGTSATF
FT                   SALDPIASGNTASGGKIMNMFDAPMNYPNGDTEVEPLLISDYEVSDDLTEYEFTLKEGI
FT                   QFHGDYGEVTADDVVYSIRRLVESNNSTNTYFPNSVLNIERETDADGNVIPDSTGVEAT
FT                   GEYSFRITLQQPFSYTLEVLAYSAFSVIPEGIIGDIEGYDGEMSQTEFSTTNPIGTGPF
FT                   TFVEWNSGNGGSFTVDRFDEYHGQQAAIEGIDSAIITDTTASYNYFLNENADVAGIPTA
FT                   KYDPEKVSIESTDGSQEFGTYGPLENDKTVNMARTPTINTFYVGFHMEKVPKAVRQAMA
FT                   YVTNREQFVDDVFKGRGVPAYHLTPPQVYPGGTSAYNSHWQG"
FT   CDS_pept        complement(597591..598751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF3"
FT                   /locus_tag="HQ_1482A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1482A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51610"
FT                   /db_xref="GOA:Q18K42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K42"
FT                   /protein_id="CAJ51610.1"
FT                   /translation="MTSESSEGFHNTDEGTVAHRDAPTSRAPDDRSQRELIRVAGLKKY
FT                   FPIETGFFEQFFGDQEYAKAVDGVNLTIHEGETIGIVGESGCGKSTLGRTLTRLYEPTD
FT                   GSVIFDYEHIETLSGSELRPIRRRMQYVFQDPLSALNPRKTVGESVAKPLKVHDIADGE
FT                   AKWKQVAELFEEVGLSQSDINAYPHQLSGGQRQRVGLCRALITEPDLIVFDEPVSALDV
FT                   TLQAQILNLIDGLQDKYNLSYAFISHDLDVVRYVCDRIVVMYAGEIVERGYADDIFNNP
FT                   QHPYTRALVRAIPSIRDDDHERESLAGTPPSVTDPPSGCRFHTRCPEFIDGQCVNQNPE
FT                   NHIVDSDDNHTVACHWAQQSDREREVHSPPSSSEREIIIREASTQE"
FT   CDS_pept        complement(598748..599842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD3"
FT                   /locus_tag="HQ_1483A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1483A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51611"
FT                   /db_xref="GOA:Q18K41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K41"
FT                   /protein_id="CAJ51611.1"
FT                   /translation="MTNPDPLLEMRNLAVTFPVDDGPDVRAVESVDLTLHEGEVHGLVG
FT                   ESGSGKSVTARAILQLLDDARVTASELTFESVNLLTQSEEEMRSVRGAEIGMIFQDSLS
FT                   ALNPVMTVGEQIAEVVRHHTNTGESTGTLSELRRKYVTGTDETSASWERSVELLDMVGI
FT                   PDASTRANEYPHQLSGGQRQRVMIAQALAGDPSIIIADEPTTALDVTVEADILAELRDL
FT                   CDDFDVSVLLITHDLGVVAETCDRVTVMYSGSVMEKGLTDSIFTHPSHPYTEGLLQSIP
FT                   EYSLISNDSELQTTPGSAPDPRDRPNGCPFRDRCPIAFDACSEPLPTHSITDDHIIRCH
FT                   DYARDRTEDVSSKYQETQEIEVSE"
FT   CDS_pept        complement(599842..600750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC3"
FT                   /locus_tag="HQ_1484A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1484A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51612"
FT                   /db_xref="GOA:Q18K40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K40"
FT                   /protein_id="CAJ51612.1"
FT                   /translation="MGTEYDNYSPDTENTFFGVRLDRFDRLRETISADRKALFGLITVI
FT                   GFILAAVLAPELAPFDPMAQEYTIMQPPSLTSAHPLGTDSFGRDLLSRIMFGARISLGV
FT                   SLGAVFIAAVIGVTLGLVAGYYGGLVDDTIMRFIDVLWAFPWLLVAIMLVAIFGQSVWN
FT                   VIIAIAFAYIDDFARIIRGEVLSIREEEFVMAAKSIGVDDVNIMIDEVLPNAVAPLIVQ
FT                   FTVLVARAMLAESTLSFLGIGVKPTTPTWGALLGQGRSLIGQAWWISIIPGIAIVITVL
FT                   GINLFGDALRDTFDVRQRGGS"
FT   CDS_pept        complement(600751..601710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB3"
FT                   /locus_tag="HQ_1485A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1485A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51613"
FT                   /db_xref="GOA:Q18K39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K39"
FT                   /protein_id="CAJ51613.1"
FT                   /translation="MGIKRYIAKRVLQAIIVVYIVATAVFVAVRSVPGDPARLVLGGTA
FT                   EPDALAAVRAELGLNQPLHIQYLRWMSDLVTADFGTSIYTGEAVLSRILGAAEPTLSIG
FT                   LIGIIIALFISIPAGIISATRRSQWEDHVATGIAFLGISMPSFWIGIVLLLTVGTAIPS
FT                   IPSYGYAPINEGLLSWLSHIILPGLAVGLPYAGILTRMTRSSMLEVLNQDYMQTARAKG
FT                   LSPRLVLLKHGLQNALLPVVTIAGILFALLLAGIVAVEIVFGIQGFGRLLIRSIERQDF
FT                   PLVQGSVIVISIIFVFMNLFIDLVYMSINPKIRYGSDT"
FT   CDS_pept        complement(601711..603438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA3"
FT                   /locus_tag="HQ_1486A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1486A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51614"
FT                   /db_xref="GOA:Q18K38"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K38"
FT                   /protein_id="CAJ51614.1"
FT                   /translation="MFNKFDKSDLEGPKIDRRTAIKLFAAGGVSSLAGCAGESGDPGEG
FT                   DTEDAATSAETEGGSAGGSITAGWNIDQIEYLDPHYIDKGQEIYLSSNIYSGLVKIGSD
FT                   GSITGDLAKDWTLPDSSTYVFDLKEGATFHNGDPLDAEAVKASFERLMSLDDSPHLGKV
FT                   SSVEEITAEDSTTLRISLSETVGPFISFLTRGPGRAGTIVHAPTATDNPEEYNRMPVGS
FT                   GAFKLTDRESGEYLQLEAHDGYFETDSNGTTLPYLDSIRIDLIPEPSTMWTAIRGSELD
FT                   YSISIPPQNAGQAESMNDLSVTGSNPGAWFCVAPLCTNPAEVQWDQYASGEAQSTNKWS
FT                   SEDLPTTSKEVRQAISMAIDREALVERAFFGYAKPAHSVYNPAIAWLHDEEPDPGQYYD
FT                   PETAKQLLDDAGYTGEPRMSLSLLGTPGDERRMTVIQSMLSEVGIEVELNIQPSSAYWD
FT                   NLYQYSNELVMYDGYVDIDPWMSLWKQLKTPVESGSAGKWQANLYNNPEFNTLLEEDAR
FT                   TSDPGTRTELLRQAEDIFIEDTPWAMTTFPLIPKAASSALGGVGNQAGLSNFHTARLE"
FT   CDS_pept        604201..605511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1487A"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1487A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51615"
FT                   /db_xref="GOA:Q18K37"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K37"
FT                   /protein_id="CAJ51615.1"
FT                   /translation="MQIDYASRARDQLGFSRWWLLLGAAVSMALVSPYQYVWSSIEGPL
FT                   ATQFGAQPPALGAVFTLFVIFQAGSQFPVGWWRDKRGPRAISFIAAILAGGGYIGLAYA
FT                   TAIWQIYILYSLGAIGVGVVYTVSVNTALKWFPDRPGLTTGVGTMAFAAGSALVVPFVR
FT                   ANATATSYPFVLRTLGVIIGLGIFLGALILRDPPDGWTDSRTTTTEENQSDKTDTEMTN
FT                   VTGTNETQYRWHDVLRTWQFWVMYGMFIAVSGAGLMLTAKVVSFADALGLTAVTATASA
FT                   TLLPVAGGAGRLILGDLSDRVPREHAMAVSFTLCGIGLAAVVYFAQNGSTLGFLAAVVM
FT                   TTFFWSPQYTLFPSVIGTYYGSANSSANYALLYSGKMWGGVFGGAAAGWLINQVGWSIA
FT                   FLVGSGLAVIAGIAALALRPPETPATEHIDADIDTGD"
FT   CDS_pept        complement(605716..607314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="HQ_1488A"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1488A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51616"
FT                   /db_xref="GOA:Q18K36"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K36"
FT                   /protein_id="CAJ51616.1"
FT                   /translation="MSPDLDAFDSRRSTVYARTGVVATSQPLAAQAGIQSLQSGGNAFD
FT                   AAVATAATLNVVEPMSTGIGGDVFAMYRTADGDVGAMRSCGGAPAAATRETIRDRLNTE
FT                   SPTMPSSGPLAVTVPGTVRGWERLLTDYGQYGFETALEPAITHASEGYPVSEIIADAWT
FT                   RNADTFIDAIGKETFSVSDGTPSVGDVVRLPHLAETFKSIAQGGADAFYEDSLATQIAS
FT                   AVRDRGGLLESSDLAEFEAEYVDPVSTTYRGATVYELPPNNQGLIALEALNIASKVDAG
FT                   SYAYDSADRIHYYAESLKRAFHDGHHYITDPEFESIPDLASSSYAANRAESIGPYASDV
FT                   SVGGPGMPPEDSDTVLLTVADRAGNVVSLINSIFEPFGSGVVVPDTGIVLQNRGASFTL
FT                   DPSHPNTLEPKKRPFHTLIPGLIQFDSDDWAAFGVMGGYMQPQGHLQVLANLLDYGFDS
FT                   QAALNAPRWRYCDDGSLAVEERFADGVLGKLARRGHEVTVRPPSAFGGAQFARRRGDVL
FT                   SGATDPRKDGTAIGF"
FT   mobile_element  complement(607578..607629)
FT                   /mobile_element_type="transposon:ISHwa23"
FT                   /locus_tag="HQ_ISHwa23C"
FT   CDS_pept        complement(607691..609640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aglD"
FT                   /locus_tag="HQ_1489A"
FT                   /product="glycosyltransferase AglD"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1489A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51617"
FT                   /db_xref="GOA:Q18K35"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K35"
FT                   /protein_id="CAJ51617.1"
FT                   /translation="MESPSAGSAKSNATGSDDDTVTTSADRQTPRGDESPAAEDDVNIS
FT                   VVLPAYNEESTLESTVQRTISTLETFCEPTSIEIVIAEDGCTDNTPEIADQLAASDRRI
FT                   RHMHSDTRLGRGGALEQAFNFANGSVLAYFDTDLATDIRHLEELITRIQTGEADIATGS
FT                   RWLPENIADRPAKRGIPSRVYNTLVRLFLRSDLRDHQCGFKAFSREAFESLQPIVEDSH
FT                   WFWDTEMLVRAQRADLTVVEFPVEWTSKGDTKVDLVRDVFGMGSQILRTWWQISVQPRL
FT                   SPRVSLGAGAVLAIVALALMTQYIDFNTVISEVRAADPWLVVAATIVYTLSWPVRGLRY
FT                   RDILFELGYYERVRFLTGAVFISQTGNLVFPARAGDLVRAYVIKARRGIAYPSGFASLA
FT                   AERVFDLLTIASLAGVVLLGYTASGQTATLAQTIIDAEGAGRVAVIVSMSVGLVAVAAV
FT                   GGIILSARSEIDIPSAVVYRVSTDSYAEMVVSVINQFIEDLQTVAGTRRGFARVGATSI
FT                   LIWSIDVVTAFVVLLAFTPALDTIQLLAVSFFAVSVGNLAKVLPLSPGGVGLYEGAFTL
FT                   LVVGLTPITPSVAIGAAVVDHAVKNLITVIGGYGSMLGLNVSLMTAVEETRDVRNRDTD
FT                   ISAEGVTQTETRNQ"
FT   mobile_element  609801..609852
FT                   /mobile_element_type="insertion sequence:HqIRS46"
FT                   /locus_tag="HQ_HqIRS46F"
FT   mobile_element  complement(609962..610018)
FT                   /mobile_element_type="insertion sequence:HqIRS81"
FT                   /locus_tag="HQ_HqIRS81D"
FT   CDS_pept        610294..610611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1490A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1490A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51618"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K34"
FT                   /protein_id="CAJ51618.1"
FT                   /translation="MSATTETETEAEIETNVDGRTTESRSELPMLSEKQQRIHQYLIQQ
FT                   ADQQTYFKSRLIAAELGLSAKEVGANMSAIINNNTTDVSIEKWGYSSGTTWKVTLESAN
FT                   C"
FT   CDS_pept        complement(610641..611309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1491A"
FT                   /product="HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1491A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51619"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K33"
FT                   /protein_id="CAJ51619.1"
FT                   /translation="MGNRNIDENKRATLRRFATIGAASPLAVLGGGETTTDNTGAERTQ
FT                   DHEQTGSDNRNEVRKAIVGYVSSTPGVHFSKIRDELKLGTGETQHHLRRLVDDGRLTIH
FT                   RDGDYKRFYLSGRFNTFEQVALGFLRRTTPRGILIELLKDPTATGADLATVLDVSQATV
FT                   STYSSKLDDAGLISRTDDYTIKEPEIILTLILRHADSLGPDAVAIADEAETLLKYSPQD
FT                   "
FT   CDS_pept        complement(611488..612663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1492A"
FT                   /product="stomatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1492A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51620"
FT                   /db_xref="GOA:Q18K32"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K32"
FT                   /protein_id="CAJ51620.1"
FT                   /translation="MDIIVVTGQGAQLPIQAGIGLGTSLVGLLGLFLAIVTVYQMVEIV
FT                   DAYEKEALTVFGEFRHLLEPGISFIPPFVSRTYAFDMRTQTLDVPRQEAITRDNSPVTA
FT                   DAVVYIKVMDAKKAFLEVDDYKKAVSNLAQTTLRAVLGDMELDDTLNKRQEINSKIREE
FT                   LDEPTDEWGIRVESVEVREVNPSKEVQQAMEQQTSAERRRRAMILEAQGERRSAVEQAE
FT                   GEKQSNIVRAQGEKQSQILEAQGDAISTVLRAKSSESMGERAVIERGMETLESIGEGES
FT                   TTFVLPQELTSLLGRYGRQLTNSDVQEEAGLESLDFDDETRELLGLDDIERILGQIDEA
FT                   AEMDLEELEQEAEAIKAGETNDIKDADQITAEKTEEMQDGETERAVETERE"
FT   CDS_pept        612860..613888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1493A"
FT                   /product="ABC-type transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1493A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51621"
FT                   /db_xref="GOA:Q18K31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K31"
FT                   /protein_id="CAJ51621.1"
FT                   /translation="MTAALVAENVYKSYGDVRALDGVSLSVDAGEMFGLVGPNGAGKTT
FT                   LVRALTGTTTVRGQLSIRGVTPTKLDKSQVGVLPQSFTPPGRLTAHELIEYYAGLYEDT
FT                   RDPATVLDDVGLSGDSTTQWYETLSGGQQRRVCVAIALINDPAVLFLDEPTTGIDPAGR
FT                   RSLWSLLETLAAGGTTVFLTSHSMTEVERLADRVGFLNDGQLLTIGDPQSLIDTHAGEN
FT                   KLIIETETALDSTAFSSLSFDIQTSVSGTRTVVKSVGPRDIGDIIDAVDMTTVTVESLT
FT                   WKQPDLEDVYLALAGETLNPSRTTKTSNSNEDTAPRIDDVNTGGNVMSQTAITTTTEES
FT                   DQ"
FT   CDS_pept        613885..614646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1494A"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1494A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51622"
FT                   /db_xref="GOA:Q18K30"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K30"
FT                   /protein_id="CAJ51622.1"
FT                   /translation="MTRHSRIRAEFTAAWHAFLRRRTAVFFTFFFPAIIVVIFGALVQT
FT                   QPTGGGLFAEPRAYYIAGYLSVVVLFTPLSRVGSTVARYRSGSRFEKLATTPLSRGEWL
FT                   LAQSLVNVVVIGIAAGLLLILSVLVTNTTLPLNLTTLFIIPFIILGVVLFCGVGAIIGR
FT                   VAGSQDGVIAASNAIALPLLFLSETFVTPSLLPVWFRPVLGLSPLTYIARGIRSVTYLE
FT                   ATTAPLGNLGVVTVIAIIAFLAGTRAVPQTD"
FT   CDS_pept        614744..615418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgA"
FT                   /locus_tag="HQ_1495A"
FT                   /product="2-dehydro-3-deoxy-phosphogluconate aldolase,
FT                   bacterial-type"
FT                   /EC_number="4.1.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1495A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51623"
FT                   /db_xref="GOA:Q18K29"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K29"
FT                   /protein_id="CAJ51623.1"
FT                   /translation="MTTNISRVFDQLIDSGVVAVMRGADADTIIDVATALHDGGVTAYE
FT                   ITADNANAAALINEVHASFRDSEVIVGAGTVLDSPTAQEMITSGAEFIVGPTFDPDILE
FT                   ICNRHGTLVAPGILSPTEALNAYEAGADLLKVFPAATVGPTHLSSIAGPLPHLPLMPTG
FT                   GINIDNVADYIEAGAAVVGAGGALMNTDAIAAGDFESITETAEMFTQEIETARMRNSSS
FT                   SS"
FT   CDS_pept        complement(615652..617541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1496A"
FT                   /product="DUF304 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1496A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51624"
FT                   /db_xref="GOA:Q18K28"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K28"
FT                   /protein_id="CAJ51624.1"
FT                   /translation="MTQIRTLSPVSIPYRILQRSGSIAFALIFVLSGQGGALPELPVIG
FT                   VVDSTFIGAIAVAIVLIFVGYETAYVRRFQYKLTTDSLDIDSGVLSRRNREIPLRRIQN
FT                   VDISRNIIQRGLNIAVVSFETAGGESTEATLRFVSAEEAKRLQREVGRRKHDKSDTRTS
FT                   ETVDSSEDDQTGNKDETSGGSPDRTVNELFVLDDGELALVGFFSIDLRVPGLLVAGLST
FT                   LGPILTGLVPAASPLRSLLTVIGGPSVLTGGVNALLGLLPVLIGVVVLSWLVGAASAVT
FT                   SYYGFRLTETRGELRYERGLFQRYDGSIPFEKIQTLTVEDDPLKRYFGYATLYVETAGY
FT                   APGQSGSGGRGSEVAVPLAQRDRIDELIKRIEPVDTIELRRPPKRARRRYLVRAGLIVG
FT                   AVIIGLYTISTVMSITFPWWVAIGLLPVGGIIAIALWRHRGHWISEDYFVTRNGVFTRE
FT                   TRIVPLYRIQTVIDTRTVFQRRLGLATIIADTAGSRSLGGSDAQAVDISAQRATTLRTE
FT                   LETRLQRAIHVRKDRLGSMSTTGVSSSKSSSDTVANNKDTIVTTESDNDGSKSQVTDTD
FT                   DNSTTHDNDQPADNHNHNDNYGGDDDGTEETRRSENETNDISNPESGSTEESE"
FT   CDS_pept        complement(617544..618011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1497A"
FT                   /product="DUF304 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1497A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51625"
FT                   /db_xref="GOA:Q18K27"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K27"
FT                   /protein_id="CAJ51625.1"
FT                   /translation="MNQLNPRIRFLWIGRAMAIAALLSGVTAGARWLFSLSVLPVWAPG
FT                   VTFVITGGLGVIFAVARYRIWRYEIRADSIYLERGVLTRVRTVVPFVRIQHVDTARSPV
FT                   ERFSGLASTVVYTAGSRGADVAVPGLSRTNANELRERLRELAIQSESEDAV"
FT   CDS_pept        complement(618126..619109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1498A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1498A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51626"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K26"
FT                   /protein_id="CAJ51626.1"
FT                   /translation="MMSVASSALEIARQVTRHARRRVTDEGDAFCTFRLTLHVDGPNRC
FT                   LNTIDTDHRIRTDTTIDTSVGTTQNETNDDSIGAYTEIEDHIDIALDTMHCESMHLHQH
FT                   DQRLWHEFNQNTMFFSPEMVTQSQAQSIETRDDVCDLYDNTVLSTPHADTTAMSVPMHL
FT                   TAEFGSTVTQSLLMNTVFTPAICDQLIAGSTASIANRHVWITRLNAEVNAIDATRAIAD
FT                   EVLPILMRIRDTVPTTRSSAGYQKTCQRLDFLMSQIDDAITNRQVVLDQHRRMLGSTHG
FT                   TVSETLYQDCPNTRPVFQTLATIKRMLQRTQANIANTEQTASSDSI"
FT   CDS_pept        complement(619288..619725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1499A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1499A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51627"
FT                   /db_xref="GOA:Q18K25"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K25"
FT                   /protein_id="CAJ51627.1"
FT                   /translation="MVIIHTVAGAIWVGSITCMTVVILPTAATGDIDATPLERIVGRLM
FT                   ALSRSGVVLTTLTGGYLAGTTYTTESLLNTANGNLIVAALLMWVIFAIFVEIGRRKLVS
FT                   GLQAKRVRAPVAASRRSFQLATGVSILLLVDIGLLTANMII"
FT   CDS_pept        complement(619940..620665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1500A"
FT                   /product="DUF2071 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1500A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51628"
FT                   /db_xref="InterPro:IPR018644"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K24"
FT                   /protein_id="CAJ51628.2"
FT                   /translation="MTDLLTMQWRDVLFAHWRVDPEVVEKQLPSEVTVATHNGDAFLGI
FT                   VPFEMADIRPRGSPIGRSFPELNLRTYVRQPGSQTRGVYFFNLDADDTIGVEIARRGFK
FT                   LPYYHAKMELTRNAASEGKNKTIHITSKRTRDTVAPARFEATYGPVDGANYVQPTTGSL
FT                   TAFLTENYQFYTDGRTLYRGTIRHSPWKIAEGHITIKENTLFTANGFEPPSDGPIVHYA
FT                   SDIDVTAGWIQSIGNSSEE"
FT   CDS_pept        621113..621634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1501A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1501A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51629"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K23"
FT                   /protein_id="CAJ51629.1"
FT                   /translation="MDSSHTATSADETERTDRNQINTVVDTSDSTAEPLSIRLPDGSES
FT                   VSEAIISHRQMLTNPGEYDLASADTVADMRETIARLTEDVPPGLRSDLKTLESSVENVI
FT                   SQLEQQQQQIEELRQATTSLAEILGASVEFSTDIDSADETIETASSSESDVQTDMESDT
FT                   DHAPDVDINH"
FT   CDS_pept        621893..622117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1502A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1502A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51630"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K22"
FT                   /protein_id="CAJ51630.1"
FT                   /translation="MMRVPDDVPNQCPVCDDAYDSVSAHDAGLMVNLIENDRYQRVCFD
FT                   PVQSDTGDALVYFYHHTHQETGTNTHVGG"
FT   CDS_pept        622542..622823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srp19"
FT                   /locus_tag="HQ_1503A"
FT                   /product="signal recognition particle 19K protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1503A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51631"
FT                   /db_xref="GOA:Q18K21"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18K21"
FT                   /protein_id="CAJ51631.1"
FT                   /translation="MAVENIVWPRYLDASITRSDGRRVSLQDAIEDPEVDEIAEAVQQI
FT                   GYDAVIEHDVAHPREWGTSGRVIVKGADDSSKNDLVQAVAAYIHLLRE"
FT   CDS_pept        622831..623064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gar1"
FT                   /locus_tag="HQ_1504A"
FT                   /product="tRNA/rRNA pseudouridine synthase complex protein
FT                   Gar1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1504A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51632"
FT                   /db_xref="GOA:Q18K20"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K20"
FT                   /protein_id="CAJ51632.1"
FT                   /translation="MQRLGIVTQHVQHLLIARCDSNMKSPPSIGAHAIDESLSTVGRVV
FT                   DVFGPTSQPYIAITPVETCSPAAILGEKIYAK"
FT   CDS_pept        623141..624160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1505A"
FT                   /product="DUF1119 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1505A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51633"
FT                   /db_xref="GOA:Q18K19"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR010545"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K19"
FT                   /protein_id="CAJ51633.1"
FT                   /translation="MHRRVAFGIGFTAVLFFLIQLGALALVPTFYEQGYQTVEDPTNPT
FT                   NSLLYIGAILVATAVMLAAFKYELQWLVKGFITLAAGSLAWYVFSVFFSPLLAAIPAVG
FT                   LAVLLIIYPEWYIIDAAGVLMGAGAAGLFGISFGLLPALVLLSILAVYDAISVYGTEHM
FT                   LDLAAGVMDLNLPVILVIPTTLSYSLREDVSPVATDDNTNVSVSDNETHTHANELAEHD
FT                   AETPSSIDETSTDDSHIRDAFFIGLGDAVMPTVLVASAAFFLPGELTPSLGIFGIPAMT
FT                   LPALTAMIGTFIGLFVLMWLVVKGRAHAGLPLLNGGAIGGYLIGALLSGVPLIRALGL"
FT   mobile_element  complement(624242..624510)
FT                   /mobile_element_type="transposon:ISHwa20"
FT                   /locus_tag="HQ_ISHwa20A"
FT   CDS_pept        complement(624263..624510)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1505B"
FT                   /note="product: ISH11-type transposase ISHwa20
FT                   (nonfunctional)"
FT                   /note="gene has a frameshift and is truncated at the
FT                   N-terminus"
FT   mobile_element  complement(624511..624656)
FT                   /mobile_element_type="insertion sequence:HqIRS38"
FT                   /locus_tag="HQ_HqIRS38A"
FT   CDS_pept        complement(624724..625221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1506A"
FT                   /product="DUF88 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1506A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51634"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K18"
FT                   /protein_id="CAJ51634.1"
FT                   /translation="MTEIHPGQRVAVLADAQNLYHTAQSLYSQKIDYGSLLKKGVSGRE
FT                   LTRAIAYVIQADAPEEETFFEALVDIGFEPKIKQIKTFGDGTKKADWDVGMSLDAVTLA
FT                   NHVDTVVLCTGDGDFSRLCSHLRHEGVRVEVMSFRESTADELVDAADTFIDLSARQETF
FT                   LL"
FT   CDS_pept        625894..626817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="HQ_1507A"
FT                   /product="4-hydroxy-tetrahydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1507A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51635"
FT                   /db_xref="GOA:Q18K17"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K17"
FT                   /protein_id="CAJ51635.1"
FT                   /translation="MTDIDLTGVFPAMTTPFTPDGRIDHDILAQNAQRLETAGVSGLVP
FT                   AGSTGESATLTHDEHIDVIETVIDSVNDVPVIAGSGSNSTREALNLSERAADAGADALL
FT                   LISPYYNIPEQAGLKDHYRTIADAIDIPQIVYNVPGRTGTNIEPETVATLASHRNIVGY
FT                   KAASGDVGQISSVVEQTRSEAFYILSGDDILTLPICGLGGSGVISVGANIEPAQTTAMV
FT                   GAAVSGDYDRARNLHYQLAPLFEHLFVETNPIPVKAAMEYRDYGPGTLRPPLTDLSDKH
FT                   RKRLESILDDLDADREMALAGQTEVI"
FT   CDS_pept        626826..627749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="HQ_1508A"
FT                   /product="4-hydroxy-tetrahydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1508A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51636"
FT                   /db_xref="GOA:Q18K16"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K16"
FT                   /protein_id="CAJ51636.1"
FT                   /translation="MSNTETNSHKDSTNTTVSNSSTQPGVRLAITGASGRMGTELRSMA
FT                   NEKTAIEFVLAITQTPDSVPAPKPDSVDAPDAIIPVSGEPSETGLEGSLETHNIDVLVD
FT                   FTTPDASIEYLDAVDTANVDVAAIVGTTGYDDAQRSMISSFAETTPILKASNFSRGIAA
FT                   LRRAVSEVVSTLPSYDIEVTETHHNGKRDAPSGTAVTILDDIESAQNNSESSTHVHGRV
FT                   GDAPRHESEIGVHARRAGDIAGKHEVLMAGGDEVLELTHRAGSRGIFAAGALDAAVWIA
FT                   GRSPGEYDFDAVLDAGTDTTEYNEDS"
FT   CDS_pept        627749..628597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="HQ_1509A"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1509A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51637"
FT                   /db_xref="GOA:Q18K15"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K15"
FT                   /protein_id="CAJ51637.1"
FT                   /translation="MSIESNIHNLWQQYNTDELTAETADTATYNILDEFLTAIESGDIR
FT                   AAEPADDTAGPEGWVVNEWVKQGILLNFGLRETRPREYGDVTYHDVLPLRETHDLGDRG
FT                   TRNTPDGTVIRRGAHLGSDCIMMSPSFVNVGAYVGNGTLIDSCNTVGSCAQIGSNVKLG
FT                   ANTLIGGVLEPVEDTPVIIESGAALGAGCRVTSGFHVGENTIIGENTLLSPRIPVYDLV
FT                   DETVYYGKLPANRRAFTRYVESSLGDHDLFESGAYKPAVVAVDIEAETLDQTRREEALR
FT                   E"
FT   CDS_pept        628594..629988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="HQ_1510A"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1510A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51638"
FT                   /db_xref="GOA:Q18K14"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K14"
FT                   /protein_id="CAJ51638.1"
FT                   /translation="MSTIDTEQTTDNTDSGAPIRRLAAWDTDSLCNLAAEFETPLYVID
FT                   AQRVRENCARLLDAFPAATIRYAIKAHSGQAVLKVIRDAGIDVECASAGEVKAALAAGF
FT                   NGNRIQYTAVNPPARDLDAIINWWQENKQLTITVGAADTVERLQERGFDGRLCIRVNPN
FT                   VGAGHHEKVTTGANAKFGIPYERVSELATQWATEFDLVGIHAHAGSGISGEDLSSHEEL
FT                   VRRMGTLARTITECAGSLEFVDVGGGFGVPYRANDPPLDIHTVAERTRDALGTVDATLA
FT                   IEPGRYVVADAGVLLTRVNTIKSARETTVVGVDAGMTTLLRPAMYDAYHEIENISASPT
FT                   TDSMPVTIAGPICESSDIFAEGRSISAPTRGDIIAIGTAGAYGYEMASTYNARPRPAEV
FT                   IYDDNTAKVARRRETRDELDVLETSSDEHSVSLSSVVSHSHSSVAPESTMSSSSTGDTP
FT                   PGGESQ"
FT   CDS_pept        629985..630977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="HQ_1511A"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1511A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51639"
FT                   /db_xref="GOA:Q18K13"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K13"
FT                   /protein_id="CAJ51639.1"
FT                   /translation="MSDESALVTAVKYHGTGNDFIIVDDTKEIPNRRAFAKVHCSRDTG
FT                   VCHETTDRRGADGVLFLTINQQHTPIQVVMTLIQPDGSTAAMCGNGARVAAAWAAEQTG
FT                   ATEMMIETPAGTRHATLSGDTITIEMGTPVFTPRCVPLTTDRDTALIDEQIGSLSITAV
FT                   NTGVPHAVGMVDDIDSISLNDIAPPIRHADTFPAGVNVTLAELTGATQFRQRTYERGVE
FT                   DETRSCGTGAVAIAAVACRIGIIDTDTPITVRPPGGALRVTVASDQSTTLTGSVEREFQ
FT                   TELTVITESSPRSTAPTMPQAKSSDSGFSSEHNNTTESSPSPSQDDVTR"
FT   CDS_pept        630964..632262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="HQ_1512A"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1512A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51640"
FT                   /db_xref="GOA:Q18K12"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K12"
FT                   /protein_id="CAJ51640.2"
FT                   /translation="MSLDNSHSFDPIEFLKRAVACPSNDSVEKMRELLVGTLQQYDIDV
FT                   HVDSAGNTIATRGIKRDSTTNDCANSNNSESTRETHLVFNTHIDTVSPHIPLDQSRSSR
FT                   SVSSNTDTHPRSQNAATTSGDTVTDKKSRSAESMVANSSTESANEPARIHGRGACDAKG
FT                   PLAAMLAAFLRVDVSSKATITLAVTPDEEVLSTGAAALDLDADMYIVGEPTGLDVCTAA
FT                   KGRFQGTLTLTGTAAHAAAPTSGVNAIAALEDALKAIRTYDTDQPNAIHPQLGKPTVVP
FT                   TTVDGGTATNQVPATCRVVLDRRSVPPETADTFQDKLTTAVNTAVSEDVGVDFSLTDRP
FT                   TPFLEAFATNPDHKLVTTLIDATKQTGESAQQRCFTAATEASYFSPAPVVVFGPGVLAD
FT                   DTGAVAHADREYVTVSSVISAARALTDATQQLI"
FT   CDS_pept        632376..633227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnp3"
FT                   /locus_tag="HQ_1513A"
FT                   /product="ribonuclease P protein component 3"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1513A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51641"
FT                   /db_xref="GOA:Q18K11"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023539"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K11"
FT                   /protein_id="CAJ51641.1"
FT                   /translation="MYEAVYVYPDSKSTVTRCAHTADRYGYDGIITRAIDAEPDFDQIR
FT                   TAMDNGFSTDSNTHTTSIPNSEPRSESDEQSNIDTITSGLQSSDTHSRLSTPDIVNGVE
FT                   IVKSDPQHASGVLGNERSQRTIVAIRGGTDVLNRFAAEQPRVDVLTKPFIGSNKSRTGD
FT                   INHVLIKAAVRNEVAIELNLGPAIRAEGGRRIKHIQRLNKLKGLIDHYDAPYVVSATPN
FT                   SHLEFRTPQELAAVGAEIGLGETWVYDGFTAWDEIITRNRHRRSESFIAPGVEYGRHEK
FT                   ND"
FT   CDS_pept        633211..633819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1514A"
FT                   /product="probable S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1514A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51642"
FT                   /db_xref="GOA:Q18K10"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K10"
FT                   /protein_id="CAJ51642.1"
FT                   /translation="MKKTIDEHAERFSEAASTYDDEQDSEPYRMCAQQVVNHAASTSCD
FT                   TVLDIGTGTGAIAFELTSAADRVIGRDISTGMLDQARMKADIENIENISFAEGRFRDPN
FT                   VDSDITVDIVTSNFAMHHLSDDEKCNAITVISALEPDRFILGDVMLFGAANPDESFYDP
FT                   SVDDPATVGILVDALTDAGFVISEVEFVHEQVGVLVAEQ"
FT   CDS_pept        633910..634443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnp2"
FT                   /locus_tag="HQ_1515A"
FT                   /product="ribonuclease P protein component 2"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1515A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51643"
FT                   /db_xref="GOA:Q18K09"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="InterPro:IPR038085"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K09"
FT                   /protein_id="CAJ51643.1"
FT                   /translation="MKHLPKHLRPRWRYLAVAIESWPHASIDRETFQRELWYAAQNLYG
FT                   DTQSAHTDLAVFNFEFSDGRGETIIRTRRGTESHARTAVACIDEIDDYAVGIRILGISG
FT                   TVRACEERYFNAWTGNKKESNVAFENESRPAVIREVCVDIATGNINATGNTDTGADSSR
FT                   NINTFTGATRLDFE"
FT   CDS_pept        634448..635200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psmA1"
FT                   /locus_tag="HQ_1516A"
FT                   /product="proteasome alpha subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1516A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51644"
FT                   /db_xref="GOA:Q18K08"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR019982"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18K08"
FT                   /protein_id="CAJ51644.1"
FT                   /translation="MQGQAQQQAYDRGITIFSPDGRLYQVEYAREAVKRGTASVGIRTP
FT                   DGIVLAADKRSRSPLMEPTSVEKIHKTDDHVGIASAGHVADARQLIDFARRQAQVNRLR
FT                   YGEPVGIETLTKNVTDNIQQYTQVGGARPFGVALLIGGIEDGSPRLYETDPSGTPYEWK
FT                   AVSIGADRSDLQEHLEENYTEELSLDEGVGLALRTIAISNDDELTAAGVDVATVASDTE
FT                   EFIELTNDEISAYIADNDLEPAEETDSE"
FT   mobile_element  635383..635492
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AG"
FT   CDS_pept        complement(635561..635911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpc34"
FT                   /locus_tag="HQ_1517A"
FT                   /product="probable transcription factor (homolog to RNA
FT                   polymerase III subunit RPC34)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1517A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51645"
FT                   /db_xref="GOA:Q18K07"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K07"
FT                   /protein_id="CAJ51645.1"
FT                   /translation="MSVEPAEADLSKDELKGLELIRETNGIHQSDFWKELDISSRKGSR
FT                   IADRLATLGFIEREETVYNGHNTYHLEPAARELEFSMLMAGDMLSPFIGEEEVNANSDA
FT                   FSQWLMNLAYDE"
FT   CDS_pept        complement(636387..637235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1518A"
FT                   /product="NRDE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1518A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51646"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K06"
FT                   /protein_id="CAJ51646.1"
FT                   /translation="MCTLTFAWRMFTDAPLVVAANRDESYDRPSDPPSITNDTHHPAIV
FT                   APQDCRAGGTWIGYNAAGRFVGLTNRWTSVPSHTDDNNEMTDNDRRSRGQLVTELLTER
FT                   GPTNPKAAVRDAINEHTYDGFNLLIADVGWNDDRDSMAMTFEWDGALNITQIDPGVHIV
FT                   VNVGRNNRYMNPEDTDRDSGVVAAQTNNAQRIHNQLSEYAHTAATATKWRNRAADMLSN
FT                   HKFGVCIHNESQSFGTVSGSLITLRADKKGTYHYADGPPCTTMFEHVEKTLHTGHKHRT
FT                   P"
FT   CDS_pept        637879..638184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1519A"
FT                   /product="HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1519A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51647"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K05"
FT                   /protein_id="CAJ51647.2"
FT                   /translation="MIDRLEKEVDMLERHLQVLRMVIDSEPIGIVKMSNETGYPHHKVR
FT                   YSLRVLEEESLIEPSSQGAITTEQTHEFVDELDEKLNHIVGKLDEMKIEETVEVEG"
FT   CDS_pept        complement(638311..639684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1520A"
FT                   /product="FAD-dependent oxidoreductase (homolog to
FT                   geranylgeranyl reductase)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1520A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51648"
FT                   /db_xref="GOA:Q18K04"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K04"
FT                   /protein_id="CAJ51648.2"
FT                   /translation="MSASQEHDIVIVGAGTAGCYAAATAADAGLDVIILERKTAAEAGH
FT                   IACGDALKGADKFPEAIPKSQLDSAFTNTGVDHGRFEIPQEETVLEIPVPGELAVIDRL
FT                   EYGNRLIEGAERAGTTFQYNTVVQDVVQNDSGTVVGVKATNDNHVIEYNADIVIDGAGA
FT                   LSILQDKADFSNTTFDTNVSYSQFCSAYREIVEVEEPVEWDDALVFKPTERAAGYLWYF
FT                   PRTETTINAGLGFQMSEEPMNLVDDLARDLRKRSEFNNATVKDKLGASLPTRRPYDSAV
FT                   APGFIAAGDAAGHVNPTTGGGIAGAAFAGMYAGQQAVTAISEGDVSEASLWEYNERVMG
FT                   DFGTRFAGLDVYNVLSTAIDVDDLMGLLASLPGEKLAEALYSGTTSFSPLLILKTIKNS
FT                   YGHWGQILNFYRTKNLADDLMGQYERYPSRPEALDSWKSARDDVMDQIYDVTGADVKY"
FT   mobile_element  639724..640230
FT                   /mobile_element_type="insertion sequence:HqIRS59"
FT                   /locus_tag="HQ_HqIRS59B"
FT   CDS_pept        complement(640511..641904)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1522A"
FT                   /note="product: phosphohexomutase (phosphoglucomutase /
FT                   phosphomannomutase) (nonfunctional)"
FT                   /note="gene: pmm2"
FT                   /note="EC_number: 5.4.2.-"
FT                   /note="gene has a frameshift"
FT   CDS_pept        642053..642334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acyP"
FT                   /locus_tag="HQ_1523A"
FT                   /product="acylphosphatase"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1523A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51651"
FT                   /db_xref="GOA:Q18K02"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18K02"
FT                   /protein_id="CAJ51651.1"
FT                   /translation="MSETRTRAHVFVSGTVQGVFYRASTRDAARERGVRGWVRNLDDGR
FT                   VEAVFEGPESAVDSLIEWCHTGSPDASVSDVSVSYTEPEGIDGFHIRR"
FT   mobile_element  join(642365..642397,642506..642525)
FT                   /mobile_element_type="insertion sequence:HqIRS56"
FT                   /locus_tag="HQ_HqIRS56W"
FT   mobile_element  complement(642398..642505)
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AI"
FT   CDS_pept        complement(642614..643066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1524A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1524A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51652"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K01"
FT                   /protein_id="CAJ51652.1"
FT                   /translation="MYTGRTTQPCCLCDNPNTAVRVDIPPRSIMLMQNAGSVAWRDIVG
FT                   TVSVHFCADDWKLIIELVTEMKMNPLGRCNVARASFNIREDFEALLAGTKDEPDQTTLE
FT                   SRLITEARETIDEYEHDPMIEMRDYVEAWITLDTLSELDIIDTSWE"
FT   CDS_pept        643155..644129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="HQ_1525A"
FT                   /product="phosphomevalonate decarboxylase"
FT                   /EC_number="4.1.1.99"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1525A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51653"
FT                   /db_xref="GOA:Q18K00"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:Q18K00"
FT                   /protein_id="CAJ51653.1"
FT                   /translation="MKATARAHPIQGLIKYHGMRDSDKRYPYHDSISVCTAPSATTTTV
FT                   EFQSDASGDVYIIDNERVDGRAAERIDAVVEHVRERTGIRDPVRLVSTNSFPSNIGFGS
FT                   SSSGFAAAAMALVTAAGEELTHPEISTIARRGSSSAARAVTGAFSQLYSGMNDTDCHAE
FT                   RIETDLDATVRTVAAHVPAYKETEEAHREAAQSHMFDARLAHVHHQIDAMRDALYNADF
FT                   DRIFELAEHDSLSLTAATMTGPAGWVYWQPQTIAVFNTVRELRERESIPVYFSTDTGAS
FT                   VYVNTTAAHVDTVESAISDIGIDTDIWTVGGPATVLSASDSLF"
FT   CDS_pept        644167..645414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh1"
FT                   /locus_tag="HQ_1526A"
FT                   /product="probable NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1526A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51654"
FT                   /db_xref="GOA:Q18JZ9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JZ9"
FT                   /protein_id="CAJ51654.1"
FT                   /translation="MNVTVFGAGYAGVTLAQQLESSLCSDIELTVIDDSDTHLLKHEVH
FT                   RVIRRPRVADIIEVPLTTLFDRATVQTAHIQDIDIETQTAQLNTGTTHEYDYGAICLGS
FT                   VTADYDIPGVAEHGLPLNTTADALAIRTALFEAAGVMSTADSSAETSNLRQQSPSDINI
FT                   NPQQHDAVPTNDTSPVDIVVGGAGLSGIQTAGELAALANEAGIQTNITLIEQQPTVAPN
FT                   FPENFQNAVSDALSDNGVRTSTATIVERACENIVKTDTGAFDADIFVWTGGIRGTDAMD
FT                   KNRPTVQSDLRAGTRTFIVGDAGRGIDADGESIPASAAAALREARTVADNLSQLVEYDI
FT                   NGGGGFEPRLDPYRFEVPGWIVTIGDDTVAQLGPEVLTGSAAKAMKASVGAGHLSSVGA
FT                   LTQAAELVDAEIRSSE"
FT   CDS_pept        645541..645984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="HQ_1527A"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1527A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51655"
FT                   /db_xref="GOA:Q18JZ8"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JZ8"
FT                   /protein_id="CAJ51655.1"
FT                   /translation="MRLALIAHDEKKPDMIEFARNRQDDLKRFELMATGTTGKRLKEAT
FT                   GLPIERKQSGPIGGDMQIGSEIASGTCSGVIFLRDPLTAQPHEPDITALLRLCDVHDVP
FT                   LATNLASADAVLDELCAVLTGESELEQADEAGFEIESETTDSV"
FT   mobile_element  complement(646110..646669)
FT                   /mobile_element_type="insertion sequence:HqIRS60"
FT                   /locus_tag="HQ_HqIRS60D"
FT   CDS_pept        complement(646855..647343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1529A"
FT                   /product="DUF371 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1529A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51657"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JZ6"
FT                   /protein_id="CAJ51657.1"
FT                   /translation="MSIESENKNHSTETKEFSEVIHAQGHTNVSARHASTLEVTSDDWL
FT                   TPAGDCILAIDADRVPSDFDTEFIQACQSPNAIITATITVESEAVGTHTEKITGSGSPQ
FT                   LSFDNNRSHVARTSTYTDDRTVLVDGDTAAADIDRDMIDALTTGAKLTLELSVTIQAD"
FT   mobile_element  647540..647815
FT                   /mobile_element_type="transposon:HqIRS114"
FT                   /locus_tag="HQ_HqIRS114D"
FT   CDS_pept        647540..647827
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1529B"
FT                   /note="product: chimeric protein (uncharacterized protein /
FT                   IS1341-type transposase) (nonfunctional)"
FT                   /note="gene has an in-frame stop codon and is truncated at
FT                   the N- and C-terminus"
FT   mobile_element  complement(647828..648218)
FT                   /mobile_element_type="insertion sequence:HqIRS46"
FT                   /locus_tag="HQ_HqIRS46G"
FT   CDS_pept        648642..649565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1530A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1530A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51658"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JZ5"
FT                   /protein_id="CAJ51658.1"
FT                   /translation="MVTKNSVVETHDVESLKESDNISLTDSKLDNGSKGQLIKVAGQLR
FT                   DRRNDLNQMASERASLRDELNAKTREKVDEAQKHREKRDELNEQVQEHKDKRNELNAEA
FT                   NELFDQVEEMKAELELDEGKNIEELEDEIEQLEFRQQTEVLSSEDERELIEKIEDKREQ
FT                   LQQKKQKVEDSGELDSLKEQAEEVRSEASQHHQKVTELADNAQEHHNQMIEAYREADDI
FT                   RDEADAMHELFVEAQETADEHHEDFVRVQKRLRELDKQEEQEREDERTEEREAAKEEAE
FT                   EIYQKFKEGETLDTEDLMKLQKTGLL"
FT   mobile_element  complement(649561..649611)
FT                   /mobile_element_type="insertion sequence:HqIRS81"
FT                   /locus_tag="HQ_HqIRS81E"
FT   CDS_pept        649914..651023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1531A"
FT                   /product="DUF373 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1531A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51659"
FT                   /db_xref="GOA:Q18JZ4"
FT                   /db_xref="InterPro:IPR007254"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JZ4"
FT                   /protein_id="CAJ51659.1"
FT                   /translation="MSTLVLCVDRSDDVGRVSDFETPIVGWEAVQSLVTELGLVDPEDS
FT                   SVNCILEALRVTRKLQDDDADPTVAVVSGGSGSLVGADRSLAAELDTLAERYSAESAIV
FT                   VIDSANDEQVIPVIESRIRVDSVDRVVVRQAHDIQSTYYLLKQFLADEELRTTVLVPLG
FT                   TTLLFLPILLIQFPPTIALAGLTALLGAVLLYKGLAIDQYLEEAPEQVQTALYSGRVSV
FT                   VTYAVGAGLALVGVFLGALAIPTTVSADSVIVQSVQFIYSAIPWLALAALTVSAGRLLD
FT                   EFIESERITTPYLNLPFGVVALGFVVRGFAGWFLQRETILTTPEVFNYMITPQQRLATF
FT                   IIVGIIISIIGVRVAASVNNQTDDDLTQH"
FT   mobile_element  join(651062..651094,651202..651690)
FT                   /mobile_element_type="insertion sequence:HqIRS57"
FT                   /locus_tag="HQ_HqIRS57D"
FT   mobile_element  651095..651201
FT                   /mobile_element_type="insertion sequence:HqIRS42"
FT                   /locus_tag="HQ_HqIRS42AH"
FT   mobile_element  651708..652268
FT                   /mobile_element_type="transposon:HqIRS89"
FT                   /locus_tag="HQ_HqIRS89B"
FT   CDS_pept        complement(651709..652072)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1531C"
FT                   /note="product: IS200-type transposase HqIRS89
FT                   (nonfunctional)"
FT                   /note="gene is interrupted (frameshift,in-frame stop) and
FT                   is truncated at the N-terminus"
FT   CDS_pept        652080..652223
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1531G"
FT                   /note="gene truncated at the N-terminus"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT   CDS_pept        complement(652536..652730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1532A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1532A"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97812"
FT                   /db_xref="GOA:J7RUI0"
FT                   /db_xref="UniProtKB/TrEMBL:J7RUI0"
FT                   /protein_id="CCL97812.1"
FT                   /translation="MEFNRGITGGALVGIVALGTAGLILTEMMPAQIVLMMVTPSMLVF
FT                   GLLCLVIGVKHGEYRTTAR"
FT   CDS_pept        complement(653262..654095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1533A"
FT                   /product="probable oxidoreductase (aldo-keto reductase
FT                   family protein)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1533A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51661"
FT                   /db_xref="GOA:Q18JZ3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JZ3"
FT                   /protein_id="CAJ51661.1"
FT                   /translation="MMARQSPTSSVAPTADGMPLLGLGTWENDNPSECANTIKTALEMG
FT                   YRHIDTAQVYGNEGAVGQGIAAADVPREEMFIATKVWIDKLGYEDVLTSTQRSLEKLGI
FT                   DTVDLLYVHWPVDTYNPVETFRALHKLVSDGKADRIGISNFEPNQVDTAIEKANVPIFA
FT                   NQIEIHPLLPQQELRDHCSKHDIELVAYSPLARGAVFDVPEITAIANNHDVSEAQIALA
FT                   WLRQKGITAIPKAVGHDHIHDNWTSLDLELTPAEIEQIDSIERTNRCVDPRFAPW"
FT   CDS_pept        complement(654623..655990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1534A"
FT                   /product="FAD-dependent oxidoreductase (homolog to
FT                   geranylgeranyl reductase)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1534A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51662"
FT                   /db_xref="GOA:Q18JZ2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JZ2"
FT                   /protein_id="CAJ51662.1"
FT                   /translation="MSTEAYDIVVVGGGTAGTFAAATAASEGLDAIILERKSADEAGHI
FT                   ACGDAIKGTSTFPDVIDRKYLKSESFTNQRIQRAVFENPRGGSVDIDFADHGAVLDRKR
FT                   YGEILIEEAERSGAEIQYDTVVQDVCQDDDGTVTGVRATRNGTVHTYNAEITIDAAGAL
FT                   SILQDKTDFTETYFDTNVSYSQFCSAYREVLEVPDPIEYDDAIVFKPTDELGYLWYFPR
FT                   TATEINVGLGFQMTEDPMQLVETLKQDIMTRPELKNATVKDKLGASLPTRRPYDSAVAD
FT                   GFLAVGDAAGHVNPTTGGGIPGAAKSAHWAALHAVDAISEGDVSESRLWEYNTDVMTSF
FT                   GKRFAAIDLYNLWGTAHNVDELVEIVSAVPGQQLADALSKGTSSMSLKLKLKTLIDTFG
FT                   HWDALYELYKVSRRATEITQIYDTYPDSPSAFKDWQANRDELMDEFYDLTGATRKY"
FT   CDS_pept        complement(656239..657102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="korB"
FT                   /locus_tag="HQ_1535A"
FT                   /product="oxoglutarate--ferredoxin oxidoreductase beta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1535A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51663"
FT                   /db_xref="GOA:Q18JZ1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JZ1"
FT                   /protein_id="CAJ51663.1"
FT                   /translation="MSSDVRFTDFKSDKQPTWCPGCGDFGTMNGMMKALANTGNNPDNT
FT                   FIVAGIGCSGKIGTYMHSYALHGVHGRALPVGTGVKLANPELEVMVAGGDGDGYSIGAG
FT                   HFVHAVRRNVDMSYIVMDNRIYGLTKGQASPTSREDFETSTTPEGPQQPPVNPLALALA
FT                   SGGTFIAQSFSTDAQRHAEIVQKAIEHDGFGFVNVFSPCVTFNDVDTYDYFRDSLVDVA
FT                   ESGHDPTDYDAAKGKILDAEKEYQGVLWQNESAVAYDQKHSITQDMSAVDSGAPDGAMD
FT                   LVREFY"
FT   CDS_pept        complement(657099..658895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="korA"
FT                   /locus_tag="HQ_1536A"
FT                   /product="oxoglutarate--ferredoxin oxidoreductase alpha
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1536A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51664"
FT                   /db_xref="GOA:Q18JZ0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JZ0"
FT                   /protein_id="CAJ51664.1"
FT                   /translation="MPADFNWAIGGEAGDGIDSTGKIFAQALSRAGRHVFTSKDFASRI
FT                   RGGYTAYKVRTAVDPVQSVVDRLDVLIALTPRTIKENHDELHEGSVIIYDGERTTMENV
FT                   EIPDGMVGLDVPLKRLAEEAGGAIMRNVVALGAACAVADFPIENLDSALEKRFGSKGQS
FT                   LVENNKEAARSGRDYVGSEYHNEFDYSLETTDADYVLLNGDEAIGMGAIAAGCKFYAGY
FT                   PITPATNVMEYLTGRIEQFGGHVLQAEDELSAINIALGAARAGARAMTATSGPGIDLMT
FT                   ETFGLIGTSETPLVIADVMRSGPSTGMPTKQEQGDLNMLLYGGHGEIPRFVVAPTTIAE
FT                   CFWKTVEAFNLAEKYQTPVYLAADLAMAVTERTFSPETFDMDDVEIERGKVVDESTIDQ
FT                   WQNEKSQFQPHALTDDGISPRAFPGTTGGAHMSTGLEHDELGRRTEDTDMRVEQVDKRT
FT                   RKVETARREEDLTPRSFGSEDAPNLVISWGSNEGAMVEAMSILDERGIDVHFLSVPYLF
FT                   PRYNLTEAIDEAETVIAVECNATGQFANVIEHDALSRVNRVNKYDGVRFKADELASKIE
FT                   QTIDTASSAGTNEETETTEITQ"
FT   CDS_pept        659150..659827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1537A"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1537A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51665"
FT                   /db_xref="GOA:Q18JY9"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JY9"
FT                   /protein_id="CAJ51665.1"
FT                   /translation="MDATVTVKEAQSVGPQTVAITMQSPPAFTAKPGQFLRVTATIDDE
FT                   EYARFYTISSPDVEETIEITVGIDPSDAGPFSQYLADIESGSKLSIAGPFGQHYYEDSD
FT                   RAVVLAGGPGIGPAVGIGDAAGAAGNEVAIVYVSETATPAHRPRLNALADAGNNVTIFT
FT                   TASDSQSGIVPPEFDDAVADIITGASTEQTFVYGFEGFIEAATDALESASINPDEAKIE
FT                   NFG"
FT   CDS_pept        660093..662072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs1"
FT                   /locus_tag="HQ_1538A"
FT                   /product="acyl-CoA synthetase"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1538A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51666"
FT                   /db_xref="GOA:Q18JY8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JY8"
FT                   /protein_id="CAJ51666.1"
FT                   /translation="MTDDDVELEARLAEQESFDPPASFVDQANVTDEAIYDEFSENWPE
FT                   CWTRAADLLSWDSEYSTVLDDSDEPFYEWFADGDLNAAYNCVDRHVEDGNKNRVAIKWE
FT                   GEHGNTRTYTYQDLYREVNEFAATLQELGVKENDVVTMYMPMIPELPIAMLACARIGAP
FT                   HSVVFAGFSADALATRMNSADSEYLITADGYYRRGDALDHFQKAQEGLDNVEHDVAASV
FT                   VVDRLGDDGFGHELSETQYDWDSLMDAHRGDRVAPVERNAEDMLFLMYTSGTTGEPKGV
FT                   KHTTGGYLAYTAWTAQSVLDLEPGDTYWCSADIGWITGHSYIVYGPLALGTTTVMYEGT
FT                   PDYPERDRLWDIIEKYAVDVFYTAPTAIRAFMKWGTEYPDSHDLSSLRLLGTVGEPINP
FT                   RAWKWYYTHIGHESCPIVDTWWQTETGGMMVTTLPGIGTMKPGSAGPPSPGIDATIVDT
FT                   AGEDVDAGRAGYLTVNKPWPGMLRTLYQNDERFIDEYWEEYSDPDTDEWVYFPEDGAKI
FT                   DDDGYMTILGRVDDVLNVSGHRLGTMEIESAIVGVNGVAEAAVVGGDHDLKGEAVYAYV
FT                   ITEDGYAEDEDLRESIIKGVEDGIGPIARPEQVIFTEELPKTRSGKIMRRLLEEIANGE
FT                   ELGDTTTLRNPEIVDEIEAKVSGD"
FT   CDS_pept        complement(662270..664669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1539A"
FT                   /product="RND superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1539A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51667"
FT                   /db_xref="GOA:Q18JY7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JY7"
FT                   /protein_id="CAJ51667.1"
FT                   /translation="MTTRFGERVRDGLEATGRYAASNQRQVFAVVAITAIISLGVGFSA
FT                   VQMSMGMTLYINDDSQTANNWESLKDTYNTGNNIFVIVESNQLYDPETIRAIDRLDQQY
FT                   GSNVDSIESVTSLADIVRRGADGEIPETKAGVRSAIARVEQRGPVADEMVNRLTPEAGT
FT                   TIILASYGDVDRYDRGAFLPERGADVVYSSVKSETAFAAMPPGMSTTITGQPVFENAAF
FT                   GLMLPEMIALFGGAFSLIFIVVYLVMRETVEKGWHVILPLGTAMTALLYMMGAMGILGY
FT                   NFNAIMLGVMPIALGLGIDYSLQIHSRYVEERRAGNNSLDAIGIATRTTGRALLIAMGT
FT                   TVVGLGSLLVSAVPPVRQFGVTSAVAVLAAMILAVTMLPALLVRFDRDGHVATETTSKS
FT                   SDDWLQAVLHRFTSSVTGGHPLITLGIAILLVSGGVYAYPQVEPKQEMMDFWPQDLAEK
FT                   NDMEELSETVESPKVVYVMIDTDQAYTPETFRDVATYQRLMIANEQVNAVQSPVTSVQM
FT                   ATDGSIPQTQTGLTQTIERLHNTDGMTDVRDPDETPSTIVLSFYVDDIEGESVRSLITA
FT                   FETNAALSLMTAEDVRITGKPVLNRNVIENVTAGLTPMTLLSFGLGLSFLAFAFLSIRI
FT                   AAALVLSVAASAAVLVTGAMYVFGIPWNPLTITMSSLTLGIGVDYGIHLFERFEYEVET
FT                   QGQTQRGAAATAVAKLSRPIIGSSFTTIFGFGVLMISRFPVLANFGRTTVLAISFALLT
FT                   AFTVLPAVLTVAPILGSPPESNPIDTDINQHTDTDTPSTNDPTTSD"
FT   CDS_pept        complement(664675..666399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1540A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1540A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51668"
FT                   /db_xref="GOA:Q18JY6"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JY6"
FT                   /protein_id="CAJ51668.2"
FT                   /translation="MSVHYPRTTAIAINLDVCNNVYTMQYYLGKRWRAILLITIMVVAA
FT                   FAAGSGGVAAEQYNDFSKPELTPTIQQQNVVAAGEMKSFDLLIQNRHTGITSMDRQIGD
FT                   IAQVVQTHRIQVGSATAVTASVDAGDTPLDIRTAQQSLGTIAAGDARKMGLTIEVDQHA
FT                   QPGVYQLPVKITYGYINSINVDKNDYFINRNTQTVKKHITVRVEKSVRLGVRDVTGADL
FT                   YKDADGTMTVRVQNTGSEIAQNAELSIVQSEYFNPKSNAVSVGELKPDETATAEFQVGV
FT                   ENVDAAGAYGVNFQLRYEDENGNPEQSLTRTGSVAVSNGPQYKLSTEARAMYVDSIGSV
FT                   AVTVTNTGERTAPNARAKLSPIEPFALVSTSASLGTLNPGESATARFKLEVSDRAIPQE
FT                   YPLTVRIIHDDTYGNDVTSDPLSVDVPVGPEKSFAVTNTAAVTAGQTETLRFTIKNTGE
FT                   GEFRDAVVRVNANSPFETDDDTTYIGMLKPGETTTVSYTVSADGSAAAKTYSLDTSIKY
FT                   DNAFGETVVSDIQSAPITITASDGGLPVSGIVIAGVVIPIALVAGVVYQTKPFSRLR"
FT   CDS_pept        complement(666448..666711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1541A"
FT                   /product="NP_1176A family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1541A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51669"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JY5"
FT                   /protein_id="CAJ51669.1"
FT                   /translation="MSTTEALAGEETSSDRWDPVREMPPSAKLVAKVLDYNEQLTQSQL
FT                   AEETLLPPRTVRYALSRLEDADVVEARISFTDARKRLYTLAI"
FT   CDS_pept        complement(666792..669257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1542A"
FT                   /product="RND superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1542A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51670"
FT                   /db_xref="GOA:Q18JY4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JY4"
FT                   /protein_id="CAJ51670.1"
FT                   /translation="MIDYQSLIDQVDEWIINRDKTVILIFILITAVLAVGFGMTATDSG
FT                   TSQFSEGVPAQEAFEDVNDNFEREPFGTGTGTTTLIQRDRNVLTKSAVLAMLRAQHRIQ
FT                   RDTSQNVVSTNSVAQTVATEIDPTATTLSAQIDVVERTPQSGVRTVTRTIVRTQPSVRS
FT                   RLSDDLNERDPSASATIATITHQVAGTSDDAGTQSGSPLTSLQREATFIVGSTSGDITV
FT                   FGSGIISGELGGVITDSLIIVVPAAVILIFIFLIIAYRDPIDLIIGLVSLAMTIAWTFG
FT                   FMGWARIEFTQILIAIPPLLLAVGIDFGIHAINRYREERVTGEDISSSMRTTTDQLLPA
FT                   FSIVTGTTVLGFAANGVSDLAPVREFGLVAAVGIIFTLLIFGIFLPAFKHLLDRKRVEY
FT                   SIPSFGTTPIGRAGSVGGQVLGVGVVIARRSPYIFLLVILILTAALGGYGTGVETRFTT
FT                   DDFLPPEETPGYLEELPEPFAPGEYTVTKTTNYLENTFESSEDDTVTVYVEGSMRQGST
FT                   LEILHKTNQDPPDSFVTAERESQPQSILTVIDQYERESASFRRLISAKDQNGNGIPDHD
FT                   LGIVYDQLFASSYGDQARLYLTDDYTATRLIYSVKAEKSQAAITADTRQLATEIRMEST
FT                   ATGSVVVRKAVSDVIAESAYTSLVIAVLTAAVFLVAIYWLLENRPGLGIANILPVLLTI
FT                   AGLASTMRYLDIPFNVLTGTTLSVGIGLGIDYSAHFVHRFTEEYRGEVDRFEALSVSVR
FT                   GTGGALAGSMLTTTSGTGVLILAITPILGQFGLLIALSVLYSFIASIFVLPAALIGWTD
FT                   IRRQLWIDT"
FT   CDS_pept        complement(669383..671017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1543A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1543A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51671"
FT                   /db_xref="GOA:Q18JY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JY3"
FT                   /protein_id="CAJ51671.2"
FT                   /translation="MNRSFVAGLLVGLILISAVGPAIALAQIDPTGQVLGRPSISVSSV
FT                   QQTVSAGTEAEVQFTLTNRGRIDKGGPDEYETRVTTARALTVEFADEKTPIEIDTGTIS
FT                   VGNVETGTTQTPPITVTIPEGIPPGDYEIPLEYEYAYTRIASYNTENVEYNDFTERAST
FT                   SVEITVREEAQFKVTGQNAVGQIGDDRTIRLTLMNTGSRTAFDASVTATSKSDELTFGS
FT                   DSESSTAYAGQEWEPGERRTITYRAHIADTAALRNYTLDLDVGYTDRNGIEQTSTALSA
FT                   GVATIPEQTFAVNSVDTALRVGTEGTLTAIIENTGPQPVFNAVSIISVNNQNIDITTSE
FT                   YALSTLRPGETAQVQYDIDISEAATATPQQFSLTVQYNTERGSRRTSDMLQATAAVREQ
FT                   RDRFIIQATEETVTAGGQTEFKLQVTNNGEQPLESIEAKAFLDAPLASSNDEAFIAALD
FT                   SGETTTIVMPLSADSGALESKTYPFAVDFQYDLPSGETKISKTYKVPVNIQQPADQGGL
FT                   SLPLSAPIIGGSILIIIIGSAVWYRRG"
FT   CDS_pept        671373..672590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pan2"
FT                   /locus_tag="HQ_1544A"
FT                   /product="proteasome-activating nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1544A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51672"
FT                   /db_xref="GOA:Q18JY2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR023501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JY2"
FT                   /protein_id="CAJ51672.1"
FT                   /translation="MSDTVNDVDLPYDEETASQQEKIQALRERLDILESQNEEMRDKLL
FT                   DANAENNKYQQKLERLTHENKKLKQSPLFVATVQEITNNGIVIKQHGNNQEALTEVTDE
FT                   MRTELEPDTRVAVNNSLSVVKRLDDETDVRARVMQVEHSPSIRYDDIGGLETQMQEVRE
FT                   TVEMPLKSPEMFETVGIQPPSGVLLYGPPGTGKTMLAKAVANQTDASFIKMAGSELVHK
FT                   FIGEGAKLVRDLFEVARENEPAVIFIDEIDAIASKRTDSKTSGDAEVQRTMMQLLSEMD
FT                   GFDERGDVRIIAATNRFDMLDEAILRPGRFDRLIEVPKPGIEGRKIIFQIHTREMNVSD
FT                   NVEFEQLAEMADDASGADIKAICTEAGMFAIREDRTEIGMGDFIEAWEKIQSESNTDGD
FT                   TARAFA"
FT   CDS_pept        672656..673342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nthA"
FT                   /locus_tag="HQ_1545A"
FT                   /product="endonuclease 3"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1545A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51673"
FT                   /db_xref="GOA:Q18JY1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JY1"
FT                   /protein_id="CAJ51673.1"
FT                   /translation="MGKPRTDRTQQVDTVLRRLAERYPDSTISLQFSNRLELLIAVVLS
FT                   AQCTDERVNSITADLFEKYETATDYAAADTDELAEDIYGITFHNNKAGYLKSIGETLAA
FT                   DYDGDVPDTMDELTALSGVGRKTANVVLQHGHDVVEGIVVDTHVQRITRRLGLTDEQTP
FT                   KQIETDLMESVPESEWQQFTHLFISHGRETCTAQNPDCTDCILESVCPSSKCDHDIDLA
FT                   SNTPWK"
FT   CDS_pept        complement(673435..673914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1546A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1546A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51674"
FT                   /db_xref="GOA:Q18JY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JY0"
FT                   /protein_id="CAJ51674.1"
FT                   /translation="MLSESTIALIAASMVTASLPFYLYGAWIMIDAETVTWGVLTYHLK
FT                   FIIPGLILNTIPVVTWMIPRLLQQLGGAVALHAVLGLQAYALLAFALTGIVRILQVKRN
FT                   AGFYDDPNQQTELNDLHPNMSAWRGRLRVGVFGYVGLWFLAWSLGLYLYMTKYVL"
FT   CDS_pept        674041..675066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1547A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1547A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51675"
FT                   /db_xref="GOA:Q18JX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JX9"
FT                   /protein_id="CAJ51675.1"
FT                   /translation="MTESSSDETAISDDTDAVAAEDADDSSPDQTDTAQQRTHEDGDSS
FT                   QGRNGSANEHPDEDEQAIAELRAEVEETYDFGDFGPEDMAEMTLEEWEAAFDPDTWIVG
FT                   EELLDRVETELKARVAIREVFGIVERTDEGGQDRVVAYSDNGYATVFADGSVEGEGTIR
FT                   RDVEPTVALCSMDSYETMNPPADASLPEPRDVVKGSGEFGNLMLQIVAAAQMIVGVGLL
FT                   GAWLFISTLETIAAPVTAVIFVLIGFFLFIVVANARLSDRFRVEEYRNRLQALETTPEP
FT                   EVTSNERTALDTEEAKSNIDINNDDTNTSMSSDTATADANIDVNPNANSHTDSEEHTDS
FT                   I"
FT   CDS_pept        675339..676028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcp1"
FT                   /locus_tag="HQ_1548A"
FT                   /product="halocyanin"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1548A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51676"
FT                   /db_xref="GOA:Q18JX8"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JX8"
FT                   /protein_id="CAJ51676.1"
FT                   /translation="MKRRDFVRAASVPAAAATASATAGVGSAQEMGTTTETPSGTGTTS
FT                   TTGTGTDTGTVTGTGTETGETDDNAAAGGPTKTVTVGPDGSLVYEPGTSDPLKIAPGTT
FT                   VEFVWDSDNHNIAVESQPDAADWQGHETLENAGFTYSHTFETLGTYEYFCQPHKTAGMV
FT                   ASIEVVENPNAGGGGGGGEKELHSLGVPIQAHWVGAATILAIVVTVIFTFYILKYGESA
FT                   HTGTGRN"
FT   CDS_pept        676031..676417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1549A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1549A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51677"
FT                   /db_xref="GOA:Q18JX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JX7"
FT                   /protein_id="CAJ51677.1"
FT                   /translation="MSSSGSTYGDIHRYEPARESTAAAIAIVLLTVVEVIFVFLFTYGL
FT                   VSGWGLTDTGNMFLGAVLAVIFVDLAFILALYRKEFLPDVVIVKKRRRKWEDLYIREDD
FT                   VDGTGFADGAWDQIKHAIYPYYKR"
FT   CDS_pept        676421..677227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="HQ_1550A"
FT                   /product="cytochrome bc1 complex cytochrome b subunit"
FT                   /EC_number="1.10.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1550A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51678"
FT                   /db_xref="GOA:Q18JX6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JX6"
FT                   /protein_id="CAJ51678.1"
FT                   /translation="MSLEKKDEYDHKSWMKKKDLTPIESVFLTSLIWLDKRLRIVDYLE
FT                   LMETLYYRVNLQMPKSHTEQYNLDNKFWYWYPLYTLGFFSTLAYVVAAISGALLGFYYS
FT                   PSAAAGGEAAGTVAYQSIAIIMQDLQFGFMLRSIHRWSAQVMVAAVFLHMLRVYFTGAY
FT                   KEPRELNWLIGIVLISLTMVFGYTGYLLPWDQLAYWAGQIGVEMSLSIPLAGEWIAQLL
FT                   FGGFSLGQATLQRMYIIHVFLLPFVVTTLIAIHIGIVWVQGIAEPH"
FT   CDS_pept        677232..678050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petD"
FT                   /locus_tag="HQ_1551A"
FT                   /product="cytochrome bc1 complex cytochrome b/c subunit"
FT                   /EC_number="1.10.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1551A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51679"
FT                   /db_xref="GOA:Q18JX5"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JX5"
FT                   /protein_id="CAJ51679.1"
FT                   /translation="MSDNTTTSNTNTGSDADTDASTDARERDIRTDGTGIVAPDDETPA
FT                   WSERKNRSTGLSRLTYEYFERARREDQDLRQESDYVERDVLAFPTWPHEIIRNLAIASF
FT                   FTGMILFLSATLPPHIGSPANPSSTPAIILPDWYLYWSFGLLKLGPLNPELAILGGEKL
FT                   MSDRTYGVLANVVVVGVVAIVPFLNKGSARRPVEQPFWAAVGVGGVIFAFTISVYSAKN
FT                   LIPMNVHLLFDLTFILPVVAGFVTWAVLKTMREGYSYDLNRRYYRLRPPK"
FT   CDS_pept        678557..678907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1552A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1552A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51680"
FT                   /db_xref="GOA:Q18JX4"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JX4"
FT                   /protein_id="CAJ51680.2"
FT                   /translation="MTTESESERRDIVVPMRVYKTVTVFSTLLAVVSVVIGFLFLDAAT
FT                   LNVSLVGDLVRFILVILNISIPESVLSSLFAVIGLGSIGLGAGVYVIGTRFRAQGMGKS
FT                   QEDASESSDTNG"
FT   CDS_pept        678900..679172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1553A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1553A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51681"
FT                   /db_xref="GOA:Q18JX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JX3"
FT                   /protein_id="CAJ51681.1"
FT                   /translation="MADEFIKGLGIFTAGGLGWMVLAGWYRTESFESSQQLVAPVSLSD
FT                   SATMFDTMGVLLMDTFFWFTIIGALTFWVLIPVVRQAREVIQDGS"
FT   CDS_pept        679558..680007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1554A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1554A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51682"
FT                   /db_xref="GOA:Q18JX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JX2"
FT                   /protein_id="CAJ51682.1"
FT                   /translation="MHPLQFIIPLDALAAVAPILAYITLGLALLNLLTRIVQHRFHLKQ
FT                   AKASDDDEGLNRWLPHTATTVGLVLVSFLYMIPHPHGGMVMSVLALGVLFADFFEYESR
FT                   LVEARSKSKQLSRPIAAVGASAFMLLYAAYQSVFFVIEPVWNSIV"
FT   CDS_pept        complement(680539..681477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1555A"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1555A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51683"
FT                   /db_xref="GOA:Q18JX1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JX1"
FT                   /protein_id="CAJ51683.1"
FT                   /translation="MRVRSALGALAAGVGGLSGINAVLNRYVDSIDPALSGEHNTLTWS
FT                   GIDISYTEAGDPTDHTLVLLHGINAAGSNGEFRRIFTALAESYHVVAPDLPGFGTSDRP
FT                   PLRYSDTFYEEFVQAFLSEDRFNSVSVVASSLTGAYLASIHEDIETDIESVVLICPTEK
FT                   GGPNRIVALRELLRAPVIGTALFNLLTSKPSIRYFNADHGYYNIENVSETWMEYEWQTA
FT                   HQPNARYAPASFISGFLNESEELKTTLSDIDVPVTLLWGREADITPLQRGRELAKDAGC
FT                   RLVVVDDAKLLPHVEFPDQCVETIQSAVSRR"
FT   CDS_pept        complement(681608..681865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1556A"
FT                   /product="MTH865 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1556A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51684"
FT                   /db_xref="InterPro:IPR024093"
FT                   /db_xref="InterPro:IPR036825"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JX0"
FT                   /protein_id="CAJ51684.1"
FT                   /translation="MTDTESELRQQFHDAFSGAEFPVDSQMDLVPTLPDGPKTKFHADE
FT                   VTLTALEMAAKLGTHQDFPYADVDSLVDDIIEGLKAEEMI"
FT   CDS_pept        681987..682517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcp2"
FT                   /locus_tag="HQ_1557A"
FT                   /product="halocyanin"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1557A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51685"
FT                   /db_xref="GOA:Q18JW9"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JW9"
FT                   /protein_id="CAJ51685.1"
FT                   /translation="MELSRRALLTTAVGSAAAGGAIGTATAQADGSSTTVTVGPGGSLV
FT                   FEPGTAESLQITPGTTVEFVWDSDNHNIVVESQPDSANWEGHEPIENAGFSYTHTFETL
FT                   GAYEYFCQPHKTAGMGASIEVVESISTPAPSNVPTVPSSAKTLGVATALAMVATLGLGF
FT                   FFLKYGGDYDIEE"
FT   CDS_pept        complement(682679..683740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gth3"
FT                   /locus_tag="HQ_1558A"
FT                   /product="probable glycosyltransferase, type 1"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1558A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51686"
FT                   /db_xref="GOA:Q18JW8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JW8"
FT                   /protein_id="CAJ51686.1"
FT                   /translation="MRVAFVSLYVDDQRTEGATRRIRRIAEGLAARGHDVTVCCSRWWQ
FT                   GSVSTFTQNDVAYIGLTEAKTPRAFALKLPFVLRRIAPDIIHATNSPPSQVIAAATAGI
FT                   MIRTPLVVDWWQVDETDHPWVVRRAARAGSRHFTPSQLIKTDVRSVGGDTDSIIRLPES
FT                   IDFELVRDADIYDRADIVYARRLDDESNIDSFLLALAELRNKQWRTAVIGDGPQRSDAE
FT                   AMARDLRIDDRITFYGSMELEQFVSTLKGAHVFAQTASVEPFARELLWALACGCVGVVE
FT                   YQARSSAHELLEDYERGARVTDPEGIAAEIESAAEINSSVIAESFSKYDHRAVLKQYED
FT                   QYVAAQSEFGWFS"
FT   CDS_pept        complement(684008..684643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1559A"
FT                   /product="DUF420 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1559A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51687"
FT                   /db_xref="GOA:Q18JW7"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JW7"
FT                   /protein_id="CAJ51687.1"
FT                   /translation="MATASAEMSLKRHPLAATIILSVVGYAVVIGTFIGIVPAQIYPDL
FT                   SLTEVNIISDAIAVVNAVNVIVILAGWRWIRRNEVRKHAAAMLTSFGLILIFLVLYLTK
FT                   IGGGGTKEFVGPAVAYYPYLGMLAIHILLSIISVPVVLYAIVLGITHTPQELREQTPHR
FT                   RVGRIAASAWVLSLTLGVVAYVLLNHTFGWEYIESGTAVILTMIMILV"
FT   CDS_pept        complement(684879..685925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="HQ_1560A"
FT                   /product="glycerol-1-phosphate dehydrogenase (NAD(P))"
FT                   /EC_number="1.1.1.261"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1560A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51688"
FT                   /db_xref="GOA:Q18JW6"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18JW6"
FT                   /protein_id="CAJ51688.1"
FT                   /translation="MLKKTTWIKLPRNVLVGHDVIGDLAAAIEELYLDGRPLIVTSPTP
FT                   DQLIGNRVRSQFADPQTVSVDHASFDAVEAVIDTAKATDAGYLIGLGGGKPIDTAKMAS
FT                   DRLGCGFVSVPTAASHDGIVSGRSSIPEGDTRHSVAADPPLAVVADTAVLAEAPWELTT
FT                   AGCADIISNYTAVKDWQLAHRLQDVEYSEYAGALSQMTAEMLVDNSDAIKQGFEESAWL
FT                   VAKALVSSGVAMSIAGSSRPASGAEHLISHQLDRLVPDAALHGHQVGVASIVTAYLHTG
FT                   ENGEWEDIRAALADVGAPTTATELGIDEEIFIQAITSAHAIRDRHTILGNGVSEAAARE
FT                   AAVFTDVC"
FT   CDS_pept        complement(686129..686893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1561A"
FT                   /product="LysE family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1561A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51689"
FT                   /db_xref="GOA:Q18JW5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JW5"
FT                   /protein_id="CAJ51689.2"
FT                   /translation="MIALSMTALTGVIFGLALAAPPGPMNAIIAEESAVRGWTAGFLAG
FT                   LGAMTADIIFFVLAAFGVITIVERAPLLRAGMITLGGVLMLYFAYGAATEIHSAFGISN
FT                   TNTGTHTLKEDNSESGSKTTQKNTNLNSHVGTGFRKAFILALTNPYQILFWLTIGVGLL
FT                   QSGTLDILAQTPYIGSLLTGLVIVETGSPTLIIGFFIGIIIWITGFPASLVRIGRRVNK
FT                   LAPVVAGGSAIVLAGFGMIFILRGVRKALIII"
FT   CDS_pept        complement(687148..687867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1562A"
FT                   /product="Gdt1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1562A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51690"
FT                   /db_xref="GOA:Q18JW4"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JW4"
FT                   /protein_id="CAJ51690.1"
FT                   /translation="MSTYLEILIIAFITQLAVLPGEKVQFIIAGLSTRYDPIVVVAAAG
FT                   SAFAGWTALEILFGQALQAVLPPIALNVVTASLFLLFAILLYRSAPSNNNTNPDVSDTT
FT                   TAETDGGLAALEMVTLPGPLNRVSGSFGGFLPIFILMVTGEFGDKTQLVTIGLAVQYGA
FT                   TSAIWIGEMLAIIPISLANAYLFHSFSGRVNMRTAYLGSALLFGFFGIDAIMSILFDFS
FT                   VWETIIAEITTAVSAAV"
FT   CDS_pept        complement(687864..688811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirR1"
FT                   /locus_tag="HQ_1563A"
FT                   /product="SirR/DtxR family transcription regulator SirR"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1563A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51691"
FT                   /db_xref="GOA:Q18JW3"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JW3"
FT                   /protein_id="CAJ51691.1"
FT                   /translation="MLSDAMEDYLKSIYRLQAEKGPPVSTSAVADTLEKTPATVTSMFE
FT                   TLTDRELLIYEKYEGVELTTEGETVALAVIRRHRLLESYLADQLGYKWSEVHGEADALE
FT                   HHISEVFERRVAAALDDPQVDPHGDPIPTADLTPLSDAASGPLSACEEGEHVVVVRVRD
FT                   RDPTELEYLDRVGIRPGTELTIVDVAPFGMITVAIGENDIDCGQTTMQTVSSSNISATA
FT                   DSTDHPSNTELLSAEQRISSDDNSNSLISTSIAESDNKPNGTTNVLTQSLPDDVAESVR
FT                   IRSLDETANSSGIDSYAETHEQGNEPESDEVSNA"
FT   CDS_pept        complement(688932..690146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC2"
FT                   /locus_tag="HQ_1564A"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1564A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51692"
FT                   /db_xref="GOA:Q18JW2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JW2"
FT                   /protein_id="CAJ51692.1"
FT                   /translation="MKTSESFRGLYCTASGDQHDLTATGPTDTGGRLEPMYDTSGIEWG
FT                   MDTSAFERGSDADTDNDLDITTRSMWRYNELLPFIDPITAGEGDTPLVTAPQLAAEVGV
FT                   ETLAIKDEGRNPTGTILDRGLSSAVTAARETGADLLALATPGNAGQSAAAYAGIAGLRS
FT                   YAFVPSRTPFSNKAMVNVHGSEMRVAGGRYPDAEDALAEQLQSDWYTLQEFDNPYRHDG
FT                   IKTVAFELAEAHGWDMPDAIVVPAGTGEVVAGVAKGFRELTAADILDSMPTLYAAQPSG
FT                   CAPIVDAATEGAVEVEPWDNPDTIVGELEIPDPNGGTVALEAIDECDGEIIAVDDDAIL
FT                   EAAVVAAQHAGLEIGAAGGAAIAAVDKLADRGVFDPTDTVIAVNTESGTKTADVLRSHL
FT                   MGKGI"
FT   CDS_pept        690369..691649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1565A"
FT                   /product="amine oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1565A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51693"
FT                   /db_xref="GOA:Q18JW1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JW1"
FT                   /protein_id="CAJ51693.1"
FT                   /translation="MSTDSVVVVGAGLAGLVAARHVAQTGATVTVYERQSDVGGRVQTR
FT                   HQDGFIIDRGFQVLFTSYPAVTRELDLDSLSLRRFTPGAVIARPGSRSVLSDPLRDPRA
FT                   AISSLQNNEVTQTDKIRTLLLRQHVGTRTEKEIFESPDQSIRSYLQEWGFSDDYLDHFI
FT                   APFYGGITLDRSLSTSKRVFEYTFKSLSTGEIALPANGMQAVPQQLAMHARDAGASIVC
FT                   EEGVTDIIDHTDSVTIETDTTTTDADAVIIATDPADARQLTGVNSIPTDTRGCVTQYYE
FT                   LPVTDAPETRKKIILNAAEPAPNTVVPLSNVASEYAPDNKALLNATFLSSAAFEHDIDT
FT                   LAEQTQSALSSWYSDRDFDSLKPIATDRIEFAQFDQPPGVHDALPQARAPGGRVYLAGD
FT                   YTTWSGIQGAMRSGREAAVAVNTDRST"
FT   CDS_pept        692330..693103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1566A"
FT                   /product="probable short chain dehydrogenase/reductase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1566A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51694"
FT                   /db_xref="GOA:Q18JW0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JW0"
FT                   /protein_id="CAJ51694.1"
FT                   /translation="MTPRISSQTEALLIGGSSGIGLETAKRLSDRGINVHLVGRTEKKL
FT                   INAVDNLPGDGTGEYSTVNLYDSDDVTAFIEAIEESEASIEYLVNAAGSFQPKPFLEHT
FT                   EADYDKYHDINRSFFFITQAVAQAMVEHGGGSIVNVGSMWAQQAIEETPASAYSMAKAG
FT                   LHTFTQQLAIELGEHNIRINAVSPSVVETPIYGEFMDPEDIHENLQAFNDMHPTGSVGQ
FT                   PDEVAAVINFLLSEETSWVTGAIWDVDGGVMAGRT"
FT   mobile_element  693435..693692
FT                   /mobile_element_type="transposon:HqIRS5"
FT                   /locus_tag="HQ_HqIRS5A"
FT   CDS_pept        693435..693692
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1566B"
FT                   /note="product: ISH9-type transposase HqIRS5
FT                   (nonfunctional)"
FT                   /note="gene is interrupted (frameshift,in-frame stop) and
FT                   is truncated at the N- and C-terminus"
FT   mobile_element  complement(694066..694628)
FT                   /mobile_element_type="insertion sequence:HqIRS71"
FT                   /locus_tag="HQ_HqIRS71E"
FT   CDS_pept        complement(694135..694314)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1566C"
FT                   /note="the underlying mobile genetic element is noncoding
FT                   but has a region of high similarity to the C-terminal
FT                   region of transposons with an IS1341-type transposase gene"
FT                   /note="pseudocoding frame (HqIRS71 element)
FT                   (nonfunctional)"
FT   CDS_pept        complement(694772..695494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1567A"
FT                   /product="probable phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1567A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51695"
FT                   /db_xref="GOA:Q18JV9"
FT                   /db_xref="InterPro:IPR004376"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JV9"
FT                   /protein_id="CAJ51695.1"
FT                   /translation="MCVINTDIVYRSRALWMPDAATLVISDLHIGRDEASNVQLPLGER
FT                   DDLLERIQTHLKELTPETVVVAGDIFHRFEGATSDNRRTLAALVDACSDVDATCIFVRG
FT                   NHDTGLDSTYNTTVVDSYTVEGLTAESPKTVICHGHTEPTITAERYIIGHDHPAITIEG
FT                   QRHPCFLSIPDSYQEANIIMLPAFSRLAAGVSINTASGNDLQSPLITRLEDARPTIYDE
FT                   QAAESLSFPPLRSLRTML"
FT   mobile_element  complement(695511..696032)
FT                   /mobile_element_type="insertion sequence:HqIRS71"
FT                   /locus_tag="HQ_HqIRS71N"
FT   CDS_pept        complement(695516..695713)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1567B"
FT                   /note="the underlying mobile genetic element is noncoding
FT                   but has a region of high similarity to the C-terminal
FT                   region of transposons with an IS1341-type transposase gene"
FT                   /note="pseudocoding frame (HqIRS71 element)
FT                   (nonfunctional)"
FT   mobile_element  696096..696361
FT                   /mobile_element_type="insertion sequence:HqIRS35"
FT                   /locus_tag="HQ_HqIRS35AH"
FT   CDS_pept        696594..697430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1568A"
FT                   /product="arNOG05395 family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1568A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51696"
FT                   /db_xref="GOA:Q18JV8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012015"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JV8"
FT                   /protein_id="CAJ51696.1"
FT                   /translation="MSGALEDKRTATRFRILVEIADRQPAVNQGEIAEAVGVTSQAVSE
FT                   YIRDLVAEGYVDKEARSRYTITKEGVDWLFQEAKGLRRFVNHVTDDVLENVKEDAAIAT
FT                   DAIEPGETVTLSITDGLLHATPGDAGPATGVATTAADSGDEVSVTGFEGVIQMDPGHVT
FT                   VIQLPPARSGGSQVVSIDELATICAGGDIVVATGVEAVVALRRADITPTTSLAAGSVAA
FT                   DGATRGLDSVVVATVDLVGQVTDTLRDDNVLYEVTQLADADVDPDMNANITHRDSE"
FT   mobile_element  697476..697576
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AH"
FT   CDS_pept        complement(697576..698223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ2"
FT                   /locus_tag="HQ_1569A"
FT                   /product="DnaJ N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1569A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51697"
FT                   /db_xref="GOA:Q18JV7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JV7"
FT                   /protein_id="CAJ51697.1"
FT                   /translation="MIVLLEWLSSFPSWLVFGVLAGGCATVIIAGVFIIGGRLFPDDTN
FT                   RFGTTGGKFNRRRGEFRSYFRAIDEPFVEERELAGETIAFYLSDHEVAVTFDAQVYFNL
FT                   DRAGIETILCEYEMPVRALGRRLPFEVSDPDSTPGANNRTQSASITAAYDQLGLRTTAD
FT                   AEAIRDAYREQVKTVHPDHGGTQAEFNQLQEAYTIARDHAEHTNCETVSRSD"
FT   CDS_pept        698369..700726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsA1"
FT                   /locus_tag="HQ_1570A"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1570A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51698"
FT                   /db_xref="GOA:Q18JV6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JV6"
FT                   /protein_id="CAJ51698.1"
FT                   /translation="MAVSWLDEVRSTDVGTVGGKAASLGELTDAGLPVPSGFVVTAATY
FT                   REFIETAGIDKELFNVVDVDHEDSTALREAHERAHQLIVETPMPDEVKQDILDSYYSLN
FT                   TTESRTDGDTSDDSESDPFVAVRSSATAEDLPDASFAGQQETFLNVRSDNLVDRVKECW
FT                   ASLFSQRAIYYRNRQGFSHSNVDIAVVVQQMVDAEKSGVMFTSHPSSGDPQIIIEAAWG
FT                   LGEAVVSGAVSPDNYTVDRETAETTSVSIAEKKMMMVKDAQTGETVEQDVSVDKRDARV
FT                   LSDDEIAELVALGKKVESHYGEPQDVEWAIYDGSVHMLQSRPITTISDDTRPGSESNQQ
FT                   ASNGEINADSPNSTESANDAEILVRGLGASPGIAAGEARVVTKLDHLDQVSDGDIIITE
FT                   MTMPDMVPAMKRASGIITDEGGMTSHASIVSRELGVPAVVGAGSATTTLDDGQLVTLDG
FT                   DKGTVREGEAEEEEQPHEPTEDARPTTPVKPMTATEVKVNVSIPEAADRAAATGADGVG
FT                   LLRMEHMVLSLGKTPEQYIADNGERAYIDELVDDMRTAAEEFYPRPVRIRTLDAPTDEF
FT                   RQLEGGEDEPHEHNPMLGYRGIRRSLDAPEIFKHELDAFRRIYEMGYDNVELMLPLVND
FT                   AEEVIQARELMKRAGIDPSTQEWGIMIETPAAALEIEEIAEAGVDFVSFGTNDLTQYTL
FT                   AVDRNNEHVADQFDELHPAVLSLIDNTIETCRDLGVKTSICGQAGSKPKMVQFLVEAGI
FT                   SSISANIDAVQDVQHEVKRVEQRLILDSVRSS"
FT   CDS_pept        701028..701600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1571A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1571A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51699"
FT                   /db_xref="GOA:Q18JV5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JV5"
FT                   /protein_id="CAJ51699.1"
FT                   /translation="MISSDGGLLLPVSLFGDIWPEFGWLSAAVERATGWGGLIIIFIYS
FT                   FLIAFALPGVSEIVLLAPIDLGLSQTGRLGIIMLVSGAGKAAGSVFAFHLGQEVKQSGP
FT                   VLQLFQNSWFDLISWSERRTVALAQQWGYAGLAAALSVPGFPDTISIYAFSVLEEDYLK
FT                   FALATFIGSIGRLIVTVIGVGAVSAFI"
FT   CDS_pept        701718..703943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="HQ_1572A"
FT                   /product="methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1572A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51700"
FT                   /db_xref="GOA:Q18JV4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18JV4"
FT                   /protein_id="CAJ51700.1"
FT                   /translation="MTMKQYTMSKMNAETQTQTRESFPTDDPAVVTCGLPYANGDLHIG
FT                   HLRTYVGGDIFSRALKRLGQETAFVSGSDMHGTPVAVNAAEEGVTPESFALRHHEQYET
FT                   TFPQFGIEFDNYGHTHDETNVEMTREIVEALIQAGYVYEREIPVAYDPAADQWLPDRFV
FT                   NGTCPYCGAHARGDECDEGCGRHLEPGEIETPVSTITGNDAEYRRREHQFFAVSELQSY
FT                   LSSFLDRLEGTTNAQNQPREWVEGELQDWCITRDMDWGVDYPDDNDLVLYVWVDAPIEY
FT                   ISSTKQYAERVGTDSFDWKNAWRDIPGVRSHSSSSAKDSSEGNSPSNINNGGEIIHIIG
FT                   RDIIQHHTVFWPAMLHAAGYTEPRAVMASGFITLEGKGFSTSRNRAVWADEYLAEGFHP
FT                   DLLRYYLATNGGFQQDVDFSWSRFRERVNNELVGTVGNFIYRSLLFAAREFDGTPDVAL
FT                   SDSVEERIETAIDAFTAGVNEYSVRAVGDAAVKLAQFGNEYIQHHEPWKLSNDDPQKQQ
FT                   VMRDCIQLAKAIAVLFEPVTPAAAERVWADLGESGDIHTVGIESALVAPPQTFDEPTEL
FT                   FEKIPEERVDELTAKLADRVTDPTDDDDSDTDTETGTDVAETTNESHSESNMTEIDPIA
FT                   DERIDFEEFEELDLRVAEIIETEPIEDADKLARIVVDLGIEQRQLVAGIRQLHDLDDLI
FT                   GETVVIVANLEKAEIFGVESNGMLLAAGADADLLTTREDADPGTSIQ"
FT   CDS_pept        704009..705769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="HQ_1573A"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1573A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51701"
FT                   /db_xref="GOA:Q18JV3"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JV3"
FT                   /protein_id="CAJ51701.1"
FT                   /translation="MRNAKIVCTLGPASDEQSTIRALVNAGMSVARLNASHGTPDHRRL
FT                   VIDRIRNVDKVTDKPVAAMVDLQGPEVRTAPSSDSISIGSDSEIRFTTGDEITPEVIGL
FT                   SYSIDAVDPGDTVLLDDGRIETTVRSVDSDGVIAHVDSGGELGGRKGVNVPGVNLDIDL
FT                   LTESDREDLRVAAEANADFVAASFVRSAADVYMISDALDALGGDIPVVAKIERAGAVEN
FT                   LDEIIDAAYGIMVARGDLGVEMPLEEVPVIQKRIITQCHDTGTPVITATEMLDSMVQAR
FT                   RPTRAEASDVANAVLDGTDAVMLSGETAIGDNPVRVVETMDRIVRQIESSAEYGTIEQE
FT                   HVPTAAENSRTEALARSARYLARDVGASAIVAASESGYTARKTAKFRPGVPVIAITPND
FT                   RVRRQLTLSWGVASTYSGSHGDIEGMMEDAVDAALDANVASSGDTIVVLSGMMTELEGT
FT                   NTTNMLKVHVVAETIATGRKVVGGRTAGPLATPTDGRLDEIPHGAILALPADFDAEFDH
FT                   DAAMLGGIIDARPGMTGYPAVIARELDIPMISGAPLPPQISDGTAITIHAERGIVYEGD
FT                   LTRSHDQDRN"
FT   mobile_element  complement(705869..705976)
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AJ"
FT   CDS_pept        706149..706415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1574A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1574A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51702"
FT                   /db_xref="GOA:Q18JV2"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JV2"
FT                   /protein_id="CAJ51702.1"
FT                   /translation="MTIYLETMTDGNQPDTTSRSDSEPVSGYTTENEDNTNSTDDTAFE
FT                   PEAVAEPEPIEPERPIPEHVLFVALGVLGTLGLLVSTIVPNLI"
FT   CDS_pept        706591..707298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1575A"
FT                   /product="NfeD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1575A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51703"
FT                   /db_xref="GOA:Q18JV1"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JV1"
FT                   /protein_id="CAJ51703.1"
FT                   /translation="MVTQAISVVAQLSLPAETLSLLLITAGLGLSILEAFAPGAHFVVL
FT                   GVSLLATGLVGLLLGTASPLVLSGLVVLFGSAALLGYREFDIYGTTGSEQTSDSNSLTG
FT                   TYGRVTERVTPTQGQVKLDAGGFDPYYSARSVDDELTAGTEVVVVDPGGGNVLTVEPLV
FT                   GGVDEIDRALATEQANRETTNSENEDPTPTPTPNSNMTQTDDTQSDEQRDSESESGLES
FT                   ESEREREREPDLS"
FT   CDS_pept        complement(707459..708145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1576A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1576A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51704"
FT                   /db_xref="GOA:Q18JV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JV0"
FT                   /protein_id="CAJ51704.1"
FT                   /translation="MSVKKAFRTTQRTQDLVYATLLGNSLIGLALGYLLIADITITQPR
FT                   YTIYGLLWIFVGAIVIWKTNPASADARTRRRATIVAIVYLSILSIVGGVIITTGGNAAN
FT                   ALTQSFGIRVATLLPGWGPAPIITTPIGAVVLMPARIVGYLALTYLVYATVIDAARAAV
FT                   SGIVGLLSCVSCSWPVIASVLSGVLGGGSAVAAIAVDFSYDVSTVVFILTIALLYWRPI
FT                   VGRVGD"
FT   CDS_pept        complement(708147..709586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="HQ_1577A"
FT                   /product="protoheme IX geranylgeranyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1577A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51705"
FT                   /db_xref="GOA:Q18JU9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18JU9"
FT                   /protein_id="CAJ51705.1"
FT                   /translation="MAEQTATTTSAIDIRRFHGLLAGTAMGVYLLVLVGVTTAVTDAAA
FT                   ACAAWPICGNGWATPGSAIGWLAVGHRVVAVIIGICAVVTLGVGIREHIERRVLITVAV
FT                   GSFLYPIQAAVGAVVAVQGPDLTLSVIHLIGGLSIFLTLAIALAWSLETETGDPTETQT
FT                   TPSKPEPDQDLPPASEYDPDLPADPRDRLLATLRAYIRLTKPRLMWLLCLVASAGMTLG
FT                   ATTTGQLTPGIALATLGGGVLSIGASGTFNHVLERDVDRRMQRTSDRPLATDLVPVWNA
FT                   IAFGILLTVISIVLFSWVNMLAAILGGVAIVFYSVVYTLLLKPNTVQNTVIGGAAGALP
FT                   ALIGWVAVTGDIGFGGLALATVIFLWTPAHFYNLALAYKEDYERGGFPMMPVVRGETET
FT                   RKHVIWWLALTLVAAGGLATIEALGIVYAVASIVFGAVFLYFAIKLHYEQTKAAAFHSF
FT                   HASNAYLGAVLIAIVFDTLVI"
FT   CDS_pept        709696..710439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="HQ_1578A"
FT                   /product="cox-type terminal oxidase subunit II"
FT                   /EC_number="1.9.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1578A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51706"
FT                   /db_xref="GOA:Q18JU8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JU8"
FT                   /protein_id="CAJ51706.1"
FT                   /translation="MRHTRLALVSVLSTLALGAVAMPVAAQSSASAELINGLNGKLLYV
FT                   GVPITILVEAILIYTVMKFRNNDDPTPTQENRRLEITWTVATALILLFVGVASYGVLAN
FT                   ENITYQPQAENAAGEAVNGEQQKPVVVRAEAYQWGWEMSYPEAGNFTNGNTMVVPEDRP
FT                   VVIRTTSRDVIHGFHVPKMALKQDSMPGQVNSIKTVPYETGSYQGYCTQFCGVAHSQMY
FT                   FTVDVVSQDEYQQWLDTQQKNADSS"
FT   CDS_pept        complement(710461..711000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribL"
FT                   /locus_tag="HQ_1579A"
FT                   /product="FAD synthase"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1579A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51707"
FT                   /db_xref="GOA:Q18JU7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JU7"
FT                   /protein_id="CAJ51707.1"
FT                   /translation="MTEEAECVIAQGTFDILHPGHIHYLTEAATFGTELHVIIARRTNV
FT                   THKPKPVLPDRQRRDVVDALEIVTAAHLGHPEDIFIPIERLQPDVIVLGHDQHHDIDAV
FT                   RDALSGRDIACDVVRASARDPQYDDEILSTGTIVDQILTQRGSKPERTQTDTDIDLDSD
FT                   SDSDPNPDPNPQTQTD"
FT   CDS_pept        complement(710997..711605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1580A"
FT                   /product="JAB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1580A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51708"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JU6"
FT                   /protein_id="CAJ51708.2"
FT                   /translation="MRLFRSSAVLGIASDALEFAREASEEAHPNEYMGLLRGEDARRIG
FT                   LDRSGTVITEVLIVPGTQSTPTSATIDSNMVPNDRHAVGSIHSHPNGVLKPSDTDRNAF
FT                   GKGRVHIIIGHPYGVTDWAAFDQHGNRRSLEVVDVDLPDPEAFFDFDETDLDIDYTKQS
FT                   GDEEQSRWDVEMDTPTQSNQQSNQNTDTDMQTDDDRGWR"
FT   CDS_pept        711852..713786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1581A"
FT                   /product="DHH/RecJ family phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1581A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51709"
FT                   /db_xref="GOA:Q18JU5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JU5"
FT                   /protein_id="CAJ51709.1"
FT                   /translation="MTTDSAGDSGDSRPNSGADSRPIVYDLAPNCTREDIEHDANYHAV
FT                   VNGVVEYGIFIDIADDISGLVHDSNLDRSYEVGDRLTVTLESVRDNGDLAFDVFNESSY
FT                   QTVVVEHDPELTAIEELEPGIDAYVAGKVTKIKQTGGPTIFRVADETGIVATAAFQEAG
FT                   VRAFPTVELDDTVRVGGAVEPHNGSLQIEVESLTQLDGADAEETRARLDTAFTRRAAPP
FT                   DISPLIEWDALEPLIDDLRDVAQLLRRTVLEGRPIRIRHHADGDGMCASVPVQLALERY
FT                   IRDVYDDDDAARHLVKRLPSKAPFYEMEDVTRDLNFALEGRSRHGQRLPFLLMLDNGST
FT                   EEDVPAYENLAHYDVPTAVIDHHHPDPSAVDPLLDAHVNPYLHDEDYRITTGMLCVELA
FT                   RMIDPSVTDEIQHVPAVAGLADRSKADAMASYIELATTVGYDHDRLLELGEALDYAAHW
FT                   LRYSDGQSIVNDVLNVGCSDESRHAELVDFLSSRAERDVERQLNATVPHLTHDRLESGA
FT                   HLYQIDLDEWAHRFTYPAPGKTTGKLHDRQVKEHGEPVITIGYGPDFAVLRSDGVRLDI
FT                   PRMVTELNEEVIGGGVSGGGHLVVGSIKFVEGMREAVLDSLVTKMGDAELDATLSSHAV
FT                   ADGASQIDD"
FT   CDS_pept        complement(714024..714623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1582A"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1582A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51710"
FT                   /db_xref="GOA:Q18JU4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JU4"
FT                   /protein_id="CAJ51710.2"
FT                   /translation="MEGLREEVAEHRAPEEDIDSLFVNRWSPRAMTGESLDEAQYMPLF
FT                   EAARWAPSSYNNQHWRFLYATREDEEFELFADLLIEANREWAEDAGVLVTLVSKETFDH
FT                   NGEHARTHSFDTGAAWQNLALEATRQGLVTHAMQGLDYEAAAEQLNVPDGFSVECMIAI
FT                   GEHAPPETLSDELQEREFPSDRKPVDEILHRGGFDD"
FT   mobile_element  714846..714955
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AI"
FT   CDS_pept        complement(715829..717520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1583A"
FT                   /product="phospholipase D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1583A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51711"
FT                   /db_xref="GOA:Q18JU3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JU3"
FT                   /protein_id="CAJ51711.2"
FT                   /translation="MTGRRSSFAHSLLNSHFRLLILIVLILCIMIVVASGATAATAATS
FT                   SMPDQKTPVIVTVVPNPVAENDVGEFIVVDTDGVSNLTLTDGESIITVPVVPGETVALS
FT                   AAPNKTRQRVEIPVRQAAVGLSNGGEQLILNHQSERVHEVTYSDAPEGERLNATSMEWI
FT                   PRGVELRSVTSTGSADVTAFVLPDTPAIPITAIQSANKRILLAGYTYASPPMTDALLSA
FT                   SDRGVRIQVLLEGSPVGGLSTAQRTQLNRLSNNGIVVQLLAGTPARFAYHHPKYAVIDN
FT                   SAIVLSENWKPAGTGGKNSRGWGVHAHSRATASELASVFAHDSTGYDVIPWSQARTDIG
FT                   FNEVLPATGQYPTQFDAELMSVDEIRVLTAPGNAGEAVRSRIDTAEKRIDVVSPRMNPS
FT                   GPYFYALVDAAKRGIQVRLLLSDAWYDTDKNRAVVNRASELNATGLPIRAQIVTSGDQF
FT                   GKIHAKGAIIDDRVALVGSLNWNEHAGTKNREVVLELVGDEPATYYSHVFISDWQGYEG
FT                   TDTASRRGVNTESEPEYVPVLLALGALAAVIIAGYALYSTVLSDHP"
FT   CDS_pept        complement(717918..719249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1584A"
FT                   /product="HEAT-PBS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1584A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51712"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JU2"
FT                   /protein_id="CAJ51712.1"
FT                   /translation="MSDEDDETAADDAPESETSIAVTPESVISRLDDVESALDAAETES
FT                   ALDEVETTLATITDDLEASTLPEPDGDDEEDPTDELEARIEDLESELDIQRGPYASDVI
FT                   EPLEEATTTIEETRWTATGLSTITDAVDETYTNIAETVSNSITVDTSLEKIDVPADGDG
FT                   SNSDEEAQLIAQLDGCMSAIADEGLDADDDAATIETLIETAETLTEDLESAEEWDDLEV
FT                   NEQLMAEGYYDVLGHYKDFPPEWSALKEWEKRGRVDMVLLAKESLQSEFMQDHCMNALV
FT                   RMADPAAFDEMHELAQRRDKTAIKALGRMGSGATDAVETLSEYIDEDSDPGLQKVTFRA
FT                   LGEIGSSNVTQPLANKLIMENDNVRPYAARALGLIGDTRAIQPLGETLRTDESDDVRAA
FT                   AAWALRQIGTRDALQTAAEHVDERSYLIQHEAKRAADALESAPA"
FT   CDS_pept        complement(719305..720222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1585A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   iron/cobalamin)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1585A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51713"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JU1"
FT                   /protein_id="CAJ51713.1"
FT                   /translation="MRVVSLLPSSTEILTALGVDPVGVSHSCDYPSSVHELPTLTSTPV
FT                   EYGPDQSASDIDSQMQSIEGSAYDLDINALSALDPDLIITQDTCEVCAVDSTAVHEAVA
FT                   AHDINADIMTLHPHSLTDVLADIERVGTAVGVPDLATDYRHQLTTRVEALTERAARVAA
FT                   ESTRPRTVALDWTDPIIAGGHWVPELIERAGGEPGLIDGGSSTPQRWVDIEEFAPEVLL
FT                   VAPCGFELSRAIEAVESIKSTADDAWDTLPAVETGVVGAIDGNGYVNRPGPRLVDTLEI
FT                   IAGLCHPTAFDTPDSSIARSLNDV"
FT   CDS_pept        720356..720904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpsA"
FT                   /locus_tag="HQ_1586A"
FT                   /product="ferritin DpsA"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1586A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51714"
FT                   /db_xref="GOA:Q18JU0"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JU0"
FT                   /protein_id="CAJ51714.1"
FT                   /translation="MSTQQTVRLRADEVEGSDALRIDSERASQLVDALNTDLAATQTLY
FT                   HQLKKHHWNVEGAEFRDLHLFLGEAADEAEEFADELAERAQALGGAPVSSPSAISERSP
FT                   VEPENEDVYDIRTSLGNDMEMYGDIIETLRDHIELAERLNDPTTAHMLRENLIEVEDAA
FT                   HHIEHYLEDDTLVVESAMQ"
FT   CDS_pept        complement(721065..721247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1587A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1587A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51715"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JT9"
FT                   /protein_id="CAJ51715.1"
FT                   /translation="MSYPELPDESKDRSGTKDAESATDRVSAHQTSPDRLVFAEDGYAD
FT                   AWIACDATLTESLER"
FT   CDS_pept        721488..722498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1588A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1588A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51716"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JT8"
FT                   /protein_id="CAJ51716.1"
FT                   /translation="MSDRKPENQDDTDDLAVLLDDLNTTLSALEEAVDDEQQSSSSRSS
FT                   QTSRDRNSASRDSSVQRRDGAQTDNRSEDDGGSSIGNVFRFTEEYTLPALISILETTIE
FT                   SLELLRGVLRFVDPEQSAFRDRSQTQNRRRRGKSPRRDPVSTVGREALSGLDRALSEIE
FT                   ETLAADNDQSLPSDRIPRDLLADARDLSAEVADRLGDVQNRPDRRRQRDTRELPRNRPD
FT                   DTTRQERQRSQDSNNTAEQRQNEGAVTIDVDAPRKTANNDDGENKSSTDTHSDVTMMDN
FT                   NAASNSESVNVDVESELASIKDTVDPDERFIDTDADADNNTDSSDDDNSGDRQSE"
FT   CDS_pept        complement(722522..722953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1589A"
FT                   /product="acetyl-CoA C-acetyltransferase small subunit"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1589A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51717"
FT                   /db_xref="GOA:Q18JT7"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JT7"
FT                   /protein_id="CAJ51717.1"
FT                   /translation="MTDENTADSNTSTGTNTAEEENQSELTAVRYADGSLGYPAHTLGS
FT                   DGNPPVDTIDLREYTAEIITWTKATATPPGVREPNTLAIVEFEIDDESVRAIGQVTTTE
FT                   ITIGDRVEPVYVSELRDPTAGIREPDSQAWDGYRFKPIE"
FT   CDS_pept        complement(722950..724104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acaB1"
FT                   /locus_tag="HQ_1590A"
FT                   /product="acetyl-CoA C-acetyltransferase catalytic subunit"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1590A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51718"
FT                   /db_xref="GOA:Q18JT6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JT6"
FT                   /protein_id="CAJ51718.1"
FT                   /translation="MERVAVIDAAMTQFGQRDGWIRELLAEAGQACLDTAGVSPDAIEH
FT                   LYVSNMASGELEGQTGVSNALAHDLGAVPAYTARIDQTSSSGGAGVYAAWQSIASGASE
FT                   LTLLVGGEKMTHRTTAEATDVIASLTHPVEYKHGITLPSFAGLTARLYLETYDAPREAL
FT                   GKVAVKNHRNGVDNPHAQFRKEVSLETVLESPIVADPLRLYDFCPITDGSAALLFCPES
FT                   LAERYTDTYAIVSGIGGATDTHVVHERGDPTTMGGVVDSSNDAYEMAEITSDDIDVAEL
FT                   HDMFTILEFLQLEDLGFFEKGAGWKAADEGITARDGALPINTSGGLKSKGHPLGASGIA
FT                   QVYEIYQQVTNNAGPRQVEAKTGLACNVGGFGNCVTTTILENAQ"
FT   CDS_pept        724363..724779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1591A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1591A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51719"
FT                   /db_xref="GOA:Q18JT5"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JT5"
FT                   /protein_id="CAJ51719.2"
FT                   /translation="MRLESIAPTVGAFTCLILAGAVFIPAVIITTPGVSVADYYAAGPI
FT                   GISVVGFLALLNIIVFLAGKQGRTDPVTVAGLTLVSGIAMVSFASVWAISITSTLLYGF
FT                   PSQYAWIVNHRWVIVGLASVTALAGSGYTTAVLR"
FT   misc_RNA        725065..725370
FT                   /gene="RNA7S"
FT                   /locus_tag="HQ_SRPRNA"
FT                   /product="signal recognition particle 7S RNA"
FT   tRNA            complement(725562..725632)
FT                   /gene="tRNAGly2"
FT                   /locus_tag="HQ_TRNA15"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon TCC"
FT   CDS_pept        complement(725939..727042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="HQ_1592A"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1592A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51720"
FT                   /db_xref="GOA:Q18JT4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JT4"
FT                   /protein_id="CAJ51720.1"
FT                   /translation="MSDTDTVADYEVVVVGGGPAGLQSALYTTRLGHDTALVDRGGGRA
FT                   AMMLDTHNVIGVTEDTSGNEFLATGTEQVESYGGDVIRDLITDIERTDDGRFYLEGSSN
FT                   AFRADRIVLGVGFSDKHPDPPVPRTGKGLHYCLHCDAYMFVDRPVYVMGTGEATAHVAM
FT                   IMLNFTDDVDVLLRGDEPEWSDKTDEQLRAHPIDIVESDIDGMNKSDNGWLESFEFEDG
FT                   SIRQYRGGFAMYGSNYNTALFETLGCELDDDGTVIVDESMETTVDGVYAVGDITDGHNQ
FT                   IPVAMGKGAQAGIDIHYQLREFPRDLEEIRAEGPVTETEVPGVSDRVQNAAASFEEAQA
FT                   PPIEAPAPDATAEVDAEADAIEPPSDD"
FT   CDS_pept        complement(727136..727485)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1592C"
FT                   /note="product: uncharacterized protein (nonfunctional)"
FT                   /note="gene has a frameshift and is truncated at the
FT                   N-terminus"
FT   CDS_pept        complement(727482..727736)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1593A"
FT                   /note="product: probable S-adenosylmethionine-dependent
FT                   methyltransferase (nonfunctional)"
FT                   /note="EC_number: 2.1.1.-"
FT                   /note="gene has an in-frame stop codon and is truncated at
FT                   the N-terminus"
FT   CDS_pept        complement(727824..729386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1594A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1594A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51722"
FT                   /db_xref="GOA:Q18JT2"
FT                   /db_xref="InterPro:IPR035185"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JT2"
FT                   /protein_id="CAJ51722.1"
FT                   /translation="MPSDNHIMASASRIRLRSVLNEWIIVIVFLMLALAAVGGYMTYTA
FT                   YENPGTTVETEQVSSWEANGTYTTAARVTEPNPLYPIGTTLQGNPAYFTAASPIIDGQF
FT                   RFGYSATGSGSVTMTAQQTLILRSISDDESGTTEYWRTTKPIGQRRMDDVGPGEMMTAS
FT                   FEWNVSRQYFRAQNISERLNNPPGSTQLLVVSTVQMEGTVNNQPVTEAAQYRLPIEVNG
FT                   ATFEPAGVQGSALTGSTTTQVTRQQTYGQLWRLGGPGAIVFGLLGLITVAYIYIGTELL
FT                   NISDAERRFVTFQSSRDEFDDWITTAELPEAATDRPTASVETLEGLVDTAIDIDSRVLT
FT                   PPEETAFYVPHDDLLCVYRPSPEVQSVMEPNSTERTTVPESSKDTVDESESSETSDSFL
FT                   SVLGGSTDDSDEQETDNSETSQDSQATTDNKSAQSEPESESEPDESTIAEESGASVTST
FT                   DWDAIASSEQDQEQANGDADTDTNTDQTSDFDVGIFDNRHSESESEPTSDTGDRSTDNT
FT                   EDN"
FT   CDS_pept        complement(729450..730604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1595A"
FT                   /product="peptidase S26 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1595A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51723"
FT                   /db_xref="GOA:Q18JT1"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JT1"
FT                   /protein_id="CAJ51723.1"
FT                   /translation="MTIRRVLSVGGEIIAIVVVVSLLVGQVLGYPVLLGFVETGSMEPT
FT                   LNPGDGFIAVPTAVSGEIQENDVIIFRAQEIQGGGLTTHRVVAETERGYITRGDANPFT
FT                   DQDGGEPPVKDPQVVAKLFQPGGSVVVIPRLGTAVTGIQAIVTGVQQQLSSTLGTQSLL
FT                   GTQGLTYIVLALSILLYLYDIIATGDRENKTRERNRERSRGLSPQVIVAAFAVLIIVAA
FT                   TAAMVIPAGTQEYTIISAEFESERPTTITKGTTGSLEYRVPNAGVVPAVVYIESGSDAV
FT                   EVQSQQLYVSGQSMKATTVSISAPQQTGLYYRYVTEYRYLALLPTPIINAAYQLHPWVP
FT                   IILIDALIGVPFYVFAMSFVDTGRLRSRSRDGVSTFQRILNRYT"
FT   CDS_pept        complement(730971..732539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1596A"
FT                   /product="probable secreted glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1596A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51724"
FT                   /db_xref="GOA:Q18JT0"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JT0"
FT                   /protein_id="CAJ51724.1"
FT                   /translation="MMRKSLATVAIIIIIPLITGVGASIFSGETDTITQNVSLEPADGP
FT                   NGEYANLDENDELVIDITESESGGEGVPIGDVTTINNVFVAGYNGSQYAEIWITEDSPA
FT                   VKFVSGGQQIQSQSNAVRVGSNETVSVGMQIDTTERTSIEINDMTVHARVAEPSDISNT
FT                   TAQSSDSTNTDSETDESKTSIQIQSSTADNRKVTIQNAGEESVTVDTNSMVVDTNEDAT
FT                   IALESVSASVETTQATMTIEDVSAPETTRGDQNIDPVGVVDITETGIISQASLRFSVSQ
FT                   SYLESTGATADEVVVLHETEDGWTQLDTDIVKTRDSDDLAVIEADTNSFSMFAVAVERP
FT                   QITITDVTVLSSTIDESGVRPVTIDVQNSGDTDSRAAISLRDTESQIATQTVTLAPDSS
FT                   STLRFNLSSDMVKSSKSTIKRIGDTTVVFNSNAETAQTTEPTSTVTTDPVPSEVRDSDD
FT                   KTRATDPDDKDTTVDDKEELNTVSTETNVNQSVSTGINLDNTMKNLAGATLVIIFIIAV
FT                   MWSRR"
FT   CDS_pept        complement(733907..734536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1597A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1597A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51725"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JS9"
FT                   /protein_id="CAJ51725.1"
FT                   /translation="MKRRQLLMTLGTATGVSTVLGTGAFTSANVDRSISVQVANDADAF
FT                   VSMVPSPKLNGAYADIESGQLVVQLNGSDNTPAGDGVNDDAVTQIKDIFRIRNQGTQEV
FT                   FVFVEKLGDDAITIFGGTTTAKNNGNRIYDAPPSGLITNETPVMEGSSNALRTPVGAPI
FT                   PVGVRVDTTGSNSLNDLSGSLSIRAQAEPPEDSPFDGSRFDPDPDA"
FT   CDS_pept        complement(734654..735826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1598A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1598A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51726"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JS8"
FT                   /protein_id="CAJ51726.2"
FT                   /translation="MQRRKLIAGIGSVAAGAAAVTGTGALTSVNAERSIAVDVADDSDA
FT                   FLAITPQRTSNGSEYASTSDGEIKFDFTETSVGGGGLNRNAETIIRDILQVRNQGTQDL
FT                   IVGVTGLPEFMSIFSDDGSVAANGNSTSLNQDNNSPSSGNLALLRVGETMNDVGVIFRL
FT                   NGEDASVLENFSGTLTFKAVAVRDLSNPDEVRNKYGLDEIASDPEPQTGTGGPESLVTA
FT                   EVDDGATTTITMNVNDQIESVDGEFPANDTSFLVEANLDISSDGFGESQNDDMRFSYAG
FT                   KDSAERPAATSDGGSLKRNTGTDGNTNRETTIEEELEGFSAEEVNNPNGEGYELTITWS
FT                   ELADDEGANLNRVPSEFQVNEVFISDGGGGIGQNSANPRALGINETYSTD"
FT   CDS_pept        737113..737697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1599A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1599A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51727"
FT                   /db_xref="GOA:Q18JS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JS7"
FT                   /protein_id="CAJ51727.1"
FT                   /translation="MISLINKINMTTQATHAEFTRDDIYEALSNKRRRFVMHYLQQYGH
FT                   TGSLGTIAEHVAAWEHNIDVSAVGSSDRKNVYTSLQQFHLPKMEDIGLIIFDQRAGTVE
FT                   LSQAAADIDIYTELVGRHELPWSMYYLSLGGIGGSIVTGSTVGTIEFIDIDPIASAIFT
FT                   VTSISVLAMIHTYYMHQDRIGENEKPPEVAQ"
FT   CDS_pept        737694..738173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1600A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1600A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51728"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JS6"
FT                   /protein_id="CAJ51728.1"
FT                   /translation="MSSFRRKLAIAIAMCATIGLTSGVSGFTAVTADRSTSVEIATQTS
FT                   AYISFGDELACGNNDIITNNFADGTTLNEGEVTVTAKGGKLRFGPRESNLLNNGHSETF
FT                   PENGGFSSDSLNSGGSVTIHVDSENTTAGSVTVHVDASGSAVAVNTTATVNVVCS"
FT   CDS_pept        complement(738358..739029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1601A"
FT                   /product="probable S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1601A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51729"
FT                   /db_xref="GOA:Q18JS5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032873"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JS5"
FT                   /protein_id="CAJ51729.1"
FT                   /translation="MTDTPQDSVKATYDTIAEHFAATREYAWPEVESFCASQQIQSPPD
FT                   TESIGVDIGCGNGRHAETLFEQTSLDKIIGVDVSRELLHTAQTRATNRGFIDDLALIQA
FT                   DAGSLPLESQSVSIVVYVATLHHLRSRRRRVASLSAVARVLESDGRALISVWSTEHDQF
FT                   ERSNGFDTTIEWTLPDGTSIPRYYHIYDPVEFRSDLESSALSIVETEISSGNCYAVVED
FT                   N"
FT   CDS_pept        739265..739480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1601B"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1601B"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97813"
FT                   /db_xref="UniProtKB/TrEMBL:J7SBM4"
FT                   /protein_id="CCL97813.1"
FT                   /translation="MDERRCPDCNVQMKKTRVTAEGIGDLYVETDRDGGVLSHLGIGYQ
FT                   NPLHAFLCPECGITTLYADIDATESE"
FT   CDS_pept        739591..739821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1602A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1602A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51730"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JS4"
FT                   /protein_id="CAJ51730.2"
FT                   /translation="MSDDDPTVPVVCEDCGTDTRVSLSDLRETLDRHNENQHDGDDVAQ
FT                   VAPRIANELANVVAEDLDLDLDSDENEDEDE"
FT   CDS_pept        739870..740652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dph5"
FT                   /locus_tag="HQ_1603A"
FT                   /product="diphthine synthase"
FT                   /EC_number="2.1.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1603A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51731"
FT                   /db_xref="GOA:Q18JS3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18JS3"
FT                   /protein_id="CAJ51731.1"
FT                   /translation="MLTFIGLGLYDERSISIAGRDALQAADYVAAEFYTSYLVDATVSD
FT                   LETAHDIDIDVRDREGVEQHPEDILRKAQSEDVAFLTAGDTMISTTHTDLRLRAIDRGI
FT                   DTRVIHGVTAQTAASGLTGLQNYRFGKSVTLPFPYAHGAEGVPTSVTDSIAANRERGLH
FT                   TVVYLDIKANRDEYLRASDAAEMLATDLEDMLAIAVARAGSPDPTVRADRLSALAEKDF
FT                   GDPLHLLVLPGELHHLEEEALAALADAPADMLNAVDSQ"
FT   CDS_pept        complement(740745..741668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artA"
FT                   /locus_tag="HQ_1604A"
FT                   /product="archaeosortase A"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1604A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51732"
FT                   /db_xref="GOA:Q18JS2"
FT                   /db_xref="InterPro:IPR014522"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JS2"
FT                   /protein_id="CAJ51732.1"
FT                   /translation="MPGVLSDVLAWVVIVAFAAGTLLRGRNDRVGRIVTVAAWGGFALF
FT                   WLQLVPHFAFVHKSYVEGILSITAVPASLYTGLLLWRGRSSLFVLSRAVAAMGLIYLPF
FT                   ETIPAIMAFGISLPAPRGVLMEIVAAQTGMLVSAFGYEPAMIVGNQGYLNTFQFFDGNH
FT                   ELTVSVVLACTGLGSISIFAGLIAAVEAPLRRKLKAMAVAVPIIYGLNILRTTFITIAF
FT                   GKQYMQWFVQEILFLFGSSDPYMVSFFISDRIISQLLAVVVLVGITYLVVRELPELLTV
FT                   IEDVLYMITGDEYNLARELGFQRESV"
FT   CDS_pept        complement(741738..742508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1605A"
FT                   /product="glyoxalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1605A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51733"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JS1"
FT                   /protein_id="CAJ51733.1"
FT                   /translation="MAGIFDHVMIRVEDLEASLEWYQTHLDYEEKGRWEADTFTNVYLG
FT                   PTEMHDEGAMLEITYNHDDRSYEMGDGWGHIAVRVPNGKLEAAYQQLLDDGVEDYRDPE
FT                   SCGGRYAFVKDPDGHEVEIVQRDPDEGTMWSIDHTMIRVEDADEALGFWTRKFEYEHTG
FT                   RWESDSFANYFMKPEGASDAAMAVELTYNYDGRAYDLGDAWGHLCVRADDLEDYWATLM
FT                   ERDATDYRDPESCEYQYAFTTDQDGHEIEILEAT"
FT   CDS_pept        complement(742771..743259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1606A"
FT                   /product="TIGR04206 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1606A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51734"
FT                   /db_xref="GOA:Q18JS0"
FT                   /db_xref="InterPro:IPR026436"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JS0"
FT                   /protein_id="CAJ51734.1"
FT                   /translation="MSDISIMKTVREQHWRGPVVILALVALPWSIQVFDARDATFLFAW
FT                   GLVNTNPPIITPLLDFLFIYTQGLPEYILAWPLSVLAYIGTLGSAVSGVVFDREDPRVT
FT                   GGLLIIMAIAQLRLAWGFSFQPYRTAWPIASGLCVLIAWWFYWPRVRTNQGSLFASDK"
FT   CDS_pept        complement(743298..744410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="drg"
FT                   /locus_tag="HQ_1607A"
FT                   /product="GTP-binding protein Drg"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1607A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51735"
FT                   /db_xref="GOA:Q18JR9"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JR9"
FT                   /protein_id="CAJ51735.1"
FT                   /translation="MGLEDEIEDLREEIANTPYNKSTEEHIGRLKAKLAEKKEKLEQQS
FT                   SSGGGYGYAVEKTGDATVALVGFPSVGKSTLINSMTNADSEVGAYEFTTLDVNPGMLQY
FT                   NGANIQILDVPGLIEGAAGGRGGGKEVLSVVRTADLVVFMVSVFEIERYERLSEELYNN
FT                   KIRLDTTPPNVSIGRRGKGGIQVTSADDVSLDEDTVASVLREHGYTNATVTVRGNVSID
FT                   QLIDAIMDNRVYLPSIVTVNKADLIDREYLPTVKSDLRDIGVDPEEAIFISAEAEKGLD
FT                   ALKSRMWDALGLIRVYMDKPGRGVDYEEPLVLREGENAVEDALTKLGGTLDKRFRFARV
FT                   TGASAQHDEQQVGRDHELADEDILRVVARK"
FT   CDS_pept        744530..744730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1608A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1608A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51736"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JR8"
FT                   /protein_id="CAJ51736.1"
FT                   /translation="MSTPATYRDSTQLRLPCETVAEFRESLNEQFVVTVVTGDDGCRII
FT                   GSPVEIESVNRFLTRRGVLTQ"
FT   mobile_element  744919..745028
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AJ"
FT   CDS_pept        745300..745665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1609A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1609A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51737"
FT                   /db_xref="GOA:Q18JR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JR7"
FT                   /protein_id="CAJ51737.1"
FT                   /translation="MEDTPGLSEQYRKASPWPLFVALGIPLSELGILFGLFPVAVGGLL
FT                   LFGGSAAGMAAESGYAQTAWRGMAGVAVVLLVLGLAFVFTALDLPDRGAAILVAAIILV
FT                   AAGATGEFFARDVDPTY"
FT   CDS_pept        745826..746227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1610A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1610A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51738"
FT                   /db_xref="GOA:Q18JR6"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JR6"
FT                   /protein_id="CAJ51738.1"
FT                   /translation="MVAKLFDRDTLLDLTVNIIPLVILAFFIVAYVFMSPFDTNPLTTA
FT                   VQFGLLAVPFALLAVLTYISGRAIVVSEQHVDQYLPGQASMENAEPVEKAPKNIEDNTD
FT                   TTADVELESTSSEQEVDASAETKSDSNAN"
FT   CDS_pept        746515..748338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="HQ_1611A"
FT                   /product="cox-type terminal oxidase subunit I"
FT                   /EC_number="1.9.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1611A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51739"
FT                   /db_xref="GOA:Q18JR5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JR5"
FT                   /protein_id="CAJ51739.2"
FT                   /translation="MEVNGQLVLTALMGVFLIGVTAWLARIENWRSYTPIAGGGGSYEQ
FT                   SDSYVSDEKPAGLIRWLTTVDHKDIGLLYGAFGLTAFAVGGLMVVLMRIELADPGMTVI
FT                   SNTFYNSLLTSHGITMLFLFATPIIAAFSNYLIPLLIGADDMAFPRINAIAFWLLPPAA
FT                   LLIWAGFFPIPEVIPAQTGWTMYTPLSVGEGMGNQANAGVDLMLLGLHLSGVSATMGSI
FT                   NFIATIFTERGKNVSWANLDIFSWTILTQSGLILFAFPLLGSAIMMLLFDRNFGTSFFA
FT                   GEGGAILWQHLFWFFGHPEVYIIVLPPMGIISYILPRFSGRRLFGFKFVVYSTLAIGVL
FT                   SFGVWAHHMFATGLDPRLRASFMAVSLAIAVPSAVKTFNWITTMWNGNIRLTTPMLFSV
FT                   GFVANFILGGVTGVFLASIPVDLVLHATYYVVGHFHYIVMGAIAFAGFAGIYYWFPLYT
FT                   GRMYQRTLGKMHFWLSMIGTNITFFAMILLGYGGMPRRYATYLPQFATLHQITTLGALI
FT                   LLAGQIIFVWNFAQSWLEGPKVEDGDPWDLHDNGLYTAEWEWYDQKLTTAIADGGDEET
FT                   EEKVLTDGGDVNSDADADSDNDSTVDTHSEE"
FT   CDS_pept        complement(748812..748895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1611B"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1611B"
FT                   /db_xref="EnsemblGenomes-Tr:CEQ38554"
FT                   /db_xref="GOA:A0A0C7U2U5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0C7U2U5"
FT                   /protein_id="CEQ38554.1"
FT                   /translation="MSDGDLLGVVLGAIALLMFATGLLLAI"
FT   CDS_pept        749083..749517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1612A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1612A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51740"
FT                   /db_xref="GOA:Q18JR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JR4"
FT                   /protein_id="CAJ51740.1"
FT                   /translation="MSESDDQETTSEHNSSHESETSEKPETGSSEMVDHQNQTQNPTQD
FT                   QMDAKKQSQHAEQSRTQGRSGRQFVIILYIALTGAAGAAGYLTGYFVDGLSAPMFLFII
FT                   PFPLSPLGFAAYGGLTIAIVIGIPLGLVIYVSEYAESIET"
FT   CDS_pept        749632..750036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1613A"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1613A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51741"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JR3"
FT                   /protein_id="CAJ51741.1"
FT                   /translation="MSMYHIVAGIDDDEAHATRCAEAAIDLPSESPEKQVTLIHSFDDN
FT                   PSGASASQVQSVRTAAELLEEHDIDTNIQESSGDPADAIIDTAVEDEADLILIGGRKRS
FT                   PAGKALFGSVTQSVILGSTRPVMVTGVDEE"
FT   CDS_pept        complement(750271..751032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA2"
FT                   /locus_tag="HQ_1614A"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1614A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51742"
FT                   /db_xref="GOA:Q18JR2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JR2"
FT                   /protein_id="CAJ51742.1"
FT                   /translation="MTAETNDAHMIDDDHDRDRDHVDTNTDTKGTGGQAEPEAALNKLI
FT                   QCDIVIENDDGTLATTTEYEDIRRIYHDTYMDAPRERIITTMADVFDIEESNAVTQLEE
FT                   DIVSRADVISYLAIDSYIDATLDPAMHAMMVEIVNRVDPESPVPDEVTELTDESYSSFV
FT                   TEHSEVLMTVWKRRCDPCRAVKSDLDSMLESIPSNVAIAGIDGENAPSFRRETEITAAP
FT                   AFIRYQKGNQCDVKTGRQSPDAVADMFDDLS"
FT   CDS_pept        complement(751095..751907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF1"
FT                   /locus_tag="HQ_1615A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate branched-chain amino acids)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1615A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51743"
FT                   /db_xref="GOA:Q18JR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JR1"
FT                   /protein_id="CAJ51743.1"
FT                   /translation="MSTLEDDETTGESSTTTHGGESSRELLRLNGVDGYYDESHILRDL
FT                   SMKVKEGEICALLGRNGAGKTTTLRSIAGATPPTVRSGSISFDGNDVTGVTAEDVSIRG
FT                   ISLVPEERRIFPNLSVAENLHLAEVVNNTSNTWGRDVEAGGEGMTTDEVYDQFPRLDER
FT                   RSQQAGTLSGGEQQMLAIARALKQNTDLMLLDEPYEGLAPQIIEDVEDAIERINETGTT
FT                   ILLVEQNAAAAINLADRAYVIDHGQIVFDGTAAELRSDEETRERYLGV"
FT   CDS_pept        complement(751904..752743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG1"
FT                   /locus_tag="HQ_1616A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate branched-chain amino acids)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1616A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51744"
FT                   /db_xref="GOA:Q18JR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JR0"
FT                   /protein_id="CAJ51744.1"
FT                   /translation="MSTDTDSNTDIESTDVSNTRTSTAASDDVLLETRGLTKEFGGLVA
FT                   TDDVNIRVERGEQVSLIGPNGAGKSTLINLITRRLEPTDGDIQFKNSSIVGLDPHEVVQ
FT                   RGVSKSFQTASIFPDLSVRENAEIAGLAAENGAFDFKLLTHRDSLTDVHQRARDTLEAV
FT                   GLLDSADETAADLPYGDKRRLEIGIALAAEPDLLLMDEPTAGMSPEETNATVELIEEVK
FT                   QALDLTFVLVEHDMEIVFNISDRIIVLNRGRVIAEGAPEDIRGNPDVQEAYLGGADL"
FT   CDS_pept        complement(752740..753894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM1"
FT                   /locus_tag="HQ_1617A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate branched-chain amino acids)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1617A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51745"
FT                   /db_xref="GOA:Q18JQ9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JQ9"
FT                   /protein_id="CAJ51745.1"
FT                   /translation="MSDPDATSSDGATVVDDPQAPSLVERLQQFREREATVIGLTAIGV
FT                   ALFPWIFARAPVISDLLLGYQNLAALMLIWAIFAIGFDLLLGYTGLLSFGHAAFWGGSA
FT                   YVAGIVSLRVSSDPIVMVAAGTIFAVLFAWVLGYLSLRRGGIYFSILTLAFAQMLYYMS
FT                   AAPLAPLTGGENGLTGIDVSPLFGSFHLESELPMLAGELLGTWMYAFVGVITVAAVGIS
FT                   YRILNSPYGMVFRAIRENEQRAKFVGLNVWRYKLMAFIVSAGFAGIAGSLFTIHGSYVP
FT                   LQSLFWTESGEIVIMVVLGGTASLFGPILGAGLYLYIENIVSGIQQLQVPFTDIVLIND
FT                   FGTYWHLLLGLIFVVVIWTAPRGLWGGLSDLRIAVESRLRGEDR"
FT   CDS_pept        complement(753891..754892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH1"
FT                   /locus_tag="HQ_1618A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate branched-chain amino acids)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1618A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51746"
FT                   /db_xref="GOA:Q18JQ8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JQ8"
FT                   /protein_id="CAJ51746.1"
FT                   /translation="MSLLADVMIILLNGLQQGAIYVLLAVGLSIILGTLKFVNFAHGAL
FT                   YVIGTYAGLLIALDVSLTSGKLREWGFSTIGLDLGFFAALVFVPIVVFIIGVTMERFLA
FT                   QSFYDRPDTDQILVTFGIAIVVQELFRVLFGSNSLPFNQPENVLAIGGFGGIPVSGPIT
FT                   LPIIGGFPRWRLWVIAITAVLVGIVYALVEYTDFGLIVRAGTRDAEMVRLLGVKIDRPY
FT                   LVVFGIGAALAGVAGVVGGPLSVVNPTVGTNILVPAFLTVVIGGIGSITGAVAGGLLIG
FT                   LVQATLIGLPSVTLGAFTLNFSPWSQVGLYAIAALVLLLRPQGILGSEEVAP"
FT   CDS_pept        complement(755021..756421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livJ1"
FT                   /locus_tag="HQ_1619A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   branched-chain amino acids)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1619A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51747"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JQ7"
FT                   /protein_id="CAJ51747.1"
FT                   /translation="MVRDNDSLHRRDVLKAAGASTVGIAGLAGCAGGGGGGDSGDGGGE
FT                   SGSDDTSSDSSSEEYPALGNFPIDGDTATFGFNVPQSGPYASEGQDELRAYELAVQHLN
FT                   NGGGWVDSQFDDLSGDGVLDFTIDYVDGDTATDADTARQSASRMIQRDNAVMISGGSSS
FT                   AVAIAVQGLCQNENVPFMACLTHSNDTTGKDAARYGFREVFNAYMTGQALAPVVREEYG
FT                   SDLSFYQLYADYSWGQTQQASMEQFMTDVAGWSQIDSVATPLGTTDFSNYLSGAQSESP
FT                   DVLILNHYGLDGANSVQQAVDAGLDEEMEIMLPLYNRPMAQAAGGSIEDIFGTVAWTAQ
FT                   IDNTPSNEFTQVFQDEYDRIPSGVAQLAYAQTLQYAAAVERAGTFYPPEVIKQLEGYEY
FT                   DNIGMGQELMRACDHQAQRDVPVVRGLPESEQSEGSFYEVVTVTSRDDVGYACDAGPAA
FT                   EAELGPYE"
FT   CDS_pept        756651..757403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1620A"
FT                   /product="GNAT family acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1620A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51748"
FT                   /db_xref="GOA:Q18JQ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JQ6"
FT                   /protein_id="CAJ51748.1"
FT                   /translation="MDIRDATIEDIEEIRDVARESLAASYGHAIDDKVIDAAIEEWYSK
FT                   DALKETLTTDDAVFVLAVDDGGPIGFAQSELITGREAIGYIDWLHVGPDHRGVGIGSQL
FT                   LSRLRQALMNAGADRLEGRVLTENETGLGFYKDQGFSVAGKRTVTIRDETFTERVYSLF
FT                   VDSTEEPAANKQQTEAGETVYIAYDETVRGSEAPFFAAYFDEDHEDRYGWFCGADESLD
FT                   VAMDTMERIECTACGNQRRPVRWDAAYL"
FT   mobile_element  join(757660..758181,758290..758309)
FT                   /mobile_element_type="insertion sequence:HqIRS60"
FT                   /locus_tag="HQ_HqIRS60E"
FT   mobile_element  complement(758182..758289)
FT                   /mobile_element_type="insertion sequence:HqIRS43"
FT                   /locus_tag="HQ_HqIRS43AK"
FT   CDS_pept        758360..758779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1621A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1621A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51749"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JQ5"
FT                   /protein_id="CAJ51749.2"
FT                   /translation="MTTNPAFEHTPDGRKIVVGRELSVGRDIAWNLLRNTQQWTEWGPS
FT                   VRAVECNQQFIDIDTTGRVQTVGGLWLPFEITSCLSYRWHWRVMKLPATGHRVDQPSTG
FT                   SPREGCRVIFELPILAAWYIPVCSRALDRIESILL"
FT   CDS_pept        759104..759793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1622A"
FT                   /product="thioredoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1622A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51750"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JQ4"
FT                   /protein_id="CAJ51750.2"
FT                   /translation="MNRRTFITSTGATTMFLTGCLSGNNEANSSNDTAGSSGGQSINSH
FT                   PAASNLAAQPRLGDLDESQHTIIAFKDPSCPRCRAFKESTVPEIKRQLIDPNKGAYILR
FT                   NYPVVYPWGEPASQALEATLERSETAHWKLQNYYYDMQRDLSTENVHGKTQTFLESNTE
FT                   VTASAVIADVKSDACSDAVTADINAAERADLDGTTPSILLFRNGQYVTTAAGSISYDVI
FT                   ATALGEN"
FT   CDS_pept        759796..760407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1623A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1623A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51751"
FT                   /db_xref="GOA:Q18JQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JQ3"
FT                   /protein_id="CAJ51751.1"
FT                   /translation="MGIKRFQSVQKRLPTTQKDWRLMGRIIKLVLTIPLYAIISVIAAG
FT                   AALTLFVLSLNVELVNDLIIGGVLPPTDRVTILVELYPFVGTSFGVLSGALLSIVSALA
FT                   GVNVAMAGYHIREHELTVAGSGASILGVVLGTLGAGCAACGSAVLLGILGLFGISTSLL
FT                   FLPLDGLEFALLALVVITVSIYWLADGMRGGMVNGCPIES"
FT   tRNA            complement(760757..760829)
FT                   /gene="tRNAThr2"
FT                   /locus_tag="HQ_TRNA16"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon CGT"
FT   CDS_pept        complement(760876..761865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trm5"
FT                   /locus_tag="HQ_1624A"
FT                   /product="tRNA (guanine(37)-N(1))-methyltransferase"
FT                   /EC_number="2.1.1.228"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1624A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51752"
FT                   /db_xref="GOA:Q18JQ2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR040601"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JQ2"
FT                   /protein_id="CAJ51752.1"
FT                   /translation="MSDGIPCVRVPPTAGERTRTMLAEQGLIDTLYEIDTTEDYLYIPV
FT                   VDSTAVPDQFDIVTHVVNTRDVPTSPADKLGFDPSYERLGEIIIIDEDNHEKAREVAKA
FT                   IVESDIPVKTVLNRDSKVSGPHRTREWEVLAGEETETCHREYGYTFRLDIESVYFSPRL
FT                   ATERHRVITQVDAHDHVIDMFAGVGPFAVPMAARGADVVAAELNENAVEYLSINAEQND
FT                   VDDNFTIVSGDVRTLPDSYIDWADRLIMNLPHSADEFLETAIRLAGDECMIHYYDIQHE
FT                   DTLYQPGIEAIRSAAEPNYKLTVETRHEVRSYAPHEYNICLDVRLQRR"
FT   mobile_element  complement(761944..762052)
FT                   /mobile_element_type="insertion sequence:HqIRS55"
FT                   /locus_tag="HQ_HqIRS55AK"
FT   CDS_pept        complement(762151..763260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfbA3"
FT                   /locus_tag="HQ_1625A"
FT                   /product="transcription initiation factor TFB"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1625A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51753"
FT                   /db_xref="GOA:Q18JQ1"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JQ1"
FT                   /protein_id="CAJ51753.1"
FT                   /translation="MSDSLHARTRETEDDEQSDGRTWRDHSTTSERRGTRNSSKTTGSD
FT                   ESTTEQTSDESSTVEETVHCPECESTELITDDERGETVCADCGLVVDEDSIDRGPEWRA
FT                   FDSAERDQKSRVGAPTTKLMHDKGLSTNIGWQDKDAYGNSLSSTQRQKMQRLRTWNERF
FT                   RTRDSKERNLKQALGEIDRMASALGLPESVRETASVIYRRALDEDLLPGRSIEGISTAA
FT                   LHAAARMAQVPRSIDEVARVSRVDEDEFERAYRYIVRELSLEIQPADPAEYVPRFASDL
FT                   EVPKETERTARELLESAKRQNVHSGKSPVGLAAAALYASAQLTNDELTQADVSEVTDIS
FT                   EVTIRNRYQELLEAWDNRSNGSGADAASA"
FT   CDS_pept        complement(763505..764869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuD"
FT                   /locus_tag="HQ_1626A"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate cobalamin)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1626A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51754"
FT                   /db_xref="GOA:Q18JQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JQ0"
FT                   /protein_id="CAJ51754.1"
FT                   /translation="MSSPFITIKNLSITRGSVTILDEVDLTAREGAFLGVVGPNGAGKT
FT                   TLLRAIDGSISTTTGSIHIGDIAIESADATTISQQVASVPQDTSISFNFDGRTIIEMGR
FT                   TPHRSRFATWTETDDTAVEQAINQVDADAFVDQPVTTLSGGEQQRILLARALAQQTPVL
FT                   LLDEPTASLDIHRQIQTLESVARLVETGKTAIAAIHDLNLAARYCDIICLLTEGSITAI
FT                   GPPAEVLTTPTLAGTFGGYPVVTTDLITGTANVTTLPDERAKTTDNTTNDQSTHEQHDE
FT                   STIVGDSSEYSRETSSQPIIHIIGHGQPVITAMSELVAAGYTVTVGPAPAGSVTATTAD
FT                   RVATSVMTTPAYKPITESMTTELRSKIDAAAAVVLANVDLTKDANAIVTAVDYAENIIT
FT                   LTQQDPQQKPQQDTTHDNLTQTPIDELPYSRDTVNTKTTDDKSIVSVIEELLASD"
FT   CDS_pept        complement(764866..765903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuC"
FT                   /locus_tag="HQ_1627A"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate cobalamin)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1627A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51755"
FT                   /db_xref="GOA:Q18JP9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JP9"
FT                   /protein_id="CAJ51755.1"
FT                   /translation="MRVQFRAIVWSAGLTGVLLLAVTLSAGVGPVDIAPITVTYVLIGA
FT                   IDSMIGLGVTVTQIPSSIQQTIVLSVRLPRIILAALVGFALASAGTVMQGFFRNPMADP
FT                   SIIGVSSGAAVGAVATIVIPLQIPFGLELQAAAFTTAVITAFSVYVIATRGGRTPTSTL
FT                   LLAGVAVQAFLGAIISFLLLYSGESIQRVVYWLMGNLGGTTWGDVRVAAIVVPPVFVLL
FT                   VAYARDLNVLLLGERDAHALGINVTRTKRILLAAASIVTAAAVAVTGVIGFVGLIVPHA
FT                   MRLIVGPDHRILLPTSALAGASFLVITDTFARSGTTAIPVGIITAALGAPFFLYLLRTN
FT                   EVTQL"
FT   CDS_pept        766106..767266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="HQ_1628A"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate cobalamin)"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1628A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51756"
FT                   /db_xref="GOA:Q18JP8"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR026469"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JP8"
FT                   /protein_id="CAJ51756.2"
FT                   /translation="MHTHSYHSTSRIDSKTVHNTISATTAVSGDSNTKNHGSSVTTTAC
FT                   RYPLTVTDATGTTVRIMSDPDRVVTLNPSAAQTMWEIGAQNEVVGVSRYASYLNGTASK
FT                   QNVSGAGGPSVERVLAATPDLVLVPNSTHSASPDRIAQLRAQGLTLVVFPQATSLTAVI
FT                   EKTERIGRLTGNCAAGDARATELQQSINRIERVTEDTDRPVGVNVFYGYTSGNNTFIDE
FT                   IIETGGLENGAANAGLSGFVPITDESVVAIDPTWIVIPTSAPLPKTPAYNSTTAYQNNN
FT                   IIRVETEHIQQPAPRAIYAVETILQATHPAASDEYQQLETTTPSANTSSSESSESNVSQ
FT                   TTARQMRSTPSGVTATQTNSPGFGIVHVVFTAIGSVIIVCIIFPRE"
FT   mobile_element  complement(767454..767843)
FT                   /mobile_element_type="insertion sequence:HqIRS46"
FT                   /locus_tag="HQ_HqIRS46H"
FT   CDS_pept        768031..768498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA3"
FT                   /locus_tag="HQ_1629A"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1629A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51757"
FT                   /db_xref="GOA:Q18JP7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JP7"
FT                   /protein_id="CAJ51757.1"
FT                   /translation="MSDSQSDSDLADIRAQKRSELKQKLTEDTEDTEDTGDDTTNNEAT
FT                   TAKTPTDPIHITSADEFNAAVTEHDVVLVDFYADWCGPCQMLEPTVKSLAAETAATVLK
FT                   VDIDQHQSLAQQYQVRGVPTLLLFNDAETVEQIVGVRDESTLRSLIQQYTQ"
FT   CDS_pept        768704..769327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1630A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1630A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51758"
FT                   /db_xref="GOA:Q18JP6"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JP6"
FT                   /protein_id="CAJ51758.1"
FT                   /translation="MITFQSQHVSLRAIIGVGSFLLSVIALQITRQTSGYPTHTRVHSW
FT                   PRLLITQFRRDINKSGSLRYGWVIIGLWSISVSGLHFGGLYYDIYTTVSWWDLLTHSLS
FT                   GFGVAAVLGLTFRSSTTPIPYWVIPAVLAIGSGFEVYEFVFKTFWYDWTFRFYLIDTVV
FT                   DLVVNTAGAATFVIAVGFLRETSMLQDSTDDASVTPELSSRRDS"
FT   CDS_pept        complement(769353..771443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hel308b"
FT                   /locus_tag="HQ_1631A"
FT                   /product="ATP-dependent DNA helicase Hel308"
FT                   /EC_number="3.6.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1631A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51759"
FT                   /db_xref="GOA:Q18JP5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JP5"
FT                   /protein_id="CAJ51759.1"
FT                   /translation="MDFDKVRNTPRTFVHVVLNDSVSLDINELPVSAAVREHYYDAGIT
FT                   QLYPPQEAAVKAGVVDGENVIVAIPTAAGKTLIAQLAMLTADGPALYIVPLRALAREKY
FT                   ETFTALPGIDAAISTGDFDAAENDLETADVVVATAEKVDSAIRNGASWVDKLACVVVDE
FT                   VHLLGSANRGPTLEITLATIQRRASGVQVVALSATIDNPEEVASWLDAELVSSTWRPVS
FT                   LRTGVYDASDETVIFDDGNRLPITADSDSPPETATDLTESDDTSTDADTKATISLVADA
FT                   VISGGQCLAFVRSRQEAASLAKQLADVGFGANPELAEDIRDIGTTPTGKQLADAVTAGV
FT                   AFHHAGLRSDHRILIESAFRNRDLRVICATPTLAAGVNVPARRVVVRDLKRYTGEKMAW
FT                   LPVLEVHQMCGRAGRPHLDPYGEAVLIGDITNKIDSSDAQTSADGEQKSIRTESRWRRY
FT                   VDAGPESIESQLTARNALRTHVLALIVAGFADSKNQVLDVLDSTFFAHQSSTADLTAVI
FT                   DDVVAELIEMGLLTTETTNTALAATAVGKTVSQQYIQPTTGAELVDGIQSITSIPTEQI
FT                   SVLTALEVVCGTPDMHDTYLGNRERADLYRFATSNMDTFVTNLSEIDDFESWLCTIKLA
FT                   QILTAWSNGVTIDEIVERYRVGPGDIESHVERARWLLGTADALTETLGVEVDIFAEGHT
FT                   QL"
FT   CDS_pept        complement(771538..772686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC2"
FT                   /locus_tag="HQ_1632A"
FT                   /product="pyridoxal phosphate-dependent aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1632A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51760"
FT                   /db_xref="GOA:Q18JP4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JP4"
FT                   /protein_id="CAJ51760.1"
FT                   /translation="MNFEFASRIERVEPSATLAISNKASELEANGVDVVDLSVGEPDFP
FT                   TPQNVVEAGKDAMDAGHTGYTPSNGIPELREAIAARLREGGIDAIDEEIIVTPGGKQAL
FT                   YEAFQVLIDDGDEVVLLDPAWVSYEAMSRLAGGSLTRVDLEPYSFQLEPGLDDLEAAVS
FT                   EETELLVINSPSNPTGAVYTDAALEGVRDLAVEYDITVVSDEIYDKITYGVEQTSLASL
FT                   SGMGDRTITINGFSKAYSMTGWRLGYVHAPSALIDQAAKLHSHSVSCAVNFVQRAGVEA
FT                   IENTDDAVVEMRDAFRERRDMLAELFESHDVDVPIGDGAFYMMLPVDNDDQAWCSGAIE
FT                   DAHVATVPGSAFGSPGHARISYAASEDRLREAVGRLAEHEYI"
FT   CDS_pept        complement(772683..773159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /gene_synonym="ribE"
FT                   /locus_tag="HQ_1633A"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.78"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1633A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51761"
FT                   /db_xref="GOA:Q18JP3"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JP3"
FT                   /protein_id="CAJ51761.1"
FT                   /translation="MTEDEDISRERMRVESDVENQTTEVIRLGLVVAEFNSSVTTEMET
FT                   TAEETAADRDAMINTTLSIPGVYDAPLAADRLARRDDIDAVAVIGAIVTGDTDHDQVIG
FT                   DAVAQRLTDVSLERDIPVTFGVSGPGQSGAEARERIEKGAEAVNAAVDMVEMLV"
FT   CDS_pept        773348..775216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1634A"
FT                   /product="TIGR03663 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1634A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51762"
FT                   /db_xref="GOA:Q18JP2"
FT                   /db_xref="InterPro:IPR016950"
FT                   /db_xref="InterPro:IPR019962"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JP2"
FT                   /protein_id="CAJ51762.1"
FT                   /translation="MSQDEVPEGTESISTGERSRLRIQLRTAIESHVSTLPLLQTIRTQ
FT                   RTLIGVITVTLFALILRLSALGGRVFHWDEGRVGYWILRYHETGVHTYRPIVHGPFIPI
FT                   IDRWLFEIAPITDATARLPVALIGGLLPLAALLLRDRLRDIEVISLAVLLAVNPLMIYY
FT                   SRFMRNDVLVAAFAFIALGAVIRGLDTGQLRYSFAAAAALALAFTTKENALLYPICYIG
FT                   AAAIILDWRLMRAVAREESRIEILREWKKQIYTALTGHGTTARTSFARVGCTLIGSVVL
FT                   FVTVCAFFYAPRPDLWQAFGNPARLPDILTAGTIGAVEKFIDTWATGGRQDHAYLPYLY
FT                   DLVETLIYGAPALLSFGLLGIIANRYAAITDRRRSLITFGTYWAIASLLGYPLATDIQA
FT                   PWVAVHVAVPLAIPAAVGLSVVIESARDAIAKTNTDTVTAGLAVLVVLAAAGGVAGANA
FT                   TYFNSASADDKQILQWAQPENDIKSTMLTTGAIAASNTGTDVLFIGTTPPSASNTDFYV
FT                   QNQSSVATAPPGGPAWHSRLPLPWYLERSNATITSTDPDTDLQTALSDPPPVVISKGHD
FT                   EDAVSAILEGYTASEYKFRLWGETVVIFIHDETRSSLAEPSSVSST"
FT   CDS_pept        775312..776517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="HQ_1635A"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide
FT                   synthase"
FT                   /EC_number="6.3.4.18"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1635A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51763"
FT                   /db_xref="GOA:Q18JP1"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JP1"
FT                   /protein_id="CAJ51763.1"
FT                   /translation="MSVTVPGPTLGVVGGGQLGRMLAEAAAPLGVEVIVLDPTPDCPAA
FT                   PVARDHIIGEFDDPDAVSDLAARVNAMTFEIELADADLLSDAISTFDVTVNPAPSTLAM
FT                   IEDKLIQKRTLDDAGIPVPSFRPVDTVSELTTALDIFDAVMLKARTGGYDGRGNVPVTD
FT                   PANAADALEAVGGSAMAERLIDFTRELSVIAVKGDETVRTFPPGENIHDEEILRETIVP
FT                   ARTSEEVRNRANAVARDVLETLDGRGVFGIELFETEAGDILVNEIAPRPHNSGHWTIEG
FT                   AHSSQFEQHIRAVLGWPLGSTARRSPTVMTNILGTVDNSRPAALTGIEPALTDEHISLH
FT                   WYGKDEVRPLRKMGHLTLSDDTISITDPSTDPDSLTIQSLIERARQCREAVAFIQTPPE
FT                   SS"
FT   CDS_pept        776521..777177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE1"
FT                   /locus_tag="HQ_1636A"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide mutase"
FT                   /EC_number="5.4.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1636A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51764"
FT                   /db_xref="GOA:Q18JP0"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JP0"
FT                   /protein_id="CAJ51764.1"
FT                   /translation="MPAHTPNEPTIQALLDRLHTQADTDLTTAETPDVGIIMGSDSDLD
FT                   TMVGAHEALDKLGFDEQTEFMTSPDARFTYETYVVSAHRTPQVLYAYGETAADRGIDVI
FT                   IAGAGGKSADLPNMTASIAYPIPVIGVPVQEKSVDSVIGMPTGAPIVAVDAGKSHNAAL
FT                   SAAQILSREHDVLKTRLEEYHTALITDVAADSFRMHDAGVNTFRANNDESGTSNE"
FT   CDS_pept        777382..777795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="HQ_1637A"
FT                   /product="NADH dehydrogenase-like complex subunit A"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1637A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51765"
FT                   /db_xref="GOA:Q18JN9"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JN9"
FT                   /protein_id="CAJ51765.1"
FT                   /translation="MSEWIAVGALGLVAVGIPLGMMAISAILRPTVPEQGKSATYESGE
FT                   IPTGSARVQFNIQYYMIALLFLVFDVETVLILPWTVIYRPALEAGADLTTVLLPMLVFI
FT                   GILIVGLVWAWRNGAVKWIKSPLANRQKTERDI"
FT   CDS_pept        777792..778496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="HQ_1638A"
FT                   /product="NADH dehydrogenase-like complex subunit B"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1638A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51766"
FT                   /db_xref="GOA:Q18JN8"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JN8"
FT                   /protein_id="CAJ51766.1"
FT                   /translation="MSSEQDNAFVTDDTQVQTDTRDARISGTDERFNSKLREAFGSSPF
FT                   ILTKFDQFMNWVRGSSMFMLQFGIACCSIEMMHTYAVKHDLDRFGAGVPRASPRQADVI
FT                   IVPGTIVSKFAPRMKRVYDQMPEPKFVVGMGSCTVSGGPFQEGYNVIKGAEEVIPVDIH
FT                   IPGCPPRPEALVYGIAKLQERISNGESAPVTVKPYELQQFDDLSQDEIVSQLAEEIDED
FT                   DLVMRYDWADSS"
FT   CDS_pept        778493..780172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoCD"
FT                   /locus_tag="HQ_1639A"
FT                   /product="NADH dehydrogenase-like complex subunit CD"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1639A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51767"
FT                   /db_xref="GOA:Q18JN7"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JN7"
FT                   /protein_id="CAJ51767.1"
FT                   /translation="MSLEEPEPTQSAEKTAEQLPTTGDEIESLLSDVVIGRDDHLNAPG
FT                   VIIRPDDVQKTLRRLRNKAGFDHLSCVTADERVDRYESIYHLTSYDDRTRELSVVVPTT
FT                   KDDPVSESAAPVFRTADWHEREAYDLIGINYEDHPDLRRILLPQTWQGHPLSNNYDQDR
FT                   PQIVTLKEWENPLAEDHREEEGDTMYINIGPHHPATHGVLHVKTVLDGEQIADIDPDIG
FT                   YLHRCEEQICEAKTYRHQIMPYPDRWDYASSGLLNEWAYARAAEDLNDLEVPEYAQVIR
FT                   TMGAEICRIASHMLAVGTFALDVYGDFTAIFMYAMRDREKAQNILEDLTGQRMMFNYFR
FT                   LGGVVWDLPEPRDEFFETIRDFLEDLPTALEEYHDLISSNEILQVRTIDTGVLPPEEAK
FT                   SYGATGPVARGSGIDYDLRRDDPYGYYDELDWDVVTEDGCDNFSRLLVRLREVEESAKI
FT                   IEQCVDILEGWPEDERTIQSNVPRTLRPDDDAEIYRAVEGAKGELGIYIRGDGTEEPGR
FT                   FKIRSPCFSNLQTLPEMSSGEYIPDMVASLGSLDIVLGEVDR"
FT   CDS_pept        780172..781233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="HQ_1640A"
FT                   /product="NADH dehydrogenase-like complex subunit H"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1640A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51768"
FT                   /db_xref="GOA:Q18JN6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JN6"
FT                   /protein_id="CAJ51768.1"
FT                   /translation="MSALLQSKTLLPETIANLLGLSGTLGAIIGGLIGAFVIANLLLVQ
FT                   TAVAGPWAKRKITAAFTDRIAVNRIGPFGLLVIVADAVRLLSKELVIPEGVDRPAWDLG
FT                   PLVIPFSALLGFAVIPMGSGIQLADPETGIVFAFAAGSIASVGLIMMGYSSNNKFSLLG
FT                   GLRAIASNIAYEIPLVITGASVILFTGTLQTSAIVAQQSEPLISIAGVTIPQWFAFVNP
FT                   FAFVLFVIANLAEVGRNPFDIPEAPTEIVAGYQTEYSSVYFVLIYLGEFIHIFLGGAIA
FT                   ATLFLGGPAGPVLPGFIWFTIKIWLFYFFTQWVRSAIPRLRVDQFLDVGWKGMLVLSFA
FT                   NLALTAIIVGVIA"
FT   CDS_pept        781230..781691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="HQ_1641A"
FT                   /product="NADH dehydrogenase-like complex subunit I"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1641A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51769"
FT                   /db_xref="GOA:Q18JN5"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JN5"
FT                   /protein_id="CAJ51769.1"
FT                   /translation="MIGLLKSMATTMKHALDGETFTVEYPDVAPEVSPRFRGVHKFSQE
FT                   RCIWCRQCEKVCPNDTIQIVQDDKRNGEQYNLHIGQCIYCRLCEEVCPVDAILLTQNFE
FT                   FTADTKDEFVYNMEQLKNVPWYKDIDPLNSREPDRGGWIDEGAGEVDYQ"
FT   mobile_element  781819..782571
FT                   /mobile_element_type="transposon:HqIRS100"
FT                   /locus_tag="HQ_HqIRS100A"
FT   CDS_pept        781957..782549
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1642A"
FT                   /note="product: IS1341-type transposase (nonfunctional)"
FT                   /note="gene has a frameshift and is truncated at the
FT                   N-terminus"
FT   CDS_pept        782685..782945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ1"
FT                   /locus_tag="HQ_1643A"
FT                   /product="NADH dehydrogenase-like complex subunit J1"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1643A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51771"
FT                   /db_xref="GOA:Q18JN4"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JN4"
FT                   /protein_id="CAJ51771.1"
FT                   /translation="MVYETIAFVLFALVTVGCSLGVVLMQDVWHSALLLGGALLSVAVH
FT                   YVMLQAEFLAVMQILVYVGGVLILVTFAVMLTRTQPEGSNI"
FT   CDS_pept        782942..783301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ2"
FT                   /locus_tag="HQ_1644A"
FT                   /product="NADH dehydrogenase-like complex subunit J2"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1644A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51772"
FT                   /db_xref="GOA:Q18JN3"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JN3"
FT                   /protein_id="CAJ51772.1"
FT                   /translation="MTTRPKLKLGSHLLPGLAAIGLFIVMTAAFLSASFPQPQGFPADA
FT                   NITASIGYAMFNLNLGDVAGESFLAAFIIIALTLDVALDGSIHLARREYSDSDTSVITD
FT                   GGRKLKNHVFNEGDD"
FT   CDS_pept        783301..783603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="HQ_1645A"
FT                   /product="NADH dehydrogenase-like complex subunit K"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1645A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51773"
FT                   /db_xref="GOA:Q18JN2"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JN2"
FT                   /protein_id="CAJ51773.1"
FT                   /translation="MLTPQYYLVLSAAVFCTGLFGILTRRNALLFLMSVELMLNAANIN
FT                   LIAFSYLWGNITGQTFGLFVMALAAAEVAIGIGIILVLYRNFDNVDVTDATTMRW"
FT   CDS_pept        783605..785629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="HQ_1646A"
FT                   /product="NADH dehydrogenase-like complex subunit L"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1646A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51774"
FT                   /db_xref="GOA:Q18JN1"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JN1"
FT                   /protein_id="CAJ51774.1"
FT                   /translation="MVGIFDLAPVIILLPFISFLTALAIGNRLPKGGALTGITATGGSL
FT                   LIAIATAVAVSGGRVYTATIYTWASGLDVVNLTFGVLIDPLSAMMLVIVTLVSFLVHIF
FT                   SLGYMNDEGEVGLPRYYAGLGLFSASMLGFVVADNLLMAFMFFELVGLCSYLLIGFWFR
FT                   EPGPPSAAKKAFLVTRFGDYFFLIGVVAVFATFGTAAFSGSGSFPALAEAALLGEAAES
FT                   VRTFGFEPQLWFTIIGLLILGGVVGKSAQFPLHTWLPDAMEGPTPVSALIHAATMVAAG
FT                   VYLVARMYGFYALSPTALAVIAFFGGFTALVAATMGVVKREIKQVLAYSTISQYGYIML
FT                   GLGGGGYVAATFHLMTHAFFKALLFLGAGSVIIAMHHTEDMWEMGGLKKKLPVTYYTFV
FT                   TGSLALAGIIPFAGFWSKDEVLYETLLHGLDGNTILLAAYAMGLIAVFFTGFYTFRMVF
FT                   LTFHGNPRSETAREPENVGMNIKIPLTILGILAATTGFLNMTPVAKLTGLHIEFLHKWL
FT                   EHGFTGLTVEHYGELLHDVAGYGATGIELSPILPGAVSLGLALAGFLLAYQLYNVPEPV
FT                   AHTDRLGSLKTMVYNNYYQDEYQVWIATGFTQPLARVASKLDQGVIDGVVNGVSGVSLF
FT                   AGSRVRRIQTGIVSNYAALLTLGLTALLVGLGLMGGWFV"
FT   CDS_pept        785626..787152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="HQ_1647A"
FT                   /product="NADH dehydrogenase-like complex subunit M"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1647A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51775"
FT                   /db_xref="GOA:Q18JN0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JN0"
FT                   /protein_id="CAJ51775.1"
FT                   /translation="MIIELLIAFTFIAALTIFAVPNRVAGRLAAIASAIPILGSLWMWA
FT                   QYDATGNALLGGSIAYETDVIWLTLGGLELHWFVGVDGISLPLVVLTTILTMLAIVSAW
FT                   TPIDERQSQFYGLMLFMEANLLGVFTALDFFVWFIFWEAVLVPMYFLIGVWGGPNRRYA
FT                   AIKFFVYTNIASLAMFIGFIALVFGLGSSVSSMRLPEITQALRAGSLTAFGGIDAATLK
FT                   LVAFIAMFVGFAVKVPVAPLHTWLPDAHVEAPTPVSVMLAGVLLKMGTYALLRYNFTMM
FT                   PDVAIDLVIPIASIAVISVIYGALLALAQQDLKRIIAYSSVSSMGYVILGLIAYTTYGV
FT                   GGATFQMVAHGLISGLMFMSVGVIYNITHTRMVGDMSGIADRMPVTAGIFIAGAFGYMG
FT                   LPLMAGFAGEFFIFKGAFASTVHTAMPLFTAAAMFGIVIVAGYLLFAMQRTLFGPFSFD
FT                   GEYEITTAAMHDIAPLAVLLALVIALGVAPDLFFGMIQEAVTPILTGGGV"
FT   CDS_pept        787152..788696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="HQ_1648A"
FT                   /product="NADH dehydrogenase-like complex subunit N"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1648A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51776"
FT                   /db_xref="GOA:Q18JM9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JM9"
FT                   /protein_id="CAJ51776.1"
FT                   /translation="MPASTFSMIDIIILQSQSGLPSGILVLTPVILLAATGLILLLIDT
FT                   IFTEVSSDSLLAGVSAIGSLLAFGITGWFLISGLGQPQTGGAITLYGDALVVDGLSLFF
FT                   ILIFTIVTTMVAVASYDYISAQQYKAEFYSLILFAATGMALMSMSNSLATAFVSLELAS
FT                   LPSYALVSFLKDDQSSIEAGLKYLLIGALSSAVFVFGISLVYAATGSLLLSDIAKSVAE
FT                   TELIGVLGIGILMIAGGFAFKTASVPFHFWAPEAYEGAPAPISAFLSSASKAAGFAVAF
FT                   RVFVEAFPLGSLPVGVDWVLAFQVLAVATMTLGNFAAATQETVKRMLAYSSIGHAGYAL
FT                   IGLAALSAGGPNGDVLGASMAHLFVYGFMNTGAFLFIALVEHWGVGRTFEDYNGLVTRA
FT                   PIAVVAMTVFLFSLAGLPPFGGFVSKYALFYSAIESGFWWLAAVGAVNSALSLFYYSRV
FT                   IRAMWIESPTQDLSALDSRPIGLYAAVLFAGVGTLILLPAFGPVVETAQTVAAALF"
FT   mobile_element  788776..789088
FT                   /mobile_element_type="insertion sequence:HqIRS80"
FT                   /locus_tag="HQ_HqIRS80A"
FT   CDS_pept        789236..790708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1649A"
FT                   /product="DHH/RecJ family phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1649A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51777"
FT                   /db_xref="GOA:Q18JM8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JM8"
FT                   /protein_id="CAJ51777.1"
FT                   /translation="MNRRLLLGCGPAVHDAVEQFIDRSGHLTIVTQHETVFESFNGEDI
FT                   DHTQANPDDSTVYPPTADMIFIASDEAKQNAITAETARTEFPNTHITSFVPATASQKIR
FT                   ERINCVSNHVIDARQALVSRFNDILTHPGARQLHQLFTTLRDIDDTLAIVMHDAPDPDA
FT                   IASALALAELADNADIDADLCYYGSISHQENRALVNLLDIDLLNFERETDVEEYDSIAL
FT                   VDHSRPGVNDGLAPDTTVDIVVDHHPPRATVEASFVDIRRNVGATSTIFADYLRRINAA
FT                   PTESVATALLFGIRTDTNDFAREVSAADFEAAAWLLTHANLSTLDNVESPQMTSGVLET
FT                   LSSAIQNRDVRGNALASNVGSITDRDSLAQAADHVLNLKGVKIAIVYGWIDDTVYLSGR
FT                   ARGVDIDLGETLRSALGTVGSAGGHADLAGAQIPLDALNLAQEESTDDHYATISDAVST
FT                   RVFGALDNKTTVLEPEESGSTVEPFQFPQKTQ"
FT   CDS_pept        791083..791865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1650A"
FT                   /product="CBS/parB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1650A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51778"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR016427"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JM7"
FT                   /protein_id="CAJ51778.1"
FT                   /translation="MSEKATVNEYMTQDVQTVSPTDTVADVAHQIKNSAGHTGFPVSEG
FT                   RTVEGVVTACDLLLVDDEAAIFTVMTEDIIVAHPDMAVVDAGRVILRSGIQKLPVVDDA
FT                   GNLVGIISNTDVVRSQIERATPEKVGKLMRTLEQIHGISVEQERRSITLDNLVPTQSRV
FT                   YGDELEGRQYELERGLAEPLVTIDTAGALLLADGHHRVMAATEVGIDEMEAYVIIVDDP
FT                   VELGMQRTAKKEGLYSIDDIEIVEYGRHPLVETTRRLQ"
FT   CDS_pept        complement(791918..792202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1651A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1651A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51779"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JM6"
FT                   /protein_id="CAJ51779.1"
FT                   /translation="MVATETYTIEDPDGNTETVELPAGLPDMFTEQGEDSIAVVCDLII
FT                   QSFAQQSHAVVHHGEGDTPADLEERNDKMESLFEDRFGVSLSEAMGHNH"
FT   CDS_pept        complement(792316..793383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB2"
FT                   /locus_tag="HQ_1652A"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1652A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51780"
FT                   /db_xref="GOA:Q18JM5"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JM5"
FT                   /protein_id="CAJ51780.1"
FT                   /translation="MTAQTDESVEHRRLVIAGSGIAGLSAAIYAGRANNDPLVLEGDEP
FT                   GGQLTLTTEVENYPGFPEGISGPELIQNMKSQAERFGADIRHGVVETVNDDEQPVILNI
FT                   SNGDTYTTDALIVASGASARTLGIPGEDELMGYGLSTCATCDGAFFRGEEIMVVGGGDA
FT                   AMEEASFLTKFASTVYIVHRREEFRAEDYWVDRIMEHVDNGDVEIMRNTELIELHGTRE
FT                   DGVDYTTLVRHPEGYPSEKLDDPETETFEFDVGAVFYAIGHTPNTEYLHNTGVSLDDRG
FT                   YLDAAGGDGGGQTKTDAPGIFAAGDVVDYHYQQAATAGGMGVKAALDVDEYLEDLEQNQ
FT                   ATTVDTDVAAVESDD"
FT   CDS_pept        793590..793877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1653A"
FT                   /product="DUF357 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1653A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51781"
FT                   /db_xref="InterPro:IPR023140"
FT                   /db_xref="InterPro:IPR036809"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JM4"
FT                   /protein_id="CAJ51781.1"
FT                   /translation="MTAELIAKTDQYERMLADALEVAEIAVPKTTPLGRAAHETREMAR
FT                   SYLEDGRHFRTVDDLVNALAAFSYGYGWLDAGVRIGLFNIPAESDLFTTS"
FT   CDS_pept        complement(794034..795527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="HQ_1654A"
FT                   /product="cysteine--tRNA ligase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1654A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51782"
FT                   /db_xref="GOA:Q18JM3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JM3"
FT                   /protein_id="CAJ51782.1"
FT                   /translation="MTLSVTNTLTGEREEFEPRGDEVLLYVCGLTVSDHAHLGHARLWV
FT                   HADIMHRWLEYQGYTVRHVENFTDVNEKIVARIGEDELGETEATVADHFTNSVIQDMRG
FT                   LNLKRATVYPRVSEHIPTIIDLVESLLDDGYAYEANGSVYFDVTAFDGYGDLSNQQLDE
FT                   MEAQTPADERAEKRHPADFALWKAGGVKPDDLNEHRSEELDQLETTHGQTWNAPWGEGR
FT                   PGWHIECSAMSMDHLDETLDIHVGGRDLMFPHHENEVAQSEAATDQQFARYWLHVGLLQ
FT                   SAGDKMSSSIGNILTIKQALDEHGVNVIRMFYLATAYRSEQTLGQSELAEATERWDRLN
FT                   RAYEMAVDASNSTDAYAIVEDESLRSSVSETKSSFTSAMNNDFNVREAIASLLKLATSV
FT                   NRHLDSQERYDYRGLYMAIEAFEALGGEVCGLKFGDQPTGDGTVEIAEELIELILDVRE
FT                   TEREAGNYDRADELRDSLDEIGIEVQDNNEETIYRVNNQ"
FT   CDS_pept        complement(795555..796085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1655A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1655A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51783"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JM2"
FT                   /protein_id="CAJ51783.1"
FT                   /translation="MSLAAETRAAARAHPWLVTALRADIINYRAAASFLDLEGDIDSVA
FT                   RALRRFGDSLNKFTTVGESDIPIRMHHGVDIVSDTHDMVQKQGEASVDILLRLNSEFII
FT                   TADGQLSAIIVDTVPDMTISGFTTAIERVQMEDINIKAAGTLQDMFIVIVPRRKGASAL
FT                   RSVEAALTVIPTS"
FT   CDS_pept        796513..797388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiX2"
FT                   /locus_tag="HQ_1656A"
FT                   /product="sirohydrochlorin cobaltochelatase"
FT                   /EC_number="4.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1656A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51784"
FT                   /db_xref="GOA:Q18JM1"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JM1"
FT                   /protein_id="CAJ51784.1"
FT                   /translation="MQALVIVAHGSHLNPDSSTPTHQHADTIRASGAFDEVRTGFWKEE
FT                   PSLREVLRTVEADEIYLVPLFISEGYFTEQVIPRELRLDGWDVSEWNSDGLSADTATLE
FT                   ATDTGQTIHYCGPVGTHEAMTDVLVRRAETVTGDPSVGDECGFAVVGHGTERNENSAKA
FT                   IEYHADRVRDLDRFDEVQALYMDEDPEVDDVTDFFDTTDIVVVPLFVADGFHTQEDIPE
FT                   DMGLTDDYRTGYDVPATVDDHRIWYAGAVGTEGLTADVILERAADAGADISTAIETVRE
FT                   QTRETTLADD"
FT   CDS_pept        797381..798631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1657A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1657A"
FT                   /db_xref="EnsemblGenomes-Tr:CCL97814"
FT                   /db_xref="InterPro:IPR041181"
FT                   /db_xref="InterPro:IPR041346"
FT                   /db_xref="UniProtKB/TrEMBL:J7RFT8"
FT                   /protein_id="CCL97814.1"
FT                   /translation="MIKVPGTVSKALIAHLVNVKDQINFDGLCVTAVDGGYRIETPSVE
FT                   TPTLTHTDLLNYVTTEEVAPYVTNWYYWESTLSELGRHRRAFLRRAEGAHKNDVPTRYR
FT                   ALHSDDGCLTEWGEIQVTAILDNRGHRHYDIRHQDDAKVAPETLETHTDPRDAREISTY
FT                   DDRGRYRPLQTAPSLQTGWVFPNLDARDAVETINFLYPASIPNWNLERNGELDITHWRE
FT                   TVERQTGIYGVVEELPRSAVEWVAEACCVDSQCLKRREWQYTDDDQLEADGGTGTFPCR
FT                   EPCSLVIAASRRWTKLEEENERTYEFDLTPSEKDQLEAIIDAVADGRTDEIREADVYEG
FT                   ANQYRTRFLRAKRIDDEGRLSGTPTEPLAESSTNDEQQTVMDDADNDVATSGNEPHDGA
FT                   DHSSQSAEANGEASKDE"
FT   CDS_pept        complement(798687..799286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1658A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1658A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51786"
FT                   /db_xref="GOA:Q18JM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JM0"
FT                   /protein_id="CAJ51786.1"
FT                   /translation="MTEPLTIRLNAGKLYAVDTPDAFSARENFDIELQNMGESVHVHLR
FT                   FDEKLSQGARLPEVNHYVKADDNRRVGVRVSPHQYPIEGELTVASGYGSKTDCVTVTIA
FT                   APESNVDETTEAGENKEASDTEDNTILTRGWKWIRSQNNIGTEIGGIAAVGGLSVIALF
FT                   IAVSIAIIIPNSVTVLLVGTVFGVVVAVALGLLLDI"
FT   CDS_pept        complement(799417..799602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1659A"
FT                   /product="UPF0434 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1659A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51787"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JL9"
FT                   /protein_id="CAJ51787.1"
FT                   /translation="MKESLMDILCDPLDKSELELEVDERDGEEIIEGRLIGKETGEVYP
FT                   IEDGIPNLLPPDMREE"
FT   CDS_pept        complement(799700..801031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="HQ_1660A"
FT                   /product="adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1660A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51788"
FT                   /db_xref="GOA:Q18JL8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JL8"
FT                   /protein_id="CAJ51788.1"
FT                   /translation="MTVTIVGSQLGDEGKGALVDLWGGGADVVARYQGGDNAGHTVVED
FT                   GDEYKLSLVPSGAVRDKIGVLGNGCVINLKTLFSEIDDLRERGLTPDVRVARRAHVIMP
FT                   YHRVLDGIEEDAKSDSDLEAGTTGRGIGPTYEDKVGRRGVRVGDLLDPSVLRDRLEYVV
FT                   PQKRALAENIFGVDTSEAFDVESLFSEYRQLGKRLTEEDMTVNAGEFLNEHLNHDSTIL
FT                   FEGAQGTSIDIDHGIYPYVTSSNPTAGGAATGTGISPTVIGQGEVVGIIKAYLSRVGTG
FT                   PLPTELTGTDEALADHIREKGGEFGTVTGRPRRIGWLDIPMLRHATRSNGFTGLVINHI
FT                   DVLAGLDEVCVGHSYDLNGEEQFTIPATTERWAECEPNLRSFDPWDSVAWSNVATEGYE
FT                   AIPANAQQYLEYLTNELDTPIYAIGVGPDRAETIELVNPFDIDA"
FT   mobile_element  801118..801168
FT                   /mobile_element_type="insertion sequence:HqIRS81"
FT                   /locus_tag="HQ_HqIRS81F"
FT   CDS_pept        complement(801227..802831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purNH"
FT                   /locus_tag="HQ_1661A"
FT                   /product="phosphoribosylglycinamide formyltransferase /
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /EC_number="2.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1661A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51789"
FT                   /db_xref="GOA:Q18JL7"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JL7"
FT                   /protein_id="CAJ51789.1"
FT                   /translation="MLTIAGLASNHGRNLLHIADQSPGDATVEVILTNDADAPVLDAAS
FT                   AREVQTGVIERPDKQSREKHEERILDALGQYDIDIICLDGYMRVLTERFIESTPPVLNV
FT                   HPSLLPAFPGLNAHERVLEADVRVTGCTVHLVTEAVDDGPIITQESVPVRTYDDPSTLK
FT                   QRVRTTAEFIAYPRAIRLFSHDKVTIDHSKTPPTVSIEIDDADQFPEKRHISSDRVDAL
FT                   RYGENPHQSAAVYADMTASEPSVVRAPQLNHGAKALSYNNYNDADAALRLVQEFKKPAA
FT                   AVIKHTNPAGCATAETLTDAYADALATDPMSAFGGIVALNRTCDAATAGAIIESFKEVV
FT                   VAPGYTDNAIDMLREREDLRVLEVDSIDESEKTSDQQSIISKPLIGGRLLQEQDTWAPS
FT                   RDDLEVVTSVEPTEEQLTTMEFAWRVLKHVKSNGIILADGTETVGIGMGQVSRVDAVRL
FT                   AVMKATEHAEDGGPAGSIMASDAFFPFPDGVETAADADIEAVIQPGGSVNDDEVIAACE
FT                   EHDIPMVFTGRRCFRHD"
FT   CDS_pept        803232..804656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="HQ_1662A"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1662A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51790"
FT                   /db_xref="GOA:Q18JL6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JL6"
FT                   /protein_id="CAJ51790.1"
FT                   /translation="MDNLSRDNPLAAVSPLDGRYSSRTAPLVSHTSEAALMRTRLRVEI
FT                   EYLYALDALEPISFSLDPSDRDTLKTTVNSFDGDDAAMIKQIEVEGAAGYSATNHDVKA
FT                   IEYFLRIQTPSYIHPWIHFGLTSEDINNLSHRLLIRSGVKNVLVPALRSLRDELVSLAQ
FT                   EYRKTPMLAQTHGQPATPTTFGKEMAVYATRIGTAIGRITDANDTLTGKLAGASGTYAA
FT                   HAAAYPDVDWRAFAQSFVTDLGLNHVKLSTQINPCDDLAALFDALCGVNNMIIDLDRDA
FT                   WLYISNRYLGQQTTAGETGSSTMPHKVNPIDFENAEGNLSKATSDLRFLADYITNSRLQ
FT                   RDLSDSTVKRNIGAGFAHALIGYKKTTDGLQKVVPNQTVMQSELESHPELIGEAVQTIL
FT                   RREGDVDAYERVKELTRGEDVALTDFHDLFASLSVSESVRDELQALSPLTYTGYASELV
FT                   DEVDETTDADAQDSYS"
FT   CDS_pept        804794..805873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="HQ_1663A"
FT                   /product="glucose 1-dehydrogenase"
FT                   /EC_number="1.1.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1663A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51791"
FT                   /db_xref="GOA:Q18JL5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR026583"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JL5"
FT                   /protein_id="CAJ51791.1"
FT                   /translation="MQAIAVSRDSKGPICIEKPRPEPEPGEALIRTLRVGIDGTDHEII
FT                   AGSYGEYPADEDHLVLGHEAVGVVEDPGTTGLERGEVVAPIVRRSPNGESVYFDRGEPD
FT                   MAPEGSYHERGIIGSHGYFSEFFTSQAQHLVSIPSSLAQVGFLVEPLSVVNKAIELATA
FT                   SRSSFTWEPTSALVLGNGSLGLLMLAHITSTDTYERCYCLGRRDRPDPTIDIIERLGAT
FT                   YVDSRKTPVDMIPSTYESMDFICEATGHAPHAFKTIDALAPNGVGALLGVPESSSFEID
FT                   GGALHNELVLHNKALIGSVNSNITHFKTASDDLQTFPEWFIDSLITDVYPLSEFRYAFD
FT                   NNDDTTIKTAVQLSAYEER"
FT   CDS_pept        805860..806525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE1"
FT                   /locus_tag="HQ_1664A"
FT                   /product="homolog to orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1664A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51792"
FT                   /db_xref="GOA:Q18JL4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR022854"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18JL4"
FT                   /protein_id="CAJ51792.1"
FT                   /translation="MKNVDDLIENAAELAERGLSKGEIADELNVSRETASWLVERSQPT
FT                   DNSQSSSANNPTEAHDIHVDWSAVGRDSKRLTYIGQAMADLLMKEGEAVDLTIGIEKAG
FT                   ASLSTVVAQELDTDLGSYAPAKHQWDEGDIDELGGSFSRNFAQIRDRDCYIVDDTITSG
FT                   TTMQETIDAIRDAGGRPVACVVVVDKQGVDSLADVPVYSLIDVVRVDSDTNDRDISNK"
FT   CDS_pept        806650..806997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grx4"
FT                   /locus_tag="HQ_1665A"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1665A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51793"
FT                   /db_xref="GOA:Q18JL3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JL3"
FT                   /protein_id="CAJ51793.1"
FT                   /translation="MTFQPGSELSDEEITTRVNETIADNDIALFMKGNRLMPQCGYSQR
FT                   AVNLISQHVEEFETIDVLPALDQYRSALEDHSGWETIPQTYVDGEFIGGSDILAELDER
FT                   GELAEKLGFDD"
FT   CDS_pept        807158..807727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1666A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1666A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51794"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JL2"
FT                   /protein_id="CAJ51794.1"
FT                   /translation="MSGRVYRLHSTLELPLEDVEAFLNGDPDLPTEIESIELTRRNNTL
FT                   ILKAVAADDNLSKYTPTAQLKASVTENRVYEEEPPRGGNPRWTDEEEEEIPSELVEFAC
FT                   FKGDRETVLQNTALQYPMFRVFRQISLLAEKGTLTAITEINEELSAHRIVEGEERPATI
FT                   EVVENPSQNENGSGGVDWRDNKFISD"
FT   CDS_pept        807945..809327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1667A"
FT                   /product="DUF4147 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1667A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51795"
FT                   /db_xref="GOA:Q18JL1"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JL1"
FT                   /protein_id="CAJ51795.1"
FT                   /translation="MFEQRGRNRQNTAQIPAKTSVSATPQECAVTAVTAGVNAAHPDQV
FT                   LSETLTREGDILSIANNQYDLSKYEEVSIIGGGNAAGRITQYLTTIVDDHLTGGIVITD
FT                   DPVDADPVNVVTGTHPLPSRSNITAAEQMRSYACDCGANTLSLVVITGGGSALLSAPAE
FT                   NIDKSALRRVTQELIQCGAPIDRINAVRKHISTIKGGQLARALTPAQTVGLIFSDVTSG
FT                   NPSVVASGPLSPDSTTYADALITLREYDVNTPESVRMHLQRGANGDIDETPSELSSSTF
FT                   DSPTTIVLADGMTALDAAANACSNLGYEPLILSSSIRGEAREAAKTHVAIAEEVQRNRT
FT                   PIDPPAAILAGGETTVTVTGDGVGGPNQEFALAAALELPSNTALCAIDTDGFDGPTDAA
FT                   GATVTTATVNDNEASAARAALKANDAYSFLDDNAALMLSTEGATGTNVNDLRVLTILTE
FT                   DT"
FT   CDS_pept        809355..810326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1668A"
FT                   /product="homolog to sulfate adenylyltransferase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1668A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51796"
FT                   /db_xref="GOA:Q18JL0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JL0"
FT                   /protein_id="CAJ51796.1"
FT                   /translation="MPESFPEYLDVDYTDGNEETSTDYPTIESKIEKAITVTKRGLEQY
FT                   ENPVVMWTGGKDSTLTLYFIEEVARQYDLETPSTVFIDHFQHFDEIHDFVDRWANEWDL
FT                   DVIYARNNDIGEYVDEHGLEPGDEIPVSDLSEHNQHHVRDLLEYEEDTFPFLLDTYVGN
FT                   HLLKTVALNDTLESYGVDGVISGVRWDEQEARAKETFFSSRHDPDIYPPHDRIQPILQF
FT                   DERAVWETFWNFVVPDTVSAYPDEGYVPTGADDLPDGVSMNDVPVSPKYFAGFRSLGSE
FT                   VSTEKTTEEPAWLQDVENTTERAGRAQDKEDLMERLRDLGYM"
FT   CDS_pept        810450..811067
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HQ_1668B"
FT                   /note="product: uncharacterized protein (nonfunctional)"
FT                   /note="gene has frameshifts and is truncated at the
FT                   N-terminus"
FT   CDS_pept        811402..812151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dph6"
FT                   /locus_tag="HQ_1669A"
FT                   /product="diphthamide biosynthesis protein Dph6"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1669A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51797"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022427"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JK9"
FT                   /protein_id="CAJ51797.1"
FT                   /translation="MNISADNQPQQTSNHWVSLFSGGKDSSWALYRALEDGRDVTHLLT
FT                   VHPSADSYMYHVPETKLAQLAAKSAGIELIEINPDEFDASNAVDAGTQGDRELEPLENA
FT                   VEALDKTLTGGITGVTAGAVESEFQTDRIRGMCNRLDIELFAPLWQRDPITLAENMIAA
FT                   GFEITIIQVAARGLDSSWLGRTLDTETLSELITLNDRHGVHVLGEGGEFETFVTNGPHL
FT                   SRPIELEYTTIWEGTRGYIDVTNATLR"
FT   CDS_pept        complement(812169..813131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="graD1"
FT                   /locus_tag="HQ_1670A"
FT                   /product="sugar nucleotidyltransferase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1670A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51798"
FT                   /db_xref="GOA:Q18JK8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JK8"
FT                   /protein_id="CAJ51798.1"
FT                   /translation="MKAVVLAGGYATRMWPITKDRPKMFLPVGDGTVIDIIFQDLEADN
FT                   RVDEVFVSTNERFADDFESYIESSSYEKPTLSVEDTSEEDEKFGVVGALEQLIDRENVS
FT                   DDLVVVAGDNLLSFDLSEFVDFFESKQTPCLAAYDVGSKDRASSYGLVQLDDDQVIDFQ
FT                   EKPDNPQSTLVSIACYAFPAETLPNFETYLADGNNPDEPGWLMQWLQNRGSVHAFTFDG
FT                   AWFDIGTPESYLDAVSWYLDGETFIDDTATVEDSTLGNNVHLMAGASVVDSELERTVVF
FT                   ENTNIDAATVSDSVIDEESSIEAVDLTETLVGSYSQIRQ"
FT   CDS_pept        813235..813651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HQ_1671A"
FT                   /product="HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1671A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51799"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038767"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JK7"
FT                   /protein_id="CAJ51799.1"
FT                   /translation="MGQDNPPSNAESAHYSGSKTTAESQSISDSTIDRNDNTTIRTDAQ
FT                   TTREHIRAEIQTTPQTASELATIVNTARSAVFGHIDHIAQSVNASPDEQFLVAPPTCKR
FT                   CGFDQFDDPLNNPSQCPDCRSERLSEPEFIIKPL"
FT   CDS_pept        complement(813661..814227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt1"
FT                   /locus_tag="HQ_1672A"
FT                   /product="purine phosphoribosyltransferase (adenine
FT                   phosphoribosyltransferase, xanthine-guanine
FT                   phosphoribosyltransferase)"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1672A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51800"
FT                   /db_xref="GOA:Q18JK6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR026597"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q18JK6"
FT                   /protein_id="CAJ51800.1"
FT                   /translation="MDQLRQSLLEAPIIEKGDYEYFVHPVSDGVPVLRPELLREIVIKI
FT                   IRKVEVDNVDKIVTPAAMGIHISTAVSLMTDIPLVVIRKRQYGLEGEVSLSQQTGYAEN
FT                   EMYINDVRDGERVLVLDDVLSTGGTMRAVLDALDQIGAEVVDTVAVIKKAGPNELDESD
FT                   HDVKTLINVRVTDGTVVIVDSNGDG"
FT   CDS_pept        complement(814484..814912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="HQ_1673A"
FT                   /product="pilin PilA"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1673A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51801"
FT                   /db_xref="GOA:Q18JK5"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JK5"
FT                   /protein_id="CAJ51801.1"
FT                   /translation="MHGYQSDERGVSPVIGVILMIAITVLLATVVGGFVLNFGDQLGDT
FT                   TPQATISFTYIDDTTVSIRHSNGDAIDPKQLMLAGDIEFTPQLSFDAVAGKDNRFSVGE
FT                   TAQYSITKEWNGQTIRIIWKSANNRRGTTLATSIAPVR"
FT   CDS_pept        815122..816312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpE"
FT                   /locus_tag="HQ_1674A"
FT                   /product="Mrp-type sodium/proton antiporter system subunit
FT                   E"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1674A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51802"
FT                   /db_xref="GOA:Q18JK4"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JK4"
FT                   /protein_id="CAJ51802.1"
FT                   /translation="MAGSTANDAYSRLLVPVRDSTTIRNTVAYAIRAAESAAEKTAANP
FT                   TVHFVYLSRQRGFDSDSINNISSADEFLERVSVWATEDVNDIQSESMVESAGSEDLDTA
FT                   DETIITIETTLLGTDRYLFSPTDFAEITINYAEKHNLDRIIVDPEYQPGGGAPMLRSYE
FT                   TALTQADCTVEKAPVERRTSRSRIETPSTLMKGIATFVICNAFYLLIAGSITPFNLLTG
FT                   AVTALAASIAFSNITFTTSPRLTKTGLRVLRMGLFIPYLLWEIAKANLAIAYIILHPSL
FT                   PIDPEMQQFRAGVRGAVSVMTLANSITLTPGTLTVDVDDDGLYIHTLTESARSDLSAGG
FT                   LERAVRFVFYGRAAARFPAPTERDSILSITTESESGELSTDVISDPSSSQTPQEAD"
FT   CDS_pept        816312..816638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpF"
FT                   /locus_tag="HQ_1675A"
FT                   /product="Mrp-type sodium/proton antiporter system subunit
FT                   F"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1675A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51803"
FT                   /db_xref="GOA:Q18JK3"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JK3"
FT                   /protein_id="CAJ51803.1"
FT                   /translation="MTASVIAIIQVNIGASLTEPVEAILIGAAIILILSAVIVSYRIVF
FT                   GPTMQDRVIAVNSVGTTTVVVLALLAAALDRPGFLDIALVYAMLNFLMSIAISKFTVER
FT                   GGVI"
FT   CDS_pept        816640..816972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpG"
FT                   /locus_tag="HQ_1676A"
FT                   /product="Mrp-type sodium/proton antiporter system subunit
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1676A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51804"
FT                   /db_xref="GOA:Q18JK2"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JK2"
FT                   /protein_id="CAJ51804.1"
FT                   /translation="MSPLNIIAVVLILAGTFFGIVATIGVIRLPDLYTRAHATSKSDTL
FT                   GIVLTLSGVALVFGTGVTTAKTVLLAIFVFITNPTAAHAITRAAYDQNIAPWTTDTEIK
FT                   PEGDDQ"
FT   CDS_pept        816969..817514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpB1"
FT                   /locus_tag="HQ_1677A"
FT                   /product="Mrp-type sodium/proton antiporter system subunit
FT                   B1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1677A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51805"
FT                   /db_xref="GOA:Q18JK1"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JK1"
FT                   /protein_id="CAJ51805.1"
FT                   /translation="MTPIQWGILASVLTLAVVVAAAAVLLYDVLNAIIAFATFSFGVAI
FT                   TWILFAAPDVALTEAAVGAGITTTLLLVTIARTVRQSGDRLLEKVDPRAALTAILFTGL
FT                   LATTVDNLPAIGSPQSPIATSPITSYYIENAYPETGVENAVTAVLAAYRGFDTLGEATV
FT                   VIAAGLAVLVILQQEAYA"
FT   CDS_pept        817511..818047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpB2"
FT                   /locus_tag="HQ_1678A"
FT                   /product="Mrp-type sodium/proton antiporter system subunit
FT                   B2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1678A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51806"
FT                   /db_xref="GOA:Q18JK0"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JK0"
FT                   /protein_id="CAJ51806.1"
FT                   /translation="MSNNADTASDTDTRAESINNPTYVESTIIMTTVRLVVPFIFTFGL
FT                   FVMFHGADSAGGGFQGGVIVASTVLLLAFAFGIDATRRWIEGPLIRTAIATGGGLFILI
FT                   GLGALINGQFLEYAAYDIGTTGIKYGIELVELGIGAIVSGVLIGLFFTLARGDMLTEGD
FT                   IDQRSSQEQHGSDRS"
FT   CDS_pept        818044..818412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpC"
FT                   /locus_tag="HQ_1679A"
FT                   /product="Mrp-type sodium/proton antiporter system subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1679A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51807"
FT                   /db_xref="GOA:Q18JJ9"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JJ9"
FT                   /protein_id="CAJ51807.1"
FT                   /translation="MTPIELFTSRYSYIVFVALVGIGLYGVINSSNLVKKVIGLNIFQV
FT                   GIFLFFIASGYVNGAAPPLIEKGAETAYASPLPHVLILTAIVVGVSLTAVALALIIRVY
FT                   NAYGSLDEDVIREVQLND"
FT   CDS_pept        818405..819907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpD3"
FT                   /locus_tag="HQ_1680A"
FT                   /product="Mrp-type sodium/proton antiporter system subunit
FT                   D3"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1680A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51808"
FT                   /db_xref="GOA:Q18JJ8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JJ8"
FT                   /protein_id="CAJ51808.1"
FT                   /translation="MTDALPLLVVIPLFAALFPVALGYLWSDAGWATAAVTALLHLGLA
FT                   SVVAQQVINSGQFSYAVGGFQPPIGIELVADSVTAVLVVLISVITILIVAYARRAGPHQ
FT                   NAFYSELLLLTAGVSGVVITGDLFNLYVFLEITGLATYALVAANRSPAAALASVKYLLV
FT                   GTIGASLYLLGVGYLYVATGTLNMADLAGQLPAVGYDTPLVVTGFVLLMTGLAIKTALF
FT                   PLHTWQPNAYAESPHSVTAYIAALVSTAAAYAIFRITYTVFTTSFASVVPLALDALAWA
FT                   AAISVIVGSVLAVVQSDLKRMLAYSSVAQFGLIIAGIAVMNEIALTGSLVHLVGHAVMK
FT                   AGLFVAVGGLASIAGGQTIDDMIGLGRRAPIVSLGFATLAFALVGVPPAIGFAGKWQIV
FT                   LGAVSAGHWAVGVVAVISTMLTLAYFLRIVERLYFRSPSSVDEQTSDMSMNMTTDGGDA
FT                   MATSISQTTRVIVTLSAISAIALGLAASDLISILEPALEVYF"
FT   CDS_pept        819907..822003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpD1"
FT                   /locus_tag="HQ_1681A"
FT                   /product="Mrp-type sodium/proton antiporter system subunit
FT                   D1"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1681A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51809"
FT                   /db_xref="GOA:Q18JJ7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JJ7"
FT                   /protein_id="CAJ51809.1"
FT                   /translation="MAEIISLRPLLAVILPAIGIAGIVLSRRYQNIREGATIITAVSTV
FT                   AIIASLLPAVLAGNVYITNLGSFVPGVAFTLRADALGTLFALLASFLWVITSFYSIGYM
FT                   RGLGEHAQTRYFASFAGSVSAAIGVAFASNLIILYIFYELLTVATYPLVTHDESDAARA
FT                   AGRKYLAYTFGGGVAVLAGIVLVFWSTGTVAFTSGGIASLASIDPLIARGAFALLAGGF
FT                   GVKAALIPVHSWLPDAMVAPTPVSGLLHAVAVVKSGVFGISRLVLDVYGPETVAQLGVG
FT                   VPLAVVAAITIVIASVIALRQDNLKRRLAYSTISQLSYIVLGLGLFSPEALIGGLLHIP
FT                   AHAFMKLTLFFCAGAIHVETHTDNISKMAGIGRRMPLTMSAFAIASVGMAGLPLVAGFV
FT                   SKWYLLIGSVDAGYPIFAIVLLGSGILNIAYFWPIVYQAFFQTAAETDAKPVVEFSLGG
FT                   QWHPIRTDGHGREYGDEHTEETDADADADDDADITAASDAVNNKQSDDTDSESSQRETA
FT                   LSGDPSDPNAETTYAVDMYPSDHTTADTEGSAQKTTADTIDDTDESIDPDSASSDNETL
FT                   NTGMNRGQDSTGVDASSSTDSSSKSPTPDASLLNTPETEVDDNTDTSANIDHPDIDAPD
FT                   HDDAYMSDPVWDRRTIYTESTWFMLGPIVIAVTGAVALGIIPQQVVFLSLIEQVVTAAT
FT                   GVII"
FT   CDS_pept        822000..823916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpD2"
FT                   /locus_tag="HQ_1682A"
FT                   /product="Mrp-type sodium/proton antiporter system subunit
FT                   D2"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1682A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51810"
FT                   /db_xref="GOA:Q18JJ6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JJ6"
FT                   /protein_id="CAJ51810.1"
FT                   /translation="MSGLSVLIPTVVSMFTLIEMCMQLALSAFANITYTILPAAAAPSL
FT                   PTIEFVIPFPPAFAILSIALIAPFLSRRVGHVLGVIVTAGVAVISLVSPVGAHLPVTFL
FT                   GFDAVLFNVDAFSRVMGVIFGTIGAAAVLYSYSSQASNRQTAFALGYVGTSIGSVFAGD
FT                   WLTLVFFWELMAITSTALVWDYGGEAVRAGFRYAIYHGIGGSLLIAAVIWHYVDVGSFL
FT                   FTAASGLTAGIPAALAAVGIGVNVGFVGLHVWLPDTYPRPHIAASVFLSVYTTKTGVYG
FT                   LARAFPDGNVLIAYMGAAMALVGVVYALLQNDMRRLLSYHIQSQVGYMVAGIGIGTALA
FT                   TAGAFAHVFNHILYKALLFMTAGVVVSRVGEENLKYLGGLRRYLPLTALAFGIAALSIS
FT                   GFPGFNGFVSKGMITAAADKKNFDGIFYILLAAGVGTFMSFIKFGYYAFIRSTPDSGVI
FT                   AGSENADADIISSAIGQRVAMLSVATLCILFGLFPDALFALLPGSTTDAHPFTLGHLTE
FT                   GIVLAVLGIIGFALVKRPISNIGKVPDIDTVINPGAFYLTRGLVRGTTEIFAIVDNAIQ
FT                   VIATRSLEITANPYGSIRQPAAILLQRDPDTLTDGSLQATIGTSVLLVVVVLVIAFIGT
FT                   MSM"
FT   CDS_pept        complement(824263..825420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /gene_synonym="dfp"
FT                   /locus_tag="HQ_1683A"
FT                   /product="phosphopantothenoylcysteine decarboxylase /
FT                   phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:HQ_1683A"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ51811"
FT                   /db_xref="GOA:Q18JJ5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q18JJ5"
FT                   /protein_id="CAJ51811.1"
FT                   /translation="MLDGVNVALGISGSIAAVKVVELAHELRRQGATV