(data stored in SCRATCH9089 zone)

EMBL: AM236080

ID   AM236080; SV 1; circular; genomic DNA; STD; PRO; 5057142 BP.
XX
AC   AM236080;
XX
PR   Project:PRJNA344;
XX
DT   04-MAY-2006 (Rel. 87, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 10)
XX
DE   Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841
XX
KW   complete genome.
XX
OS   Rhizobium leguminosarum bv. viciae 3841
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Rhizobium.
XX
RN   [1]
RP   1-5057142
RA   Crossman L.C.;
RT   ;
RL   Submitted (21-FEB-2006) to the INSDC.
RL   Crossman L.C., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1186/gb-2006-7-4-r34.
RX   PUBMED; 16640791.
RA   Young J.W., Crossman L.C., Johnston A.W.B., Thomson N.R., Ghazoui Z.F.,
RA   Hull K.H., Wexler M., Curson A.R.J., Todd J.D., Poole P.S., Mauchline T.H.,
RA   East A.K., Quail M.A., Churcher C., Arrowsmith C., Cherevach A.,
RA   Chillingworth T., Clarke K., Cronin A., Davis P., Fraser A., Hance Z.,
RA   Hauser H., Jagels K., Moule S., Mungall K., Norbertczak H.,
RA   Rabbinowitsch E., Sanders M., Simmonds M., Whitehead S., Parkhill J.;
RT   "The genome of Rhizobium leguminosarum has recognizable core and accessory
RT   components";
RL   Genome Biol. 7(4):R34-R34(2006).
XX
DR   MD5; d2208932b74f46353122dea87dc55047.
DR   BioSample; SAMEA1705944.
DR   EnsemblGenomes-Gn; EBG00001182866.
DR   EnsemblGenomes-Gn; EBG00001182867.
DR   EnsemblGenomes-Gn; EBG00001182868.
DR   EnsemblGenomes-Gn; EBG00001182869.
DR   EnsemblGenomes-Gn; EBG00001182870.
DR   EnsemblGenomes-Gn; EBG00001182871.
DR   EnsemblGenomes-Gn; EBG00001182872.
DR   EnsemblGenomes-Gn; EBG00001182873.
DR   EnsemblGenomes-Gn; EBG00001182874.
DR   EnsemblGenomes-Gn; EBG00001182875.
DR   EnsemblGenomes-Gn; EBG00001182876.
DR   EnsemblGenomes-Gn; EBG00001182877.
DR   EnsemblGenomes-Gn; EBG00001182878.
DR   EnsemblGenomes-Gn; EBG00001182879.
DR   EnsemblGenomes-Gn; EBG00001182880.
DR   EnsemblGenomes-Gn; EBG00001182881.
DR   EnsemblGenomes-Gn; EBG00001182882.
DR   EnsemblGenomes-Gn; EBG00001182883.
DR   EnsemblGenomes-Gn; EBG00001182884.
DR   EnsemblGenomes-Gn; EBG00001182885.
DR   EnsemblGenomes-Gn; EBG00001182886.
DR   EnsemblGenomes-Gn; EBG00001182887.
DR   EnsemblGenomes-Gn; EBG00001182888.
DR   EnsemblGenomes-Gn; EBG00001182889.
DR   EnsemblGenomes-Gn; EBG00001182890.
DR   EnsemblGenomes-Gn; EBG00001182891.
DR   EnsemblGenomes-Gn; EBG00001182892.
DR   EnsemblGenomes-Gn; EBG00001182893.
DR   EnsemblGenomes-Gn; EBG00001182894.
DR   EnsemblGenomes-Gn; EBG00001182895.
DR   EnsemblGenomes-Gn; EBG00001182896.
DR   EnsemblGenomes-Gn; EBG00001182897.
DR   EnsemblGenomes-Gn; EBG00001182898.
DR   EnsemblGenomes-Gn; EBG00001182899.
DR   EnsemblGenomes-Gn; EBG00001182900.
DR   EnsemblGenomes-Gn; EBG00001182901.
DR   EnsemblGenomes-Gn; EBG00001182902.
DR   EnsemblGenomes-Gn; EBG00001182903.
DR   EnsemblGenomes-Gn; EBG00001182904.
DR   EnsemblGenomes-Gn; EBG00001182905.
DR   EnsemblGenomes-Gn; EBG00001182906.
DR   EnsemblGenomes-Gn; EBG00001182907.
DR   EnsemblGenomes-Gn; EBG00001182908.
DR   EnsemblGenomes-Gn; EBG00001182909.
DR   EnsemblGenomes-Gn; EBG00001182910.
DR   EnsemblGenomes-Gn; EBG00001182911.
DR   EnsemblGenomes-Gn; EBG00001182912.
DR   EnsemblGenomes-Gn; EBG00001182913.
DR   EnsemblGenomes-Gn; EBG00001182914.
DR   EnsemblGenomes-Gn; EBG00001182915.
DR   EnsemblGenomes-Gn; EBG00001182916.
DR   EnsemblGenomes-Gn; EBG00001182917.
DR   EnsemblGenomes-Gn; EBG00001182918.
DR   EnsemblGenomes-Gn; EBG00001182919.
DR   EnsemblGenomes-Gn; EBG00001182920.
DR   EnsemblGenomes-Gn; EBG00001182921.
DR   EnsemblGenomes-Gn; EBG00001182922.
DR   EnsemblGenomes-Gn; EBG00001182923.
DR   EnsemblGenomes-Gn; EBG00001182924.
DR   EnsemblGenomes-Gn; EBG00001182925.
DR   EnsemblGenomes-Gn; EBG00001182926.
DR   EnsemblGenomes-Gn; EBG00001182927.
DR   EnsemblGenomes-Gn; EBG00001182928.
DR   EnsemblGenomes-Gn; EBG00001182929.
DR   EnsemblGenomes-Gn; EBG00001182930.
DR   EnsemblGenomes-Gn; EBG00001182931.
DR   EnsemblGenomes-Gn; EBG00001182932.
DR   EnsemblGenomes-Gn; EBG00001182933.
DR   EnsemblGenomes-Gn; EBG00001182934.
DR   EnsemblGenomes-Gn; EBG00001182935.
DR   EnsemblGenomes-Gn; EBG00001182936.
DR   EnsemblGenomes-Gn; EBG00001182937.
DR   EnsemblGenomes-Gn; EBG00001182938.
DR   EnsemblGenomes-Gn; EBG00001182939.
DR   EnsemblGenomes-Gn; EBG00001182940.
DR   EnsemblGenomes-Gn; EBG00001182941.
DR   EnsemblGenomes-Gn; EBG00001182942.
DR   EnsemblGenomes-Gn; EBG00001182943.
DR   EnsemblGenomes-Gn; EBG00001182944.
DR   EnsemblGenomes-Gn; EBG00001182945.
DR   EnsemblGenomes-Gn; EBG00001182946.
DR   EnsemblGenomes-Gn; EBG00001182947.
DR   EnsemblGenomes-Gn; EBG00001182948.
DR   EnsemblGenomes-Gn; EBG00001182949.
DR   EnsemblGenomes-Gn; EBG00001182950.
DR   EnsemblGenomes-Gn; EBG00001182951.
DR   EnsemblGenomes-Gn; EBG00001182952.
DR   EnsemblGenomes-Gn; EBG00001182953.
DR   EnsemblGenomes-Gn; EBG00001182954.
DR   EnsemblGenomes-Gn; EBG00001182955.
DR   EnsemblGenomes-Gn; RL0791.
DR   EnsemblGenomes-Gn; RL0993.
DR   EnsemblGenomes-Gn; RL1081.
DR   EnsemblGenomes-Gn; RL1140.
DR   EnsemblGenomes-Gn; RL1143.
DR   EnsemblGenomes-Gn; RL1153.
DR   EnsemblGenomes-Gn; RL1158.
DR   EnsemblGenomes-Gn; RL1978.
DR   EnsemblGenomes-Gn; RL2020.
DR   EnsemblGenomes-Gn; RL2030.
DR   EnsemblGenomes-Gn; RL2111.
DR   EnsemblGenomes-Gn; RL2137.
DR   EnsemblGenomes-Gn; RL2171.
DR   EnsemblGenomes-Gn; RL2197.
DR   EnsemblGenomes-Gn; RL2311.
DR   EnsemblGenomes-Gn; RL2349.
DR   EnsemblGenomes-Gn; RL2439.
DR   EnsemblGenomes-Gn; RL2451.
DR   EnsemblGenomes-Gn; RL2463A.
DR   EnsemblGenomes-Gn; RL2469.
DR   EnsemblGenomes-Gn; RL2724.
DR   EnsemblGenomes-Gn; RL3035.
DR   EnsemblGenomes-Gn; RL3096.
DR   EnsemblGenomes-Gn; RL3286.
DR   EnsemblGenomes-Gn; RL3640.
DR   EnsemblGenomes-Gn; RL3660.
DR   EnsemblGenomes-Gn; RL3694.
DR   EnsemblGenomes-Gn; RL3856.
DR   EnsemblGenomes-Gn; RL3970.
DR   EnsemblGenomes-Gn; RL4070.
DR   EnsemblGenomes-Gn; RL4313.
DR   EnsemblGenomes-Gn; RL4345.
DR   EnsemblGenomes-Gn; RL4475.
DR   EnsemblGenomes-Gn; RL4479.
DR   EnsemblGenomes-Gn; RL4510.
DR   EnsemblGenomes-Gn; RL4641.
DR   EnsemblGenomes-Gn; RL4674.
DR   EnsemblGenomes-Tr; EBT00001761575.
DR   EnsemblGenomes-Tr; EBT00001761576.
DR   EnsemblGenomes-Tr; EBT00001761577.
DR   EnsemblGenomes-Tr; EBT00001761578.
DR   EnsemblGenomes-Tr; EBT00001761579.
DR   EnsemblGenomes-Tr; EBT00001761580.
DR   EnsemblGenomes-Tr; EBT00001761581.
DR   EnsemblGenomes-Tr; EBT00001761582.
DR   EnsemblGenomes-Tr; EBT00001761583.
DR   EnsemblGenomes-Tr; EBT00001761584.
DR   EnsemblGenomes-Tr; EBT00001761585.
DR   EnsemblGenomes-Tr; EBT00001761586.
DR   EnsemblGenomes-Tr; EBT00001761587.
DR   EnsemblGenomes-Tr; EBT00001761588.
DR   EnsemblGenomes-Tr; EBT00001761589.
DR   EnsemblGenomes-Tr; EBT00001761590.
DR   EnsemblGenomes-Tr; EBT00001761591.
DR   EnsemblGenomes-Tr; EBT00001761592.
DR   EnsemblGenomes-Tr; EBT00001761593.
DR   EnsemblGenomes-Tr; EBT00001761594.
DR   EnsemblGenomes-Tr; EBT00001761595.
DR   EnsemblGenomes-Tr; EBT00001761596.
DR   EnsemblGenomes-Tr; EBT00001761597.
DR   EnsemblGenomes-Tr; EBT00001761598.
DR   EnsemblGenomes-Tr; EBT00001761599.
DR   EnsemblGenomes-Tr; EBT00001761600.
DR   EnsemblGenomes-Tr; EBT00001761601.
DR   EnsemblGenomes-Tr; EBT00001761602.
DR   EnsemblGenomes-Tr; EBT00001761603.
DR   EnsemblGenomes-Tr; EBT00001761604.
DR   EnsemblGenomes-Tr; EBT00001761605.
DR   EnsemblGenomes-Tr; EBT00001761606.
DR   EnsemblGenomes-Tr; EBT00001761607.
DR   EnsemblGenomes-Tr; EBT00001761608.
DR   EnsemblGenomes-Tr; EBT00001761609.
DR   EnsemblGenomes-Tr; EBT00001761610.
DR   EnsemblGenomes-Tr; EBT00001761611.
DR   EnsemblGenomes-Tr; EBT00001761612.
DR   EnsemblGenomes-Tr; EBT00001761613.
DR   EnsemblGenomes-Tr; EBT00001761614.
DR   EnsemblGenomes-Tr; EBT00001761615.
DR   EnsemblGenomes-Tr; EBT00001761616.
DR   EnsemblGenomes-Tr; EBT00001761617.
DR   EnsemblGenomes-Tr; EBT00001761618.
DR   EnsemblGenomes-Tr; EBT00001761619.
DR   EnsemblGenomes-Tr; EBT00001761620.
DR   EnsemblGenomes-Tr; EBT00001761621.
DR   EnsemblGenomes-Tr; EBT00001761622.
DR   EnsemblGenomes-Tr; EBT00001761623.
DR   EnsemblGenomes-Tr; EBT00001761624.
DR   EnsemblGenomes-Tr; EBT00001761625.
DR   EnsemblGenomes-Tr; EBT00001761626.
DR   EnsemblGenomes-Tr; EBT00001761627.
DR   EnsemblGenomes-Tr; EBT00001761628.
DR   EnsemblGenomes-Tr; EBT00001761629.
DR   EnsemblGenomes-Tr; EBT00001761630.
DR   EnsemblGenomes-Tr; EBT00001761631.
DR   EnsemblGenomes-Tr; EBT00001761632.
DR   EnsemblGenomes-Tr; EBT00001761633.
DR   EnsemblGenomes-Tr; EBT00001761634.
DR   EnsemblGenomes-Tr; EBT00001761635.
DR   EnsemblGenomes-Tr; EBT00001761636.
DR   EnsemblGenomes-Tr; EBT00001761637.
DR   EnsemblGenomes-Tr; EBT00001761638.
DR   EnsemblGenomes-Tr; EBT00001761639.
DR   EnsemblGenomes-Tr; EBT00001761640.
DR   EnsemblGenomes-Tr; EBT00001761641.
DR   EnsemblGenomes-Tr; EBT00001761642.
DR   EnsemblGenomes-Tr; EBT00001761643.
DR   EnsemblGenomes-Tr; EBT00001761644.
DR   EnsemblGenomes-Tr; EBT00001761645.
DR   EnsemblGenomes-Tr; EBT00001761646.
DR   EnsemblGenomes-Tr; EBT00001761647.
DR   EnsemblGenomes-Tr; EBT00001761648.
DR   EnsemblGenomes-Tr; EBT00001761649.
DR   EnsemblGenomes-Tr; EBT00001761650.
DR   EnsemblGenomes-Tr; EBT00001761651.
DR   EnsemblGenomes-Tr; EBT00001761652.
DR   EnsemblGenomes-Tr; EBT00001761653.
DR   EnsemblGenomes-Tr; EBT00001761654.
DR   EnsemblGenomes-Tr; EBT00001761655.
DR   EnsemblGenomes-Tr; EBT00001761656.
DR   EnsemblGenomes-Tr; EBT00001761657.
DR   EnsemblGenomes-Tr; EBT00001761658.
DR   EnsemblGenomes-Tr; EBT00001761659.
DR   EnsemblGenomes-Tr; EBT00001761660.
DR   EnsemblGenomes-Tr; EBT00001761661.
DR   EnsemblGenomes-Tr; EBT00001761662.
DR   EnsemblGenomes-Tr; EBT00001761663.
DR   EnsemblGenomes-Tr; EBT00001761664.
DR   EnsemblGenomes-Tr; RL0791.
DR   EnsemblGenomes-Tr; RL0993.
DR   EnsemblGenomes-Tr; RL1081.
DR   EnsemblGenomes-Tr; RL1140.
DR   EnsemblGenomes-Tr; RL1143.
DR   EnsemblGenomes-Tr; RL1153.
DR   EnsemblGenomes-Tr; RL1158.
DR   EnsemblGenomes-Tr; RL1978.
DR   EnsemblGenomes-Tr; RL2020.
DR   EnsemblGenomes-Tr; RL2030.
DR   EnsemblGenomes-Tr; RL2111.
DR   EnsemblGenomes-Tr; RL2137.
DR   EnsemblGenomes-Tr; RL2171.
DR   EnsemblGenomes-Tr; RL2197.
DR   EnsemblGenomes-Tr; RL2311.
DR   EnsemblGenomes-Tr; RL2349.
DR   EnsemblGenomes-Tr; RL2439.
DR   EnsemblGenomes-Tr; RL2451.
DR   EnsemblGenomes-Tr; RL2463A.
DR   EnsemblGenomes-Tr; RL2469.
DR   EnsemblGenomes-Tr; RL2724.
DR   EnsemblGenomes-Tr; RL3035.
DR   EnsemblGenomes-Tr; RL3096.
DR   EnsemblGenomes-Tr; RL3286.
DR   EnsemblGenomes-Tr; RL3640.
DR   EnsemblGenomes-Tr; RL3660.
DR   EnsemblGenomes-Tr; RL3694.
DR   EnsemblGenomes-Tr; RL3856.
DR   EnsemblGenomes-Tr; RL3970.
DR   EnsemblGenomes-Tr; RL4070.
DR   EnsemblGenomes-Tr; RL4313.
DR   EnsemblGenomes-Tr; RL4345.
DR   EnsemblGenomes-Tr; RL4475.
DR   EnsemblGenomes-Tr; RL4479.
DR   EnsemblGenomes-Tr; RL4510.
DR   EnsemblGenomes-Tr; RL4641.
DR   EnsemblGenomes-Tr; RL4674.
DR   EuropePMC; PMC1557990; 16640791.
DR   EuropePMC; PMC2383954; 18458328.
DR   EuropePMC; PMC3147472; 21642401.
DR   EuropePMC; PMC3569347; 23405347.
DR   EuropePMC; PMC5739047; 29220487.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00520; ybhL.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01059; mir-598.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AM236080.
DR   SILVA-SSU; AM236080.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5057142
FT                   /organism="Rhizobium leguminosarum bv. viciae 3841"
FT                   /strain="3841"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /db_xref="taxon:216596"
FT   CDS_pept        complement(join(5056183..5057142,1..72))
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="RL4742"
FT                   /product="putative uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:RL4742"
FT                   /db_xref="EnsemblGenomes-Tr:CAK10225"
FT                   /db_xref="GOA:Q1MA15"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MA15"
FT                   /protein_id="CAK10225.2"
FT                   /translation="MSDTGRKIMRVLSGESLSPPPLWLMRQAGRYLPEYRETRAKAGSF
FT                   LDLCYTPEHAVEVTLQPIRRYGFDAAILFSDILVIPDAMKRNVRFTEGHGPEMDPIDEA
FT                   GIGSLNGEEVVDYLRPVLETVRRLREELPAETTLLGFCGAPWTVATYMIAGHGTPDQAP
FT                   ARLFAYKHARAFEHLLMLLADVSADYLVAQIDAGADAVQIFDSWAGVLGEKEFEAFAIR
FT                   PVARMIASVKSRRPHARIIAFAKGAGYQLKTYRQKTGADAIGLDWSVPLAFAAELQKDG
FT                   PVQGNLDPMRVVAGGRALEEGIDDILQHLGNGPLIFNLGHGITPQADPEHVRLLVDRVR
FT                   GGA"
FT   CDS_pept        474..1295
FT                   /transl_table=11
FT                   /locus_tag="RL0001"
FT                   /product="conserved hypothetical protein"
FT                   /product="Hypothetical UPF0085 protein R00001."
FT                   /db_xref="EnsemblGenomes-Gn:RL0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05489"
FT                   /db_xref="GOA:Q1MNF6"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNF6"
FT                   /protein_id="CAK05489.1"
FT                   /translation="MENRTNFFHLHLISDSTGETLISAGRAASAQFRSAQPIEHVYPLI
FT                   RNRKQLLPVLQAIDDAPGIVLYTIVDRELASLIDERCIEMGVASVNVLEPVMNAFQIYL
FT                   GAPSRRRVGAQHVMNAGYFARIEALNFTMDHDDGQMPDDYNDADVVIIGISRTSKTPTS
FT                   IYLANRGIKTANIPIVYGVPLPESLFVASKPLIVCLIATTDRISQVRENRVLGVTQGFD
FT                   REHYTDRAAISEELKYARSLCARHNWPLIDVTRRSIEETAAAIVALRPKLR"
FT   CDS_pept        1329..1928
FT                   /transl_table=11
FT                   /locus_tag="RL0002"
FT                   /product="putative septum formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05490"
FT                   /db_xref="GOA:Q1MNF5"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNF5"
FT                   /protein_id="CAK05490.1"
FT                   /translation="MTPKLILASSSPFRRMLMENAGLSFEAHAARIDERAVEAPLENAG
FT                   AKPDAVALVLARAKAEEVSSRFPDSLVIGSDQTMSLGDSVFHKPTDLADAASHLQALSG
FT                   VTHRLNSAVAIVSDGVVLWEHLAHAQLTMRPLTVEFIARHLARVGERALSSVGAYQLEG
FT                   EGIQLFEKIEGDYFTILGLPMLPLLKKLRELGAIDG"
FT   CDS_pept        1921..2778
FT                   /transl_table=11
FT                   /locus_tag="RL0003"
FT                   /product="putative shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05491"
FT                   /db_xref="GOA:Q1MNF4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNF4"
FT                   /protein_id="CAK05491.1"
FT                   /translation="MGDSRETFGPKAFVTGFPIKHSRSPLIHGYWLKTLGLLGSYRAHE
FT                   VTPEAFADFIHSLKDGSSGFTGGNVTIPHKELAFRLADKPDALSQELGASNTLWREDGA
FT                   LHATNTDGRGFIANLDERHPGWDRHGTAVVFGAGGASRAIIQAVRDRGFKEIHVVNRTV
FT                   ERARELADRFGPRVQAHPAGALVEVMKGAGLFINTTSLGMDGEPAPQLDFSPLAADAVV
FT                   TDIVYVPLKTPILAQAEEQGFPIVDGLGMLLHQAVPGFEKWFGQRPIVDAPLRALIIAD
FT                   MEAH"
FT   CDS_pept        2778..3389
FT                   /transl_table=11
FT                   /locus_tag="RL0004"
FT                   /product="putative dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05492"
FT                   /db_xref="GOA:Q1MNF3"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNF3"
FT                   /protein_id="CAK05492.1"
FT                   /translation="MLKIGLTGSIGMGKSTAAKLFADAGIPVNDSDAVVHDLYAGEAAP
FT                   LVNAAFPGTMKDGAVDRRELGRQLALDPDGFKCLEAIVHPLVRKRETEFLKRQRATGAD
FT                   MVLLDIPLLFETGAEARVDVVVVVSTDPQIQRQRVLAREGMTEEKFDMILSRQTPDAEK
FT                   RRRADYLIDTSHSIATTRERVFEIVADLKTRIAKGDFRNA"
FT   CDS_pept        3382..4104
FT                   /transl_table=11
FT                   /locus_tag="RL0005"
FT                   /product="putative DNA polymerase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RL0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05493"
FT                   /db_xref="GOA:Q1MNF2"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNF2"
FT                   /protein_id="CAK05493.1"
FT                   /translation="MREIIFDTETTGLDNRADRIIEIGGIELFNHFPTGNTIHIFINPG
FT                   DQKVHPDALAVHGITDEFLKDKQPFAEVAEQILTFFGDAKWIAHNATFDMGFINAEFAR
FT                   IGLPPILPERVLDTLSMARRKHPMGPNSLDALCRRYGIDNSHRTKHGALLDSELLAEVY
FT                   IEMIGGRQAALGLGMVGKSNQAARGEMGMEDDVVIAALLERPRPLAPRLSQTEEQAHEA
FT                   LVAKLGEKSVWAKYANLD"
FT   CDS_pept        complement(4172..4654)
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="RL0006"
FT                   /product="putative SecB protein export protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05494"
FT                   /db_xref="GOA:Q1MNF1"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNF1"
FT                   /protein_id="CAK05494.1"
FT                   /translation="MADDNNSNGAANPTLSILAQYTKDLSFENPGAPRSLQARDKAPTI
FT                   NINVNVNANPLSDTDFDVVLSLNAEAKDGDKTVFHAELTYGGVFRVAGFPQEHMLPVLF
FT                   IECPRMLFPFARQIIADVTRNGGFPPLMIDPIDFTQMFAQRVAEEQARAKVQAVPN"
FT   CDS_pept        complement(4756..5271)
FT                   /transl_table=11
FT                   /locus_tag="RL0007"
FT                   /product="putative transmembrane FxsA-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05495"
FT                   /db_xref="GOA:Q1MNF0"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNF0"
FT                   /protein_id="CAK05495.1"
FT                   /translation="MTDMRFSILPAFILLLPFAEIAGFVVVGQAIGLWLTLVLVMLGFV
FT                   LGVVLLRRQGIGILRRMSSEGRNGVMPGRDLLRPAMNVIASLLLIIPGFLTDIIAILIL
FT                   IPPVRDLVWRAIAKRFVVVNAKGGSSSGPQPDFRDRKPNSKVVDLEEEDYHREPDRNSP
FT                   WSGRHLGD"
FT   CDS_pept        5394..6098
FT                   /transl_table=11
FT                   /locus_tag="RL0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05496"
FT                   /db_xref="GOA:Q1MNE9"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNE9"
FT                   /protein_id="CAK05496.1"
FT                   /translation="MSSNDFITLFFLVAAVLIFFQLRSVLGRRTGNEKPPRDLYTPRDA
FT                   APAEAADAGKVVTLPRRDATTEDEDRFAAIDAFAAPGTPLNESLRALNKADPAFSPKEF
FT                   LNGARMAYEMIVMAYADGDRKTLKNLLSREVYDGFDAAIGEREARGEKVKSTFVGIDKA
FT                   EITHAETKGSEAQITVRIASQLISATYDKADVLIEGDAENVAEVNDVWTFARDTRSRDP
FT                   NWKLVATESEHE"
FT   CDS_pept        6091..7209
FT                   /transl_table=11
FT                   /gene="mltA"
FT                   /locus_tag="RL0009"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase a precursor"
FT                   /db_xref="EnsemblGenomes-Gn:RL0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05497"
FT                   /db_xref="GOA:Q1MNE8"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNE8"
FT                   /protein_id="CAK05497.1"
FT                   /translation="MSDHASDFVLQAISFDTLEGWKDDDPSGLFEVMRSCRRQITDVKP
FT                   YRTGSLGLSSEDLLPLLAAAEDFTPSSPASARAFFETHCRPFLIRRNDGNSGFVTAFYE
FT                   PDIDVSERPDEIFRFPFYRRPDDLIDLDDANRPAGLDKAYAFGRLHEGHVTAYPDRRAI
FT                   DQGFLEGRGLEIAWAKSKVDVFFVHVQGAARLRYQDGRIGRITYAAKAGHAFSAIGKLL
FT                   IERGEIDRAEISMQAIRAWLARNPERVDEVLWHNRSYIFFRDAPVADPQAGPIAAAKVP
FT                   LLAGRSLAVDRTIHTFGFPFFIRAESLTHLDQGRPFRRLMLALDTGSAIVGPARGDIFT
FT                   GSGDIAGESAGTVRNQADFVILIPNAAAGRFD"
FT   CDS_pept        7209..7775
FT                   /transl_table=11
FT                   /locus_tag="RL0010"
FT                   /product="putative Smr domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05498"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNE7"
FT                   /protein_id="CAK05498.1"
FT                   /translation="MARDRKLSADERILWGKVARSTRPMPGKAGALTELDAFLAEAEAA
FT                   AEREQEKRTPATPTPLQPTAPSMAKPSAGVHHPLEKPVKRKIAKGRLALEARIDLHGLV
FT                   QSEAHTILLDFLIRAHERSMRHVLVITGKGSSMGSDGALKRAVPLWFSKPEFRYLISSY
FT                   ESAAQHHGGEGALYIRLSRRHGERP"
FT   CDS_pept        7772..8149
FT                   /transl_table=11
FT                   /locus_tag="RL0011"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05499"
FT                   /db_xref="GOA:Q1MNE6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNE6"
FT                   /protein_id="CAK05499.1"
FT                   /translation="MTPFGEAVRRLRARKGVSQKEMAEALNVSPAYLSALEHGKRGLPT
FT                   FDLLQRIAGYFNIIWDEAEELFLLARSSDPRVVIDTSGLPPEYTEFANRLARRIRNLDS
FT                   AEIGRLSALLENGGKGDGKAS"
FT   CDS_pept        8285..10720
FT                   /transl_table=11
FT                   /gene="gyrB1"
FT                   /locus_tag="RL0012"
FT                   /product="putative DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:RL0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05500"
FT                   /db_xref="GOA:Q1MNE5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNE5"
FT                   /protein_id="CAK05500.1"
FT                   /translation="MSDTSATENGVSTEYGADSIKVLKGLDAVRKRPGMYIGDTDDGSG
FT                   LHHMVYEVVDNAIDEALAGHADIVTVTLNPDGSVTVTDNGRGIPTDIHTGEGVSAAEVI
FT                   MTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLKLKIRRHDKIHEMSFTHGVADAP
FT                   LKVTGDAPNETGTEVSFMPSTDTFTMTEFDYGTLEHRLRELAFLNSGVRILLTDKRHSD
FT                   IKQEELRYDGGLEAFVAYLDRAKKSLVDKPVAIHGEKDGITVEVAMWWNDSYHENVLCF
FT                   TNNIPQRDGGTHMAGFRAALTRQVVSYADSSGITKREKVTLQGEDCREGLTAVLSVKVP
FT                   DPKFSSQTKDKLVSSEVRPVVESLVNEALNTWFEEHPSEAKILVGKVVEAAAAREAARK
FT                   ARELTRRKGALDIASLPGKLADCSERDPTKSEVFLVEGDSAGGSAKQGRSRENQAILPL
FT                   RGKILNVERARFDKMLSSQEIGTLITALGTGIGKDEFNVEKLRYHKIIIMTDADVDGAH
FT                   IRTLLLTFFFRQMPQLIERGHLYIAQPPLYKVSRGKSVQYLKDEKALEEYLISQGLEDA
FT                   SLRLGSGEVRAGQDLREVILDALRMRALLDNLHSRYNRSAVEQAAIAGALNAELASDPA
FT                   RALALANEVAGRLDIIAEETERGWRGDVTTDGGLRLERMVRGVRELVVLDMALIGSSDA
FT                   RHIDQLTARLKEIYQTPPSLHRREGDIEISGPRALLDAIFASGRKGLTMQRYKGLGEMN
FT                   AEQLWETTLDPNVRSLLQVRVNDATDADGLFARLMGDEVEPRREFIQDNALSVANLDI"
FT   CDS_pept        complement(10828..11427)
FT                   /transl_table=11
FT                   /locus_tag="RL0013"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05501"
FT                   /db_xref="GOA:Q1MNE4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNE4"
FT                   /protein_id="CAK05501.1"
FT                   /translation="MTKSNHRESDYPIDPMFLDRWSPRAFTGEIIEEAQLLGLLDAAHW
FT                   APSSANHQPWRFIYGLKGSEHWEIFVALLNDSNQEWARNASALIFVVSRAFTGAAGSTE
FT                   EKPSYTHSFDAGAAWGHLAIQARLSGLYAHGMGGIKHEEIRQAFAIPEGYRVEAGVAIG
FT                   RLADKSVLSERNQAREFPSQRKPLSEVAFNGRFVAN"
FT   CDS_pept        complement(11473..11769)
FT                   /transl_table=11
FT                   /locus_tag="RL0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05502"
FT                   /db_xref="InterPro:IPR014543"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNE3"
FT                   /protein_id="CAK05502.1"
FT                   /translation="MEFEMHLSKAVVRTEHASRYLQQLCKHWSHKFSVDFDPLKGRVPF
FT                   SETAEVTFAADDAALTMTLSVADSSQQERMQHVIDDHLKRFAFREELDIVWTN"
FT   CDS_pept        11922..12887
FT                   /transl_table=11
FT                   /locus_tag="RL0015"
FT                   /product="putative glutathione-S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05503"
FT                   /db_xref="GOA:Q1MNE2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNE2"
FT                   /protein_id="CAK05503.1"
FT                   /translation="MRMLVNGKWTEDWQPVQAKDEKGGFVRQTSSFRNWVTPDGSAGPT
FT                   GEAGFAASAGRYHLYVAYICPWASRTLIGRKLKGLEDIISVSVVEPLLGKQGWRFGDYP
FT                   GATEDHVNGVTYMHEIYTRAAPDFTGRATVPILWDKQKTTIVNNESADILRMLNSGFGG
FT                   LAKNPIDLYPAVRCTEIEAFNDRIYPDLNNGVYRAGFATTQIAYEEAFADVFACLDWVE
FT                   QQFEGRTFLFADHPTESDIRLFVTLVRFDVAYHGIFKCNLRRLSDYANLRAFCRRMLDW
FT                   PGIGETVNLDHIKRGYYSIESLNPTKIIPSGPDLAEIFRA"
FT   CDS_pept        13031..13873
FT                   /transl_table=11
FT                   /locus_tag="RL0016"
FT                   /product="putative FAA hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05504"
FT                   /db_xref="GOA:Q1MNE1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNE1"
FT                   /protein_id="CAK05504.1"
FT                   /translation="MKLMRVGEAGSEKPALLDADGKIRDLSGHVADIGGEAIGPAGLAK
FT                   IAAIDPKSLPELVPGRIGACVAGTGKFICIGLNYSDHAAETGATVPPEPIIFMKATSAI
FT                   VGPNDNVIIPRGSEKTDWEVELGVVIGKTAKYVTEAEALDYVAGYCVSNDVSERAFQTE
FT                   RSGQWTKGKSCDTFGPIGPWLVTKDEIPEPQNLGMWLTVNGQKMQNGSSKTMVYGVAFL
FT                   VSYLSQFMSLHPGDVISTGTPPGVGMGLKPPRYLKSGDVVELGIEGLGTQKQTFVADR"
FT   CDS_pept        14079..15356
FT                   /transl_table=11
FT                   /locus_tag="RL0017"
FT                   /product="putative PHB depolymerase"
FT                   /note="Codons 60 to the C-terminus are similar to codons
FT                   255 to the C-terminus of Azospirillum brasilense PHB
FT                   depolymerase phaZ UniProt:Q92TD3 (EMBL:SME591782) (603 aa)
FT                   fasta scores: E()=3.2e-80, 57.471% id in 348 aa, and entire
FT                   protein is similar to Rhizobium meliloti (Sinorhizobium
FT                   meliloti) Hypothetical protein SMc02770 UniProt:Q92TD3
FT                   (EMBL:SME591782) (424 aa) fasta scores: E()=7.2e-138,
FT                   76.000% id in 425 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05505"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNE0"
FT                   /protein_id="CAK05505.1"
FT                   /translation="MFYQLYELNHAAMAPFRAAADIMRFAYANPLNPFSHTPFGRTMAA
FT                   SLEMFERTTRRYGKPEFGLKQTTIGDKTVSVREEVVWSRPFCNLLHFARNAPAARGNDP
FT                   RILIVAPMSGHYATLLRGTVEALLPSADIYITDWIDARMVPMTEGTFDFDDYIDYVIEM
FT                   LHFLGHDTHVVAVCQPSVPVLAAAAVMEEARDPLSPASMTLMGGPIDTRINPTAVNKLA
FT                   QERSLQWFSDNVIMNVPWPQPGFVRPVYPGFLQLSGFMSMNLDRHLVAHKEFFMHLVKN
FT                   DGEPERHRDFYDEYLAVMDLTAEFYLQTVEEVFIKHSLPKGELMHRGKRVDPTAIRNVA
FT                   LLTVEGENDDISGVGQTMAAQTICVNIPEDMRMHYLQPDVGHYGVFNGSRFRREIAPRI
FT                   IDFVRQHSRSAVKPQIPRVIKGGRTG"
FT   CDS_pept        15502..15936
FT                   /transl_table=11
FT                   /locus_tag="RL0018"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05506"
FT                   /db_xref="GOA:Q1MND9"
FT                   /db_xref="InterPro:IPR021273"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MND9"
FT                   /protein_id="CAK05506.1"
FT                   /translation="MNQSALLRPDWTPATIALMILGFMVFWPLGLAMLAYIIFGDRLRG
FT                   FKRDVNEATDGFFASCRRPHGRHRPHFSTGNVAFDDWRKAELDRMEEERRKLDEMREEF
FT                   DSYLRELRRAKDQEEFDRFMRDRRNAKRDDNGPVAEYQTP"
FT   CDS_pept        16044..16802
FT                   /transl_table=11
FT                   /locus_tag="RL0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05507"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MND8"
FT                   /protein_id="CAK05507.1"
FT                   /translation="MFSLLKTRSKARKPAPPEMRTLDVAGRLMPLTIKQHDRATRITLR
FT                   IEPGGRALKMTVPKGLAAREVNAFLDRHQGWLLTKLAKFSTDTGLRDGGEILLRGVSHR
FT                   IQHSGSLRGLTEAVSIDGRPVLRVSGMPEHVGRRIAAFLKKEARADLARLATMHAATIR
FT                   APIRSISMKDTRSRWGSCSSEGNLSFSWRIVMAPPSVIDYLAAHEVAHLKEMNHGPHFW
FT                   ALCRKLCPGMEEAKSWLKRHGSQLHAIDFD"
FT   CDS_pept        16969..17637
FT                   /transl_table=11
FT                   /locus_tag="RL0020"
FT                   /product="putative N-(5'-phosphoribosyl)anthranilate"
FT                   /db_xref="EnsemblGenomes-Gn:RL0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05508"
FT                   /db_xref="GOA:Q1MND7"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MND7"
FT                   /protein_id="CAK05508.1"
FT                   /translation="MRPDIKICGLKTPEAVDRALKRGATHIGFIFFEKSPRYIEPDLAA
FT                   KLAEPARGKAKIVAVVVDPTNDELDEIVSLLKPDMLQLHGNESPEHVLTIKALYGLPVM
FT                   KVFSVRTADDLKRVEAYIGIADRFLFDAKAPKGSELPGGNGISFDWSLLSWLDGSVDYM
FT                   LSGGLNKDNVAEALFVTKAPGIDVSSGVETAPGVKSVAKIDEFFDAVEKANAPMMASGS
FT                   "
FT   CDS_pept        17640..18860
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="RL0021"
FT                   /product="putative tryptophan synthase beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RL0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05509"
FT                   /db_xref="GOA:Q1MND6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MND6"
FT                   /protein_id="CAK05509.1"
FT                   /translation="MNETPKPNSFRSGPDEDGRFGIYGGRFVAETLMPLILDLQDEWNR
FT                   AKNDPAFQAELKHLGAHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCI
FT                   GQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKL
FT                   LGAEVKPVTAGSGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGI
FT                   EAKEQMLAAEGRLPDLVIAAVGGGSNAIGIFHPFLDDPSVKIVGVEAGGKGLQGDEHCA
FT                   SITAGSPGVLHGNRTYLLQDSDGQIKEGHSISAGLDYPGIGPEHSWLNDTGRVDYVPIM
FT                   DHEALEAFQTLTRLEGIIPALEPSHAIAEVIKRAPTMGKDEIILMNLSGRGDKDIFTVG
FT                   KILGMGL"
FT   CDS_pept        18864..19703
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="RL0022"
FT                   /product="putative tryptophan synthase, alpha subunit"
FT                   /product="Tryptophan synthase alpha chain (EC 4.2.1.20)."
FT                   /db_xref="EnsemblGenomes-Gn:RL0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05510"
FT                   /db_xref="GOA:Q1MND5"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MND5"
FT                   /protein_id="CAK05510.1"
FT                   /translation="MTARMDKRFAELKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAG
FT                   SDIIELGMPFSDPMADGPAIQLAGQRALKGGQTLKKTLQLAADFRKTNDATPIVMMGYY
FT                   NPIYIYGVEKFLDDALLAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKR
FT                   LPKVLKNTSGFVYYVSMNGITGSALPDPSLVSGAVERIKQHTKLPVCVGFGVKTAEHAK
FT                   VIGGSADGVVVGTAIVNQVATSLTHDGKATADTVQAVATLVRGLSTGTRSARLVAAE"
FT   CDS_pept        19845..20750
FT                   /transl_table=11
FT                   /locus_tag="RL0023"
FT                   /product="putative acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit beta (EC 6.4.1.2) (ACCase beta chain)."
FT                   /db_xref="EnsemblGenomes-Gn:RL0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05511"
FT                   /db_xref="GOA:Q1MND4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MND4"
FT                   /protein_id="CAK05511.1"
FT                   /translation="MNWITNYVRPRINSMLGRREVPENLWIKCPETGEMVFHKDLEGNK
FT                   WVIPASGYHMKMPAKARLADLFDNGEFESLPQPKVAQDPLKFRDSKKYSDRLRDSRLKT
FT                   EQEDTILAGVGKVQGLKLVAVVHEFNFIGGSLGMAAGEAIVKAFERATAEKCPLVMFPA
FT                   SGGARMQEGILSLMQLPRTTVAVDMLKESGQPYIVVLTNPTTGGVTASYAMLGDIHLAE
FT                   PGAEIGFAGKRVIEQTLREKLPEGFQTAEYLLEHGMVDMVVKRHDIPETLARLLKILTK
FT                   KPVSAANDMNGGAIALAASA"
FT   CDS_pept        20778..22130
FT                   /transl_table=11
FT                   /gene="folC2"
FT                   /locus_tag="RL0024"
FT                   /product="putative FolC bifunctional protein [Includes:
FT                   Folylpolyglutamate synthase (EC 6.3.2.17)
FT                   (Folylpoly-gamma-glutamate synthetase) (FPGS)"
FT                   /product="Dihydrofolate synthase (EC 6.3.2.12)]."
FT                   /db_xref="EnsemblGenomes-Gn:RL0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05512"
FT                   /db_xref="GOA:Q1MND3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MND3"
FT                   /protein_id="CAK05512.1"
FT                   /translation="MIPRGQTAVSEAAQEIDKLMGLHPKGFDLSLDRITRLLDVLGNPH
FT                   RKLPPVIHVAGTNGKGSVTAFCRALLEAGGYSAHVHTSPHLVNWHERYRIGVKGGRGQL
FT                   VDDAVFAEAVRRVADANAGQHITVFEILTAVTFILFSEHPADAAIIEVGLGGRFDATNV
FT                   ISDPAVSVIMPISLDHQPYLGDRVELIAAEKAGIMKPGFPVVIGHQEYDAALDVLMSTA
FT                   ERLHCPSAVFGQDFMAHEEYGRLVYQDEFGLADLPLPRLPGRHQYANAAAAIRAVKAAG
FT                   FTVTETMMEKAMSSVEWPGRLQRLSEGRLLSHAPAGAEIWIDGGHNPGAGEVIAEAMAN
FT                   FEERQSRPLFLIIGMINTKDPVGYFKAFAGLVEKVFCVPIRGSEAMIDPVILSNAAYDA
FT                   GLVAEPMSTVGDALEAIKAVADPEALPPRILVGGSLYLVGDVLADNGTPPK"
FT   CDS_pept        complement(22203..22523)
FT                   /transl_table=11
FT                   /locus_tag="RL0025"
FT                   /product="putative thioredoxin"
FT                   /note="Similar to entire protein of Rhodobacter sphaeroides
FT                   (Rhodopseudomonas sphaeroides) Thioredoxin (TRX) trxA (104
FT                   aa) fasta scores:E()=1.7e-21, 57.692% id in 104 aa, and
FT                   similar, but truncated at the N-terminus, to Agrobacterium
FT                   tumefaciens (strain C58/ATCC 33970) Thioredoxin C-1 trxA
FT                   (133 aa) fasta scores: E()=1.1e-35, 91.509% id in 106 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05513"
FT                   /db_xref="GOA:Q1MND2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MND2"
FT                   /protein_id="CAK05513.1"
FT                   /translation="MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEIA
FT                   VEMEGKVKVAKLNIDENPELAAQFGVRSIPTLAIFKGGEVADISVGAKPKTALSNWISS
FT                   AA"
FT   CDS_pept        complement(22599..26150)
FT                   /transl_table=11
FT                   /locus_tag="RL0026"
FT                   /product="putative ATP-dependent UvrD family DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05514"
FT                   /db_xref="GOA:Q1MND1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MND1"
FT                   /protein_id="CAK05514.1"
FT                   /translation="MSDVTALPNDDDPGAWIGWTTIQQAIASDPLRSAWVSANAGSGKT
FT                   HVLTQRVIRLLLSGARPSAILCLTYTKAAASEMSNRVFERLAEWVVLDDEDLSRRITQI
FT                   EGMAPDGLKLAEARRLFAKALETPGGLKIQTIHAFCEALLHQFPLEANVAGHFSVLDDR
FT                   AAVALLSDARRALLTATAPDEDSALAEAFAYVLNLGDESGLENLLGDIVANRNAIRRFT
FT                   AAAEQQGGVEMVLRKRLGLAVGDTEDRIEAQYWPLPELSGSVLELYLSLADQKGGAKAQ
FT                   EVAYGLRLAGRERDDARRAQFLEKIFLTVKGEPKADSQFFVKAMLAEAPQLAEAIAIAR
FT                   AHVAASRDRLKLMRMYGATHAALVLADRLNHDYEELKKQRSQLDFEDLITRTADLLTKS
FT                   GVGPWIHYKLDRGIDHILVDEAQDTSPIQWSVIQSLAEDFFSGESARPIVRTLFAVGDE
FT                   KQSIYSFQGARPERFSEESDRTRRRVSDSGQSFSSVRLPLSFRSTADVLEAVDHIFKTP
FT                   ENARGLSALGEPVVHRSSRIGHPGAVDLWEMIAPEAVVKEEDWTAPFDATPESAPAAIL
FT                   ARRIAHSIGTLVGRETIVDKGKERLIEAGDILVLVRKRDAFVNALTRALKRRGDIPVAG
FT                   ADRLVLTSHIAVQDLLALGRFLLLPEDDLSLAAVLKSPLFDLSEDDIFAIAALRGDNES
FT                   FWSHLRSFAADGTELFRAAVERLELFLRQSRSLSVHDFYARVLGSYGGRRQFLARLGTE
FT                   VSDILDEFLTFTLDHESSGLPGLQSFISTLELEAPVMKREQDKGRNEVRIMTVHASKGL
FT                   EAPIVFLVDGGSKAFTHTHLPKLRLIETRPDEPPMPVWVPVSDLANSLTQDDAARIQML
FT                   AEEEYRRLLYVAMTRAADRLVVCGYRGVRVNNDTWHMMISTALHDDHPHVEATTFSGSD
FT                   GEWPGIKWRVPRVERSFERIDRSQERGSEETLPDGLLRPLPPQAELPRPLSPSGAGTII
FT                   DEDEGGLLVVSPLFGEKEHSDRSLEKGRLIHRMLQALPEIPLAERPDAASRYAERAARF
FT                   WPEVERRKLVDSVLKLLDEEGLQAVLGAQAQPEVSIMGTLTLEDRRYAVSGRIDRLAVL
FT                   ADRVVILDYKTNRVPPATEEAIPFAHRAQLAIYREILTPLYPDKLIDCMLVYTENASLY
FT                   TLSEKALGLALAAVKTK"
FT   CDS_pept        complement(26143..29334)
FT                   /transl_table=11
FT                   /locus_tag="RL0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05515"
FT                   /db_xref="GOA:Q1MND0"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MND0"
FT                   /protein_id="CAK05515.1"
FT                   /translation="MAERQQPRILTIPAGLPFLKMLATTLCDGRLTPLFRHEADDPLSL
FT                   AKVTIYLPTRRAVRVLRSEFVDLLGGRSAILPVIRPLGETDDDSGYFDEVLPATIDLAQ
FT                   PLSNTARLLELARLILAWRNKLPEIVRHIHSDSPLVAPASPADAIWLARNLAELIDSIE
FT                   TEDLDWSELSKLDTGDYAAWWQLTAEFLQIASAFWPQRLSELGKSSPARHRNAILRAEA
FT                   SRLSATKPAGPIIIAGSTGSVPATADLIAAVAHLPEGVIVLPGLDLSMPERHWQMVAPE
FT                   PAPGQHANPASRSHPQYGLSVLLKRLKLTRADVTLLDRPEADLERRAEILSRALAPAEA
FT                   TSDWGAWKNDLPAGALTSAFSDISLIEAANEREEATAIAIALRLALERPGQDSESRAAL
FT                   ITPDRNLARRVMAELSRFGILADDSAGTPLSAMPQGTLLQLLLEAALRPGDPVAIVSLL
FT                   KHPLARFGLERGALISATEALELLALRGGVAEVDISTLEPLLAHQLAEQALDRHAPQWR
FT                   KALSPEAADAAYDLARRVAQATEPLASALMRHRPEDRGRTTRFTLSEWAERTGRSLEAV
FT                   AVDPQGNLADLWSNEAGDALAALLGEVIDTDGQMEADGPQWIDIMAALAAGHAVKPRAL
FT                   SHPRLFIFGTLEARLQSVDTLILGGLNEGTWPGQTANNPFIPRMMKTEIGLEPPERRIG
FT                   QLAHDFEMANGTRHLIYSRALRQGSTPTVASRWLQRLLALGGEAFEAELKGRGNRFLQW
FT                   AALIDRGEAQAPAQRPSPKPPLALQPKSYSFSEVGRLRRDPYAIYARRILRLDPVDPFN
FT                   RDPGAAERGTLYHKIIDRFIREAHIAGTPDAAAAMEHVLSELFDMEKLPPHIDAVWRPR
FT                   FRAVARAFLEWEAGRRHGILKTLTEVRGGMELEPINIRLTGVADRIDITGPHSADIIDY
FT                   KTGYNPSPAQARVLLDPQLALEAAALSAGAFRDAGSLVPQELLYVRLRPGSRFQVDTVN
FT                   NESSARSDKAKSAMDLAAESIDQLVKFVGLLQSSERGFTSRLIPAQQFDFGGDYDHLAR
FT                   VSEWSTAETEESGDE"
FT   CDS_pept        complement(29338..30069)
FT                   /transl_table=11
FT                   /locus_tag="RL0028"
FT                   /product="putative nucleotidyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05516"
FT                   /db_xref="GOA:Q1MNC9"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNC9"
FT                   /protein_id="CAK05516.1"
FT                   /translation="MTIRQAMVLAAGLGTRMRPITDTIPKPLVKIDGKPMIDYALDSLV
FT                   AAGVERAVVNVHHFADQMLDHLGKYHGLDIVISDERDALMNSGGGLAKGLRLLNRDNIF
FT                   VMNADLFWIGEQQGRPTNLQRLAGFFNAERMDMALLCVGIEDTTGHNGKNDFSLAADGQ
FT                   LTRYRDDPSNPVVYAGAIVMNPSLLDDAPKDAFNLNIYFDKAIARGRLFGMVLEGHWLT
FT                   VGTPEAIGEAEETIRRLRAFA"
FT   CDS_pept        complement(30083..31600)
FT                   /transl_table=11
FT                   /locus_tag="RL0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05517"
FT                   /db_xref="GOA:Q1MNC8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNC8"
FT                   /protein_id="CAK05517.1"
FT                   /translation="MTTGDAISLFLKDEAATIRLGEDLALALKAGDCLALSGDLGAGKS
FT                   SLARAILRAMADDEGLEVPSPTFTLVQSYDLRIAVSHFDLYRLGDPAELTELGFDEALQ
FT                   NGICLVEWPEMAQSELPAERIALTLAHEGSGRRATIEAAGAQNTRIRRVLAIRDFLDTA
FT                   GYPAAKRRFLTGDASLRAYEAIYPKAENQRIILMDWPPLAEGPPVLDGKPYPKVAHLAE
FT                   NAYPFVAIADALRKDGFAAPEVYKVDYNKGILLIEDLGSEGVLDAHGQPVIERYRESVA
FT                   CLARLHALKFPQHIPVGKRHVHHIPDFDRTAMKMEVRLVLDWHLPWKRQGAPATEVERT
FT                   EYLAIWDALIDELATAEKNLLLRDFHSPNIIWRERESGIRKIGLIDFQDAMIGPTAYDL
FT                   ASIVQDARVTIEPGLFRQLMDDYLGLRRAQGSFDEDGFMRAWAIMSAQRNCKLAGLWVR
FT                   LLQRDGKPGYLKHMPRTLSYLNVALEHETLAPLRDWCTRAGIGQSES"
FT   CDS_pept        complement(31597..34182)
FT                   /transl_table=11
FT                   /locus_tag="RL0030"
FT                   /product="putative two-component sensor histidine kinase
FT                   transcriptional regulatory protein"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Caulobacter crescentus Sensor protein divL (769 aa) fasta
FT                   scores: E()=1.4e-66, 31.950% id in 795 aa, and entire
FT                   protein is similar to Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970) Two component sensor kinase (AGR_C_44p)
FT                   (881 aa) fasta scores:E()=0, 70.905% id in 795aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05518"
FT                   /db_xref="GOA:Q1MNC7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNC7"
FT                   /protein_id="CAK05518.1"
FT                   /translation="MSELKSSLPGQADDGARADRRPLMAGQGYKSATAHEAAKQEHGPL
FT                   ARFLKSCAAGTALATLARPALAQAEQQAAATAHLFTSSQVVGVSVVIGVISAALLSTLW
FT                   LVRQRGNLENESREIRSALSDAQQRISQYQALIADKNRRIVIWDGNARPELLGQLPPET
FT                   GAPQDGEFLAFGLWLKSRSASELEKAIDRLRDEAQSFDMVVETIRDEILEAQGRVSGGR
FT                   AFVRFVALNNLRAELAELRIERDRLMTSISAFQTMLDAIDMPAWQRDPVGRLTWVNQAY
FT                   GEAVEARSPQQAINEGREMLTTVARERIRATTTPESPFHDKISTVVRGNRTFFDVVDVR
FT                   VPGGSAGIAIDVSDIEAVRAELERTLKSHAETLDHLATPVAIFDGDRRLQFYNQAFVAL
FT                   WELDIAFLEGRPDNSELLERLRAAKKLPDQLNWKSWKEAALSVYRALDTQSDLWHLPNG
FT                   QTLRVFATAHPQGGATWVFENLTEQVDLETRYNTLVKVQGETIDHLSEGVAVFGPDGRI
FT                   RLSNPAFRALWGITETEAKPGTHIRALGEACTPSYDRPDGWKTFAELITSFDDERRSGQ
FT                   GTLELFSGLVLDYAVIPLPNAQTMLTFVNMTDSVRAERALTEKNEALRKADELKNDFVQ
FT                   HVSYELRSPLTNIIGFTDLLRTPGVGPLTERQAEYIDHISTSSSVLLTLVNDILDLATV
FT                   DAGIMRLNYADIDLNDLLDDVSMQIADRLHESGVALEITAPAYLGSIVADPQRLKQILL
FT                   KLLSNAANFSPEGTSISLECHREGTDFVFAVSDRGPGISPDMIATVFDRFATGAKSGKR
FT                   GGAGLGLSIVDSFVSLHHGDVTIDSEPGKGTTVVCRIPSVDVPHSAAAE"
FT   CDS_pept        complement(34386..35786)
FT                   /transl_table=11
FT                   /locus_tag="RL0031"
FT                   /product="putative S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05519"
FT                   /db_xref="GOA:Q1MNC6"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNC6"
FT                   /protein_id="CAK05519.1"
FT                   /translation="MSTEKDYVVADIGLADFGRKEITIAETEMPGLMSCRTEFGQTKPL
FT                   KGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAIKG
FT                   ESLEDYWVYTDKIFQWADGGLSNMILDDGGDATMYILLGARAEAGEDVLSHPHSEEEEI
FT                   LFAQIKKRLAASPGWFTKQRDAIKGVTEETTTGVNRLYQLSQKGLLPFPAINVNDSVTK
FT                   SKFDNKYGCKESLVDGIRRGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGARVKVTEAD
FT                   PICALQAAMDGYEVVLLEDVVSSADIFITTTGNKDVIRIDHMRAMKDMAIVGNIGHFDN
FT                   EIEVAALRNLKWTNVKPQVDLIEFPKGNRIILLSEGRLLNLGNATGHPSFVMSASFTNQ
FT                   TLAQIELFTKPDQYSNQVYILPKHLDEKVARLHLDKLGVKLTELSEEQAAYIGVSPKGP
FT                   FKSDHYRY"
FT   CDS_pept        complement(35943..36218)
FT                   /transl_table=11
FT                   /locus_tag="RL0032"
FT                   /product="putative PTS phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:RL0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05520"
FT                   /db_xref="GOA:Q1MNC5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNC5"
FT                   /protein_id="CAK05520.1"
FT                   /translation="MTSLSRELLIINKRGLHARASAKFVQMVETFDAAITVSKDGMTVG
FT                   GTSIMGLMMLAASPGSSVVVSASGSQAEEALEALDQLIQNRFGEEM"
FT   CDS_pept        complement(36228..36629)
FT                   /transl_table=11
FT                   /locus_tag="RL0033"
FT                   /product="putative PTS phosphotransferase system component
FT                   IIA"
FT                   /product="PTS system, mannose-specific IIAB component
FT                   (EIIAB-Man) (Mannose-permease IIAB component)
FT                   (Phosphotransferase enzyme II, AB component) (EC 2.7.1.69)
FT                   (EIII-Man)."
FT                   /note="Similar to the N-terminus to codon 135 of
FT                   Escherichia coli mannose-specific IIAB component, manX, PTS
FT                   system (322 aa) fasta scores: E()=3.7e-05, 30.645% id in
FT                   322 aa, and similar to entire protein of Agrobacterium
FT                   tumefaciens (strain C58/ATCC 33970 PTS system, IIA
FT                   component (133 aa) fasta scores: E()=1.8e-40, 85.714% id in
FT                   133 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05521"
FT                   /db_xref="GOA:Q1MNC4"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNC4"
FT                   /protein_id="CAK05521.1"
FT                   /translation="MIGLVLVTHGKLAEEFRHAVEHVVGPQKFIETVCIGPEDDMDQRR
FT                   QDILEAVSGADDGHGVVILTDMFGGTPSNLAISVMSSGHTEVIAGVNLPMLIKLAGVRG
FT                   ENNMEKALVEASEAGRKYINVASRVLSGK"
FT   CDS_pept        complement(36780..37232)
FT                   /transl_table=11
FT                   /locus_tag="RL0034"
FT                   /product="putative PTS phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:RL0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05522"
FT                   /db_xref="GOA:Q1MNC3"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNC3"
FT                   /protein_id="CAK05522.1"
FT                   /translation="MTEAGFNVHATAIVVGKTGLLFSGPSGWGKSMLAFTCMTEARRLG
FT                   LFTALVADDQVLLSAEAGAVIATCPPSITGLIELRGTGIVHQDHIPKATMHYAVLPGSA
FT                   TGENRIPPEGEMVSLAADFSLPALRLLTGVCSPLAILMAKVPDIGR"
FT   CDS_pept        complement(37229..39019)
FT                   /transl_table=11
FT                   /locus_tag="RL0035"
FT                   /product="putative two-component regulator sensor histidine
FT                   kinase transcriptional regulator"
FT                   /product="Sensor protein chvG (EC 2.7.3.-) (Histidine
FT                   kinase sensory protein exoS)."
FT                   /db_xref="EnsemblGenomes-Gn:RL0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05523"
FT                   /db_xref="GOA:Q1MNC2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNC2"
FT                   /protein_id="CAK05523.1"
FT                   /translation="MAQLVQERDLDDAEGVSTRRVRGRRWSHPFTLIRRIFGNAVFSSL
FT                   TRRILFFNLVALVVLVGGILYLNQFREGLIDARAESLLTQGEIIAGAVSASASVDTNSI
FT                   TIDPQKLLELQAGQSITPVPNDEDLEFPIDPEKVAPVLRRLISPTRTRARIFDADANLL
FT                   LDSRHLYSRGQVLRFDLPPVEEEKQTWSEWFATLFNKALQPGNLPLYKEAPGGDGSIYP
FT                   EVMNALTGVRGAVVRTTEKGELIVSVAVPIQRFRAVLGVLLLSTQAGDIDNIVHAERLA
FT                   IMRVFGVATLVNVLLSLVLSSTIANPLRRLSAAAIRVRRGAKTREEIPDFSARQDEIGN
FT                   LSIALREMTTALYDRIDAIESFAADVSHELKNPLTSLRSAVETLPLARSDDSKKRLMDV
FT                   IQHDVRRLDRLISDISDASRLDAELARVDAGSVDMEVLLRDLIEVSRQVRSTKKQVEIE
FT                   YAIERKPNVKTRFVVNGHDLRIGQIIANLIENARSFVPEKGGKITVRLVRTRSRCVTTI
FT                   EDNGPGIQAENIDRIFERFYTDRPEAEGFGQNSGLGLSISRQIAEAHGGSLRAENITDA
FT                   ESGHILGARFILSLPIGAAA"
FT   CDS_pept        complement(39204..39938)
FT                   /transl_table=11
FT                   /locus_tag="RL0036"
FT                   /product="putative two-component response regulator
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05524"
FT                   /db_xref="GOA:Q1MNG3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNG3"
FT                   /protein_id="CAK05524.1"
FT                   /translation="MPTIALVDDDRNILTSVSIALEAEGYKVETYTDGASALDGLLARP
FT                   PQLAIFDIKMPRMDGMELLRRLRQKSDIPVIFLTSKDEEIDELFGLKMGADDFITKPFS
FT                   QRLLVERVRAVLRRASSREAAAAGTSPTGAPKNGAVQQARSLERGQLVMDQERHTCTWK
FT                   GEAVTLTVTEFLILHSLAQRPGVVKSRDALMDAAYDEQVYVDDRTIDSHIKRLRKKFKM
FT                   VDTDFDMIETLYGVGYRFREAA"
FT   CDS_pept        40276..41886
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="RL0037"
FT                   /product="putative phosphoenolpyruvate carboxykinase"
FT                   /product="Phosphoenolpyruvate carboxykinase [ATP] (EC
FT                   4.1.1.49) (PEP carboxykinase) (Phosphoenolpyruvate
FT                   carboxylase) (PEPCK)."
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:RL0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05525"
FT                   /db_xref="GOA:Q1MNG2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNG2"
FT                   /protein_id="CAK05525.1"
FT                   /translation="MEMFGVHNPAIELATVGLGGAASVRYNFSAAALYEEAIRRGEAEL
FT                   TAQGALRAITGQHTGRSPRDKFVVRDINTDGEIWWDNNKPISPEHFAVLRDDMLAHAAG
FT                   KELFVQDLVGGAEEGHALPTRVVTEFAWHSLFIRNLLIRPDTAALSSFVPKLTIIDLPS
FT                   FKADPARHGCRSETVIACDLTNGLVLIGGTSYAGEMKKSVFTVLNYLLPAKGVMPMHCS
FT                   ANVGPDGDAAVFFGLSGTGKTTLSADPARTLIGDDEHGWSENGIFNFEGGCYAKTIRLS
FT                   AEAEPEIYATTQRFGTVLENVVLNESREPDFNDGSLTENTRCAYPMDFIPNASKTGRAG
FT                   HPKTIIMLTADAFGVMPPIARLTPDQAMYHFLSGYTAKVAGTEKGVVEPEATFSTCFGA
FT                   PFMPRHPAEYGNLLKELIGRHGVQCWLVNTGWTGGAYGTGKRMPIKATRALLAAALSGE
FT                   LGQVEFRADTNFGFAVPVSVHGVDGSILDPRSTWADKAAYDAQAEKLVSMFIANFAKFE
FT                   NHVDGGVRDAAPGVKVAAE"
FT   CDS_pept        41993..42436
FT                   /transl_table=11
FT                   /locus_tag="RL0038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05526"
FT                   /db_xref="GOA:Q1MNF8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNF8"
FT                   /protein_id="CAK05526.1"
FT                   /translation="MASDALYIDDRITIAGWELTEQFVLAGGPGGQNVNKVSTAVQLFF
FT                   NIANSPSLNDRVKTNAIKLAGRRLSKDGVLMIEASRFRSQDRNREDARDRLKELILEAA
FT                   KPPPPPRKKTRPTKGSVERRLKEKSGRSEVKKMRGRPGGGSGE"
FT   CDS_pept        42438..43049
FT                   /transl_table=11
FT                   /locus_tag="RL0039"
FT                   /product="putative alkylated DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05527"
FT                   /db_xref="GOA:Q1MNG1"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNG1"
FT                   /protein_id="CAK05527.1"
FT                   /translation="MPELLSGIRHLPGYLDRARQEALVEVIRTVVAEAPLYVPAMPGTG
FT                   KPMSVRMTNCGPLGWVTDKERGYRYQPTHPATGRPWPDMPQQLLDIWNDVSGYDKPPEA
FT                   CLVNFYSDEARMGLHQDKDEQDLKAPVVSISLGNSCLFRVGGLSRNDRTLSFKLSSGDL
FT                   VVLGGEGRLCFHGVDRIHPATSTLLKNGGRINLTLRRVNP"
FT   CDS_pept        complement(43056..44051)
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="RL0040"
FT                   /product="putative pantothenate kinase"
FT                   /product="Pantothenate kinase (EC 2.7.1.33) (Pantothenic
FT                   acid kinase) (Rts protein)."
FT                   /db_xref="EnsemblGenomes-Gn:RL0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05528"
FT                   /db_xref="GOA:Q1MNG0"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNG0"
FT                   /protein_id="CAK05528.1"
FT                   /translation="MSIATEIIGVPETLDHFQSESYSPYHFFSSEQWAKFRADTPLTLT
FT                   SDEVKRLRSMGDPIDLDEVRRIYLSLSRLLSAHVESSQMLFEQRNRFLSLSDVTKTPFV
FT                   IGIAGSVAVGKSTTARILKELLGRWPSSPKVDLVTTDGFLHPNAVLQREKLMQRKGFPE
FT                   SYDTGAILRFLSAIKAGRPDVKAPSYSHLVYDVLPDEYKIVDRPDILIFEGINVLQSRD
FT                   LPAGGKIVPMVSDFFDFSIYIDAAEDEIHNWYVTRFMRLRETAFRDPNSYFHRYASISD
FT                   AEALEIAEDLWANINLKNLRQNILPTRPRADLILKKGKDHLIEQVALRKL"
FT   CDS_pept        complement(44048..44371)
FT                   /transl_table=11
FT                   /locus_tag="RL0041"
FT                   /product="putative histidine biosynthesis bifunctional
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05529"
FT                   /db_xref="GOA:Q1MNF9"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNF9"
FT                   /protein_id="CAK05529.1"
FT                   /translation="MSGFSLSDLESIVAERSKAPPEQSWTAKLVAGGQPKAAKKLGEEA
FT                   IEAVMAAVTGDRDNLTYEAADVLYHLLVVLKIAEIPLENVMAELERRTAQSGLKEKASR
FT                   QSS"
FT   CDS_pept        complement(44389..45177)
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="RL0042"
FT                   /product="putative imadazole glycerol phosphate synthase
FT                   sununit"
FT                   /db_xref="EnsemblGenomes-Gn:RL0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05530"
FT                   /db_xref="GOA:Q1MNF7"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNF7"
FT                   /protein_id="CAK05530.1"
FT                   /translation="MTLKARVIPCLDVKDGRVVKGVNFLNLVDAGDPVEAAKAYDAAGA
FT                   DELCFLDITASSDNRETIFDVVSRTADQCFMPLTVGGGVRTIADIRKLLLCGADKVSIN
FT                   SAAVSNPDFVTEAADKFGDQCIVVSIDAKRRRTQAVGGDNLSAWEIYTHGGRNATGIDA
FT                   VEFAQKMVARGAGELLVTSMDRDGTKVGYDLELTRAIADAVRVPVIASGGVGDLDDLVA
FT                   GVKEGHANAVLAASIFHFGTYSVSEAKHYMSKCGIDMRLD"
FT   CDS_pept        complement(45178..45924)
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="RL0043"
FT                   /product="putative imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05531"
FT                   /db_xref="GOA:Q1MNC1"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNC1"
FT                   /protein_id="CAK05531.1"
FT                   /translation="MILFPAIDLKGGQCVRLKLGDMQQATVYNTDPAAQARSFEDQGFE
FT                   WLHVVDLDGAFAGHSANGDAVEAILKATDNPVQLGGGIRTLDHIEAWLSRGLRRVILGT
FT                   VAVRNPDLVIEACRKFPDHVAVGIDAKGGKVAVEGWAEASELGIIELARKFEGAGVAAI
FT                   IYTDIDRDGILAGINWSSTLELADAVSIPVIASGGLASLDDIRRMLEPDARKLEGAISG
FT                   RALYDGRIDPKEALALIKAARAKETA"
FT   CDS_pept        complement(45931..46488)
FT                   /transl_table=11
FT                   /locus_tag="RL0044"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05532"
FT                   /db_xref="GOA:Q1MNC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNC0"
FT                   /protein_id="CAK05532.1"
FT                   /translation="MIHDSFPANDGSSRRQNGVSAGDIAEAVLEFYIEGEDDLIGLLAY
FT                   ALYERQKRDFVLSHRKRNAGRSPDEAELAAVNSNYLSTDLRNTLRDRASQILSSYAETY
FT                   VEAMEPQIRLTAVNSDALRQVRSIEKSIKRRLGFWRQVRAGFAVTLLLLLLFGAAAIAA
FT                   VFFQSDIVDAWNALMVPTTLRM"
FT   CDS_pept        complement(46485..46676)
FT                   /transl_table=11
FT                   /locus_tag="RL0045"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05533"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNB9"
FT                   /protein_id="CAK05533.1"
FT                   /translation="MRSMPASRKSGKVFYTLRPSREGLPPFSDIKLPGGTVIRRVDEAI
FT                   HRKALSNAAKALKERLDR"
FT   CDS_pept        complement(46921..47571)
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="RL0046"
FT                   /product="putative imadazole glycerol phosphate synthase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RL0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05534"
FT                   /db_xref="GOA:Q1MNB8"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNB8"
FT                   /protein_id="CAK05534.1"
FT                   /translation="MRVAIIDYGSGNLRSATKAFERAAHEAGIDAHIDLTDRAEDVAAA
FT                   DRIVLPGVGAYADCRRGLDAVPDMAEVLIEAVEKKARPFLGICVGMQLMSSRGLEKTVT
FT                   HGFGWIPGNVVEMTPDDPALKIPQIGWNTLDLKRQHPLFEGIPTGSQGLHAYFVHSYHL
FT                   AAENTEDVIATADYGGPMTAFVGRDNMVGAQFHPEKSQKLGLALIANFLRWNP"
FT   CDS_pept        complement(47574..48059)
FT                   /transl_table=11
FT                   /locus_tag="RL0047"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05535"
FT                   /db_xref="GOA:Q1MNB7"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNB7"
FT                   /protein_id="CAK05535.1"
FT                   /translation="MTSSYIFLTPPGGTSATADETRTIRDGFTLLGFLFPWIWLLAHRL
FT                   WLHAAAAFLLQGIGGALMDEPGLGPAGAAILLGVNMLVGLEGQNFRVRNLAAKGWNEDA
FT                   LIAADTIGTAEQVYFSDRAAIAASDDAAAPDWQNKARPNGQHGNATSLGLFGFDGGR"
FT   CDS_pept        complement(48082..48690)
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="RL0048"
FT                   /product="putative histidine biosynthesis bifunctional
FT                   protein hisB"
FT                   /EC_number="4.2.1.19"
FT                   /note="Similar to C-terminus from codon 160 of Escherichia
FT                   coli. hisB HIS7_ECOLI (EMBL:E64967) ( Histidine
FT                   biosynthesis bifunctional protein hisB [Includes:
FT                   Histidinol-phosphatase (EC 3.1.3.15)) fasta scores: id
FT                   48.990% dehydratase (EC 4.2.1.19) (IGPD)]. id in ungapped
FT                   id, and to entire protein of Agrobacterium tumefaciens
FT                   (strain C58/ATCC 33970). hisB HIS7_AGRT5 (EMBL:AE007946) (
FT                   Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)
FT                   (IGPD).) fasta scores: ungapped id 89.286% length=198 id in
FT                   E(), and to entire protein of Burkholderia multivorans.
FT                   hisB HIS7_BURML (EMBL:AB091436) (
FT                   Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)
FT                   (IGPD).) fasta scores: ungapped id 54.124% length=195 id in
FT                   E()"
FT                   /db_xref="EnsemblGenomes-Gn:RL0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05536"
FT                   /db_xref="GOA:Q1MNB6"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNB6"
FT                   /protein_id="CAK05536.1"
FT                   /translation="MAETAASRTGSVSRKTNETSISVSVNLDGTGKSTISTGVGFFDHM
FT                   LDQLSRHSLIDMEIDAKGDLHIDDHHTVEDTGIAIGQAISKALGDRRGITRYASIDLAM
FT                   DETMTKAAVDLSGRPFLVWNVAFSAPKIGTFDTELVREFFHALAQNAGITLHILNHYGA
FT                   NNHHIAETCFKAVARALRTATEIDPRQAGRVPSTKGTLV"
FT   CDS_pept        48847..49374
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="RL0049"
FT                   /product="putative heat-shock ATP-dependent protease"
FT                   /product="ATP-dependent protease hslV (EC 3.4.25.-) (Heat
FT                   shock protein hslV)."
FT                   /db_xref="EnsemblGenomes-Gn:RL0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05537"
FT                   /db_xref="GOA:Q1MNB5"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNB5"
FT                   /protein_id="CAK05537.1"
FT                   /translation="MTTIITVRKGGKVVMAGDGQVSLGQTVMKGNARKVRRIGKGEVVA
FT                   GFAGATADAFTLLERLEKKLEQYPGQLMRAAVELAKDWRTDKYLRNLEAMMLVADKSIT
FT                   LAITGNGDVLEPEHGTTAIGSGGNFALAAALALMDTDKSAEEIARRALDIAADICVYTN
FT                   HNVVVELLDAEG"
FT   CDS_pept        49361..49873
FT                   /transl_table=11
FT                   /locus_tag="RL0050"
FT                   /product="putative acetyltransferase"
FT                   /product="putative Mutant AAC6'-IbY166A
FT                   6'-N-acetyltransferase."
FT                   /db_xref="EnsemblGenomes-Gn:RL0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05538"
FT                   /db_xref="GOA:Q1MNB4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNB4"
FT                   /protein_id="CAK05538.1"
FT                   /translation="MPKAEPYAFRPLAVADLPLLAEWLESRHVRRWWSDPAKALASMEK
FT                   HIDAASVSCFMVTLSGKDFAFIQAADLDEVDDEALAGQPKGTYGIDQFIGIEELAGKGH
FT                   GPAFMIGFCNMLFAKGAQRILVDPHPDNAFAIRAYTKAGFQGLGETTTNYGRALLMALD
FT                   RQENDTQ"
FT   CDS_pept        49870..51177
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="RL0051"
FT                   /product="putative ATP-dependent heat shock protease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RL0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05539"
FT                   /db_xref="GOA:Q1MNB3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNB3"
FT                   /protein_id="CAK05539.1"
FT                   /translation="MTTFSPREIVSELDRYIIGQHDAKRAVAIALRNRWRRQQLDPSLR
FT                   DEVMPKNILMIGPTGVGKTEISRRLAKLAGAPFIKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVGIGLVREKKRAEVQAKAHVSAEERVLDALVGTTASPATRENFRKKLRDGELDDKEID
FT                   IEVADAGSGMGGFEIPGMPGANIGVLNLSEMFGKAMGGRTKKVRTTVKASYSDLIRDES
FT                   DKLIDNEVIQREAVRSTENDGIVFLDEIDKIAARDGGMGAGVSREGVQRDLLPLVEGTT
FT                   VSTKYGPVKTDHILFIASGAFHVSKPSDLLPELQGRLPIRVELRPLNKDDFRRILTETE
FT                   ASLIRQYRALMETESLSLEFTDDAIDALADVAVHLNSSVENIGARRLQTVMERVLDDIS
FT                   YNAPDRGGTAVTIDAAYVREHVGDLAQNTDLSRFIL"
FT   CDS_pept        51470..52417
FT                   /transl_table=11
FT                   /locus_tag="RL0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05540"
FT                   /db_xref="InterPro:IPR009842"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNB2"
FT                   /protein_id="CAK05540.1"
FT                   /translation="MRRLLTSLMIAVALVNSAPAFAMQTVPAGNRHAEQPDIPGASIRR
FT                   TKGTKSSFDLKYEKVHELLATDRELMSKIRKVSSAYGINPIHVVGAIVGEHTYNVDAYD
FT                   RLQAYYVKAASYAGESFRFAYDGESVDEFVARPQFAECKSKSDSYTLWSCREDVWETDF
FT                   RGKTVGGTSFPNNRFSAVFFQPFYAGQTFGLGQVNPLTALMLSDLVTRVSGYPKLNEKN
FT                   AGAVYRAIMDPDISLAFVAASIRRSIDDYKEIAGMDISGNPGLTATLYNVGNSRQRAAA
FT                   LAAKNRGAGATVWPEENYYGWLINDKLDELKGLL"
FT   CDS_pept        52466..53878
FT                   /transl_table=11
FT                   /locus_tag="RL0053"
FT                   /product="putative cytochrome P450 protein"
FT                   /product="Cytochrome P450 4A3 precursor (EC 1.14.15.3)
FT                   (CYPIVA3) (Lauric acid omega-hydroxylase) (P450-LA-omega
FT                   3)."
FT                   /db_xref="EnsemblGenomes-Gn:RL0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05541"
FT                   /db_xref="GOA:Q1MNB1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNB1"
FT                   /protein_id="CAK05541.1"
FT                   /translation="MDMRPDPFVPPAPLPRTVPPSRLEIIRIILRNPLELWGEPSYTLP
FT                   WIRTNFFGQRTLIVNDPGLIKHVLVDNANNYRMSDVRQLVLRPILRDGLLTAEGPVWKR
FT                   SRKAVAPIFTPRHAQGFAGQMLRQSEDYARKYEGAGEAGAIFDISTDMTELTFAILADT
FT                   LFSGEIVTSSGHFADDVNELLHRMGRVDPMDLMRAPSWVPRVTRIGGQKVLEKFRAIVR
FT                   NTMDMRLAKMKADRSSAPEDFLTLLLEQAGPDGLTKEEIEDNILTFIGAGHETTARALA
FT                   WTLYCVSNSPHIREGMEEEIDAVLATGAKPVEWLDMMPQTRAAFEEALRLYPPAPSINR
FT                   AAISDDFWTSPKGERVELEAGVTVLVMPWTLHRHELHWDRPRAYMPERFLPENRASIGR
FT                   FQFLPFGAGPRVCIGATFALQEAVIALAVLMHRYRFDSTDQTNPWPVQKLTTQPKNGLP
FT                   MRVTPRIISTKA"
FT   CDS_pept        53965..56136
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /locus_tag="RL0054"
FT                   /product="malate synthase G"
FT                   /product="Malate synthase G (EC 2.3.3.9) (MSG)."
FT                   /db_xref="EnsemblGenomes-Gn:RL0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05542"
FT                   /db_xref="GOA:Q1MNB0"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MNB0"
FT                   /protein_id="CAK05542.1"
FT                   /translation="MSRVDKNGLAIETVLHDFLVEEVLPGLAVDADKFFADFSAIVHDL
FT                   APKNCALLAKRDELQVKIDDWYRRHGAPADMDEYQSFLREIGYLLPEGSDFQVSTQNVD
FT                   PEIASIAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAIPESDGAEKGKSYNPKRG
FT                   EKVIAWVRDFLDTSAPLQDCRWKDVGSFAVKDGALVVRSIDGEQAMLTDGKHFAGYRGD
FT                   AAAPTHILLKNNGIHIEIVIDAATTIGKADPAHISDVWLESAITTIMDCEDSIAAVDAE
FT                   DKVVVYRNWLGLMKGDLQEEVAKGGTSFIRTLNPDLQYAGPDGAAFEVHRRSLMLVRNV
FT                   GHLMISPAILDRDGNEVPEGIMDAAITGLIALYDIGPSGRRKNSRTGSMYVVKPKMHGP
FT                   EEVAFAVEIFSRVEDALGLPRNTIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLD
FT                   RTGDEIHTSMEAGPMIRKGDMRQAAWISAYENWNVDIGLECGLAGHAQIGKGMWAMPDL
FT                   MAAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHRVNVARVQQGLKDRARAKLSDILS
FT                   VPVAVRPNWTPEEIQRELDNNAQGILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRI
FT                   SAQHMANWLHHKVVTEAQIIETMRRMAAVVDRQNASDPAYQPMAGNFDDSIAFQAALDL
FT                   VLKGREQPNGYTEPVLHRRRLELKAKHTA"
FT   CDS_pept        complement(56207..56890)
FT                   /transl_table=11
FT                   /locus_tag="RL0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05543"
FT                   /db_xref="GOA:Q1MNA9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNA9"
FT                   /protein_id="CAK05543.1"
FT                   /translation="MRIRNAFPVFGLLATLALAGCSTTSDSASVDDKGAGPTVQTAQIF
FT                   NDAYGLTKDAGYSLPAIPIDRVKPQFRRQVVSYQTTERPGTIIVNTRERFLYYILANGK
FT                   AMRYGIGVGKQGFAWAGTAYVAWKQEWPNWHPPKEMAVRRPDLAKYVEDGMGPGLSNPL
FT                   GARAMYLFNEDGKDTLFRLHGTPEWASIGTAASSGCIRLMNQDVIDLYSRVRPGKGTSK
FT                   VVVIQ"
FT   CDS_pept        57070..57564
FT                   /transl_table=11
FT                   /locus_tag="RL0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05544"
FT                   /db_xref="GOA:Q1MNA8"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNA8"
FT                   /protein_id="CAK05544.1"
FT                   /translation="MTILSVYNNNPLIDGRQSDRAMMVRRGTQILLHEMRHAVLPELPL
FT                   ASGRRADLITLSEKGEIWIIEIKTSIEDFRVDRKWPEYRLHCDRLFFATHQDVPLEIFP
FT                   EECGLFLSDGYGAHMIREAPEHRMAPATRKSVTLNFSRAAAQRLMMAEWANGKPFTVDD
FT                   V"
FT   CDS_pept        complement(57585..58163)
FT                   /transl_table=11
FT                   /gene="actR"
FT                   /locus_tag="RL0057"
FT                   /product="putative two-component response regulator
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05545"
FT                   /db_xref="GOA:Q1MNA7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNA7"
FT                   /protein_id="CAK05545.1"
FT                   /translation="MTEQNHDNFAASDEDHIGPDASLLIVDDDGPFLRRLARAMETRGF
FT                   QVETAESVAEGVAKSRGRPPKYAVVDLRLGDGNGLDVIEAIRQRRDDTRIIVLTGYGNI
FT                   ATAVTAVKLGAVDYLAKPADADDVFSALTQRPGEKAELPENPMSADRVRWEHIQRVYEM
FT                   CERNVSETARRLNMHRRTLQRILAKRAPK"
FT   CDS_pept        complement(58232..59560)
FT                   /transl_table=11
FT                   /gene="actS"
FT                   /locus_tag="RL0058"
FT                   /product="putative two-component regulator sensor histidine
FT                   kinase transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05546"
FT                   /db_xref="GOA:Q1MNA6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNA6"
FT                   /protein_id="CAK05546.1"
FT                   /translation="MIDKPGMIDKTEGYTLEDRHNSRRLRLQTLVRLRWLAVGGQALTV
FT                   FIVAFWLKFPLPLVASSSLIAALAWVNFYLTIRYPPTHRLEPPAAFALLGFDLLQLCAL
FT                   LFITGGLANPFAALVCVPVIISFASQPIRYSTALIGVAMVCITVLAFSPFPLPWFDGVE
FT                   INVHNVMQFGVWCSIASTMAFAAFYAYRVSMEASQLADALAATELVLQREKHLSQLDGL
FT                   AAAAAHELGTPLATISVVAKEMERELKDDDRFREDVMLLRSQSERCRDILRRLTTLSSE
FT                   GEAHMRRLPLSSMIEEIVAPHREFGIRLELIEKCPRKGEPVTDRNAGIMYGLGNLIENA
FT                   VDYAREKVIVTVEHDHDKVLIVIEDDGNGYAPDILTRIGEPYVTKRQKEDTAGGLGLGL
FT                   FIAKTLLERSGASLIFENRDPESAGARIRIEWPRMLIDANSTK"
FT   CDS_pept        complement(59583..62048)
FT                   /transl_table=11
FT                   /gene="helO"
FT                   /locus_tag="RL0059"
FT                   /product="putative ATP-dependent helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05547"
FT                   /db_xref="GOA:Q1MNA5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNA5"
FT                   /protein_id="CAK05547.1"
FT                   /translation="MTISASLPELPVSHVLPVVAAALEKQKRAVLSAPPGAGKTTLVPL
FT                   YLLGQAWRGDGKIILLEPRRLAARAAASRMASLIGEQVGETVGYRMRLDNRISAATRIE
FT                   VVTEGVFARMILDDPELTGVSVVIFDEFHERSLDADFGLALALDVQSALREDLRILVMS
FT                   ATLDVERVAALLDHPPVIESLGRSFPIDIRYQDRPGGERIEDAVTRAILDAHANETGSI
FT                   LAFLPGQAEITRTVERLQGRFGAETLIAPLYGNLSQKEQDAAIRPASQGMRKIVLATSI
FT                   AETSITIDGVRIVIDSGLQRLPVFEASTGITRLETVRVSRASADQRAGRAGRTEPGTAV
FT                   RLWHQGQTAALPAFTPPQILSSDLSGLVLDLAHWGVQDPASLAFVDQPPETTLREARVL
FT                   LGQLGALDKDGALTARGKVMRDLALPPRLAAMVVSAGEAGQARDAAMIAVLLTEQGLGG
FT                   TSVDIEERLRRFKVERGERAEASRRLAGRLASGLDRGAATAPALAGQLLLHAFPDRIAL
FT                   QRGGRGRFVMANGRGAELPETERLAGSQMLVIADLTGRAAQARVLAAAEVTRGDIEAEL
FT                   PGEIKTGDQIFFDRQSRQIRARRATRLGAIVFEETPLPRPSGAAVTQALVEGVRELGLD
FT                   QLSFSKEAVQLRERIGFLHRTIGEPWPDVSDDALLSRLDEWFAPFQTEARGLSEISAAG
FT                   LSNGLMSLVPHELQRDLSRLAPTHFEAPTGQRHPIQYEGEEPVLTIRVQELFGLKQHPA
FT                   IAGGRLPLLLELTSPAHRPIQTTRDLPGFWAGSWKDVRADMRGRYPRHPWPERPEDALP
FT                   TTRAKPRGT"
FT   CDS_pept        complement(62045..62992)
FT                   /transl_table=11
FT                   /locus_tag="RL0060"
FT                   /product="putative ornithine cyclodeaminase"
FT                   /product="Ornithine cyclodeaminase (EC 4.3.1.12) (OCD)."
FT                   /db_xref="EnsemblGenomes-Gn:RL0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05548"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNA4"
FT                   /protein_id="CAK05548.1"
FT                   /translation="MLVLDEEQTRAALPWPELIEAIARMFQSECVMPVRHHHEMEVPHE
FT                   ESATLLLMPAWVPGRYAGVKTVSVFPGNVRRGLPAIFGTYLLSSGATGEMLAAIDGGEL
FT                   TARRTAAASALAARHLARADAEELLVCGTGRLSLNLMLAHGTTRPIKRYRVWGRNGQAA
FT                   EKIAAEARALGLNAEAVADAEAAARTADIISCATLSSAPLISGEWLKPGAHLDLVGAFK
FT                   PSMRESDDAAIRRASVYVDTRAGAIAEAGDIVQPLKSGVLKEGDIRAELAELVSGAHGG
FT                   RSHDAEITLFKSVGAALEDLAGAILAYKTVTGQK"
FT   CDS_pept        complement(70180..71670)
FT                   /transl_table=11
FT                   /locus_tag="RL0061"
FT                   /product="putative alpha-amylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05549"
FT                   /db_xref="GOA:Q1MNA3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNA3"
FT                   /protein_id="CAK05549.1"
FT                   /translation="MKQTMSTWPKHPVIYEINTWVWLGEVSRKYQRPVNLSSVPADEWD
FT                   RIASFGLDAVWLMGVWERSPAGIEISMQNERLLEDFRRALPDFTPEDNVGSPYCVRRYV
FT                   VDDHLGGPQGLAVARSMLHERGLRLILDFVPNHVAPDHLWVRDQPGYFVQGSDDDARND
FT                   PASFATVGSKVFARGRDPFFPAWPDVLQLNTFSPALRETVVETIAEIAGQCEGVRCDMA
FT                   MLVLNTIFERTWGDHAGAKPDDDYWSTIIPTIKSRYPEFKFIAEAYWDLEWELQQQGFD
FT                   YCYDKKLYDRMEHGDAESVRQHLLADSTYQEKMVRFIENHDEPRAAAAFPLEKARAAAV
FT                   AMLTLTGAKLLHEGQFEGATTRLPIFLGRRPVASVDCDLSAFYARLLTAIHGDVFKNGE
FT                   WRLCETSGWSDNQSCRNILSWCWAKGEARCLIVINFSETASQALVHVPWDELRGKEWRL
FT                   DDVLSEDCYDRNGSEIRDVGLHVDLWPWKSSLFELRAR"
FT   CDS_pept        complement(71667..74426)
FT                   /transl_table=11
FT                   /locus_tag="RL0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05550"
FT                   /db_xref="GOA:Q1MNA2"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR031335"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNA2"
FT                   /protein_id="CAK05550.1"
FT                   /translation="MDKKLASARTGAETKRLAEARDRGINWKKWGPYLSERQWGTVRED
FT                   YSETGDAWNFFTHDHARSRAYRWGEDGIAGISNDKQNLCFALALWNGKDPILKERLFGL
FT                   TNNEGNHGEDVKEYYFYIDSTPTHSYMKYLYKYPQAVFPYADLVETNGRRSRNEFEYEL
FT                   LDTGVFDDDRYFDVFVEYAKAAPEDILVKITAFNRGPDAANLHLLPTLWFRNDWASWIA
FT                   ETSRAARKPNLRQIEAAAGQSTVAATDSVGGAFLLSCEGDVPLLFTENETNAERLFPGQ
FT                   RNESLYVKDGINNFVVQGDQNAVNPERQGTKVAAHYRMTIAPGQSATVRLRLSAAKTAQ
FT                   ARTAQNGFGKEFDQTLAERLQEADEFYSSLTPSSVSPDAANVMRQAIAGMLWSKQFYFF
FT                   DGDNWLDEHHSNPLHAGYRHTRNSDWFHMLNEDVISMPDKWEYPWYAAWDLAFHTLPIA
FT                   IVDPDFAKDQLKLMLRGVYLHPNGQMPAYEWNFGDVNPPVHAFATLFLHRTEQALRGET
FT                   DVQFLREAFNKLVLNFTWWVNRKDRFGKNVFEGGFLGLDNIGIFDRSAPLPTGGHLEQA
FT                   DGTAWMALFSQNMMELAVELAVHDPTYEDMVVKFAEHFYYIAGAMNQPDKGGMWDEEDG
FT                   FYYDLLRLPDGSGTRLKVRSMVGLLPLCAATVMEPWQRERIPRAMEQLAQRMRRMPELQ
FT                   QNIHVTGPGHYGVSDRGMFALVNSERLRRILSRMLDENEFLSSYGIRSLSKVHERDPYV
FT                   FQVQGQEYRVDYLPSESNTGMFGGNSNWRGPVWMPVNVLIIRALQNFYLYYGDNFKIEC
FT                   PTGSGKLMNLFEVSKEIADRLGRIFLRDEHGRRAVYGGTEKFQTDPHWRDLVLFYEYFH
FT                   GDNGAGLGASHQTGWTGLIAKTIQLYGLLDPQKALEVGKQAAFTQNPK"
FT   CDS_pept        complement(74746..76002)
FT                   /transl_table=11
FT                   /locus_tag="RL0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05551"
FT                   /db_xref="GOA:Q1MNA1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNA1"
FT                   /protein_id="CAK05551.1"
FT                   /translation="MFSTQIKMLERREYDRARRKLSESTPGHRGIARQFFLAVAFVVAA
FT                   NAPSWSQEDEAKHYSKEAMQQALQTRDQYDVYGLRFGVGKSTLQPGAETLLDDIATALK
FT                   NFPDWSLRIVGHTDASGNAETNERLSLERANAIKAALVERGVNTDRLLAAGAGQTRPIA
FT                   SNETAEGKALNRRVELVRLTDSAEAKKLLKGMSDYLAAQKTISFAYDANLQVVTNSEQK
FT                   LGLTSSGTVVLSRPDKVHTTRSGGFVEIEALFDGKTLTLLGKNLNKYTQVDIPGTVDHL
FT                   IDELKDRYGLPLPAADLLMTNSYDELMQGVYDSKDLGSGVINGAECDSLAFRKDEVDFQ
FT                   IWVAQGAQPYPCRLVITSRMVKGGPEYSVQVRDWKSGDELMPGDFGFKNPTNAEKVNIK
FT                   DIQSNLGDLPGNFVRGDGK"
FT   CDS_pept        complement(76906..78225)
FT                   /transl_table=11
FT                   /locus_tag="RL0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05552"
FT                   /db_xref="InterPro:IPR016883"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MNA0"
FT                   /protein_id="CAK05552.1"
FT                   /translation="MPETLSTDADLDRLPTDDDLSRLQFTTVLYYLHCTNPDNGLVRDK
FT                   TEPNAPASIAAIGMALATIPVVVERGVLIREFAAKITRNRLRYLMACPQGPEPDSSGYK
FT                   GFFYHFLDIETGRRVWQCELSTIDSAFLFAGALTVATYFDRDTADEAEIRGLATALYER
FT                   ADWNWARDGGATLTHGWRPESGFIPYRWRGYDEGLLLYIIGLGSPTHPLPPESYAAYTE
FT                   SYEWRNIYGRELLYSGPLFTHQLSHMWIDFRGIRDAFMREHDTDYFENTRHATYVQQEY
FT                   AIRNPMNFAGYGEHCWGFTACDGPGWGKRTTEGVDREYFDYIARGAPFGPDDGTIAPWV
FT                   AVASLPFAPEIVVPTVRNFARMNLGMTRLYGFKPSFNQTYAVEKSPTGWWVSPHHFGID
FT                   QGPVVLMIENYRTGLLWSIMRRCRPIVTGLRRAGFSAGWL"
FT   CDS_pept        complement(78231..82121)
FT                   /transl_table=11
FT                   /locus_tag="RL0065"
FT                   /product="putative glycosyl transferase"
FT                   /note="Similar to codons 1550 to the C-terminus of
FT                   Rhizobium meliloti (Sinorhizobium meliloti) Protein ndvB
FT                   (2832 aa) fasta scores: E()=1.1e-136, 40.078% id in 1290
FT                   aa, and similar to codons 1420 to the C-terminus of
FT                   uncultured Acidobacteria bacterium Putative cyclic beta
FT                   1'-2' glucan synthetase (1308 aa) fasta scores: E()=0,
FT                   45.589% id in 1308 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05553"
FT                   /db_xref="GOA:Q1MN99"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037820"
FT                   /db_xref="InterPro:IPR037824"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN99"
FT                   /protein_id="CAK05553.1"
FT                   /translation="MATSTADAPRHDSIAELNPSSAVALLSNDRYSVLVTAAGAGYGMW
FT                   QGLDITRWREDSTRDCWGQFCYVRDLTDNDLWSIGRQPLFRPSNIYEHAFHGNRAELSC
FT                   HAGDIEIASKICVAPDVDVEVRMLTVTNHGTRERTLELTSYAEVCLYNRSADMAHPGFA
FT                   KLFVETQFDEATGALFARRRPRAAGEKATWAVHVSSSNLQPAQAAQYETDRLRFLGRGR
FT                   TTANPVAFDAGASLSGTTGPVLDPIFCLRRTVRLAPGADARIAFVTGAADDQSAVQLIA
FT                   KRYAEIDAVEQAFSDASRRYESELQTLGLKPGDISLFNRLAGSVIFANPAMRQATDLQR
FT                   DRWDRAALWAHGISGDLPIVLVRANSDRHHALVRQVTMAHDFARRRGLRFDLILVDEGG
FT                   SASAKRLAEKLQSGPQAEMIGKPGGIFILSEPDTGNDHLATIAAAARVVLLGSGGELGD
FT                   QLNRLSPARSPLSPTFTTRLNEQPAAPLPKPAEDLQYWNGLGGFTADGHEYVVRVDALK
FT                   PQAPTLPPAPWTNVIANPHFGCLTTEAGLGYTWAENSQMNRLTPWSNDPVTDAPGEVLY
FT                   LRDEETGDIWTPTPLPLGPGAVVTVRHGQGYSRYTSFSRHLSQELTVSVAPNDPVKIMR
FT                   LRLSNEDTRVRHVTAIYFAEWVLGTQREQTAARVVCERDARSGAIVARNPWAGDFAGRL
FT                   AFAAASQPARSTTSDRTEFLGQYGSVFQPAALGRTDLAERFGPLLDPCAALMVDISLRP
FT                   NESREIVFVLGQAADLDEVSRLVHEHTDLERAAASLSAVCRQWDDILNSIQVSTPDTGV
FT                   NLMMNRWLVYQVLACRMWARTSNYQSGGAYGFRDQLQDVMALVYSVPSEARSHILRSAA
FT                   RQFEEGDVQHWWHPPSGVGVRTRITDDLYFLPLVVHHYVSTTGDVQLLDETVPFITSPV
FT                   LRDDQEEDFNQPATSEQSGTVYEHCVRALEHGYRLGSHGLPLMGTGDWNDGMNKVGAGG
FT                   KGESVWNGWLYLTVLKSFAEISASRGDQSRAAWCRERVEALRIALEANAWDGGWYRRAY
FT                   FDDGTPLGSSLNDECQIDAIPQAWAVISGEADAERASQAMRAVHDRLVRQEDRLIKLFD
FT                   PPFDDGVLQPGYIKGYVPGIRENGGQYTHAATWVVWATALQGDGDLALKLWNLINPIYH
FT                   GATKDQVERYKVEPYAVAADIYGAPPHTGRGGWTWYTGSASWLYRVALEAILGFRQEGR
FT                   FLRFEPCVPAGWPAYEIAYRYGSATYRIHFDNSKGIGRGVQSVTLDGELVANESVPLAQ
FT                   DARTHDVHVIIG"
FT   CDS_pept        complement(82152..84617)
FT                   /transl_table=11
FT                   /locus_tag="RL0066"
FT                   /product="putative xylulose-5-phosphate phosphoketolase"
FT                   /EC_number="4.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:RL0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05554"
FT                   /db_xref="GOA:Q1MN98"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN98"
FT                   /protein_id="CAK05554.1"
FT                   /translation="MVSLKTARDAKVALHAKMATGGPLSTEELQSIDAYWRASNYLSVG
FT                   QIYLLDNPLLKEPLRREHIKPRLLGHWGTSPGLNMLYVHLNRVIKRDDLEMIYVIGPGH
FT                   GGPSLVAHAYLEGTYSEVYPNISQDAEGMKRLFKQFSFPGGIPSHVAPETPGSIHEGGE
FT                   LGYALSHAYGAAFDNPNLIVACVVGDGEAETGPLATGWHGNKFLNPARDGCVLPILHLN
FT                   GYKIANPCFLARIPRDELRKFFEGMGYTPYFVEGSDPENVHQQLAGVLDTAVADIQEIW
FT                   ATARTKGKIKRPMWPMIIFRTPKGWTCPPEIDGKKCEDYWRAHQVPMGDMDKPEHIRIL
FT                   QEWMKSYRPEELFDDSGRFKPGLAALAPVGQRRMSDNPHANGGLLLRDLKMPDFRDYAV
FT                   SVPSPGQTHTEAARVMGKFLRDIMKMNMDSKNFRLFSPDENNSNRWQDVLEVTDRCYMA
FT                   DIYPEDDHLSPDGRVMEVLSEHQCQGWLEGYLLTGRHGFFSCYEAFIHIIDSMFNQHAK
FT                   WLKVCNDIPWRRSVASLNYFLSSHVWRQDHNGFSHQDPGFIDHVVNKKADVVRIYLPPD
FT                   ANTLLSVTDHCLRSRNYVNVVVAGKQPAPQWLTMDQAIKHCSEGLGIWEWASNDKGSEP
FT                   DVVMACCGDVPTLETLAAVELIREHLPELKVRVINVVNLMKLQPPSEHPHGLPDRDFDA
FT                   LFTKNKPIIFAFHGYPWLIHRLTYRRTNHGNLHVRGYKEEGTTTTPFDMVVLNEMDRFH
FT                   LVEDVIDRLPQLGARAAYFKQAIREKLVEHRQYIEKYGDDMPAISGWKWGSKAQPKTRQ
FT                   RTSTEGDNA"
FT   CDS_pept        complement(84994..85662)
FT                   /transl_table=11
FT                   /locus_tag="RL0067"
FT                   /product="putative CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05555"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR017080"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN97"
FT                   /protein_id="CAK05555.1"
FT                   /translation="MLVKDVMITKVVGVSPDNSVRRAAEIMLANHVSGVPVIDDAGRLV
FT                   GIISEGDLLRRTELGREATAELGTSALTAEEKATAYVRSNAWRVADVMSCDPIVVEGDT
FT                   SLARVSALMQEHHIKRLPVMRDGVLVGIVSRADLLKAIVTADQDETASGDEAIRRSIAT
FT                   RLSENADLLGKDTTVTVTDGVAHLWGTIDTEECKKAARVAAESVRGVRRVVEHFSEDRR
FT                   "
FT   CDS_pept        complement(85775..87463)
FT                   /transl_table=11
FT                   /locus_tag="RL0068"
FT                   /product="putative component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05556"
FT                   /db_xref="GOA:Q1MN96"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN96"
FT                   /protein_id="CAK05556.1"
FT                   /translation="MDTQQIPFKVTAVRFVRAVKVFMSSEVGGKAALMFAGLVALFLAL
FT                   SGLNVANSYVGRNFMTAIANRQTPEFMRQAIFYIGVFAAFTIVAVVSRFIEERLALLWR
FT                   EFLTRRAVSLYLADRAYYHLDVSGQLTHPDQRIAEDMRVFTVTTLSFILMILNSSLTII
FT                   AFSGVLWSISPLLFAVAVVYAACGSYLTIALGRPLIKLNYDQLDKEASFRSGLIQVREN
FT                   AEGIMLAHCEEQQGFRLLRRLDDAVANFRKVTAINRNVGFFTTGYNWLIQIIPALIIAP
FT                   AYIRGNIDFGVITQSGAAFAMLVGAFSLVITQFQSISTFAAVVARLSSLMEAIERAGTP
FT                   ADAGIEVVEGKERLAYEQLTLLHATNSVPIVKDVSISIPLGTRVLITGPARDAQAALFR
FT                   ATAGISFKGSGRIIRPAADDILFLPQRPYLPTGTLRQILVRNERAGKIPDDRIVQFLRE
FT                   LNLEHVLEQAGGLNTEQNWEILLSPQEQQLLAFINILIAAPQFAFLDRLDATLGLERLH
FT                   TIMQMLSESSITYINNAETAALRDYHDAVLECGEDGGWVWTVNRA"
FT   CDS_pept        complement(87586..89265)
FT                   /transl_table=11
FT                   /gene="celD"
FT                   /locus_tag="RL0069"
FT                   /product="putative cellulose biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05557"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN95"
FT                   /protein_id="CAK05557.1"
FT                   /translation="MTYGVLGADMRIDIIDTIAGFEAVRENWDQVFMEDPDAQHFLSWI
FT                   WMKNYLSRRRRWFILALRERDPEAPYVAFFPLRLITHLNEKTGLFYDEIIMAGNFAADY
FT                   TGFIVRPDYEHHAIAGFASFLKHQNWTDLKLEYFSGPAGRREKMIEALQGPEVMFRDSS
FT                   PKNSENIDNTICPIVPLPASFDDYLEQRMSSQTRQKLRRFLRKVEGDDVYRITMATAET
FT                   IDRDLDILFNLWRIKWSARKGTERTERLIITTREMLMDSFNCGNLEVPVFWHGDQPLGA
FT                   LANIIDRQKKAILFYITGRDENWKTPSPGLILHGYCIRRAIEHGFKTYDFLRGNEPYKY
FT                   MFGVEERRISCTLFRTRNGQNLHGVLNPRSIRFVYEQALDMYRNGARSKAEIAFNQVLQ
FT                   SAPGHTGAEFGLANLLFDRGKLTEAQAAYKVLVEQAPDPTPIQMRLGDTQLALHQYDQA
FT                   AETFRQIGEIGPHLIQAHYKRGIALAASKRLAEAEAVFAAIQEVHSDDPTALDYVAKAS
FT                   AALERIRVSAEPAPCKTDAVPETIARWNRGRQLSERRRPRLH"
FT   CDS_pept        complement(89508..89999)
FT                   /transl_table=11
FT                   /locus_tag="RL0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05558"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN94"
FT                   /protein_id="CAK05558.1"
FT                   /translation="MAAMSDVLLRVGRLNYVWTNTESLLIYIIAHLLRVEKDAAIVVFL
FT                   TLNTTRARIDLIERLSKLASTSPSDRKAILSAMSRLKKESKTRNKYNHCIYSFDEKGDI
FT                   SSTQLMRLVEDDKQIRYGKIEQMDAREIEHLEKSIAEIVAISRTLWAFIHASPQISGEL
FT                   "
FT   CDS_pept        complement(90117..91466)
FT                   /transl_table=11
FT                   /gene="toaE"
FT                   /locus_tag="RL0071"
FT                   /product="putative HlyD family secretion protein"
FT                   /product="Hypothetical protein expD2."
FT                   /db_xref="EnsemblGenomes-Gn:RL0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05559"
FT                   /db_xref="GOA:Q1MN93"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN93"
FT                   /protein_id="CAK05559.1"
FT                   /translation="MGRKNRETTGPVQLEWYSDVPRSIRVHSIVGLTVLFTSFGGFGFW
FT                   AATAPLASAVIAQGSFVATGNNKIIQHLEGGIIKEMRVSEGDTVKEGDILLTLDPTASR
FT                   SNERMLQLRRLRLEAVVARLRAEAQGLRQFQLPDIVTKEAGDPDINAIIQSQNVVFHSK
FT                   QIKLEEQLNLIGKNIASLEFRFVGYRGQRESFERQLSLLTEERDSKARLVKVGYMRKTD
FT                   LLAIERAIADAMGDIARLNGELNESEAEIAKFRQEAVIAVNSNKQAALDALETAETDLD
FT                   SVREQMREAAGVLERTTIRSPVSGTVVRSYFHTAGGVITTGKPIMEILPSHVPLILEAK
FT                   VLRTSIDQLHEGETASIRLTALNRRTTPVLQGKVFYVSADSIEENAGASVKDVYIVRVG
FT                   IPDSEIARVHNFHPVPGMPAEVLIQTSERTFFEYLSKPITDSMSRAFKER"
FT   CDS_pept        complement(91472..93769)
FT                   /transl_table=11
FT                   /gene="toaD"
FT                   /locus_tag="RL0072"
FT                   /product="putative ATP-binding component of Type I protein
FT                   secretion system"
FT                   /note="Similar, but truncated at the N-terminus to
FT                   Agrobacterium tumefaciens (strain C58/ATCC 33970) ABC
FT                   transporter, nucleotide binding/ATPase protein (690 aa)
FT                   fasta scores: E()=3.5e-164, 82.138% id in 683 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05560"
FT                   /db_xref="GOA:Q1MN92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN92"
FT                   /protein_id="CAK05560.1"
FT                   /translation="MNQISKQIFAAGSALDLRSGTIPSAAPSEATMTDVCVSAIDEAVE
FT                   NLRRLSGAAASSPDRPKKTSEAAANEAADIGRASATQAPLPEKMVVPEAKVETAPPVAV
FT                   AQGLATAKTPEAPARPQIEARVSPEQPKEKIELKSSPTMPFAKTIEGESGPISENNRRM
FT                   RAGGGGNGKDSDPGGGGGGGGGSGGGFHKRSEPVNFAASLSRGMAAVRHNMVVVMMFTI
FT                   AINVLLLAIPLYLFQISDRVLTSRSVDTLVMLSIAVIGAVLLQAFMDSVRRFILMRTAV
FT                   ELEVQLGAPILSAAARASLHGSGKDYQTLQDLQLLRGFLTSGTLIAFLDAPLMPFFVVV
FT                   VYFVHPHLGIIIMVCCAVLFVIAYLNQKFTARQFAESNGYLSRANFHLDSMSRNSQIIN
FT                   AMAMIPEAVKMWGRETAGSLKSQVEAQDRNIIFSGISKACRMITQVTLLGWGAHLSLSG
FT                   ELTGGMVIAASIISGRALAPIEGAIEGWNQFNRSAAAYSRIKGLLLNSPLNFPRLRLPN
FT                   PEGRLDVERILFVPPPQKKVILNGISFSLRKGESLAIIGNSGSGKTTLGKMLVGSIVPT
FT                   SGNVRLDLMDLRNWDQRQFGESIGYLPQDVQLFPGTIKANICRMRDDVDDHQIYDAAVL
FT                   ADVHELIAGFPQGYETIVAADGAPLSGGQKQRIALARAFFGNPKFVVLDEPNSNLDTQG
FT                   EAALAKALIHAKKQGITTVTITQRPALLQCVDKILVLKDGTVAMFGERIEVLQALSKNN
FT                   GNNGQQAPRIEG"
FT   CDS_pept        complement(93795..95831)
FT                   /transl_table=11
FT                   /locus_tag="RL0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05561"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN91"
FT                   /protein_id="CAK05561.1"
FT                   /translation="MHIEKISEIIAHFIGLFEMTTDEMRLRTNYAEGAGPGADGPALPD
FT                   QDAFTAAFSSDLQLKDYDPGINYKSGSYEIEFGPARHFGRVFEESLEKLAAIAGKDIPL
FT                   PHFGDPTDIVLTDEPELTVFAGPGSAISHVLQVNALYDDDYLDMTDGVHAPRDTSFVIE
FT                   RLADFSTKAEIFTPFASLHRTDTYDGALKVAEDLEVYIQNAQNTEDSGTTSLGTDATHE
FT                   FVRLDPGVNDTVYINGKAETDIPVLDDFLPDRGLAKLPEEPDDSNTSVEQDDPSGTSLE
FT                   VTAGANLVVNVASVINTGVITSVTAVMGNYHQVDAISQAFVYSDNDEIASTLHSSDRSG
FT                   EAAETIAKNIALFEHSTFEASSHADTDATEPTFPNSWRVSVIDGDVSFVQWIEQYQFVT
FT                   DNDTMTVITSGSETTVLTGGNTSINFSSFFGMGMQYDLVIIGGNVLDINSITQISLLYD
FT                   NDWVRAEDGVDPGADIQTGDNLIWNFASIHNVGTDSPFAAMPDYMAATQKAIEDRDPNM
FT                   PEGLSFDVNFQGYAGLNVLYITGNLYDMTIIKQVSILGDSDDVTLAASTILENNPDATV
FT                   TIDTGSNAVVNIAEIVDYDSFGQTTYLAGQLYSDAILIQGGLVEHDTTQPQPADDRLAN
FT                   EVIAFFDNDDPAGGDCADGVINAGNDFSWSSTHPADVMQAMVA"
FT   CDS_pept        complement(95973..96929)
FT                   /transl_table=11
FT                   /locus_tag="RL0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05562"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN90"
FT                   /protein_id="CAK05562.1"
FT                   /translation="MSDDTEITKVGALADGFANSAINSTEIDDDSTGYVGGVANGDNRD
FT                   NTDNSVDVDVKAEIDVATNNGDNRDNEYDWSYKSDDDTSTKTTTITDTDTKTDYDWSYD
FT                   SKTYSDNDTDTKTITDTDTKTVTDTDIKTVTETETDTKTVTDSNNTSDSFNKTDTDFAV
FT                   IEDVKDSNLGVAGHDLTFNLGDDFSFTLDVDSILNNSLTGAGNDSGFSAVQANHLADQD
FT                   SAWNTKMENEGAQNHLNANGGTANSAEGMEMDGKSWDLKAGDDANGASTADASAILANS
FT                   GFHLELVQGANLLSNTVDSSVIGGNSHTSDVGEDTST"
FT   CDS_pept        97773..98555
FT                   /transl_table=11
FT                   /locus_tag="RL0075"
FT                   /product="putative GerE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05563"
FT                   /db_xref="GOA:Q1MN89"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN89"
FT                   /protein_id="CAK05563.1"
FT                   /translation="MFMTGSGMENADQGRKLGSSGDTILVVAKADLFSECMVEALAKKF
FT                   PNCEVASITSTKPILDKDSSDMKLVLFYHIPGPELHEALQAARENHPETSIGLVVEAID
FT                   MLEPYVSRLVEARIIDGVLPLNLRLDVFMAAVDLLMKGGEHFPSALLNRLTNKNAQLEP
FT                   SLYQTKSVDAARSNALKLRRDSISALTTREVQILDLICKGTQNKIIADKLHLSENTVKV
FT                   HVRNIYKKMNVRNRTEAASRFFNEHPAGEEDMSGRWRN"
FT   CDS_pept        complement(98571..98891)
FT                   /transl_table=11
FT                   /locus_tag="RL0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05564"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN88"
FT                   /protein_id="CAK05564.1"
FT                   /translation="MVKKQDAAQLKGRRIRSAMFAWGTALLAIGPTACTVVDDHIAVVA
FT                   KKNIPVVEAPRVSKAYAYPANRVGRPAAATVRTVAYHGSAPYICSPSGFGQKSRCFARP
FT                   PI"
FT   CDS_pept        99276..100301
FT                   /transl_table=11
FT                   /locus_tag="RL0077"
FT                   /product="putative dTDP-glucose 4-6-dehydratase-like
FT                   protein (UDP-glucuronic acid decarboxylase)"
FT                   /db_xref="EnsemblGenomes-Gn:RL0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05565"
FT                   /db_xref="GOA:Q1MN87"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN87"
FT                   /protein_id="CAK05565.1"
FT                   /translation="MRSFVPSEGYSEVSSGIPVAQALRTVLVNGGGGFLGSHLCERLLQ
FT                   HGHRVICLDNFSTGRRANVDHLASNTRFHIVEHDVRQPFDIEASLIFNFASPASPPDYQ
FT                   RDPVGTLLTNVLGAVNTLDCARKTGAIVVQSSTSEVYGDPIHSPQHESYCGNVNQIGPR
FT                   GCYDEGKRSAETLFFDYHRTYGVDVKVGRIFNTYGPRMRLDDGRVVSNFIVQALRNADL
FT                   TIYGDGQQTRSFCYVDDLIEGFLRFSTAGSACNGPINLGNPTEMTVRRLAEIIRDLTNS
FT                   RSRIVHLPAVTDDPRQRRPDISRAMAELDWQPRIGLETGLARTVDYFDGLLAGTEKAEV
FT                   V"
FT   CDS_pept        100303..101286
FT                   /transl_table=11
FT                   /locus_tag="RL0078"
FT                   /product="putative UDP-glucose 4-epimerase (UDP-galactose
FT                   4-epimerase)"
FT                   /db_xref="EnsemblGenomes-Gn:RL0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05566"
FT                   /db_xref="GOA:Q1MN86"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN86"
FT                   /protein_id="CAK05566.1"
FT                   /translation="MPRYILVTGGAGFIGSHICKALSRAGMIPVTYDNLSTGHADSVRW
FT                   GPLIRAELADAAALRRTLAEFSPDCVIHCGANAYVGESVEMPRKYYRNNVVGSLTLLEA
FT                   CLDQDIDRIVFSSSCATYGVPASLPIREESPQHPVNPYGRTKLIFEMALEDFAAAYGIR
FT                   FAALRYFNAAGADPDGELAERHQPETHLIPRALLAAAGRLERLDIFGTDYATEDGTCVR
FT                   DYIHVSDLAQAHLAAVNHLLADGGSLSVNLGSGRGTSVREILEAIHRASGREVPVRYRS
FT                   RRVGDPPILFANTARAKAELGFAPAFSDIDTIIRTAGPTFGLEMRA"
FT   CDS_pept        101283..103151
FT                   /transl_table=11
FT                   /gene="acsAB"
FT                   /locus_tag="RL0079"
FT                   /product="putative transmembrane cellulose synthase"
FT                   /EC_number="2.4.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RL0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05567"
FT                   /db_xref="GOA:Q1MN85"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN85"
FT                   /protein_id="CAK05567.1"
FT                   /translation="MSSVSQIGHGVRTAKAATVETFDPVFTGWNRVAYGFGILCWLTAL
FT                   GYFWIWWCQSAHIISWATFVLVTLVLVWITLVPAYFILIFLDARTVSPRAGLPEGRVAM
FT                   VVTKAPSEPFAVVRTTLQAMLDQIGVDFDVWLADEDPSEETRRWCEEHGVLISTRKGVA
FT                   EYHRTTWPRRTRCKEGNLAYFYDHFGYARYDFVAQFDADHVPTPTYLREILRPFADPEI
FT                   GYVSAPSICDANAGTSWAARGRLYAEASLHGSLQTGYNNGWAPLCIGSHYAVRTSALRQ
FT                   IGGLGPELAEDHSTTLMMNSGGWRGVHAVDAIAHGDGPANFTDLVVQEFQWSRSLVTIL
FT                   LQHSRRHIMHLPWRLRFQFVFSQLWYPLFSVFMAMMFLLPVAALLTGRVFVNVTYPDFL
FT                   LHFVPMSMVLTLFAFFWRTTATFRPHDAKLLGWEGLAFIFLRWPWSLAGSLAAVRDYIC
FT                   GSFVDFRITPKGRQQQRSLPLRVIAPYIGLAGLSAAAMMFATDAAAAQGFYVFAMMNLS
FT                   VYLALTVLIVVRHAVENDLPLLPQSRGLWLATATGLAIFVAGGTQAGSHGLRGLEALSH
FT                   GQTFVSFTETQFAVAGAGLGGGKTRIVKFHLRWNGFGRTGRDEQGA"
FT   CDS_pept        103148..103711
FT                   /transl_table=11
FT                   /locus_tag="RL0080"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05568"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN84"
FT                   /protein_id="CAK05568.1"
FT                   /translation="MSRRNRQVSSMEDVMSIGSRLWGAALALSLCLPVATHGAEVAKTK
FT                   APTPLSAYELYRIYGDKTWTWNTGGGRFFYDGRRFVAWSNDKGKPSFAEGRWVVDDLGQ
FT                   LCMRATWTNAEGAARASTCFGHRKIGNTIYQRRQPNGEWYVFRHASVRQGDEFQKLVPT
FT                   DTVSAKASEVKQILLSQEVARKGG"
FT   CDS_pept        103715..104686
FT                   /transl_table=11
FT                   /locus_tag="RL0081"
FT                   /product="putative polysaccharide degradation protein"
FT                   /note="Codons 85 to 235 are similar to codons 65 to 215 of
FT                   Alcaligenes sp. XY-234 Beta-1,3-xylanase (469 aa) fasta
FT                   scores: E()=0.00031, 28.105% id in 153 aa, and entire
FT                   protein is similar to Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970) AGR_L_3016p (320 aa) fasta scores:
FT                   E()=2.7e-82, 66.901% id in 284 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05569"
FT                   /db_xref="GOA:Q1MN83"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN83"
FT                   /protein_id="CAK05569.1"
FT                   /translation="MKKLMKKNLSTAAIALLLLCVADLPGRSEVQYAGIAPNPAAAVRT
FT                   IIDKRPVLHADGIKFGAYDPHGDFGAQASVATEALFLPWEDVDLETLRVADAYAQARGR
FT                   NLLITVEPWSWDVDWRLTSAELRAKVLRGDYDVNMRAIAQMISELKSPVIVRWGQEMED
FT                   KSGRFSWSGWSPQDYITAYKRMMDIVRQEAPGTELMWSPKGEPGLQAYYPGDDYVDLVG
FT                   LSVFGLQRYDELAYNGHRTFSEALKQGYDLVAGYGKPIWVAELGYGGGDAYMKPWIETV
FT                   ALKQSAFPNLQEVVYFNDRDVHAWPFDLGRPDWRVVESLANR"
FT   CDS_pept        complement(104748..106034)
FT                   /transl_table=11
FT                   /locus_tag="RL0082"
FT                   /product="putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05570"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN82"
FT                   /protein_id="CAK05570.1"
FT                   /translation="MQVNRRSFLMGSAGAAAGLAFGAGSAIPAFAEDAQLRAMWWGSND
FT                   RAKRTLDVAKLYQSKTPGVTIVGESLSGDGYWTKLATQMAGRSIADIFQLEPGTISDYS
FT                   KRGACMPLDEFVPSTLQVDSFGADMLKLTTIDGKLYGVGLGLNSFSMFFDTVEFEKAGI
FT                   PVPTPDLTWDEYAKLAVELAKSSGKSGGPYAARYAYVFDAWLRQRGKSLFARESVGLGF
FT                   TADDAREWFDYWEKLRKAGGTVAADVQTLDQNTIDTNALGLGKSVIGMAYSNQMIGYQL
FT                   IIKNKLGITMLPREKKGGPSGHYYRPALIWSVGATTKNGEAAAKFIDFFVNDIEAGKIL
FT                   GVERGVPMSPTVREAILPQLNPTEQETVKYVNLLKDQVGEYPPPVPMGATQFDQRVLRP
FT                   ICDELAFERVSPADAATRLIEEGKATIKG"
FT   CDS_pept        106182..107201
FT                   /transl_table=11
FT                   /locus_tag="RL0083"
FT                   /product="putative LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05571"
FT                   /db_xref="GOA:Q1MN81"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN81"
FT                   /protein_id="CAK05571.1"
FT                   /translation="MNDQKIRRPRQADIATLAGVSVSTVSRVLANEPGISESVRLQILK
FT                   VAAENGYPVKPASEAVAGGLALIASDGVTGTLSVFYEAIVDGLRAGAAEAGMPFEVRLV
FT                   REDRTTPDAVRDYMQTAGAEGLFLVGIDPNESLRDWLQASMTPTVLVNGTDPRMQFDGV
FT                   SPANFFGAYEATSRLTKAGHRRILHLSGSHRHTIRERVRGFEAAIAAVSGAEGRLVSLA
FT                   LQGSASREAHERTTEALAENAGFTAAFCMNDFIAVGVLEAVTEAGLRVPEDFAIVGFDD
FT                   LPCAQMTNPQLSTMRVDRAALGREAVSLMLSRFRNRTASARHICQAVAPIPGGTVPNA"
FT   CDS_pept        107329..109185
FT                   /transl_table=11
FT                   /locus_tag="RL0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05572"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN80"
FT                   /protein_id="CAK05572.1"
FT                   /translation="MTYDPASANPLAGNPLETRADMSRALLALFDPLLACFSKGNARVT
FT                   LNGGGAHFDRAAADLEGFARPLWGLAPLGAGNGDFAHWHRFAEGLANGTDPAHPEYWGT
FT                   VNGRDQRMVELAALGFALALVPEKIWEPLDARARGNVVAYLKHARQFDYADNNWKFFRI
FT                   FVDIALDRLGADFDRSLTRQYLEELEGFYIGDGWYRDGNVRRIDHYIPFAMHFYGLIYS
FT                   KLVDDDYAKRYRERAVLFARDFRHWFAADGATIPFGRSLTYRFACAGFWSALAFADVEA
FT                   LPWGEVKHLCLQHLRWWKDKPIADRDGVLSIGFGYPNLLMSESYNSAGSPYWAFKAFLP
FT                   LAIAEDHPFWTAKEKVPEQAPDIIPQRHPGMVIMRAGGDVVALSSGQENLQMRCGTEKY
FT                   AKFAYSARYGFSVEADERAFALAAFDSALAFSDDGLHYRVRETNEEAKIAGEVLFAKWS
FT                   PFADVDVETWLVPAAPWHIRLHRIRTSRPLRIAEGGFAIGRRDFELDTLSASGGVAYAV
FT                   GEADFTGILDLGSSVKRSGLVQKAMPNTNVIVAKTLVPQLRGQIPTGETILVTAVLALD
FT                   DPAALSSAWARPPKAPDIAALEALVREKGVTVSAIEAPGQMP"
FT   CDS_pept        109182..110192
FT                   /transl_table=11
FT                   /locus_tag="RL0085"
FT                   /product="putative glycerate dehydrogenase"
FT                   /note="Codon 70 to the C-terminus are similar to codons 60
FT                   to the C-terminus of Methylobacterium extorquens. HprA
FT                   DHGY_METEX (EMBL:MESERCYC) ( Glycerate dehydrogenase (EC
FT                   1.1.1.29) (NADH-dependent hydroxypyruvate reductase) (HPR)
FT                   (GDH) (Hydroxypyruvate dehydrogenase) (Glyoxylate
FT                   reductase) (HPR-A).) fasta scores: E()=2.1e-16 ungapped id
FT                   39.574% 313 id, and to entire protein of Rhizobium meliloti
FT                   (Sinorhizobium meliloti). Putative dehydrogenase protein.
FT                   Q92W31 (EMBL:B95906) (336) fasta scores: E()=2.7e-82
FT                   64.881% id in 336 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05573"
FT                   /db_xref="GOA:Q1MN79"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN79"
FT                   /protein_id="CAK05573.1"
FT                   /translation="MSQPAIILAMQPSRTQHVLPDEVLRRLGGIGRLLDSKPLQRFDDE
FT                   RARRLLAEAEILITGWGGPYVGPEIPTAAPHLKFIVHAAGTVKGVIDDAIFEAGIPVSH
FT                   SAEANAVPVAEFTLAAIIFAGKRVFRFRDLYVADRNRNRTHLMQREAIGNYRRTVGIVG
FT                   ASRIGRRVIELLKPFDYRLLLSDPTLDAAEAAGLGTEKIDLDELMRQSDIVSLHAPSLP
FT                   STQHMIDARRLSLMKDGATLINTARGILIDEAALLSVLKTGRIDAVLDVTDPEIPEAGS
FT                   AFYDLPNVFLTPHIAGAIGLERARLGEMAVDEIERFVTGQPLLYQIHQANLANIA"
FT   CDS_pept        complement(110281..111609)
FT                   /transl_table=11
FT                   /locus_tag="RL0086"
FT                   /product="putative GFO/IDH/MocA family oxidoreductase"
FT                   /note="N-terminus to codon 230 is similar to the N-terminus
FT                   to codon 200 of Rhizobium meliloti (Sinorhizobium meliloti)
FT                   Inositol 2-dehydrogenase (330 aa) fasta scores:
FT                   E()=1.3e-08, 26.471% id in 204 aa, and entire protein is
FT                   similar to Rhizobium meliloti (Sinorhizobium meliloti)
FT                   PUTATIVE OXIDOREDUCTASE PROTEIN. (433 aa) fasta scores:
FT                   E()=2.6e-146, 82.89% id in 415 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05574"
FT                   /db_xref="GOA:Q1MN78"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN78"
FT                   /protein_id="CAK05574.1"
FT                   /translation="MGLISVFVSSRMQEDHSMEKRRFALIGTGNRGTTMWGKDLLAGWR
FT                   EHVDLTAIVEKNSLRGERARNMIGSNAPLYENIDSMLAEQKPDLVIVCTPDHTHDDIVV
FT                   RALESGIDVITEKPMTTSVEKIRRILDAEKRTGRRVDVSFNYRYAPTAAKIKELLNAGE
FT                   IGRVTSVDFHWYLNTKHGADYFRRWHAYKENSGSLFVHKATHHFDLLNWYLDSDPEAVT
FT                   SFADLQNYGRKGPFRGPRCKLCPHTHECDYYLDLEADPFLDSLYEDPSKIDGYFRDGCV
FT                   FREDIDIPDTMVVSLRYRNNVHVSYSLNTFQPIEGHHLAFNGTKGRIELRQYEAQPWEE
FT                   PKQDTILLIRNFPDGKEAVERIVVPHFTGGHYGGDDRMRNMIFKPDTEDRLAQRAGTRA
FT                   GAMSVLCGIAALESSRTGKVVDIADLMPELANDGSPNSLRTSR"
FT   CDS_pept        complement(111710..112534)
FT                   /transl_table=11
FT                   /locus_tag="RL0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05575"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN77"
FT                   /protein_id="CAK05575.1"
FT                   /translation="MQVEGLSINLATIREQCGFAEAVDICLKHGITAIAPWRDQVAKVG
FT                   LDEAVRIVKSNGIKLTGLCRGGFFPAANDADWQKNLDDNRRAIDEAAAFSADCLVLVVG
FT                   GLPGSSKDIVAARRMVFDGIAAVLPHAQAAGVKLAIEPLHPMYAADRACVNTLGQALDL
FT                   CEQLGEDVGVAVDVYHVWWDPDLANQIARAGRMKRIFAHHICDWLVPTKDMLLDRGMMG
FT                   DGVIDLKGIRRMVEAAGFFGAQEVEIFSAENWWKRPAEEVIATCVERFRSCC"
FT   CDS_pept        complement(112672..113835)
FT                   /transl_table=11
FT                   /locus_tag="RL0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05576"
FT                   /db_xref="InterPro:IPR009334"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN76"
FT                   /protein_id="CAK05576.1"
FT                   /translation="MTTINLPLDGKIVPYTLTGTPIALAKRDAKAFPRIAFAAAHVVAD
FT                   PLADNDPWLTPAIDWERTLAFRHRLWDLGLGVAEAMDTAQRGMGLGWPEARDLIRRALS
FT                   EAAGRKDALIACGAGTDHLTPGPDVTVDTILSAYEEQIETVEAAGGRIILMASRALAAA
FT                   AKGPDDYIRVYDRILRQVKEPVIIHWLGEMFDPALEGYWGNGDHIQAMSTCLEVIEAHA
FT                   DKVDGIKISLLSKEKEVAMRRRLPKGVRMYTGDDFNYAELIAGDEEGHSDALLGIFDAI
FT                   APAASAALEALGRKSNHEFFDLLEPTVPLSRHIFKAPTRFYKTGVVFLAYLNGLQDHFV
FT                   MVGGQQSTRSLTHLAELFRLADKARVLADPELATARMKQVLAVHGVN"
FT   CDS_pept        complement(113839..114987)
FT                   /transl_table=11
FT                   /locus_tag="RL0089"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05577"
FT                   /db_xref="GOA:Q1MN75"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN75"
FT                   /protein_id="CAK05577.1"
FT                   /translation="MARLGIILHGVTGRMGYNQHLVRSILAFRDQGGITLKSGEKLEID
FT                   PIIVGRNGAKMEELAKKHNIKRWSTDLDAALANPDDTIFFDAGTTLMRAELLSKALDAG
FT                   KHVYCEKPISDDLQVALDLARKARRSGLKHGVVQDKLFLPGLRKLALLRDSGFFGKILS
FT                   VRGEFGYWVFEGDWGVPAQRPSWNYRKGDGGGIILDMLCHWRYVLDNLFGEVKAVSCLG
FT                   ATHIPRRIDEQGKPYDCDTDDAAYATFELEGGAIAQVNSSWAVRVRRDDLVTFQVDGTH
FT                   GSAVAGLTKCWSQHRVNTPKPVWNPDQPQTIDFYKTWDEVPDTQAFDNGFKAQWEMFIR
FT                   HVVEDAPWPYGLEAGAKGVQLAELGLKSWAERRWLDVPALEF"
FT   CDS_pept        complement(115119..115796)
FT                   /transl_table=11
FT                   /locus_tag="RL0090"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05578"
FT                   /db_xref="GOA:Q1MN74"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN74"
FT                   /protein_id="CAK05578.1"
FT                   /translation="MNDSGGNGEKKRSRRPSAERTAQRDPERTRAAILDAATREFAENG
FT                   MGGARVDAIAERAGTNKRMLYHYFGDKEQLYLRVLEEAYVGIRTAERALHIGDRSPEEG
FT                   ISELALFTWRYFLQHPEFLSLLGTENLHRARWLRQSVRLKELHSHLIGELSDVLEQGKK
FT                   QGVFIETADPLHVYLTIASLGYFYLSNQYTLSTIFGRDLMEPTHLNAWERHIVHVTLAS
FT                   IKR"
FT   CDS_pept        115995..117281
FT                   /transl_table=11
FT                   /locus_tag="RL0091"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05579"
FT                   /db_xref="GOA:Q1MN73"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN73"
FT                   /protein_id="CAK05579.1"
FT                   /translation="MTFRVSRRNFVAGGATLLSLSALGTSALAQETRLRLLWWGSQPRA
FT                   DRTNKVSQLYQSKKPGTSITGEFLGWGDYWPRLATQVAGRNAPDVIQMDYRYIVQYARR
FT                   GALAPLESYMPAKLNLDDFDKAQIEGGSVDGHLYGVSLGANSAATVLNTTAFKEAGVDL
FT                   PTQATTWEEFGRIGAEITKAGKRKGMFGIADGSGGEPLFENWLRQRGKALYTADGKIAF
FT                   DVDDASEWYDMWAKFREAGACVPADIQALDKNDIETNTVSLGKSAAGFAHSNQFVAYQA
FT                   MNKDKLALTNYMRIKPESKGGHYRKPSMFFSVSAQSKAVDLAVDYVNFFVKNPEAALLL
FT                   DVERGIPESSAMREVVAAKLDENGKVALAYVSGLGDLAGKLPPPPPAGAGEGELMLRNI
FT                   AEQVGFGQLSPSDGGKQLVAEITQILARG"
FT   CDS_pept        117288..118247
FT                   /transl_table=11
FT                   /locus_tag="RL0092"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05580"
FT                   /db_xref="GOA:Q1MN72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN72"
FT                   /protein_id="CAK05580.1"
FT                   /translation="MSNAMRTPAGAINVERYQGAVADGRFRRLWNANAPGYLFLLPWLI
FT                   GFFGLTLGPALISLYLSFTDFDMLQSPRWVGMANYVRIATADPKFSAAMYVTLTYVVFS
FT                   VPFKLTFALLVAMALNRGLRGLSVYRAIFYLPSLLGGSVAIAVLWRQLFASDGLVNAAL
FT                   SYFGIEGPSWISHPNYSIYTLVALSVWQFGSPMIIFLAGLRQIPQDMYEAASLDGASKF
FT                   RQFYKITLPLLTPVIFFNAVVQTIDAFKAFTPAFIISGGTGGPINSTLFYTLYLYQEAF
FT                   GNFRMGYASALAWILVVIIAIFTAFSFLTSRYWVHYDD"
FT   CDS_pept        118249..119127
FT                   /transl_table=11
FT                   /locus_tag="RL0093"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05581"
FT                   /db_xref="GOA:Q1MN71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN71"
FT                   /protein_id="CAK05581.1"
FT                   /translation="MTASVTAARPPSDITKRSLPASLIIHALLIAASLLMLYPLLWMVS
FT                   ASVRPETEIFSSTSLIPSSIDFSSYARGWVGLDVSFGRFFWNSLVISLLVVTGNVIACS
FT                   LTAFAFARLRFAGRNFWFAIMLGTLMIPYHVTLIPQYVLFLDLGWVNTILPLVVPKFLA
FT                   SDAFFIFLMVQFFRGIPRELDEAAMMDGCSAWRIYWKIMLPLSLPVLATAAIFSFIWTW
FT                   DDFFGPLIYLNDMNTYTIQLGLRTFVDSTSASDWGGLFAMSTLTLVPVFFFFLFFQRLL
FT                   IEGIATTGMKR"
FT   CDS_pept        119151..120224
FT                   /transl_table=11
FT                   /locus_tag="RL0094"
FT                   /product="putative GFO/IDH/MocA family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05582"
FT                   /db_xref="GOA:Q1MN70"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN70"
FT                   /protein_id="CAK05582.1"
FT                   /translation="MSIRTVAIVGCGIGRSHIVEGYLPHSDKFKVVAICDLNEQRMAAV
FT                   GDEFGIERRTTSFAELLADDTIDIIDICTPPGIHLEQVVAALAAGKHVVCEKPLTGSLA
FT                   AVDTIMAAEKTAKGVLMPIFQYRYGDGIQKAKRIIDAGIAGKPYTASVETFWLRKPEYY
FT                   AVPWRGKWATELGGVLVTHALHLHDMLMHLMGPAARVFGRVATRVNDIEVEDCASASLL
FT                   MESGAFVSLSCTLGSQEQISRLRLHFENVTFESSHEPYTPGKDPWKIIAANDDVREQID
FT                   RVVGDWQPVAPRFTTQMGQFHAFLSGHAPLPVTTKDARRALELVTAIYQSSDSGADVPL
FT                   PVGPDSPKYADWRARTK"
FT   CDS_pept        120256..121332
FT                   /transl_table=11
FT                   /locus_tag="RL0095"
FT                   /product="putative ATP-binding component of ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05583"
FT                   /db_xref="GOA:Q1MN69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN69"
FT                   /protein_id="CAK05583.1"
FT                   /translation="MATSVVLQKVEKRYGAMDVIHGIDLTIDPGEFVVFVGPSGCGKST
FT                   LLRMIAGLEEITGGGLLLDNERMNEVAPAKRGIAMVFQSYALYPHMSVYKNLAFGLETA
FT                   GYKKAEIEPKVKRAAEILQIEKLLERKPKALSGGQRQRVAIGRAIVREPRIFLFDEPLS
FT                   NLDAELRVQMRVEISRLHRSLGNTMIYVTHDQVEAMTMADKIVVLNSGRIEQVGAPLDL
FT                   YNNPANRFVAGFIGSPKMNFLKARIEQAGETETSIHVCGNSVRLPRRLKGGAGEEVTFG
FT                   IRPEHLSLAEGAITLSTINVDLVENLGGATMLYTTTPDNQLLTVALDGQQKVERGANVK
FT                   ASFDPARCHVFDAAGKTI"
FT   CDS_pept        121601..122494
FT                   /transl_table=11
FT                   /locus_tag="RL0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Haemophilus influenzae LicA protein (339 aa) fasta scores:
FT                   E()=4.8e-12, 28.333% id in 300 aa, and similar, but
FT                   truncated at the N-terminus to Rhizobium loti
FT                   (Mesorhizobium loti) Mll5370 protein. (414 aa) fasta
FT                   scores:E()=2.8e-52, 49.123% id in 285 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05584"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN68"
FT                   /protein_id="CAK05584.1"
FT                   /translation="MLWGVSMTPEDRIHALGIWQGPIAISPIAGGITNRNYLVSDAVAR
FT                   CVVRLGTDIPIHHINRQNELAASRAAHAAGISPAVIHHSPGVLVLEYIEARALSPEDIR
FT                   TPQMLARVLPLVRACHRDIARHFRGQAMIFWVFHVIRDYAANLKASESAYLPLLPGLVG
FT                   RAETLEEAAGPFEIAFGHNDLLAANFLDDGKRLWLIDWDYAGFNTPLFDLGGLASNNEL
FT                   SEATERTMLETYFDRPLTDDLNRRYTAMKCASLLRETLWSMISEIHSSIDFDYAGYTAE
FT                   NLARFDRAYQAFEQDQ"
FT   CDS_pept        122495..124945
FT                   /transl_table=11
FT                   /locus_tag="RL0097"
FT                   /product="putative dehydrogenase"
FT                   /product="Pyruvate dehydrogenase phosphatase regulatory
FT                   subunit."
FT                   /db_xref="EnsemblGenomes-Gn:RL0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05585"
FT                   /db_xref="GOA:Q1MN67"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN67"
FT                   /protein_id="CAK05585.1"
FT                   /translation="MTKELPKTAKAVVIGGGIIGCSTAYHLGKLGWTDTVLLERKKLTS
FT                   GTTFHAAGLVGQLRTSANITQLLGYSVDLYKRLEEETGLGTGWKMNGGLRVACNEERWT
FT                   EVRRQATTAQSFGLEMQLLTPQEAFDLWPLMAVDDLVGAAFLPTDGQANPSDITQALAK
FT                   GARMSGVSIFEDTEVLDLEIDKGRIRAVITAQGRIECERVVVCAGQWTRAFAARFGVNV
FT                   PLVSVEHQYIITESFGVPSNLPTLRDPDRLTYYKEEVGGIVMGGYEPNPIPWAANGIPD
FT                   GFHYTLLDSNFDHFEQIMEQALGRVPALENVGVKQLLNGPESFTPDGNFILGEAPELKN
FT                   FFVGAGFNAFGIASAGGAGMALAEWVTKGEPPYDLWPVDIRRFGRPHFDTDWVRTRTLE
FT                   AYGKHYTMAWPFEEHSSGRPCRKSPLYDRLKAQGACFGEKLGWERPNWFADLFANEEPK
FT                   DVYSYTRQNWFDAVGREHKAVREAAAIFDQTSFAKFVLKGRDAEAALSWIASNDVARPV
FT                   GSLVYTQMLNDKGGIECDVTVARIAENEYYIVTGTGFATHDFDWIARNIPAEMHAELVD
FT                   VTSAYSVLSLMGPNSRAVLEKVTGSDVSNAAFPFGKVRTIGIAGCPVRALRITYVGELG
FT                   YELHIPVEYATTVYDVLMAAGGELGLVNAGYRAIESCRLEKGYRAWGSDIGPDHTPVEA
FT                   GLGWAVKMRKSIPFRGREAIERQLSGGVKKRLACFVPEDADTVLLGRETIYRDGKRVGW
FT                   LSSGGFGYTLGKPIGYGYVRNPDGVTEDFVLSGTYELDVARERIPCKVSLSPLYDPDMA
FT                   RVKA"
FT   CDS_pept        complement(125075..126532)
FT                   /transl_table=11
FT                   /locus_tag="RL0098"
FT                   /product="putative mannitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05586"
FT                   /db_xref="GOA:Q1MN66"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN66"
FT                   /protein_id="CAK05586.1"
FT                   /translation="MTERLQTLSDLAPTAKLPAYDRNQLKSGILHLGPGAFFRAHFAPF
FT                   TDAALAAEGGDWGIEVASLRTADVADNLSAQNGLYTTLIRDSSGTTAEVIGSILKAHVA
FT                   PRDPAGLLARLEDPAIRIVSMTVTEKAYGFDPATGGLDLKHPDIVADLVSRHTPRGVIG
FT                   YLVEGLARRRQKGIAPFTPLSCDNLPSNGAVLKRLVLEFASRIDPDLHRWIEASVPFPS
FT                   TMVDRITPASTEATYADAERLTGRTDMAAVETEPFTQWVIEDHFANGRPAWEKVRGALM
FT                   VEEVSAYEKMKLRMLNGAHSLLAYLGYIGGYEFIRDVMDDAALAALAYRHMHAAARTLD
FT                   PVPGIDLDDYASELIARFANKAIAHRTYQIAMDGTQKLPQRLLEPASEALAHGDRAETY
FT                   AIAVAAWMRYAIGEHGNGERYELRDPRAGEIAALIADIPRTGLAISAALFTLPGLFPAA
FT                   LTGHRAWTQDVADKLEILIQDDRLPLF"
FT   CDS_pept        complement(126529..127944)
FT                   /transl_table=11
FT                   /locus_tag="RL0099"
FT                   /product="putative uronate isomerase (glucuronate
FT                   isomerase)"
FT                   /db_xref="EnsemblGenomes-Gn:RL0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05587"
FT                   /db_xref="GOA:Q1MN65"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN65"
FT                   /protein_id="CAK05587.1"
FT                   /translation="MDAGNGFLHPDRLFPADPATRTVARDLYETVRNLPIVSPHGHTEP
FT                   SWFADDKPFEDAASLLVIPDHYLFRMLHSVGVTLDELGVPRLDGKPVASGRAIWRTFAA
FT                   HYHLFRGTPSSLWVDHAMSAVLGCTEPLTPDNADALYDHINAQLALPEFRPRALHQRFG
FT                   IETIATTDGALDPLAHHQKMAADGWIGKVRTTYRPDSVTDPDAVGFRDNLVKFGEITGT
FT                   EVTRWDGLIEAHRRRRAYFRQFGATATDHGVPTAFTADLPLTEKQALLDKALKGPLSAE
FT                   DAELFRGQMMTEMAGLSAEDGMVMQIHAGSRRNTDSGLFATRGPNMGADIPTSTDWVGG
FT                   LNALLSKYGHAPGLRVLLFTLDETTYARELAPMVGHWPCLMIGPPWWFHDSPLGIRRYL
FT                   DQVVETAGFANMAGFNDDTRALLSIPARHDVWRREVCRFLAQLAGEHRLSKREAEIVAG
FT                   ELSYGNAKKAYKL"
FT   CDS_pept        128125..128334
FT                   /transl_table=11
FT                   /locus_tag="RL0100"
FT                   /product="putative slyX protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05588"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN64"
FT                   /protein_id="CAK05588.1"
FT                   /translation="MSDETNHITRLEEMLAHQAKTIEELSDQLAEQWKTVEQMRTKLDR
FT                   LTERFLSLEEQSLDAPAITRPPHY"
FT   CDS_pept        complement(128390..129871)
FT                   /transl_table=11
FT                   /gene="gabD2"
FT                   /locus_tag="RL0101"
FT                   /product="putative succinate-semialdehyde dehydrogenase
FT                   [NAD(P)+]"
FT                   /product="Succinate-semialdehyde dehydrogenase [NADP+] (EC
FT                   1.2.1.16) (SSDH)."
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RL0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05589"
FT                   /db_xref="GOA:Q1MN63"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN63"
FT                   /protein_id="CAK05589.1"
FT                   /translation="MAFTSALTKHVPFSSPLLRDAGYIDGVWTSGDATKTFDVLNPATG
FT                   ELLASLPDMGAAETRAAIDAAHAAQPGWAARPARERSTILRKWFDLMVANADELAAILT
FT                   AEMGKPFPEARGEILYAAAYIEWYAEEAKRIYGETIPAPSDDKRMIVIRQPVGVVGTIT
FT                   PWNFPAAMITRKIAPALAVGCTVVSKPAEQTPLTAIALAVLAEQAGIPAGVFNVIVGVD
FT                   GPAIGRELCGNEKVRKISFTGSTEVGRILMRQCADQIKKVSLELGGNAPFIVFDDADLD
FT                   AAVEGAIASKYRNAGQTCVCANRLYVQSNVYDAFAAKLAAKVAEMSVGDGFEPGVVIGP
FT                   LIDEQGLAKVEDHVSDALAKGAKLLTGGKRIDGAGTFFTPTVLTGVARGMKVAREETFG
FT                   PVAPLFRFDTVEDVINQANDTEFGLAAYFYAGDLKKVWRVAEALEYGMIGINTGLMSSE
FT                   TAPFGGIKQSGLGREGSRHGADDYLEMKYLCIGGV"
FT   CDS_pept        complement(130039..131319)
FT                   /transl_table=11
FT                   /gene="goaG"
FT                   /gene_synonym="gabT"
FT                   /locus_tag="RL0102"
FT                   /product="putative 4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05590"
FT                   /db_xref="GOA:Q1MN62"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN62"
FT                   /protein_id="CAK05590.1"
FT                   /translation="MNATSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDF
FT                   AAGIAVLNTGHRHPRVIAAVKDQLDRFTHTCHQVVPYESYVHLAERLNALLPGDFEKKT
FT                   IFVTTGAEAVENAVKIARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPG
FT                   DVFHIPFPVELHGVTADQSLAALKKLFAADVDPQRVAAIIIEPVQGEGGFYSAPAAFMK
FT                   ALRELCDQHGILLIADEVQTGFARTGRMFAMDHHEVAPDLTTMAKSLAGGFPLAAVTGR
FT                   AAIMDAPGPGGLGGTYGGNPLGIAAAHAVLDVIVDEDLCNRANLLGGRLKQRLESMRET
FT                   VPEIVDIRGPGFMNAVEFNDRTTGLPSAEFANRVRLIALDKGLILLTCGVHGNVIRFLA
FT                   PITIQDEIFGEALDILEASMLQASAAK"
FT   CDS_pept        131486..132295
FT                   /transl_table=11
FT                   /gene="gabR"
FT                   /locus_tag="RL0103"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05591"
FT                   /db_xref="GOA:Q1MN61"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN61"
FT                   /protein_id="CAK05591.1"
FT                   /translation="MNDNGPVRYKVAEAARLAGVSASTLRLWESQGLVVPGRSETGHRQ
FT                   YSADDVARLKRISWYRVERGLNPAAIREALESEEPSADGAEASQDTGLGRKLRSLRHAN
FT                   GKTLDQVAGDIGVTSSTLSTLERTSQGVSFKTLHDLAEYYGTTVSRLSGEESGDVPVLV
FT                   RAGEWRKWPETTPGVTVQLLAEGRRMMDCHRFVLAPGAASEGAYRHEGEEFMHVLSGRL
FT                   ELVLDGDQFFDLGPGDSLYFESRRDHSWRNRHDGETVLLWINTPPTF"
FT   CDS_pept        132535..133161
FT                   /transl_table=11
FT                   /locus_tag="RL0104"
FT                   /product="putative ribonuclease"
FT                   /note="Similar to the N-terminus to codon 170 of
FT                   Escherichia coli Ribonuclease D (375 aa) fasta scores:
FT                   E()=3.2e-06, 31.847% id in 157 aa, and entire protein is
FT                   similar to Agrobacterium tumefaciens (strain C58/ATCC
FT                   33970) Ribonuclease D (208 aa) fasta scores: E()=4.8e-72,
FT                   88.942% id in 208 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05592"
FT                   /db_xref="GOA:Q1MN60"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN60"
FT                   /protein_id="CAK05592.1"
FT                   /translation="MAATIRYHEGDISAADVARYTGAIAIDTETLGLVPRRDRLCVVQL
FT                   SPGDGTADIIRIAAGQKEAPNLVALLEDPTHQKIFHYGRFDIAVLFHTFSVTTTPVFCT
FT                   KIASRLIRTYTDRHGLKDNLKEMLDVDVSKAQQSSDWAAERLSPAQLEYAASDVLYLHA
FT                   LRDKLTERLIRDGRYDHATACFEFLPTRAKLDLLGWEEADIFAHS"
FT   CDS_pept        133393..134958
FT                   /transl_table=11
FT                   /locus_tag="RL0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05593"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN59"
FT                   /protein_id="CAK05593.1"
FT                   /translation="MLTPVRAASNASFSSQGQTAAIVASGLGQSVIAPAPVNAVEAADL
FT                   NSAIAGKLNILLLAARERMVEALFDVIDAAGHSLSLDRGEDESNLAFASRLADAIRRLP
FT                   AARIDEVERQLTAQGHGLPLRTIAEALKNPTGPEAARIVAYLEIVRYKDRDLAARAVVR
FT                   SYRQNDASPMRTEARPEIQLHEDNRPAAATRQLAEKVPVLVAPLTEAAALLTAEEPLIA
FT                   ETVEAADPETPQPEEAPAQPAPVAAAEVAAEESLPQELEAQQLLSTDLDKIEDTQEAVE
FT                   QSAVQPRIVSDKADPVIPRNWAGIVASMTEEASEMIATLIREQEIETVLEDVPVEAAVE
FT                   IDTILDEAVISEATGSLTKQPMELAAPDVRQTAALRPSQPDIPPLVVETRQPREVSAQA
FT                   EMIPVPETIESPYVPLAARMPEGLAYTQLPYQFAKDILSNEKAGETHHQHQHHRDGAPQ
FT                   DQNQDEQQAQSGGEDAEPDGEETDAAPARRTPRMIDAEPVAHQPAGAAADPVYALYQRM
FT                   VGWE"
FT   CDS_pept        complement(135131..136834)
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="RL0106"
FT                   /product="putative 30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:RL0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05594"
FT                   /db_xref="GOA:Q1MN58"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN58"
FT                   /protein_id="CAK05594.1"
FT                   /translation="MSVATPSREDFAALLEESFAKNDLAEGYVTKGIVTGIEKDVAVVD
FT                   VGLKVEGRIALKEFGARAKDGLLKVGDEVEVYVERIENALGEAVLSREKARREESWVKL
FT                   EAKFEAGERVEGVIFNQVKGGFTVDLDGAIAFLPRSQVDIRPIRDVTPLMHNPQPFEIL
FT                   KMDKRRGNIVVSRRTVLEESRAEQRSEIVQNLEEGQVVDGVVKNITDYGAFVDLGGIDG
FT                   LLHVTDMAWRRVNHPSEILNIGQQVKVQIIRINQETHRISLGMKQLESDPWDGIQAKYP
FT                   EGKKISGTVTNITDYGAFVELEPGIEGLIHISEMSWTKKNVHPGKILSTSQEVEVVVLE
FT                   VDPSKRRISLGLKQTLENPWAAFARSHPAGTEVEGEVKNKTEFGLFIGLDGDVDGMVHL
FT                   SDLDWNRPGEQVIEEFNKGDVVKAVVLDVDVEKERISLGIKQLGKDAVGDAAASGDLRK
FT                   NAVVSCEVIAVNDGGVEVKLVNHEDITSFIRRADLARDRDEQRPERFSVGQVFDARVTN
FT                   FSKKDRKIMLSIKALEIAEEKEAVAQFGSSDSGASLGDILGAALKNRGGE"
FT   CDS_pept        complement(137011..137658)
FT                   /transl_table=11
FT                   /locus_tag="RL0107"
FT                   /product="putative cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05595"
FT                   /db_xref="GOA:Q1MN57"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN57"
FT                   /protein_id="CAK05595.1"
FT                   /translation="MTNETFTIAIDGPAAAGKGTLSRRIADQYGFHHLDTGLTYRATAK
FT                   ALLDAGLPLDDEAVAEKIAREVELAGLDRDILSKHEIGEAASRIAVMPAVRRALVEAQR
FT                   RFSTKAPGTVLDGRDIGTVVCPNAAVKFYVTASPEVRARRRYDEILGKGLTADFDAIFE
FT                   DVKRRDERDMGRADSPLKPADDAHLLDTSEMSIEAAFQAAQSIIDAVLSRNA"
FT   CDS_pept        complement(137731..139089)
FT                   /transl_table=11
FT                   /gene="aroA1"
FT                   /locus_tag="RL0108"
FT                   /product="putative 3-phosphoshikimate
FT                   1-carboxyvinyltransferase
FT                   (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
FT                   synthase)"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RL0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05596"
FT                   /db_xref="GOA:Q1MN56"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN56"
FT                   /protein_id="CAK05596.1"
FT                   /translation="MLNGSASKPATARKSAGLTGSVRIPGDKSISHRSFMIGGLASGET
FT                   RITGLLEGEDVINTGRAMQAMGARIRKEGAQWVIEGTGNGALLAPDAPLDFGNAGTGVR
FT                   LTMGLVGTYDFHSTFIGDASLSKRPMGRVLNPLREMGVQVSASEGDRLPVTLRGPGTPS
FT                   PIRYRVPMASAQVKSAVLLAGLNTPGVTTVIEPVMTRDHTEKMLQGFGAALSVETDGDG
FT                   VRTIRLEGRGKLAGQVIDVPGDPSSTAFPLVAALIVPGSDITIVNVLMNPTRTGLILTL
FT                   QEMGADIEVVNARLAGGEDVADLRVRHSELKGVTVPEDRAPSMIDEYPILAVAACFAEG
FT                   ATVMKGLEELRVKESDRLSAVADGLKLNGVDCDEGEDFLIVRGRPDGKGLGNAADGRVS
FT                   THLDHRIAMSFLVLGLASEHAVTIDDAAMIATSFPEFMQLMTGLGAKIELVAE"
FT   CDS_pept        139366..139749
FT                   /transl_table=11
FT                   /locus_tag="RL0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05597"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN55"
FT                   /protein_id="CAK05597.1"
FT                   /translation="MAKAELGTKRTDPETGKKFYDLNRDPIVSPYTGKSYPLSFFEETS
FT                   AIAEVAEEDEVAEVDTENTEVELVSLEDADDAASGDDIPDIGDDDVEIEGDDDDDTFLT
FT                   PDEDDDDDDMSDIIGVTGDEDEV"
FT   CDS_pept        140098..140430
FT                   /transl_table=11
FT                   /locus_tag="RL0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05598"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN54"
FT                   /protein_id="CAK05598.1"
FT                   /translation="MNYVYILHSTEFPDRYYVGVTSDLKSRLAKHNAGEVSHTSKYLPW
FT                   SLKTYLAFSDEAQAFAFEKYLKSASGRAFAKIKTLAAPFNSGRTLPQPPDQTIATRPTG
FT                   SRVRLT"
FT   CDS_pept        140531..141253
FT                   /transl_table=11
FT                   /locus_tag="RL0111"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05599"
FT                   /db_xref="GOA:Q1MN53"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN53"
FT                   /protein_id="CAK05599.1"
FT                   /translation="MTRSRRRRIIRTRRTLTGLALVGSISFLAGMTDATGLLLTGDFVS
FT                   FMTGNTTRAALALSEGNLYHAAVLICAIVVFVLGNAAGIVISHISQRRIFVVLGCVGLV
FT                   LALASMMTVQNMLFARFYMIVFSMGMVNAAVEHIEGLPIGLTYVTGALSRFGRGIGRWI
FT                   IGDRRVEWTIQIVPWGGMVLGAIAGAVLTRLTGAHALWLVSLFAMVLALAAMLIPRPLQ
FT                   RRFNQKVAPSGSAITRAK"
FT   CDS_pept        141322..142110
FT                   /transl_table=11
FT                   /locus_tag="RL0112"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05600"
FT                   /db_xref="GOA:Q1MN52"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN52"
FT                   /protein_id="CAK05600.1"
FT                   /translation="MFLISKLVWIFAQPLSLAFFLVFLALLAGLLRWRTLSILGAAGSA
FT                   LILFVTLYTTAGNLLMQGLEQRFAKPAADPDSLQCMIVLGGGFENEVNTARHGIEFNGG
FT                   ADRFIEALRLAQKFPQSRILVSGGDGSISGIYEGDAAASERFFPLFGVGRDRLIEERQS
FT                   RTTFENAVNTKEFLASQGLSNCLLITSGFHMPRSVGIFRKLGIDIVPWPTDYRTDGQVR
FT                   LGLDFTQPSLNAQNLATAIREWYGLVGYYLAGRTSELYPS"
FT   CDS_pept        142264..142677
FT                   /transl_table=11
FT                   /locus_tag="RL0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05601"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN51"
FT                   /protein_id="CAK05601.1"
FT                   /translation="MRRRDHEITAFGNLQVEIIGTAVVIALRPLLPVAGQLALVDHRVD
FT                   QAVIVDVLPDDETIGKFGRLALLLEMFLLVDLRVGDQRLLTEGDSRHGKQQDDIQNGEH
FT                   QRFHGFPLLDKGSVAQCMSPKVCSGSRTTTCIT"
FT   CDS_pept        142765..143400
FT                   /transl_table=11
FT                   /locus_tag="RL0114"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05602"
FT                   /db_xref="GOA:Q1MN50"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN50"
FT                   /protein_id="CAK05602.1"
FT                   /translation="MSLLVYLDYAGIALFAATGALAASRKQLDLIGFLFFAMVTGTGGG
FT                   TVRDIVLGRVPVFWVLNPAYILVCCIVGVMVFFTAHLLESRYRLLIWLDAIGLAAYCVI
FT                   GAAKGLAATGSPTIAIVTGTLTATFGGILRDLMANEPSVLLRPEIYVTAALIGAGVFTL
FT                   ANGLGMQLYLASACGVVAAFGVRGGALWFGWTFPTYRHKPGRHPDDVM"
FT   CDS_pept        complement(143477..143899)
FT                   /transl_table=11
FT                   /gene="irrA"
FT                   /locus_tag="RL0115"
FT                   /product="iron response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05603"
FT                   /db_xref="GOA:Q1MN49"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN49"
FT                   /protein_id="CAK05603.1"
FT                   /translation="MMTGAFPIAIEVRLRGAGLRPTRQRVALGDLLFAKGDRHLTVEEL
FT                   HEEAVAAGVPVSLATVYNTLHQFTEAGLIRVLAVESAKTYFDTNVSDHHHFFVEGDNEV
FT                   LDIPVSNLTIANLPEPPEGMEIAHVDVVIRLRAKQG"
FT   CDS_pept        144197..144712
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="RL0116"
FT                   /product="putative 3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase (Beta-hydroxydecanoyl thioester dehydrase)"
FT                   /EC_number="4.2.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:RL0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05604"
FT                   /db_xref="GOA:Q1MN48"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN48"
FT                   /protein_id="CAK05604.1"
FT                   /translation="MTTRQSSFSYEELIACAHGELFGPGNAQLPLPPMLMVHRITEISE
FT                   TGGTFDKGYLRAEYDVRPDDWYFPCHFEGNPIMPGCLGLDGMWQLTGFFLGWLGEEGRG
FT                   MALSTGEVKFKGMVRPQTKLIEYGIDFKRVMRGRLVLGTADGWLKADGETIYQAADLRV
FT                   GLSKDKTA"
FT   CDS_pept        144791..145990
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="RL0117"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase I"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I (EC
FT                   2.3.1.41) (Beta-ketoacyl-ACP synthase I) (KAS I)."
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RL0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05605"
FT                   /db_xref="GOA:Q1MN47"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN47"
FT                   /protein_id="CAK05605.1"
FT                   /translation="MSSIGNDAAEVTESLRQAKSGISFSSDFAEHGFKCQVWGSPKLGS
FT                   AELAELVDRRAMRFLSQGGAWNHVAMKQALADSGLEEKDYAQNERTGIIMGSGGPSTRT
FT                   LIEAAEITIKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIG
FT                   NAAEMIQWGKQDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPDSASRAYDVNRDGFV
FT                   IAGGAGVLVLEELERAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQALATVK
FT                   GDVDYVNTHGTSTPVGDSKEIGAIREVFGSKIPHIQSTKSLTGHSLGAAGVQESIYSLL
FT                   MMQQGFIGESAHITELDPEFEGVPIVRKRIDDAKIDIALSNSFGFGGTNATLVFQRYNG
FT                   "
FT   CDS_pept        145998..146804
FT                   /transl_table=11
FT                   /gene="fabI1"
FT                   /locus_tag="RL0118"
FT                   /product="putative Enoyl-[acyl-carrier-protein] reductase
FT                   [NADH] (NADH-dependent enoyl-ACP reductase)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RL0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05606"
FT                   /db_xref="GOA:Q1MN46"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN46"
FT                   /protein_id="CAK05606.1"
FT                   /translation="MTGIMQGKRGLVMGVANNHSIAWGISKALAAQGAELAFTYQGDAL
FT                   GKRVKPLAAEVNSDFVLPCDVEDIASVDAVVDAISERWGKLDFIVHAIGFSDKNELKGL
FT                   YADTTRENFSRTMVISCFSFTEIAKRCAPLMEDGGAMLTLTYNGSTRVIPNYNVMGVAK
FT                   AALEASVRYLAADYGPRGIRVNAISAGPIRTLAGAGISDARAILSWNQRNAPLRKTVTI
FT                   DQVGSSALYLLSDLSSGVTGEVHFVDAGFNVTSMPTLETLRKADVE"
FT   CDS_pept        complement(146893..147909)
FT                   /transl_table=11
FT                   /locus_tag="RL0119"
FT                   /product="putative ribosomal RNA small subunit
FT                   methyltransferase"
FT                   /EC_number="2.1.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:RL0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05607"
FT                   /db_xref="GOA:Q1MN45"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN45"
FT                   /protein_id="CAK05607.1"
FT                   /translation="MSSETLKTLFHPFASGTVAAPGEGERVLFLGAEAGFALPEGFAAS
FT                   LSAVQGFRPLYRQLLAQRIEAKPEIDGEDYDAALVLCTKHKGENEANLAAAIARTRLGG
FT                   LIVVAGAKEDGIQPLRKRMEGFNLAVDYMPKYHGVAFWFGRPADADEIISKLAKAPVRV
FT                   DGRFNATAGMFSHDRIDAGSELLTSRLPEDFTGDVADFGAGWGYLSVEMARKSVGLTRL
FT                   DLYEADHAALEAARDNLAKNCPNAPARFFWHDLAGEPVKDKYDLIIMNPPFHEGHAAEP
FT                   ALGQAMIKTAASALRGGGRLMLVANRGLPYEPVLAANFRESGETCRNARFKVLWAKK"
FT   CDS_pept        complement(147985..150123)
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="RL0120"
FT                   /product="putative Polynribonucleotide
FT                   nucleotidyltransferase (Polynucleotide phosphorylase)
FT                   (PNPase)"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:RL0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05608"
FT                   /db_xref="GOA:Q1MN44"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN44"
FT                   /protein_id="CAK05608.1"
FT                   /translation="MFDTHTVEIEWAGRPLKLETGKIARQADGAVLATYGETVVLATVV
FT                   SAKAPKAGQDFFPLTVNYQEKTYAAGKIPGGYFKREGRPSEKETLVSRLIDRPIRPLFP
FT                   EGYKNDTQVVVTVIQHDLENDPDVLSMVATSAALTLSGVPFMGPVGGARVGYINGEYVL
FT                   NPHLDEMDESSLDLVVAGTYDAVLMVESEAKELNEDVMLGAVMFGHKGFQPVLDAIIKL
FT                   AEVAAKEPRDFQPADYSALESEMLGLAEGELRNAYKITQKADRYAAVDAVKAKVKAHFL
FT                   PEEGEAKYTAEEVGAIFKHLQAKIVRWNILDTKSRIDGRNLETVRPIVSEVGLLPRTHG
FT                   SALFTRGETQAIVVATLGTGEDEQYVDSLTGMYKERFLLHYNFPPYSVGETGRMGSPGR
FT                   REIGHGKLAWRAIRPMLPTPEQFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPL
FT                   AKPVAGIAMGLILEGDRFAVLSDILGDEDHLGDMDFKVAGTADGITSLQMDIKITGITE
FT                   EIMKVALGQAQGGRVHILGEMSKAITESRGQLGEFAPRIEVMNIPVDKIREVIGSGGKV
FT                   IREIVEKTGAKINIEDDGTVKIASSSGKEIEAARKWIHSIVAEPEIGQVYEGTVVKTAD
FT                   FGAFVNFFGARDGLVHISQLASERVAKTQDVVKEGDKVWVKLLGFDERGKVRLSMKVVD
FT                   QATGQEIPNEKKKEEAAE"
FT   CDS_pept        complement(150472..150741)
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="RL0121"
FT                   /product="putative 30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:RL0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05609"
FT                   /db_xref="GOA:Q1MN43"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN43"
FT                   /protein_id="CAK05609.1"
FT                   /translation="MSITAERKSALIKEYATVEGDTGSPEVQVAILTERINNLTEHFKD
FT                   HKKDNHSRRGLLTMVSSRRSLLDYLKKKDEGRYSKLITSLGIRR"
FT   CDS_pept        complement(150895..151833)
FT                   /transl_table=11
FT                   /locus_tag="RL0122"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05610"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN42"
FT                   /protein_id="CAK05610.1"
FT                   /translation="MSGGSDAISSLSGRHSGPRGHGGPTEGKIMRGTAIGILTFFSMFL
FT                   AAAGARSAERWAELPAFPSMPVAKTSGMAEVNDIKMYYAEYGEGDPILFIHGGLGNADV
FT                   WGHQVADFAKDHLVIVADSRGHGRSTRSQQPFGYDLMTSDYVALLDYLKIDKVTLVGWS
FT                   DGGIIGIDMAMKNPEKLTRVIAQAANVTTDGVKADVMNNKTFNDYINVAGEYYRKLSPT
FT                   PNEYEAFVTQISHMWETQPAWTAADLGKIAVPVTLAIGDHDEAVKLDHTEMMAKDIPGA
FT                   KLVILKDASHFAMLQDPTGYDAMIRDAMAGR"
FT   CDS_pept        complement(151863..152795)
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="RL0123"
FT                   /product="putative tRNA pseudouridine synthase B (tRNA
FT                   pseudouridine 55 synthase) (Psi55 synthase)
FT                   (Pseudouridylate synthase) (Uracil hydrolyase)"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RL0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05611"
FT                   /db_xref="GOA:Q1MN41"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN41"
FT                   /protein_id="CAK05611.1"
FT                   /translation="MSKPRKPKGRPISGWLILDKPVDFGSTEAVSKIKWLYKAEKAGHA
FT                   GTLDPLASGMLPIALGDATKTVPYVMDGRKIYEFTVSWGEERATDDLEGDVTKSSDKRP
FT                   SEQQIRDILPGYIGTISQVPPQFSAIKIAGERAYDLAREGETIEIPSREVDIFRLTLLA
FT                   CPDADSAHFEVECGKGTYVRALARDFGRELGCYGHVSGLRRTFVAPFAEGAMVPLADLV
FT                   ALEAIEDMDERLAALDALLIDTCEALSSLPHLVINDDQAHRLKMGNPILVRGRDAPVAE
FT                   SEAYATARGKLIAIGEIGQGEFRPKRVFA"
FT   CDS_pept        complement(152809..153213)
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="RL0124"
FT                   /product="putative ribosome-binding factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05612"
FT                   /db_xref="GOA:Q1MN40"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN40"
FT                   /protein_id="CAK05612.1"
FT                   /translation="MTRPTSSAPSQRMLRIGEQVRAAITQVLQRGEVRDDVIEATVISV
FT                   SEVRMSPDLKIATAYVTPLGVSDHSIVIEALNRHARFIRGRLGPQLRQMKYMPEVRFRD
FT                   DTSFDNYKKIDELLRSPEVSRDLDGDNDEQ"
FT   CDS_pept        complement(153364..156117)
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="RL0125"
FT                   /product="putative translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:RL0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05613"
FT                   /db_xref="GOA:Q1MN39"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN39"
FT                   /protein_id="CAK05613.1"
FT                   /translation="MTDSNDDKTISVAGKKTLTLKPSGMSQGTVRQDMGRGRTKAVVVE
FT                   TRKRRPMRPEDEKPITPVAPAAPVRAAEPAPAPVQARPQQPTPAPRVQQGNNNQTNQRP
FT                   PQQSHQPPRQNDRPRPVVLNHLSPEEMDARRRALADSQARDAQDAIRRAEEEKRRAAEE
FT                   VIRKAAEAEEAARRAAEEAIRQAEAPAVAEPAAAEPAPAEARTDAPRPPQPASSAPAAR
FT                   RPDAAGAPAARPAPGAAVPGAVRGRRDEKEEDDRGAARGGPVRGRVVRPEPAKPVTTRP
FT                   KTDEERRRGKLTITTANVDGEDNARGRSLSAMRRRQEKFRRGQMQETREKISREVVLPE
FT                   TITIQELSQRMSERAVDVIKYLMKEGQMMKPGDVIDADLAEIIAGEFGHTVRRVSESDV
FT                   ELGIFNVSDEDGELVSRPPVVTIMGHVDHGKTSLLDAIRHANVVSGEAGGITQHIGAYQ
FT                   VEQNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIESINHAKAAGV
FT                   PIIVAINKVDKHEADPQKVRNQLLQHEVFVESMGGEVLDVEVSAKTGKNLDKLLEAILL
FT                   QAEILDLKANANRTAEGTVIEAQLDRGRGSVATVLVQKGTLRPGQIIVAGDVWGRVRAL
FT                   VTDKGDHVKEAGPATPVEVLGLSGTPQAGDKFAVVESESRAREISEYRQRLARDKAAAR
FT                   QSGQRGSLEQMMMQRQSVGIKEFPLVIKGDVQGSIEAIAGALEKLGTDEVRARIVHSGA
FT                   GGITESDISLAEASNAAIIGFNVRANTQARQFAEREGIEIRYYNIIYDLVDDVKAAMSG
FT                   LLSPERRETFIGNAEILEVFNITKVGKVAGCRVVEGKVERGAGVRLIRNDVVVHEGKLK
FT                   TLKRFKDEVSEVPMGQECGMAFENYEDMRAGDVIECFRVEHITRTL"
FT   CDS_pept        complement(156219..156911)
FT                   /transl_table=11
FT                   /locus_tag="RL0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05614"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN38"
FT                   /protein_id="CAK05614.1"
FT                   /translation="MMTAHEPDAPLEDDDLAGYDVNGRMCIVTRESGSPEELIRFVAAP
FT                   DGTVVADLKRELPGRGCWVKIDRSLVDRAVAKKLFARALKTDVKAADDLGESVDRLLAA
FT                   QLMQMMNMARKAGQFVSGSSKVDAAVRSGAALAVFHSTGAADDGVRKIDQARKAWHLGM
FT                   ETEEEIPSFRLFSESEMEGLMGQNAFIHAAVLAGQAGEGVVKRAKMLEQYRIGGQSRAA
FT                   GGAGRLKQ"
FT   CDS_pept        complement(156908..158509)
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="RL0127"
FT                   /product="putative transcription elongation protein (N
FT                   utilization substance protein A) (L factor)"
FT                   /db_xref="EnsemblGenomes-Gn:RL0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05615"
FT                   /db_xref="GOA:Q1MN37"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN37"
FT                   /protein_id="CAK05615.1"
FT                   /translation="MAVSANRLELLQIADAVAREKVIDREIVLAAMADAIQKAARSRYG
FT                   TESNIRADINPKTGEIRLQRLLEVVEKAEDYSTQIPLELARDRNPDAALGDFIADPLPP
FT                   MDFGRIAAQSAKQVIVQKVREAERDRQFDEFKDRVGEIVNGTVKRVEYGNVIVDLGRGE
FT                   GIIRRDEMIPRENVRYGDRVRAYVYDVRREQRGPQIFLSRTHPQFMVKLFTMEVPEIYD
FT                   GIIQVKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWS
FT                   QDPATFVVNALQPAEVAKVVLDEDAERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDI
FT                   DIMTEAEESERRQKEFNERTNLFMDSLDVDEMVGQVLASEGFAAVEELAYVDLDEISSI
FT                   DGFDEETAQEIQQRAREFLERLEAEMDEKRKALGVQDELREINGMTAQMMVALGEDGIK
FT                   SIEDFAGCAADDLVGWSERKNGETKKFEGLFSKFDVSRVEAEQMIVQARLSAGWITQED
FT                   LAKGTEEEVTEAEQEA"
FT   CDS_pept        complement(158569..159174)
FT                   /transl_table=11
FT                   /locus_tag="RL0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05616"
FT                   /db_xref="GOA:Q1MN36"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN36"
FT                   /protein_id="CAK05616.1"
FT                   /translation="MSDLTNADNEREPRLITETGLDQRLADIIEPVLVDLGFRLIRVRM
FT                   MNQNGATMQVMAERNDGTMTVQDCEEVSMAISPVLDVEDPVDKEYHLEVSSPGIDRPMV
FT                   RKSDFVRWQGHLVKCETSILIDNRKRFRGKIVEAGTDGFTLERDQIAYGEEQKVTIPFT
FT                   ALSDAKLILTDDLIRDALRADKLAKAQAANQNEADDEE"
FT   CDS_pept        159373..161052
FT                   /transl_table=11
FT                   /locus_tag="RL0129"
FT                   /product="putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05617"
FT                   /db_xref="GOA:Q1MN35"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN35"
FT                   /protein_id="CAK05617.1"
FT                   /translation="MRIYCRWRAITKAGEIVAYTSSTLAPLRHDTYRTIWFASLSSNFG
FT                   GLIQAVGAAWMMTTITASEDMVALVQTSTALPIMLFSLISGALADNYDRRRVMLTAQCM
FT                   MLTVSALLTASALLGWITPWLLLFFTFLIGCGTALNNPSWQASVGDMVPRADLPAAVTL
FT                   NSMGFNITRSVGPAIGGVIVAAAGAAAAFAVNTLSYLALIYALLRWRPAAPVSTLPREA
FT                   LGSAIFAGLRYVSMSPNLEKVLVRGLLFGIGASSILALLPVVALDLVAGGPLTYGFMLG
FT                   AFGIGAIGGAVLNARLRQVLSSEMIVRLSFAGFALSAVIAALSPSAVLTSAGLLVSGAC
FT                   WVSALSLFNTIVQLSTPRWVVGRALSLYQTVTFGGIAGGSWLWGIAADRYGVADALLMS
FT                   SVVMLLGIAIGLRFSMPAFASLNLDPLNRFIEPALSLDITPRSGPIVIQVDYEIADEDL
FT                   AEFMELMGERRRIRIRDGARNWALMRDLENPSLWTETYHTPTWVEYIRHNQRRTQADAE
FT                   NTDRLRALHRGEGPLHVHRMIERQAIPPDNDVFHKAPIDLHH"
FT   CDS_pept        161049..161531
FT                   /transl_table=11
FT                   /locus_tag="RL0130"
FT                   /product="putative transcriptional
FT                   regulator/acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05618"
FT                   /db_xref="GOA:Q1MN34"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN34"
FT                   /protein_id="CAK05618.1"
FT                   /translation="MRPAMQRSGIYRFRLARQSDLAAIVRLLADDNLGGTREIVSDPVD
FT                   ARYLSAFAAIEADANQLLAVANDATDRVVGCLQLSFVPGLSRTGMWRGQIESVRVASDL
FT                   RGSGLGSHFIEWAIAQCAERGCGLVQLTPDKTRGDAIRFYERLGFVASHEGLKRNL"
FT   CDS_pept        complement(161538..162812)
FT                   /transl_table=11
FT                   /locus_tag="RL0131"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05619"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN33"
FT                   /protein_id="CAK05619.1"
FT                   /translation="MRGLHMLKDGPRRLRIFALALAAALLPLSCYAAPSKADVEVQFEK
FT                   WVQADLWPEAKANGISEKVFQAAFSGITLNWNLPDLAPPGFPPPKEQKQTQAEFSSPAP
FT                   YFNEDQLKKLAATGRGFAAQYGSTLKRIEKTYGVPGSIVLAIWGRETGFGAAKIPNSAI
FT                   EVLATKAFMSTRKEMFRTELVAALHILDGGDVTPANFKGSWAGALGQPQFMPTSYLKYA
FT                   VDFDGDGHRNIWTSVPDTLASIANYLVKKGWQRNRDWGFEVSIPEAVSCAQEGPDLAKP
FT                   LSHWTSLGIDRISGKGFPSGEMKAEGMMLVPAGRDGPEFIVTPNFYIIKEYNNSDLYAL
FT                   YIGNLADRIAYNGGAFQGKWGDVGKMLRSDVAAMQKALERQGYDVGGSDGLPGYKTRRS
FT                   IGQWQAKNGMKPTCFPEATMKGKLK"
FT   CDS_pept        complement(162809..163414)
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="RL0131A"
FT                   /product="putative recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0131A"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05620"
FT                   /db_xref="GOA:Q1MN32"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN32"
FT                   /protein_id="CAK05620.1"
FT                   /translation="MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKDQLLGP
FT                   LSHAMGEAYDKVKICSRCGNVDTVDPCIVCTDVQRDQSVIIVVEDVSDLWALERAGAMN
FT                   AAYHVLGGTLSPLDGVGPDDLNIRGLIDRVGEGGIRELIIAVNATVEGQTTAHYITDQL
FT                   QGLDVKITRLAHGVPVGGELDYLDEGTLAAALRARTVI"
FT   CDS_pept        163433..164101
FT                   /transl_table=11
FT                   /locus_tag="RL0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05621"
FT                   /db_xref="GOA:Q1MN31"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN31"
FT                   /protein_id="CAK05621.1"
FT                   /translation="MERKRNRGRIGHPMKILALCTGNPESLPGKSYKTGIFKHAVTGAV
FT                   MIDAEGLVGDAICNRKHHGGVDQAVYVEGSLTLDWWSRELGRPYEPGTFGENMVISDLD
FT                   NRDVAVGDRFLTGDLVLEVTSCRMPCATFAARMADPKFVKRYTAAARPGIYCRVIRGGV
FT                   VEPGMPMEYTSFSGDKITMPELMEAFGRRLPGADRTRYLAAPIHYKLRAMLESQADEAR
FT                   "
FT   CDS_pept        complement(164124..164447)
FT                   /transl_table=11
FT                   /locus_tag="RL0133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05622"
FT                   /db_xref="GOA:Q1MN30"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN30"
FT                   /protein_id="CAK05622.1"
FT                   /translation="MRDIMGMMGKVKEMQAKMEQMQAEIAELTAEGKAGGGLVTVLISG
FT                   KGDLKSLKIDPSLFKEDDVEILEDLIVAAHKDAKDKAEALAAEKTKALTAGLPIPPGFK
FT                   LPF"
FT   CDS_pept        complement(164470..166347)
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="RL0134"
FT                   /product="putative DNA polymerase III"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RL0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05623"
FT                   /db_xref="GOA:Q1MN29"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN29"
FT                   /protein_id="CAK05623.1"
FT                   /translation="MSDTERQSKDAASTGTGYRVLARKYRPKDFTDLMVGQEPMVRTLT
FT                   NAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTSEIDKPTIDLRAPGEHCQAIME
FT                   GRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLSTQAFNGLLKTL
FT                   EEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFTTIAAKEGIEAEPDA
FT                   LAMIARAAEGSARDGLSLLDQAIAHGAGVVQAEAVRGMLGLADRARIVDLFQHIVKGDV
FT                   AAALGEFQNQYEAGANPVVVLTDLADFTHLVTRLKYVPDAANDPSLSEVERTKAAEFAK
FT                   CVAVTTLSRIWQMLLKGIPETEGSSRTAGAAEMVLIRLAHAAHLPAPEDAARRLAEFSG
FT                   DNTGPRPSSSPSGNGGGSGTRVPYQSSVAARAAETAPSQPPSSAPVAMLRAVPSSQSET
FT                   MAVGRIEPKPAEAPKPLVPVNSVNDIVNLATEKRDPKLKAMVRTFLRPVRIEAGRLDVS
FT                   LAPGAPTTLLNELAVKLKEWTGIHWIVSLSRDEGQPTLVEAEARTREQHVIDARQDPDV
FT                   AAILAHFPGAKIIDVRVRAPEPEEEGEATPPAAAESEEGDILPGDDIEF"
FT   CDS_pept        166459..166989
FT                   /transl_table=11
FT                   /locus_tag="RL0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05624"
FT                   /db_xref="GOA:Q1MN28"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN28"
FT                   /protein_id="CAK05624.1"
FT                   /translation="MASGSSTTNLPDAHIGNIVIKSKPTCEKTASRRKRQEECPLKGFA
FT                   LDPRLENDSVSIMVTGLCDLRLSKDARWPWLILVPRRADITEIFELTPLDQVLLAFETE
FT                   LVAKALKKITGATKINIGALGNIVRQLHVHVIARFEGDANWPGPVWGFGRAEPYEDGKR
FT                   DEFTAKLREALSS"
FT   CDS_pept        166986..167945
FT                   /transl_table=11
FT                   /locus_tag="RL0136"
FT                   /product="putative MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05625"
FT                   /db_xref="GOA:Q1MN27"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN27"
FT                   /protein_id="CAK05625.1"
FT                   /translation="MSHSLFDSDVPHPEPSNLTAFAANDLNRDSEHRDEQSVEKALAKE
FT                   GTHIFAFTRDKLVLKHDGQVLDPLFARYELQELQPDWDETVLLGYRKSGEPRLAVPVGI
FT                   DVDDLTSQYKPADGRTLFREMLIDEVLLGEFAQAASLIRWNGDNRFCGRCGSAMEIHIG
FT                   GYKRVCAACEHVIFPRTDPVVIMLTVDEQRDLCLLGRSPHFAPGMYSCLAGFLEPGETI
FT                   ENAVRRETLEESGIRTGRIRYHASQPWPMPHSLMIGCYAEAKSTEISRDETELEDCRWF
FT                   TREETIEMLERPSATGRASPPKGAIAHRLMRDWVEWKR"
FT   CDS_pept        167950..168645
FT                   /transl_table=11
FT                   /locus_tag="RL0137"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05626"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN26"
FT                   /protein_id="CAK05626.1"
FT                   /translation="MPVARSERLLTLLQTLRRYRRPVTGTVLAQETGVSLRTLYRDIAS
FT                   LQAQGAMIEGEAGIGYVLKPGFMLPPMMFSEEELEALVLGSRWVARAAEPRLAGAGADA
FT                   LAKIAAVLPADMREMIDSAALFVGPKRRDEDKADVSAIRRAIRLERILELHYGDEQGRI
FT                   SRRRVWPFGLGYYEHVRVLMAWCELRQDFRHFRTDRIIDMALHEVRYPRRRTVLLKEWR
FT                   ETQDVPMEN"
FT   CDS_pept        169172..169540
FT                   /transl_table=11
FT                   /locus_tag="RL0138"
FT                   /product="putative glyoxalase/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05627"
FT                   /db_xref="GOA:Q1MN25"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN25"
FT                   /protein_id="CAK05627.1"
FT                   /translation="MTSPNLIILYVKDPGESASFYRNLLNREPAVEAPNFVAFPLEGGF
FT                   TLGLWRRSKVEPQPSAIGNRGEVAFMVEGENAVARHYEDWRQRGLPIAQELTELDFGPT
FT                   FVVLDPDGHRLRVCEPDK"
FT   CDS_pept        complement(169654..170508)
FT                   /transl_table=11
FT                   /locus_tag="RL0139"
FT                   /product="putative P-protein [includes: chorismate mutase
FT                   and prephenate dehydrogenase]"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:RL0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05628"
FT                   /db_xref="GOA:Q1MN24"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN24"
FT                   /protein_id="CAK05628.1"
FT                   /translation="MNIKTNRIAFQGEFGANSDMASRDMFPTMEPLPCQTFEDAFTAVD
FT                   NGDADIGMIPIENTIAGRVADIHHLLPESRLHIIGEYFMPIRFQLMVLPGVTKDEIRTV
FT                   HSHIHALGQCRKIVRANGWKPVIAGDTAGAAKLVQETGDRSMAALAPRLAADLYGLEII
FT                   AENVEDTENNVTRFVVLSRDEEWAQRNSAEEKVVTTFVFNVRNIPAALYKALGGFATNN
FT                   INMTKLESYQLGGKFVATQFYADIEGHPNDPNVRRALEELRFFSEKVRILGVYKGHAMR
FT                   GLL"
FT   CDS_pept        complement(170519..171274)
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="RL0140"
FT                   /product="putative 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase (CMP-KDO synthetase)
FT                   (CMP-2-keto-3-deoxyoctulosonic acid synthetase)"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase
FT                   (EC 2.7.7.38) (CMP-KDO synthetase)
FT                   (CMP-2-keto-3-deoxyoctulosonic acid synthetase) (CKS)."
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:RL0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05629"
FT                   /db_xref="GOA:Q1MN23"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN23"
FT                   /protein_id="CAK05629.1"
FT                   /translation="MSDSNLDGVLVLIPARMASTRLPGKPLADICGLPMIVQVAMRARE
FT                   AAIGRVVVAVDETRVFDAVAAAGFEVVMTRVDHQSGSDRIFEALTKVDPEGKAKIIVNI
FT                   QGDLPTIDPETVRAALRPLENEAVDIGTLTTEIDNEEDKTAPHIVKIIGSPISGNRLHA
FT                   LYFTRATAPYGQGPLYHHIGLYAYRRAALERFVSLGPSTLEKRESLEQLRALEAGMRID
FT                   AEVVDTVPLGVDTPADLEKARRILSAKSN"
FT   CDS_pept        171429..171992
FT                   /transl_table=11
FT                   /gene="cycM"
FT                   /locus_tag="RL0141"
FT                   /product="memmbrane-bound cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:RL0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05630"
FT                   /db_xref="GOA:Q1MN22"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN22"
FT                   /protein_id="CAK05630.1"
FT                   /translation="MNSYVNTAVGALLGTIFVLMSVSIASEGIFHSEAPEKEGFAIVAE
FT                   EAPAAGGEAAPAVAVPIAQLLASADAKAGETVFKKCQACHDGTKGGPNKVGPNLFGVVD
FT                   RPIASHAGFAYSAPMKDFSKGGSEKWTFEYLNKFLLAPKKDIPGTAMGFAGLAKDQERA
FT                   NVILYLHTLADSPGPLPDPNAATQ"
FT   CDS_pept        complement(172062..173009)
FT                   /transl_table=11
FT                   /locus_tag="RL0142"
FT                   /product="putative transmembrane permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05631"
FT                   /db_xref="GOA:Q1MN21"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN21"
FT                   /protein_id="CAK05631.1"
FT                   /translation="MSAIIFDVLPVFILILIGWVIVRSGLMASNVGEALSEFVFKIAVP
FT                   LLLFRTIAEADFHGASPFRLWIVYFSGVAITWTAGHIAATRLFGRDERIGVLAGVSSAF
FT                   ANNIFIGLPLVERTVGDEGLVALSILLAVHLPVMMVAGTVLMEHAERKIAGKSDRSMVL
FT                   VLRQIAVNLVRNPLVIGLAAGMAMHLSGLTMPTTLATVVGQIAGIAGPAALISLGMALE
FT                   RYGVSGNLGIASVTSSLKLLLLPGCVWAASRLLGLSPEWTAAIVLTSSVPTGVNAWLIA
FT                   NRFGVGHSLAASTITVTTALGAITVSLWAYFLGA"
FT   CDS_pept        173497..174489
FT                   /transl_table=11
FT                   /locus_tag="RL0143"
FT                   /product="putative Pfk family kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05632"
FT                   /db_xref="GOA:Q1MN20"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN20"
FT                   /protein_id="CAK05632.1"
FT                   /translation="MTRFDVLTVGNAIVDIIARCDDQFLIDNQITKAAMNLIDAERAEL
FT                   LYSRMGPALEASGGSAGNTAAGVASLGGKAAYFGNVAQDQLGDIFAHDIRAQGVHYQTR
FT                   PKGTFPPTARSMIFVTEDGERSMNTYLGACVELGPEDVETDVVADAKVTYFEGYLWDPP
FT                   RAKEAILDCARIAHENGREMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFANRQEALSL
FT                   YETDDFEEALNRIAADCKIAAVTMSEDGAVILKGRERFYVDAIRIREVVDTTGAGDLFA
FT                   SGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRPMTSLSEAAKRAGLI"
FT   CDS_pept        complement(174482..175021)
FT                   /transl_table=11
FT                   /locus_tag="RL0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Agrobacterium tumefaciens (strain C58/ATCC 33970)
FT                   Hypothetical protein Atu0078 (200 aa), fasta
FT                   scores:E()=1.4e-52, 73.889% id in 180 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05633"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN19"
FT                   /protein_id="CAK05633.1"
FT                   /translation="MRSKVLKSCLALAIALAASMGSVEFAHAQAAKGPSGLPLPRFVTL
FT                   KSKRVNLRIGPGTDYAVSWMYLKSGLPVEIIQEYDNWRRIRDADGTEGWVNQSLLSGQR
FT                   AAIAAPWMKTKGKGIYVNLRREAQPSASIVAKLEPGVMLTIGECNGDWCRAESDGASGW
FT                   VAQSEIWGAYPGEAFK"
FT   CDS_pept        175207..176208
FT                   /transl_table=11
FT                   /gene="gyaR1"
FT                   /locus_tag="RL0145"
FT                   /product="putative glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:RL0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05634"
FT                   /db_xref="GOA:Q1MN18"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN18"
FT                   /protein_id="CAK05634.1"
FT                   /translation="MTAKKKPKVYITRKLPDAVETRMRELFDAELNIDDAPRSVPELIA
FT                   AVKTADVLVPTVTDRIDAALIEQAGPQMKLIASFSNGTDHIDVEAAARKGITVTNTPNV
FT                   LTEDTADMTMALILAVPRRLGEGARVLTDKPGEWAGWSPTWMLGRRIHGKRIGIVGMGR
FT                   IGTAVARRAKAFGLSIHYHNRKRVNPAVEDELEATYWESLDQMLARVDIVSVNCPSTPA
FT                   TFHLISARRLALLQPTAYLVNTARGDVVDEAALIKCLREGRIAGAGLDVFENEPAVNPR
FT                   LIKLANEGKVVLLPHMSSATIEGRIDMGDKVIINIRTFIDGHRPPNRVLPGR"
FT   CDS_pept        complement(176222..176710)
FT                   /transl_table=11
FT                   /locus_tag="RL0146"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05635"
FT                   /db_xref="GOA:Q1MN17"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN17"
FT                   /protein_id="CAK05635.1"
FT                   /translation="MRIVPLDQTFTRWDELLALILSAFASMNGRIDPPSSALKLTTASL
FT                   AEKAGTEIGHVAIDGEKLIGCLFLRPEADCLYVGKLAVLPEVQGKGLGKRLLALAEETA
FT                   AALDLPALRLETRIELTDNHAVFAAWGFCRTAEKAHPGFARTTFVEMRKVLAPPICVA"
FT   CDS_pept        complement(176707..177531)
FT                   /transl_table=11
FT                   /locus_tag="RL0147"
FT                   /product="putative molydopterin synthase sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05636"
FT                   /db_xref="GOA:Q1MN16"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN16"
FT                   /protein_id="CAK05636.1"
FT                   /translation="MTEAAFPGVGRHDNIGAMEPLSPEEIARYHRHILLPEIGGAGQQK
FT                   LKAARVLVIGAGGLGAPVLQYLAAAGVGTLGIVDDDRVSLSNLQRQVIHDSGTIGELKT
FT                   ESAAFAIARLNPHVRLIRFEERFSPEAARRQLSGFDLLIDGSDNFDTRYAAADAADEAR
FT                   IPLVTGAVGRFDGSLTVLKPYETAEDGTPNPRYRDLFPEAPPAGLIPACAEAGIIGALT
FT                   GVIGTMMAMEAIKLVTGIGEPLVGRLLLYDALSARFDTIRYKRRRTTQRQAG"
FT   CDS_pept        complement(177528..178652)
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="RL0148"
FT                   /product="putative DNA replication and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05637"
FT                   /db_xref="GOA:Q1MN15"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN15"
FT                   /protein_id="CAK05637.1"
FT                   /translation="MPHKVSLSRLKLTDFRNYAAAALALDGRHAVLTGDNGAGKTNLME
FT                   AVSLLSPGRGLRRAAYGDITRVGAAGGFSIFAALDGMEGDVEIGTGIETGEETTARKLR
FT                   INGTTAKTADELTDHLRLLWLTPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFE
FT                   RAMRSRNKLLDEGRFDPSWLAGIEEQMASLGIAMALARQEMLGLLTRLIEETRETSPFP
FT                   SASLQLSGFMDGQFSRPSVDLEDDYAAMLAESRYRDAGAGRTLEGPHRADLIVHHREKA
FT                   MEAERCSTGEQKALLVGLVLAHARLVGNLTGHAPILLLDEIAAHLDEGRRAALFDLIDG
FT                   LGGQAFMTGTDRAMFSALGDKAQFFTVADGRVFE"
FT   CDS_pept        179034..179399
FT                   /transl_table=11
FT                   /locus_tag="RL0149"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05638"
FT                   /db_xref="GOA:Q1MN14"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN14"
FT                   /protein_id="CAK05638.1"
FT                   /translation="MPDPVDIIVGRNVRQFRALRRVSQLELGEALGLTFQQIQKYEKGA
FT                   NRVSASKLHQIAVFLDVDISALFEGAGMSPFGSRVELSPDAYALALSYDKLNSPAGKEA
FT                   VKTIVTLMTGESAETTA"
FT   CDS_pept        complement(179558..179758)
FT                   /transl_table=11
FT                   /locus_tag="RL0150"
FT                   /product="conserved hypothetical protein"
FT                   /product="hypothetical protein smc02277"
FT                   /db_xref="EnsemblGenomes-Gn:RL0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05639"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN13"
FT                   /protein_id="CAK05639.1"
FT                   /translation="MAPAFSSQSEDVDVLAGAIYTWCAERNIKLRSQQGLSIASIAIDL
FT                   YHAGHQTQDDLLMALHECELH"
FT   CDS_pept        complement(180070..181197)
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="RL0151"
FT                   /product="putative chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05640"
FT                   /db_xref="GOA:Q1MN12"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN12"
FT                   /protein_id="CAK05640.1"
FT                   /translation="MAKADFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKDAER
FT                   KFKEINEAYEMLKDPQKRAAYDRYGHAAFEHGGMGGGGGGFAGGGFSDIFEDIFGEMMG
FT                   GGRARQRSSGGRERGADLRYNMEITLEESFSGKTAQIRVPTSITCDVCSGSGAKPGTQP
FT                   KNCGTCQGTGRVRAAQGFFSIERTCPTCHGRGQIIPDPCPKCHGQGRVTEERSLSVNIP
FT                   AGIEDGTRIRLQGEGEAGARGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISMTTAAL
FT                   GGTFDVATLDGTKSRVTVPEGTQVGKQFRLKGKGMPVLRSVQTGDLYIQIQIETPQKLT
FT                   KRQRELLQEFEQLSSKENNPESTGFFARMKEFFEG"
FT   CDS_pept        complement(181283..183199)
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="RL0152"
FT                   /product="putative heat shock chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05641"
FT                   /db_xref="GOA:Q1MN11"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MN11"
FT                   /protein_id="CAK05641.1"
FT                   /translation="MAKVIGIDLGTTNSCVAVMDGKDAKVIENAEGARTTPSMVAFSDD
FT                   GERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFTIVKGDNGDAWVE
FT                   ANGKGYSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVLRIINEPTAAALAYGLDKKEGKTIAVYDLGGGTFDISILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVEYLVGEFKRDNGIDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFI
FT                   TADASGPKHLTLKLTRAKLESLVDDLVQRTIAPCKAALKDAGVTAAEIDEVVLVGGMSR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRLIERNTTIPTKKSQTFSTAEDNQQAVTIRVSQGEREMAADNKLLGQFDLVGLP
FT                   PSPRGMPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAEAH
FT                   ATEDKKRREAVEARNQAESLIHSSEKSLKDYGDKVSEADRTAISDAIAALKTASEASEP
FT                   DADDIKAKTQTLMEVSMKLGQAIYEAQQAEGGAAGDASAESGDNVVDADYEEIKDDDRK
FT                   KSA"
FT   CDS_pept        complement(183536..185872)
FT                   /transl_table=11
FT                   /locus_tag="RL0153"
FT                   /product="putative penicillin-binding
FT                   transpeptidase/transglycosylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05642"
FT                   /db_xref="GOA:Q1MN10"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN10"
FT                   /protein_id="CAK05642.1"
FT                   /translation="MAGRGRSGDRIEPSFSGRPARDDDEFSLDADDRIAGGRSQRRGGS
FT                   KPPPQRAAPRRRREPPEREGGGFFGFMRRVIYWCVVLFIWAGIGVAGLVVYYGSRMPSA
FT                   STWAIPERPPNVKITAVDGSVIANRGATGGEALSLENMSPYIPEAVIAIEDRRFYSHFG
FT                   VDPLGLGRAIVTNLTAGHMVQGGSTLTQQLAKNLFLSPERTLERKVQEVLLSLWLEQKY
FT                   TKDQILAMYLNRVFFGSNAYGVEAASRRYFNKSARDVNLGEAAVLAGLLKAPSRLSPAR
FT                   DAEAANARAQLVLAAMREQGFITDSEVKTAMSQTPASAKSYWSGAGHYVADMVMDELPG
FT                   LIGDVKEDVIVDTTIDKSLEKKAEQSLVDILDKEGGKLDASQAALVSIDGTGAIRALVG
FT                   GRDYATSQFNRAVKAKRQPGSSFKPFVYAAALEKGLTPYSVFNDAPIRIGDWTPENYEK
FT                   KYNGEVTLATALAKSLNTVAAQLVMYDGPDQVIKLAHRLGIESELQPNASIALGTSEVS
FT                   LMELTASYAAFMNGGYKATPHVIRRVTTAEGKVLYENTYDSPPRVLSEQIAAEMDAMMM
FT                   GVIDNGTGKSAKIPGWQAAGKTGTTQNSRDALFVGFTSNLTTGVWFGNDDGKPMKKVTG
FT                   GGLPAKAWKEFMIAAHKGLSPAPLFGNGQLIADPNNGQPMAEAPGNGQLGSGQPMTAEA
FT                   PPSTIGGIISGVFGGNDNANRYPQAPVRQQAATSGSGPVPPADIAEGGGSGYEGMVPPG
FT                   DVGGAQTTSSVQPRRTTLLDLIMGQ"
FT   CDS_pept        complement(186083..186304)
FT                   /transl_table=11
FT                   /locus_tag="RL0154"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05643"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN09"
FT                   /protein_id="CAK05643.1"
FT                   /translation="MTQDYLAFLGLFAPRAAAIDVTVWHKHNPILPVRLTDGANLNPSG
FT                   QIWRRFHLGEWEYKQDPETLDDYEARQF"
FT   CDS_pept        complement(186908..187558)
FT                   /transl_table=11
FT                   /locus_tag="RL0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05644"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN08"
FT                   /protein_id="CAK05644.1"
FT                   /translation="MKNLIVKVAAAAMLVLAPAIAQAAEGYSTANVNMRAGPSTRYPAV
FT                   AVVPAGSSVEIRGCLSNVNWCDVEFYGGRGWVSGQYVQAVYQQRRVYVGPQYYRPLGIP
FT                   MVSFSVGNYWDRYYRNRDFYRERDRWSRGPDYYYRDRVYRDRDRDWSDDKRRDDRRDDI
FT                   RRSDRRDNDNRGNTRSSDFRDLPQFNGGKADTYNRPDPRASPFVCRPGDPSCD"
FT   CDS_pept        complement(187564..187821)
FT                   /transl_table=11
FT                   /locus_tag="RL0156"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05645"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN07"
FT                   /protein_id="CAK05645.1"
FT                   /translation="MESHGPTALKVHAFAISQGLSRTRYCVTKFPPFKLRSSPPEYKLL
FT                   KDNENSGALTNASDRSMFCSRWHMPRKRSQALLEKRANEE"
FT   CDS_pept        complement(187987..189444)
FT                   /transl_table=11
FT                   /locus_tag="RL0157"
FT                   /product="putative peptidase"
FT                   /note="Similar to Bacillus clausii KSM-K16. Deacylase.
FT                   Q5WDJ9 (EMBL:AP006627) (432) fasta scores: E()=3.8e-37
FT                   33.183% id in 443 aa, and to Agrobacterium tumefaciens
FT                   (strain C58/ATCC 33970). AGR_C_165p. Q7D266 (EMBL:AE007952)
FT                   (507) fasta scores: E()=4.1e-158 82.062% id in 485 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05646"
FT                   /db_xref="GOA:Q1MN06"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN06"
FT                   /protein_id="CAK05646.1"
FT                   /translation="MFFRLACLSGLVYRPAEFQKESKMTDVNQVLARADQNLSSSLDKL
FT                   FELLRIQSISTDPAYKAECRKAAEWLVAYLEGLGFTASVRDTPGHPMVVAHHAGASADA
FT                   PHVLFYGHYDVQPVDPIELWENDPFEPSIKDVGEGRKILTGRGTSDDKGQLMTFVEACR
FT                   AYKEINGALPCRVTILFEGEEESGSPSLKPFLEANATELKADYALVCDTGMWDRDTPAI
FT                   AAALRGLVGEEVIVTAADRDLHSGLFGGAAANPIHILVKALAGLHDETGRITLDGFYEG
FT                   VEETPDNIKASWETLGKTAESFLGEVGLSIPSGEKGRSVLELTWARPTAEINGIWGGYT
FT                   GEGFKTVIAAKASAKVSFRLVGTQDPAAIREAFRSYISSKIPADCSVEFHPHGGSPAIH
FT                   LSYDSPVLTKAKNALSDEWPKPAIVIGMGGSIPIVGDFQKMLGMESLLVGFGLSDDRIH
FT                   SPNEKYELVSYHKGIRSWVRILEALAA"
FT   CDS_pept        189588..191972
FT                   /transl_table=11
FT                   /locus_tag="RL0158"
FT                   /product="putative GGDEF/EAL domain transcriptional
FT                   regulator"
FT                   /note="Codons 260 to the C-terminus are similar to codons
FT                   740 to the C-terminus of Pseudomonas putida. morA Q7WYW5
FT                   (EMBL:AY323811) ( MorA.) fasta scores: ungapped id 40.600%
FT                   length=1282 id in E(), and to Agrobacterium tumefaciens
FT                   (strain C58/ATCC 33970). GGDEF family protein. Q8U728
FT                   (EMBL:HS161255) (779) fasta scores: E()=2.7e-134 49.935% id
FT                   in 773 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05647"
FT                   /db_xref="GOA:Q1MN05"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN05"
FT                   /protein_id="CAK05647.1"
FT                   /translation="MFSVITCIRDNHDWRLVLAAAAVCLVGTMAAMLLLSRAQECDAGR
FT                   RKLWIGASAFAFGTGVWATHFIAMLAYDGGMPIGYQLGLTALSFLLSVVGSWAAILVAS
FT                   ESRGRFSRIRGGVLMALGIASMHLTGMQAIETQAAILYDPFMTLSAVLAGALLSSAAFH
FT                   AFFQSKGLRRLLASSITFVLAICALHFISMASITLVPDPGKEVPATVLDASLLAAIVVV
FT                   AATTLILIALAVVFIESHLTDLKGLANASQEGLLILREGRIIDANERFQGLSGWKLAGL
FT                   SGKAPSAVLTAVQGTGQNRPSETVLNTRDGREIAVEVTASRIVYRGHNCEVLAVRDLTE
FT                   RRQAEEMIEHLAHHDVLTDLPNRSLFDTRIRQALQMAERKNSEVALFYLDLDRFKAVND
FT                   IFGHAEGDRILRKVASILRRVADESDTVARLGGDEFAIIQLAGQQPAAAQKLAADILGE
FT                   FAAEMDTARDPTAVGVSVGIALYPTDGAAAEELCNNADTALYRVKHDGRGKICFFDAEM
FT                   DKAARNRRQIESELRHAIIRNQIHVSYQPILDALSGEIGGYEALMRWNRPGHGLTEPDI
FT                   FISIAEESGSIVQLGEWVLQQACREAVRWPLPLMIAVNLSPVQFMLPNLCERIEAILAE
FT                   TGLAPSRLELEITEAALIRDRDRVMTTLLRLHKLGVHIVMDDFGTGFSSLSNLRSFPFD
FT                   KIKVDRSFTGVLEHDAGARSIVRAIIGLGHSLGMPVVTEGVETEMQRRIVVEEGCAQVQ
FT                   GLLLGKPDIEPSIKLAAHENVLTAQIETGVSSLRRAQGAGE"
FT   CDS_pept        complement(192083..192499)
FT                   /transl_table=11
FT                   /locus_tag="RL0159"
FT                   /product="putative MarR family transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05648"
FT                   /db_xref="GOA:Q1MN04"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN04"
FT                   /protein_id="CAK05648.1"
FT                   /translation="MDSGAYLASQLAKGFARSLHQRAVGLGFSPGQFPILLELWAEDGL
FT                   TQKQLLERVDIEQATMANTLSRMVRDGLIERRPHPSDKRAQLLFLTPRARAMEAEAIET
FT                   AREADLALFKGFRVFERELTLEYIRRLLENAKAL"
FT   CDS_pept        192994..196044
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="RL0160"
FT                   /product="putative DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RL0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05649"
FT                   /db_xref="GOA:Q1MN03"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN03"
FT                   /protein_id="CAK05649.1"
FT                   /translation="MPNSIWTSSHARAIHARMKKGDHLFLVDGSGFIFRAFHALPPLTR
FT                   KTDGLPIGAVSGFCNMLWKLLRDARNTDVGVTPTHLAVIFDYSARTFRKDLYDAYKANR
FT                   SAPPEELIPQFGLIREATRAFNLPCIETEGFEADDIIATYARQAEATGADVTIVSSDKD
FT                   LMQLVSPNVHMYDSMKDKQIGIPDVVEKWGVPPEKMIDLQAMTGDSVDNVPGIPGIGPK
FT                   TAAQLLEEYGDLDTLLERATEIKQVKRRETILANIDMARLSRDLVRLRTDVPLDLDLDA
FT                   LVLEPQNGPKLIGFLKTMEFTTLTRRVAEACDCDASAIEPAIVRIEWGEKARGPDLDAA
FT                   EPEPVAGGIPDVSGESVPVPPRAKAKTAVEGAFSPADLAKARAEAFATLPFDHSAYVTI
FT                   RDLATLDRWIADARATGLVAFDTETTSLDAMQAELVGFSLAIADNTADPTGTKIRAAYV
FT                   PLVHKNGVGDLLGGGLAENQIPMGDALARLKALLEDESILKVAQNLKYDYLLMKRYGIE
FT                   TRSFDDTMLISYVLDAGTGAHGMDPLSEKFLGHTPIPYKDVAGSGKANVTFDLVDIDRA
FT                   THYAAEDADVTLRLWLVLKPRLAAAGLTSVYERLERPLLPVLARMEARGITVDRQILSR
FT                   LSGELAQSAARLEDEIYVLAGERFNIGSPKQLGDILFGKMGLSGGSKTKTGQWSTSAQV
FT                   LEDLAAAGFELPRKIVDWRQVTKLKSTYTDALPGYVHPETKRVHTSYSLASTTTGRLSS
FT                   SEPNLQNIPVRTAEGRKIRTAFISTPGHKLISADYSQIELRVLAHVAEIPQLTKAFEDG
FT                   VDIHAMTASEMFGVPVEGMPGEVRRRAKAINFGIIYGISAFGLANQLSIERSEAGDYIK
FT                   KYFERFPGIRDYMESRKAMARDKGYVETIFGRRINYPEIRSSNPSVRAFNERAAINAPI
FT                   QGSAADVIRRAMIKIEPALVEVGLADRVRMLLQVHDELIFEVEDEDVEKAMPVIVSVME
FT                   NATMPALEMRVPLRVDARAATNWDEAH"
FT   CDS_pept        196319..198664
FT                   /transl_table=11
FT                   /locus_tag="RL0161"
FT                   /product="putative cell division DNA translocase protein"
FT                   /note="Codons 60 to the C-terminus are similar to codons
FT                   650 to the C-terminus of Escherichia coli. ftsK FTSK_ECOLI
FT                   (EMBL:A64828) ( DNA translocase ftsK.) fasta scores:
FT                   ungapped id 47.076% length=1329 id in E(), and codons 180
FT                   to the C-terminus are similar to Rhizobium meliloti
FT                   (Sinorhizobium meliloti). Putative cell division protein
FT                   FtsK like protein. Q92TK5 (EMBL:C96030) (611) fasta scores:
FT                   E()=9.9e-133 79.500% id in 600 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05650"
FT                   /db_xref="GOA:Q1MN02"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN02"
FT                   /protein_id="CAK05650.1"
FT                   /translation="MRFPRTNLTDAGDFSSEIETDLPEENPGEKPAAPIWQSNFSLAPN
FT                   VRFTRTPETLISRRRAPNEPVRDDSQIGQQAIRIEPVAVDVPFDIYLPEPDEISAAPQR
FT                   IELQQSPLLDEAAAPAFRASAELSSISDFAFWEVMAFEEAEPVRAPPLISFPKTETSPE
FT                   SITSLFRIMEWRPGRPAPAQVVSRPAPQPAAVSAKVAVRPAAAISLEKPRRIAVEAPVM
FT                   LAPQAAPTPQLAPAPHIASAPQAAPAPQRTPPVAAVLPSPRLAARPEKIDASGYEFPPR
FT                   ALLQEPPERLGEIMSQETLEQNAGLLESVLEDFGIKGEIIHVRPGPVVTLYEFEPAPGV
FT                   KSSRVIGLADDIARSMSALSARVAVVPGRNVIGIELPNVTRETVYFREMIESQDFEKSG
FT                   YKLALGLGKTIGGEPVIAELAKMPHLLVAGTTGSGKSVAINTMILSLLYRMTPEQCRLI
FT                   MVDPKMLELSVYDGIPHLLTPVVTDPKKAVMALKWAVREMEERYRKMSRLGVRNIDGYN
FT                   DRVAQAREKGETIHVMVQVGFDKGTGTPIEESQALDLTPMPYIVVIVDEMADLMMVAGK
FT                   DIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILG
FT                   EQGAEQLLGQGDMLHMQGGGRISRVHGPFVSDVEVEKVVAHLKTQGRPEYLDTVTADEE
FT                   EETEEEEAGAVFDKSAMASEDGNELYEQAVKVVMRDKKCSTSYIQRRLGIGYNRAASLV
FT                   ERMEKEGLVGPANHVGKREIVSGRGDGE"
FT   CDS_pept        complement(198700..199203)
FT                   /transl_table=11
FT                   /locus_tag="RL0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05651"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN01"
FT                   /protein_id="CAK05651.1"
FT                   /translation="MRAIKVVDYDPSWPRLFAEISAEVSALLGDRLLSIDHIGSTSVPG
FT                   LAAKPKIDLAAVMISDAFLPAAIEIVRAADFVFHGDTGEQRWAFTRDHDGYGFRLYLCG
FT                   PDNRAHRGRILFRDYLRNHPERAKAYADLKRRLAAEADDDWDFYTGGKTDFVSETVRLA
FT                   ALKT"
FT   CDS_pept        complement(199223..199819)
FT                   /transl_table=11
FT                   /gene="phnN"
FT                   /locus_tag="RL0163"
FT                   /product="putative ATP-binding phosphonate metabolism
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05652"
FT                   /db_xref="GOA:Q1MN00"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MN00"
FT                   /protein_id="CAK05652.1"
FT                   /translation="MMSHEPHAGAGAERGTMVVVVGPSGAGKDTLMNLAARRFKGREDV
FT                   HFVRRVITRHRDAGGEDHLSVSLQGFAAMEQSGSFAVWWEAHGLKYGIPAEISVALSKG
FT                   HIVVANGSRSALHRFQAAFPRLKVINVTARPEVLAGRLETRGRETHEDIMARLARGPLT
FT                   VRGEYDVVELDNSGSLEEAEQKMIEILNGLLTKTP"
FT   CDS_pept        complement(199816..200988)
FT                   /transl_table=11
FT                   /gene="phnM1"
FT                   /locus_tag="RL0164"
FT                   /product="putative phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05653"
FT                   /db_xref="GOA:Q1MMZ9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMZ9"
FT                   /protein_id="CAK05653.1"
FT                   /translation="MPAPKAERPDAMSKETVFSNARIVLEDDILSGSILIRDGKIADIS
FT                   EGNSVAGEDFEGDYMIPGLVELHTDHLEGHYQPRPGIRWNKTAAVQAHDAQIVTSGITT
FT                   VFDCLRMGADEDGGFEHGEMREMADAIQSAETEGRLRAEHLIHLRCEVSADNVLEHFAD
FT                   FESDRHVRLVSLMDHAPGQRQFQTMDQYIFYYQKKRGLSDEAFARFVAKRQAESARNST
FT                   PHRNAIAKVCAERGITVASHDDATLSHVDEAIDNGVRLAEFPTSFDAARASHEHGMSVL
FT                   MGAPNIVRGKSHSGNIAARDLAEMGVLDVLSSDYVPLSLLHAPFILADEVESISLPKAI
FT                   AMVTSTPARTVSLDDRGRIATGLRADLVRVHRSHGVPVTRSVWRQGRRVA"
FT   CDS_pept        complement(200969..201664)
FT                   /transl_table=11
FT                   /locus_tag="RL0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05654"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMZ8"
FT                   /protein_id="CAK05654.1"
FT                   /translation="MRYALYFSPPKDDPLTGAASLWLGRNAFTGETYPAPEHEQLGAAE
FT                   QFELTADPRRYGFHATIKAPFSLASSVTEKDLMTVAEDFARRTQAFEIPELVLGQLGRF
FT                   FALVPGSLHQPLQDFAAKVVRSFEPFRAALSETDMARRNPEKLSDSQRAHLKRWGYPYV
FT                   MEDFGFHMTLSGQVPETRAEVMKAILTERFANFTGRPLSISGLAVFIEETRGAPFKVHS
FT                   WLPLAGAKS"
FT   CDS_pept        complement(201786..203138)
FT                   /transl_table=11
FT                   /gene="phoT"
FT                   /locus_tag="RL0166"
FT                   /product="putative permease component of phosphate uptake
FT                   ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05655"
FT                   /db_xref="GOA:Q1MMZ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMZ7"
FT                   /protein_id="CAK05655.1"
FT                   /translation="MSSVPTINAAERERLLSAYPDVFHRSFMQRWGLLLISAAVFVYLA
FT                   FCFAFFNVIPTFVNGNWDRAAIYVQDWYSWRAQPRLRFQNDQVVPQWTSRRQYPEGADI
FT                   NWLKPNADGSRYTVTFGSDGDRMEVTPSRVDVYIDGKLYPVTITHDRASLPSDAPARMQ
FT                   QDDNKVNVYYGFAGQAEIRTNQVYIQRRFLGWANFFFDTHSPFWGRSLPEVVGLMFSGE
FT                   RLDPNQSNASLALDNFLNNASWQHGDILSKLMQTLVMAFVGTLFGTLVAFPLAFIAARN
FT                   IMRSRAANWGTKRLFDFLRSIDMLIWALFFTRAFGPGPLPGIAAIFFTDTGALGKVYAE
FT                   ALENIDDKQREGVRSVGAAPVAVQRYGVIPQVLPVFISQSLYFWESNTRSATAIGAVGA
FT                   GGIGLKLLESMKTNSDWDKVAYMVLLILLVVFAFDNLSNALRSRVMGKKGH"
FT   CDS_pept        complement(203138..204118)
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="RL0167"
FT                   /product="putative permease component of phosphate uptake
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05656"
FT                   /db_xref="GOA:Q1MMZ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMZ6"
FT                   /protein_id="CAK05656.1"
FT                   /translation="MAHSAGADSLSGLQEGSRTILDHYQSQVRTRRIYTVVSIVVFLII
FT                   LGASLDFANSANSGKFFERLPYFFDFMKSFVPDSPLEIFRAMFDLPSPFSDGSIKYDYT
FT                   SDRVWITDSFYIPNFFYQLAITLNIAIVSTILGASGAFLLCFFASTNLVGAGVTRWVVR
FT                   RIMEIMRAFPEIVVAGLLAAILSIGPISAIIAVWVHTVGALGKLFFEVVENADMKPDEG
FT                   LRAAGAGWLERVRFAILPQVLPNFVSYTLLRTEINVRASTIIGAVGGGGIGEVFSLSIG
FT                   RDHAAKTYAIIILLLITVICVDQFSAWLRRRLIGKQSFEFGQGAA"
FT   CDS_pept        complement(204187..205110)
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="RL0168"
FT                   /product="putative solute-binding component of phosphate
FT                   uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05657"
FT                   /db_xref="GOA:Q1MMZ5"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMZ5"
FT                   /protein_id="CAK05657.1"
FT                   /translation="METSMSAFRKILMATIAVAALAGNAAAQDVKVLRIGLDGGENEAD
FT                   QVRRTECVKPGLIAATGVSEVQLFPSPNYNGVIQGLLGGTIDLAVMGAASYAAIYIKDP
FT                   NAVTPVLTTKQADGSTGYYSIMVARKDSGIKTLADAKGKKLGFADPDSTSGYLVPNVAL
FT                   PKDTGAPVKQYFSETGFGGGHENLVLGVLDKKFDVGTTFGSGQGDWAQGYSSGNLHQMV
FT                   TKGLLDMDDIVEVWKSPLIPNGPLMVSQKLPADLQKKVTTYFAELPKTDKSCFESFTGG
FT                   GYVDWVPVDQSFYQTIIDARKAVIGG"
FT   CDS_pept        complement(205369..206436)
FT                   /transl_table=11
FT                   /locus_tag="RL0169"
FT                   /product="putative transposase for insertion element family
FT                   protein"
FT                   /product="transposase for insertion sequence element
FT                   is1111a"
FT                   /db_xref="EnsemblGenomes-Gn:RL0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05658"
FT                   /db_xref="GOA:Q1M490"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1M490"
FT                   /protein_id="CAK05658.1"
FT                   /translation="MTASYEYHIGVDYHKSYSHLVVQDSSGKTLRSGRVKNDRQSLGGF
FT                   LERYRENSHAVVEATRNWMVMYDWLDDICDDVVLAHPLKVKAIADAKIKTDKIDATVLA
FT                   HLLRADLVPEAWAPSERSRDLRVALRERMFYVRLRTMTKNRIVTVFDRYPEQTAQLKKL
FT                   GDLFGKAGRVQLAQVNVSEIDRIQIDRGLAFIGDIDMRIKQSEATIRAMTKANANVKLL
FT                   KTIPGIGEFFARLIDAEIDDISRFRHSKKLAAYAGLVPSTHSSGGKTFHGKIIKQGNKW
FT                   LRWAFVEAVAPAIASDPQLRAQYEHLKIKGINKARVAIARKLLTITFQILRDQRAYEPR
FT                   GESTMEGASTISRLS"
FT   CDS_pept        complement(206639..207484)
FT                   /transl_table=11
FT                   /gene="phoC"
FT                   /locus_tag="RL0170"
FT                   /product="putative ATP-binding component of phosphate
FT                   uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05659"
FT                   /db_xref="GOA:Q1MMZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMZ3"
FT                   /protein_id="CAK05659.1"
FT                   /translation="MMFELKNVTRRFGKKLAVDSVTLAIAQGQMVGIIGRSGAGKSTLL
FT                   RMINRLQEPSSGSVHFAGVEVSGLRGQALRNWQRDCAMIFQQFNLVPRLDVLTNVMLGR
FT                   LNHRSTLMSLLNIFTREERVHAIAALERLGIEQTALQAAGTLSGGQQQRVAIARALMQN
FT                   PKMVLADEPIASLDPLNAKIVMDALRDINEREGITVITNLHTLDTARNYCERIVGMAGG
FT                   RVVFDGKPSELTAEAVKEIYGTDKDGAGIDETMTSTSLESKRRAEDVSSGRVAKAAAVH
FT                   "
FT   CDS_pept        complement(207600..208217)
FT                   /transl_table=11
FT                   /locus_tag="RL0171"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05660"
FT                   /db_xref="GOA:Q1MMZ2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMZ2"
FT                   /protein_id="CAK05660.1"
FT                   /translation="MSRKLGIEPYFHETASVSDSTFGRYTEVSERCRISEASFGDYSYI
FT                   MQDGSVWCATIGKFVNIAAAVRINATNHPTWRATLHHFTYRAADYWPDGDMETDFFAWR
FT                   RANRVTIGNDVWIGHGATILPGVSVGNGAVIGAGAVVSKDVAPYTIVGGVPAKLIRERF
FT                   PREVGERMDRLSWWDWEHDRLRQALEDFRNLDAEDFLSRYGG"
FT   CDS_pept        complement(208214..208921)
FT                   /transl_table=11
FT                   /locus_tag="RL0172"
FT                   /product="putative ATP-binding component of phosphate
FT                   uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05661"
FT                   /db_xref="GOA:Q1MMZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMZ1"
FT                   /protein_id="CAK05661.1"
FT                   /translation="MATPLVVSEVSKSFTMHLRDGIKLPVVSDVAFSVASGECVVLGGP
FT                   SGIGKSSLLKMIYGNYAVDTGQILIRHDGRIVDLASIDPRTVLNVRRNTLGYVSQFLRT
FT                   VPRVAAIDVVAEPLVARGEDAVTAREKAGALLARLNLPETLWQLPPATFSGGEQQRVNI
FT                   ARGFITEHTILLLDEPTASLDARNRAVVVGMIAEKKKAGVALLGIFHDEEVREAVADRI
FT                   LDVQQFSPRKIAA"
FT   CDS_pept        complement(208948..209724)
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /locus_tag="RL0173"
FT                   /product="putative ATP-binding component of phosphate
FT                   uptake ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05662"
FT                   /db_xref="GOA:Q1MMZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMZ0"
FT                   /protein_id="CAK05662.1"
FT                   /translation="MSDTPLLKVHDVSKFYGNRIGCRDVSFELWPGEVLAIVGESGSGK
FT                   TTLLNCLSTRLLPSTGSVEYHMRDGSYRDLYRMNEAERRFLMRTDWGFVHQNPADGLRM
FT                   TVSAGANVGERLMATGDRHYGKIRASAIDWLERVEIDADRIDDQPRAFSGGMRQRLQIA
FT                   RNLVTGPRLVFMDEPTGGLDVSVQARLLDLVRGLVNDLGLSAIIVTHDLAVARLLSHRM
FT                   MVMKDGYVIEHGLTDRVLDDPREPYTQLLVSSILQV"
FT   CDS_pept        complement(209721..210596)
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="RL0174"
FT                   /product="putative phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05663"
FT                   /db_xref="GOA:Q1MMY9"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMY9"
FT                   /protein_id="CAK05663.1"
FT                   /translation="MTDLASYNFAYLDEQTKRMIRRAILKAIAIPGYQVPFASREMPMP
FT                   YGWGTGGVQVTASIIGPDDVLKVIDQGADDTTNAVSIRAFFQKVANVAVTTHTKDATII
FT                   QTRHRIPEEKLGVGQVLVYQVPIPEPLRFLEPRETETRKMHALEEYGLMHVKLYEDIAH
FT                   NGRISRTYAYPVKVHGRYVMDPSPTPKFDNPKMHMSDALQLFGAGREKRIYAVPPYTDV
FT                   VSLDFEDYPFDIQRFDKPCALCGAEDVYLDEVVLDDKGGRMFVCSDTDHCEDRRAHGHA
FT                   GEMLAREAAE"
FT   CDS_pept        complement(210593..211699)
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /locus_tag="RL0175"
FT                   /product="putative phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05664"
FT                   /db_xref="GOA:Q1MMY8"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMY8"
FT                   /protein_id="CAK05664.1"
FT                   /translation="MYVAVKGGETAIANAHRLLADRRRGDRSLPAIGIDQIVAQLALAV
FT                   DRVMAEASLFDRTLAALAIRQSRGDMIEAIFLLRAYRTTLPRFGYSRPLDTADMTIERR
FT                   ISATYKDLPGGQLLGPTFDYTHRLLDPSLLSDEAVETPAQRAAETGRVMRVSEILGEEG
FT                   LIEADGDMPEDHEIGDLTREPMEFPMTRDLRLQALARGDEGFLLALGYSTQRGYGRNHP
FT                   FTGEIRIGDVEVEFDVPELGFAVSLGTIQITECQMVNQFKGSAKAPPQFTRGYGLVFGQ
FT                   SERKAMAMSLVDRALRAEELGEDITAPAQDEEFVISHSDNVQATGFVEHLKLPHYVDFQ
FT                   AELDLVRRMRREFEAARNGGEDMKEAAE"
FT   CDS_pept        complement(211704..212312)
FT                   /transl_table=11
FT                   /gene="phnH"
FT                   /locus_tag="RL0176"
FT                   /product="putative phosphonate utilisation protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05665"
FT                   /db_xref="GOA:Q1MMY7"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMY7"
FT                   /protein_id="CAK05665.1"
FT                   /translation="MGLKTEALTGGFVEPVFHAQSVFKMLMDGMARPGTIQTVQPDVAP
FT                   PAPLGIAAGTIALTLCDHDTPVWLSQGLARSAVPEWLGFHTGAPLTTEKAEARFAFTEA
FT                   GTALSSFGLFASGTQEYPDRSTTLIIELAELEGGRRLALMGPGIQSVAEIAPIGLPETF
FT                   LRLWTENRALFPRGVDIVLTAGKRFLCLPRTTKITATEI"
FT   CDS_pept        complement(212312..212788)
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="RL0177"
FT                   /product="putative phosphonate utilisation protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05666"
FT                   /db_xref="GOA:Q1MMY6"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMY6"
FT                   /protein_id="CAK05666.1"
FT                   /translation="MISADRTDAASQTASGRKRAADLLARAERSELLAAFDALPEKPVA
FT                   HQVRGPETGLVMVRGRIGGGGAPFNLGEVTVTRATVRLDSGSVGHAQALGTDREKARLA
FT                   AIFDALWQEEATKDFVEQALLLPVTERIADAERRKADETAATRVDFFTMVRGDN"
FT   CDS_pept        212906..213643
FT                   /transl_table=11
FT                   /locus_tag="RL0178"
FT                   /product="putative GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05667"
FT                   /db_xref="GOA:Q1MMY5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMY5"
FT                   /protein_id="CAK05667.1"
FT                   /translation="MSGLKQVQRQTGVALWRQIADRIREAISNGAYDETGMVPPETMLA
FT                   LQFGVNRHTVRSALAALAQEGIVRAVQGRGTLIERKERLNFPITRRTRFTAGIGDQARE
FT                   MRGLLLEEAKEEASAEIARWLGLKPGEEVIRLETLRQADKRPVSRATSWFPAKRFAGIG
FT                   EAYRTEESITKAFAELGLPDYVRATTEVTAAHASAADMADLELTPGAILLIAKAMNTDL
FT                   EGVPVQYSISRFAADRVQFTIEN"
FT   CDS_pept        complement(213683..214318)
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="RL0179"
FT                   /product="putative 2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase (Phosphoglyceromutase) (PGAM)
FT                   (BPG-dependent PGAM) (dPGM)"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase (ec 5.4.2.1) (phosphoglyceromutase)
FT                   (pgam) (bpg-dependent pgam) (dpgm)"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RL0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05668"
FT                   /db_xref="GOA:Q1MMY4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMY4"
FT                   /protein_id="CAK05668.1"
FT                   /translation="MSGTLVLVRHGQSDWNLKNLFTGWKDPDLTELGIQEANTGGAALA
FT                   EYGIKFDVAYTSVLVRAQHTLKLILDKVGQPDLLTIRDQALNERDYGDLSGLNKDDARA
FT                   KWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLRGEKVLVAAHGNSLR
FT                   SLVMVLDKLSREGVLALNLATGVPMVYKLKADSTVASKEVLGDMSGAH"
FT   CDS_pept        complement(214340..215164)
FT                   /transl_table=11
FT                   /gene="dapB1"
FT                   /locus_tag="RL0180"
FT                   /product="putative dihydrodipicolinate reductase"
FT                   /EC_number="1.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:RL0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05669"
FT                   /db_xref="GOA:Q1MMY3"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMY3"
FT                   /protein_id="CAK05669.1"
FT                   /translation="MSDAAMKLVVVGAAGRMGQTLIRLIHSIEGVRLHAAVERAGSPFV
FT                   GKDAGEIAGLGPTGVIIGDDPLNAFLDAEGVLDFTSPAATVEFSGLAAQARIVHVVGTT
FT                   GCSADDNTKIAAAARHARIVKSGNMSLGVNLLSVLAEQAARALDPDDWDIEILEMHHKH
FT                   KVDAPSGTALLIGEAAAKGRGIDLASQSVRVRDGHTGAREAGTIGFATLRGGSVIGEHS
FT                   VLFAGEGEIVTLSHSAADRSIFARGAIKAALWARDKKPGLYSMLDVLGLSSS"
FT   CDS_pept        complement(215180..216967)
FT                   /transl_table=11
FT                   /locus_tag="RL0181"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05670"
FT                   /db_xref="GOA:Q1MMY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMY2"
FT                   /protein_id="CAK05670.1"
FT                   /translation="MEAAESRTQSVSSDTVTGILKRIIAENGRDHLWGYVFAIACLIVV
FT                   ALSTAFTAWIMRAIIDEAFANRRADVVWIICLSIFIAFVLRGFASYGQAVALSRVGNDI
FT                   VARYQRRLYAHLMTLSVGFFSEARSAHIAAQVSQNVSGIRDVLNLTITSTVRDLLTFVS
FT                   LLAVMIIQDPLLSLAVFIMAPPLLYALRYVSKRLRSATREAVHLNSHVLGAMQETIQGI
FT                   AIVKAFTMEEELERKVNKLIKGAESRANRIARLSERTSPLTESFAGFAVASVLAYAAYR
FT                   SIYFNVPPGAFFSFVTALLLAYDPARRLARLQVQMERAVVNARMIYELLDMEPRQRDLP
FT                   DARPLTVTQARIEFRNVSFAYGKESVLSGVSFIAEGGGTTALVGPSGAGKSTVISLIPR
FT                   FYDPREGEILIDGQDIAHITKKSLRQQLAYVSQQPYLFEGTIRDNIRYGRPEATDAEVE
FT                   EAARLAYAHDFISAQPQGYETPVGENGVTLSGGQRQRLSIARALVRNAPILLLDEATSA
FT                   LDTESEAAVQKALDEAMSGRTVVVIAHRLSTVVRADKIVVMQQGRVVEEGNHETLAKVS
FT                   DGLYARLNNLQRPSASDSN"
FT   CDS_pept        complement(217115..218140)
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="RL0182"
FT                   /product="putative glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RL0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05671"
FT                   /db_xref="GOA:Q1MMY1"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMY1"
FT                   /protein_id="CAK05671.1"
FT                   /translation="MSKPNNSTAPLPFPILIGDIGGTNARFSILTDAYAEPKQFPNVRT
FT                   ADFATIDEAIQQGVLDKTAVQPRSAILAVAGPINDDEIPLTNCDWVVRPKTMIEGLGME
FT                   DVLVVNDFEAQALAIAALSDENRERIGDATRDMIASRVVLGPGTGLGVGGLVHAQHSWI
FT                   PVPGEGGHVDLGPRSKRDYDIFPHIETIEGRVSAEQILCGRGLVNLYHAICVVDGIEPT
FT                   MKDPADITSHALAGSDKAAVETVSLFATYLGRVAGDLAMVFMARGGVYLSGGISQKIIP
FT                   ALKKPEFRIAFEDKAPHTALLRTIPTYVVTHPLAALAGLSSYARMPANFGVSTEGRRWR
FT                   R"
FT   CDS_pept        complement(218158..218538)
FT                   /transl_table=11
FT                   /locus_tag="RL0183"
FT                   /product="putative methylglyoxal synthase"
FT                   /product="methylglyoxal synthase (ec 4.2.3.3) (mgs)"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:RL0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05672"
FT                   /db_xref="GOA:Q1MMY0"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMY0"
FT                   /protein_id="CAK05672.1"
FT                   /translation="MAGGKCLALIAHDQKKDDMAAFARANRDILSRWKIVATGTTGGRV
FT                   LDAAPDLDVVRLKSGPLGGDQQIGALISTGEVDALIFFVDPLTPMPHDVDVKALMRLAI
FT                   VYDIPMALNHATAIKLLPTLEA"
FT   CDS_pept        complement(218624..219700)
FT                   /transl_table=11
FT                   /locus_tag="RL0184"
FT                   /product="putative murein endopeptidase
FT                   (d-alanyl-d-alanine-endopeptidase)"
FT                   /note="Similar, but extended at the N and C-termini, to
FT                   Shigella flexneri. mepA MEPA_ECOLI (EMBL:AE015256)
FT                   (Penicillin-insensitive murein endopeptidase precursor (EC
FT                   3.4.99.-) (D-alanyl-D-alanine-endopeptidase)
FT                   (DD-endopeptidase).) fasta scores: ungapped id 41.250%
FT                   length=274 id in E(), and to entire protein of Rhizobium
FT                   meliloti (Sinorhizobium meliloti). PUTATIVE MUREIN
FT                   ENDOPEPTIDASE TRANSMEMBRANE PROTEIN (EC 3.4.99.- ). Q92T29
FT                   (EMBL:SME591782) (355) fasta scores: E()=2.6e-69 61.708% id
FT                   in 363 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05673"
FT                   /db_xref="GOA:Q1MMX9"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMX9"
FT                   /protein_id="CAK05673.1"
FT                   /translation="MAFGFAQAFRTLGTLALAGAIGAGLAVGDVGAEQKTPSPGSAKAL
FT                   FGGAGLPTQGPAQPIGFYAKGCMAGAVALPTDGPTWQAMRLSRNRRWGNPAMIALLERF
FT                   SQDAVRYAGWPGILVGDIAQPRGGPMLNGHSSHQIGLDADIWFSPMPARRMTAQEREDL
FT                   PFTSMLQKDKFLTVNPKVWTESRARLLMLAASYPEVERIFVNPAIKKKMCDTWGGDRTN
FT                   LGKLRPIYGHDSHFHIRIKCPPGAAGCTPQAPVPAGDGCDKSLAYWFTPAPWAPPKPPK
FT                   PGAKPPKPPREMMVTDLPNACAAVLDAASVASMQAATYGGPSAASALAATPAAASADDT
FT                   DGALPDVGPVPNDKPAIQ"
FT   CDS_pept        219976..221808
FT                   /transl_table=11
FT                   /locus_tag="RL0185"
FT                   /product="putative solute-binding component of ABC
FT                   transporter"
FT                   /note="Similar, but truncated at the C-terminus, to
FT                   Rhizobium sp. (strain NGR234). Hypothetical protein Y4WM
FT                   precursor. Y4WM_RHISN (EMBL:RSAE104) (663) fasta scores:
FT                   E()=2.2e-171 67.833% id in 600 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05674"
FT                   /db_xref="GOA:Q1MMX8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMX8"
FT                   /protein_id="CAK05674.1"
FT                   /translation="MAALWSKIGLFLSLAGALAPMTATAQDQPFLIGSSVISEMKYKPG
FT                   FAHFDYVNPDAPKGGDLRLSASGAFDTFNPLLAKGQAAVGLTLVYDTLMKPADDELLVS
FT                   YGLLAEGLSFPTDVSSATFRLRKEAKWSDGQPVTPEDVIFSLDKTKELNPLTANYYRHV
FT                   AKAEKTGDRDVTFTFDEKNNRELPNILGQLVVVPKHWWEGQGPDGKPRDISKTTLEPVM
FT                   GSGPYKIASFSPGATIRYELRDDYWGKDLNVNVGQNNFRNVIYTYFGDRDVEFEAFRAG
FT                   NSDYWQETTAARWATGYDFPAVKEGRVKKEEVANPLRATGIMQALVPNMRRDLFKDIRV
FT                   REALNYGLDFEELNRTVAFNSYKRIDSYFWNTELASSGLPQGRELEILQGMKDKVPAEI
FT                   FTTPYTNPVAGDPQKSRDNLRKAIALLKEAGWEIKGNRMVNSKTGQPMSFEILLSSPML
FT                   ERWAVPYASNLRKIGIDARVRTVDASQAVNRERSFDYDMIWNVWAETMNPGNEQADYWG
FT                   SGSVNQQGSRNYAGIANPAVDELIRMVIFAPNRDEQIAAIKAMDRVLLANHYVIPLFYR
FT                   DTYNIAYWNTVTHPAEFPAYSLGFPDAWWSTSAK"
FT   CDS_pept        221959..223047
FT                   /transl_table=11
FT                   /locus_tag="RL0186"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05675"
FT                   /db_xref="GOA:Q1MMX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMX7"
FT                   /protein_id="CAK05675.1"
FT                   /translation="MGAYILRRLLLMIPTIVGIMAISFVVIQFAPGGPVEQVIAQLTGQ
FT                   ADSADQRLSGGGDLLGGGGSDEGSKYRGAQGLDPELIAKLEKQFGFDKPPLTRFGEMMW
FT                   NYIRFDFGESFFRNTSVLELIKEKLPVSISLGIWILIFSYAISIPLGIRKAVKDGSTFD
FT                   VWTSGVIVVGYAVPSFLFGILLIVLFAGGSFYDWFPLRGLVSDNFDQLAWWQKPLDYFW
FT                   HLTLPLISLSLSAFATTTLLTKNSFIEEIKKQYVVTARAKGLNERQVLYGHIFRNAMLI
FT                   IIAGFPGAFISAFFTGSLLIENIFSLDGLGRLGYLSVINRDYPIVFATLYIFSLLGLVV
FT                   SLVSDLIYTWIDPRIDFERRDV"
FT   CDS_pept        223047..224195
FT                   /transl_table=11
FT                   /locus_tag="RL0187"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05676"
FT                   /db_xref="GOA:Q1MMX6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMX6"
FT                   /protein_id="CAK05676.1"
FT                   /translation="MDAAANPVITTPVKPPRKGLLSPTNIRRWHNFKANGRGYWSLWLF
FT                   LVLFVLSLFAEFLANDRPIIASYKGEVLFPVLIDYPEEKFGGFLAETDYRSSVIADEIN
FT                   ANGWMIWPPIRYSYRSVNSNIPHSAPTAPFWLMTNEERCAGYPQGVNDPDCTLGNLNWL
FT                   GTDDQARDVLARVIYGFRISVLFGLVLTICSAVIGVTAGAVQGYFGGWTDLLLQRFIEI
FT                   WSSMPVLYILLIIAALLPPGFFVLLGIMLLFSWVGFVGIVRAEFLRARNFEYVRAARAL
FT                   GVNNRTIMWRHLLPNAMVATLTFLPFILSGSITTLTSLDFLGFGMPPGSPSLGEMIAQG
FT                   KTNLQAPWLGLTAFFAMSIMLSLLIFIGEAVRDAFDPRKTFQ"
FT   CDS_pept        224192..225829
FT                   /transl_table=11
FT                   /locus_tag="RL0188"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05677"
FT                   /db_xref="GOA:Q1MMX5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMX5"
FT                   /protein_id="CAK05677.1"
FT                   /translation="MSDMTEPLLSVRDLSVAFHQGGETSLAVDHISFDIAKGEVVALVG
FT                   ESGSGKSVSANSILRLLPYPSASHPSGEILFKGKDLLKASERALREVRGNDITMIFQEP
FT                   MTSLNPLHTIEKQIAEILALHQGLTGQSARQRVLELLNQVGIREPEKRLKAYPHELSGG
FT                   QRQRVMIAMALANRPELLIADEPTTALDVTVQAQILELLRQLKAVHGMSMLFITHDLGI
FT                   VRKFADRVCVMTKGKIVETGTVEEVFANPKHDYTRHLLASEPRGEPPLADPSKPLVMEG
FT                   SDIRVWFPIKSGLMRRVVDHVKAVDGIDLSLRAGQTLGVVGESGSGKTTLGLALTRLIS
FT                   SEGRIAFVGKDIAGYSFNEMRPLRNQLQVVFQDPYGSLSPRMSVGDIVAEGLKVHERSL
FT                   TSEERDQRVCWALEEVGLDPLTRWRYPHEFSGGQRQRIAIARAMVLKPRFVMLDEPTSA
FT                   LDMSVQAQVVDLLRDLQKKHDLAYLFISHDLKVVKALANDVIVMRFGKVVEQGPSADIF
FT                   RAPKDDYTRALMAAAFNIEAVPTPAVQQ"
FT   CDS_pept        225838..226797
FT                   /transl_table=11
FT                   /locus_tag="RL0189"
FT                   /product="putative 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05678"
FT                   /db_xref="GOA:Q1MMX4"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMX4"
FT                   /protein_id="CAK05678.1"
FT                   /translation="MPATPPVLVDIKFNAEGVARVLKTAFADRGSINLADPRNRARDLR
FT                   AVEYALLWKPDADLFARAPNLKVIFSGGAGVDHIIGMDGLPEIPIVRFVDRSLTTRMSE
FT                   WVVMQCLMHLRGQYTHDSHQRQREWAKLIAPEAAEVTVGVMGLGILGQDAVAKLRVMGF
FT                   NVIGWSRSRKQIDGVETFDASELDSFLARTDILVGLLPLTPETSGFYDAGLFAKLRRNG
FT                   ALGQPVFINAGRGKSQVEADIVSAIRDGTLGGASLDVFEAEPLASDHPLWELRNVFITP
FT                   HDAAVSEENALFCHVETQIARFERGEPLQFVVDRAAGY"
FT   CDS_pept        226886..227233
FT                   /transl_table=11
FT                   /locus_tag="RL0190"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05679"
FT                   /db_xref="GOA:Q1MMX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMX3"
FT                   /protein_id="CAK05679.1"
FT                   /translation="MMAHQTDTRWEKSNGKLHKEEQIPPVKARQGRMGYRILTVLIVAL
FT                   VLAFVVWIPVEIWGNREANEVAPQQPGQQLQSQQPAPAPAPALQNGTAVPTETPNTTPA
FT                   APNVAPATPAQ"
FT   CDS_pept        227421..228725
FT                   /transl_table=11
FT                   /locus_tag="RL0191"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /product="nicotinate phosphoribosyltransferase (ec
FT                   2.4.2.11) (naprtase)"
FT                   /EC_number="2.4.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:RL0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05680"
FT                   /db_xref="GOA:Q1MMX2"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMX2"
FT                   /protein_id="CAK05680.1"
FT                   /translation="MARTDIARRVYNHAWKLDPIIRSLIDTDFYKLLMLQMIWKLYPDV
FT                   NASFTLINRTKRVRLAEELDEGELREQLDHARTLRLSKKEMIWLAGNSFYGRAQIFEPE
FT                   FLAWLSNFQLPEYELSKKDGQYVLDFHGSWKETTMWEIPALAIVNELRSRSAMKALGPF
FT                   TLDVLYARAKAKMWSKVERLKELPGLRISDFGTRRRHSFLWQRWCVEALKEGIGPAFAG
FT                   TSNVLLAMDSDLEAVGTNAHELPMVAAALAETDEQLRNAPYKILRDWNKLYGGNLLIVL
FT                   PDAFGTAAFLRDAPEWVADWTGFRPDSAPPIEGGEKIIDWWKKMGRDPRQKLLIFSDGL
FT                   DVDAIIDTYRHFEGRVRMSFGWGTNLTNDFSGCAPIEISGLNPISVVCKVSDANGRPAV
FT                   KLSDNPQKATGEPAEVERYLKFFGAEDRIDQTVLV"
FT   CDS_pept        complement(229362..229760)
FT                   /transl_table=11
FT                   /locus_tag="RL0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="C-terminus from codon 60 is similar to Xanthomonas
FT                   campestris (pv. campestris). Hypothetical protein XCC0125.
FT                   Q8PE56 (EMBL:AE012107) (85) fasta scores: E()=0.093 32.836%
FT                   id in 67 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05681"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMX1"
FT                   /protein_id="CAK05681.1"
FT                   /translation="MCWIRARPNNEMARLPAYPRGRRSDGAARFRRSKIPDFLPCSFTA
FT                   SLHVWVYRLPKSKTEVKQVEELSVKSKIIKTVYFSQEDGRLRICFKNGEERLFEGVPSS
FT                   EAHAMTVAPSPGHYYLDRIRTRFRRLAA"
FT   CDS_pept        complement(229806..230375)
FT                   /transl_table=11
FT                   /locus_tag="RL0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05682"
FT                   /db_xref="GOA:Q1MMX0"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMX0"
FT                   /protein_id="CAK05682.1"
FT                   /translation="MIRGKDMKDIIILPGIGGSGEAHWQTRWERSNPYMRRFQPTNWEK
FT                   PDLADWISALERAVGASTTPPLLVAHSLACLLVAHWQQVSSLAVAGAFLVAVPDPQSAS
FT                   FPKEAAGFADPPSQRMRFPTLIIASGDDPFGTLDHAHARADLWGSGLVAIGPFGHINGQ
FT                   SGLEDWGQGKALLTAFSAGLARSDRA"
FT   CDS_pept        230468..230944
FT                   /transl_table=11
FT                   /locus_tag="RL0194"
FT                   /product="putative AsnC transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05683"
FT                   /db_xref="GOA:Q1MMW9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMW9"
FT                   /protein_id="CAK05683.1"
FT                   /translation="MAFQENNRVQLDPTDIAIIEAMQENGRIAVSELGRRVGLSQPAAS
FT                   ERVKRLEDRGIIVGYAARIDPTALGIGMTAVLRLRTTHEHIKPCLKQFAEMPQVMEVLR
FT                   LTGEDCFLLKVLVPAPGELETIVDTIARFGAVTTSLVLRSENPKPIGRALLQRP"
FT   CDS_pept        231363..231680
FT                   /transl_table=11
FT                   /locus_tag="RL0195"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05684"
FT                   /db_xref="GOA:Q1MMW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMW8"
FT                   /protein_id="CAK05684.1"
FT                   /translation="MRFLLRLASLVALAAAVIAGTIDSIQSVAASSVVMTPISDAWQDV
FT                   SPTTLTSLQSSLSYYIHPRFYALIFQWLMLQPAFAVFLVIALLLWMIGYKKPSVAGRFT
FT                   A"
FT   CDS_pept        231998..232990
FT                   /transl_table=11
FT                   /locus_tag="RL0196"
FT                   /product="putative outer membrane basic lipo-protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05685"
FT                   /db_xref="GOA:Q1MMW7"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMW7"
FT                   /protein_id="CAK05685.1"
FT                   /translation="MKKSLLTLFAVAAMSTTALAADVKPALVYGTGGKFDKSFNEAAYN
FT                   GAEKFKAETGIAYRDFEPTGDTQGEQAIRNFASRGFNPVVAVSFAWTSAIEKVAAEFPD
FT                   TKFIIVDSVVDKPNVRSVVYKEEEGSYLVGVLAGMASKTGKVGFVGGMDIPLIRKFECG
FT                   YEQGARSVKADIEVFQNMTGTTGAAWNDPVRGGELTKNQIDQGADVVYAAAGATGLGVL
FT                   QTAADNKKLSIGVDSNQNHLHPGSVLTSMVKRVDLAVYNAYNDTKNDKFTAGVQALGVK
FT                   EDGVGAAIDDNNKSLITPEMQAAVDKAKADIIAGTIKVHDYTSDNACPK"
FT   CDS_pept        233067..234590
FT                   /transl_table=11
FT                   /locus_tag="RL0197"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /note="Similar to Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970). ABC transporter, nucleotide binding/ATPase
FT                   protein. Q8UJ14 (EMBL:C97374) (501) fasta scores:
FT                   E()=2.7e-149 87.976% id in 499 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05686"
FT                   /db_xref="GOA:Q1MMW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMW6"
FT                   /protein_id="CAK05686.1"
FT                   /translation="MEPAVTDKPAIELVGIDKKFGAVHANKDINLTVAKGTIHGIIGEN
FT                   GAGKSTLMSIIYGFYHADSGEIRVNGNPVTIRDSQAAIATGIGMVHQHFMLVDNFTVLE
FT                   NIMLGAEGGMLLARGVASARAELKRLETEYGLEVDPDALIEELPVGLQQRVEILKAMYR
FT                   GAEILILDEPTGVLTPAEADHLFRILKVLRDQGKTIILITHKLREIMAITDTVSVMRRG
FT                   EMVATRKTAETTVEELAELMVGRRVLLRVQKGEANPGSAVLSVRNLTVKDNRGVTMVDN
FT                   VSFDVRAGEIVGIAGVAGNGQSELLEAIAGIRKPTSGEILLDGQTIDKADPARLRDLGL
FT                   AHIPEDRHHMGLVLKFEEYENSVLGYHRRPAYSKGPLLDLEAIRKDAMEKIEKYDIRPP
FT                   NPRLKTANFSGGNQQKIVVAREIERDLKMLIIGQPTRGVDIGAIEFIHRRIIEMRDAGK
FT                   AILLVSVELDEIRSLSDRILVMFAGHVVGEKTPDAGEQTLGLMMAGIAA"
FT   CDS_pept        234598..235701
FT                   /transl_table=11
FT                   /locus_tag="RL0198"
FT                   /product="putative transmembrane permease component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05687"
FT                   /db_xref="GOA:Q1MMW5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMW5"
FT                   /protein_id="CAK05687.1"
FT                   /translation="MSTASVPLPNWINYGLIPILNLIVAFLISGFVVWLIGESPLDALS
FT                   LLIEGALGNGEFIGFTLFYATSFIFTGLSVAVAIHAGLFNIGSEGQAYMGGLGCALVAL
FT                   SLDNYVPWYVTMPVAVVGAALFGAVAAFIPAWLQAKRGSHIVITTIMFNYIIASLMNYL
FT                   LVHVLIVPGKMAPETRTFLEGGQLPKLTWLMEIFGTKLGAAPLNVSFIIALVMCYVVWL
FT                   LIWRTKLGFEMRTLGVSPTAASYAGIPYVRIVMIAMMLSGALAGMMALNPVMGASARLQ
FT                   VGFVGGAGFVGIAVSLMGRNHPLGIILAAFLFGILYQGGDWISFEMPNITREMILVIQG
FT                   LVILFAGALEYMFRPAMVRLYQQFKRG"
FT   CDS_pept        235712..236683
FT                   /transl_table=11
FT                   /locus_tag="RL0199"
FT                   /product="putative transmembrane permease component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05688"
FT                   /db_xref="GOA:Q1MMW4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMW4"
FT                   /protein_id="CAK05688.1"
FT                   /translation="MDYYDIFISVLASTIRLSIPLIFTALAGLFSERAGIFDIGLEGKM
FT                   LGSAFAAACVAYLTDSAWLGLGAGILCSVALSLVHGFASITNRGNQIVSGVAINFFIAG
FT                   ITIVLGQAWFGQGGRTPQLAPDSRFAPIILPGADVARDIPIIGPLYANVISGNNILTYL
FT                   AFLAVPFSWWVLYRTRFGLRLRAVGENPGAVDTAGISVAWLRYRAVMCAGILCGFAGTY
FT                   LAIAQSAAFIKDMSAGKGYIALAALVFAKWKPVPVMFACLLFGFLDALANFMQGKQVPL
FT                   IGEVPVQVFQALPYVLTCVLLAGFIGVATPPKAGGVPYTKER"
FT   CDS_pept        236685..237074
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /locus_tag="RL0200"
FT                   /product="putative cytidine deaminase (cytidine
FT                   aminohydrolase)"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:RL0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05689"
FT                   /db_xref="GOA:Q1MMW3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMW3"
FT                   /protein_id="CAK05689.1"
FT                   /translation="MSHDLFEAARGAMAFAHAPYSKFPVGAAIRAEDGKVYTGANIENL
FT                   SFPQGWCAEPTAIGAMIMGGAKKIVEMAVIAEKLPLCPPCGGCRQKISEFASKETKIYL
FT                   CDEAGVKKTMTMEELLPFSFETELG"
FT   CDS_pept        237071..237871
FT                   /transl_table=11
FT                   /gene="punA"
FT                   /locus_tag="RL0201"
FT                   /product="putative purine nucleoside phosphorylase"
FT                   /product="purine nucleoside phosphorylase i (ec 2.4.2.1)
FT                   (pnp i) (pu-npase i) (inosine phosphorylase)"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RL0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05690"
FT                   /db_xref="GOA:Q1MMW2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMW2"
FT                   /protein_id="CAK05690.1"
FT                   /translation="MKATVSLLAALLGGIKPRHGIVLGSGLGSLVGELDGAVRVPYRDL
FT                   PGFPVSAVSGHAGEVVAGRLGGVPVVMLSGRVHYYEKGDANAMRLPIEVLKALGVEALI
FT                   LTNSAGSLRDDMPPGSVMQITDHINYSGMNPLIGEESDHRFVGMTNAYDAGLAAAMQRA
FT                   AAKLEIELAQGVYMWFSGPSFETPAEIRMARILGADAVGMSTVPEVIISRMLGLRVAAA
FT                   SVITNYGAGMTGNELSHEETKDMAPIGGARLAAILKDMIAAGRG"
FT   CDS_pept        237987..238763
FT                   /transl_table=11
FT                   /gene="deoC1"
FT                   /locus_tag="RL0202"
FT                   /product="putative deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RL0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05691"
FT                   /db_xref="GOA:Q1MMW1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMW1"
FT                   /protein_id="CAK05691.1"
FT                   /translation="MNSHSNRETAAVALSLLDLTNLRDDCTEAQIDALCARAQTPYGTS
FT                   AAICIWPRFVAQARNILGTGHAVRIATVVNLPSGDMEVADVAAEAREAIADGADEIDLV
FT                   IPYRKLLAGNEKAVTDMVKAVRAECAGPVLLKVIIETGELKDAALIRHASELAIEAGAD
FT                   FIKTSTGKVAVNATLEAADIMIRAIRESGRKVGFKPAGGIGSVADAALYLSLAETIMTP
FT                   DWAMPSTFRFGASDLLDDILSVLSGTQSASAAASGY"
FT   CDS_pept        238765..240072
FT                   /transl_table=11
FT                   /gene="deoA"
FT                   /locus_tag="RL0203"
FT                   /product="putative thymidine phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RL0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05692"
FT                   /db_xref="GOA:Q1MMW0"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMW0"
FT                   /protein_id="CAK05692.1"
FT                   /translation="MIPQEIIRRKRDGDELDAAEISSFIAALAAGQLSEGQIGAFAMAV
FT                   WFKGMSRTETVALTLAMADSGDRLQWADVDRPIADKHSTGGVGDNVSLMLAPIAAACGL
FT                   AVPMISGRGLGHTGGTLDKLESIPGYMITPDADLFHKVVKEAGCAIIGQTGTLAPADGR
FT                   LYAVRDVTATVDSIPLITASILSKKLAAGLETLVLDVKVGNGAFMVDRGQAETLAQSLV
FT                   EVANGAGVKTSALITDMNQPLADSAGNAVEMRNCLDFLAGRKADTRLETVVLAFAAEML
FT                   VKSGIAASSDEAEGMARRALSSGKAAEVFARMVSMLGGPADLIENPDRYLARAPVAKPV
FT                   PAARSGWLAACDARGIGVSVIDLGGGRRHPADRIDHRVGFSELLPLGTRVNAGEPIALV
FT                   HAADDAAAERAVAALAAHYRITEEKPELTPVIAGLI"
FT   CDS_pept        complement(240079..240612)
FT                   /transl_table=11
FT                   /locus_tag="RL0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05693"
FT                   /db_xref="GOA:Q1MMV9"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMV9"
FT                   /protein_id="CAK05693.1"
FT                   /translation="MLVRTVLFASIAAVLATQVPSFFGGTSQQPAETLSANYVSAQTEQ
FT                   PVAPEPVYGSNAIRLQADAQGHYTGSFKINGKPVQGLIDTGATYVALNETLARRLGFTA
FT                   NQLDFRYGVNTANGQTKAAHVTLDRVEIGGIRVREVEAFVLKDDALTTTLVGMSFLQKL
FT                   ASYSVADGSLSLKQ"
FT   CDS_pept        complement(240774..241403)
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="RL0205"
FT                   /product="putative uracil phosphoribosyltransferase (UMP
FT                   pyrophosphorylase)"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:RL0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05694"
FT                   /db_xref="GOA:Q1MMV8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMV8"
FT                   /protein_id="CAK05694.1"
FT                   /translation="MDGVTVIDHPLVQHKLTIMRRKETSTGSFRRLLREISTLLCYEVT
FT                   RDLELTMETIETPLQTMESPILEGKKLVFASILRAGNGLLEGMLDLVPSARVSHIGVYR
FT                   DHETLQPVEYYFKAPEDVAERLIIVVDPMLATGNSSIAAIDKLKERGAHNIRFLCLLAA
FT                   PEGIRNFRAAHPDVPVFTASIDSHLNEKGYIMPGLGDAGDRMYGTK"
FT   CDS_pept        complement(241550..242518)
FT                   /transl_table=11
FT                   /locus_tag="RL0206"
FT                   /product="putative adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:RL0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05695"
FT                   /db_xref="GOA:Q1MMV7"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMV7"
FT                   /protein_id="CAK05695.1"
FT                   /translation="MTSHLKKVELHCHLEGAAPPALTAAQARKYGVDISAELRDGAYVW
FT                   HDFASFLVCYDKVSEVYRTEEDYALLTETYLDELAGIDTIYSELIVSPDHGKRIGLGAD
FT                   AYISGICEGIRRAREKSGIEARLIVTGERHFGPESVIGAAEYAARAANPLITGFNLAGE
FT                   ERMGRVADYARAFDIARDAGLGLTIHAGEVCGAFSVADALDAVRPSRIGHGVRAIEDLD
FT                   LVTRLADLGTVLEICPGSNIALGVFPDFASHPLRRLKDAGVRVTISSDDPPFFHTSLKR
FT                   EYELAAGTFGFGDAEIDAMTRTAIEAAFVDDETRKALLARI"
FT   CDS_pept        complement(242515..243735)
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="RL0207"
FT                   /product="putative phosphopentomutase
FT                   (phosphodeoxyribomutase)"
FT                   /EC_number="5.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:RL0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05696"
FT                   /db_xref="GOA:Q1MMV6"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMV6"
FT                   /protein_id="CAK05696.1"
FT                   /translation="MARAFLFVLDSFGVGGAPDAAAYGDEGADTLGHIAEFCAAGAADR
FT                   AGLREGPLSLPNMSELGLMQIARSASGRFPAGMPVPEKVYGIYGAATEISRGKDTPSGH
FT                   WEIAGTPVSFDWGYFPIEGDAFPQEFIEALCREADVPGILGNCHASGTEIIARLGEEHI
FT                   RTGKPICYTSSDSVFQVAAHEVHFGLDRLLAFCGLARGLLDSYNIGRVIARPFIGQSAS
FT                   TFQRTGNRRDFSVLPPEPTLLDRLIEQGRHVHAVGKIGDIFAHQGISRVIKANGNEALM
FT                   DASLSAIDAAEDGDLVFTNFVDFDMIYGHRRDVPGYAAALEAFDARLPDVHKKLKPGDL
FT                   VVLTADHGCDPTWRGTDHTRERVPVIAYGPGIRSRSIGVRRGYADIGESIARHLGIPAG
FT                   PHGRSFL"
FT   CDS_pept        complement(243895..244476)
FT                   /transl_table=11
FT                   /locus_tag="RL0208"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05697"
FT                   /db_xref="GOA:Q1MMV5"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMV5"
FT                   /protein_id="CAK05697.1"
FT                   /translation="MALRNPFTRLVLTMRRLARDRKGAGAIEFAILFPVLVMLYIGAFE
FT                   ITVGLSVSKRVTRAAGTVADLVTQQQSVTKSALAQMPSVATAIFVPYNSTSLTLKITGI
FT                   TIDAGANAKVLWSWAKDGTVPYAKNTAVTNVPADMKTANSFLVRTELSIPYTMFLFAPN
FT                   FMPDGMRTITISRSYFYRQRQGDSIPCGDC"
FT   CDS_pept        complement(244476..245111)
FT                   /transl_table=11
FT                   /locus_tag="RL0209"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05698"
FT                   /db_xref="GOA:Q1MMV4"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMV4"
FT                   /protein_id="CAK05698.1"
FT                   /translation="MTVIDQKTDKGRAFAPFRFLRFRTLARSREGAAAIEFALLAIPYF
FT                   LVIFAILETFVAFAAEELVSNAVDTMSRRMRTGQITYNLGRTTDMNQAQFRQAFCDEIS
FT                   ILIRCSASEVATPSKLYLDVQTFSTFSAIPTTIPKVSTDKYADINTAAFKFAPGGAGTI
FT                   NMVRAYYRWEIITDLVRPYITTIRPSDGSMPSQYLIVATAAFQNEQYP"
FT   CDS_pept        complement(245227..245637)
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="RL0210"
FT                   /product="putative pilus subunit transmembrane protein"
FT                   /note="putative alternative start site at codon 13"
FT                   /db_xref="EnsemblGenomes-Gn:RL0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05699"
FT                   /db_xref="GOA:Q1MMV3"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMV3"
FT                   /protein_id="CAK05699.1"
FT                   /translation="MSSSGKTIFFAGMIAVFGISGVSAAADDDMLRVYMDHARVLKLDR
FT                   PVSKVIVGNAAVADATVADAKTIVLTGRSFGTTNLVLLDADGNAILDERILVSIDEGNT
FT                   VRVYRQTQRSVLSCTPNCEQHAQQAATATSSP"
FT   CDS_pept        246017..246202
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="RL0211"
FT                   /product="putative pilus subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05700"
FT                   /db_xref="GOA:Q1MMV2"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMV2"
FT                   /protein_id="CAK05700.1"
FT                   /translation="MTKLFSRFLKDESGATAIEYGLIAALISVALITGATTLGDRIGTT
FT                   FNNLGTKMNTGVTASN"
FT   CDS_pept        246327..246839
FT                   /transl_table=11
FT                   /gene="cpaA"
FT                   /locus_tag="RL0212"
FT                   /product="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05701"
FT                   /db_xref="GOA:Q1MMV1"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMV1"
FT                   /protein_id="CAK05701.1"
FT                   /translation="MIAAAVFVILPLCLAMAAFSDLFTMTIPNRISVILTASFFVLAPL
FT                   SGLGLAEIGMHLAGAAIVFSACFALFAFNVMGGGDAKLMSAAALWFGLNESLLFLMTDV
FT                   AMIGGLITLLILLVRGQSDTILAIGLPVPNSVLLAKKIPYGIAIAIGGFMAFPSSPLFL
FT                   AALESLK"
FT   CDS_pept        246950..247765
FT                   /transl_table=11
FT                   /gene="cpaB"
FT                   /locus_tag="RL0213"
FT                   /product="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05702"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMV0"
FT                   /protein_id="CAK05702.1"
FT                   /translation="MKPARLIILAVAVVAAGLAGLLAMQMAGSGGVVTQVRSVVEKEPT
FT                   VNILVSSANLSVGARLDDQSVHWMAWPQGGVVPGLITEADKPDAVKDLQGAVVRLPIFE
FT                   GEPIRPEKIADSSSRILSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKGAEA
FT                   DKLITETVLSNVRVLAIDQQIQEKDDGSKSVVGTTATLELTPDQTKVLAVAQQMADRLS
FT                   LALRSVADAQEQDTSAADYLLSGDNGSAIIQVIKSGAIVTDASAAPKAE"
FT   CDS_pept        247771..249276
FT                   /transl_table=11
FT                   /gene="rcpA"
FT                   /locus_tag="RL0214"
FT                   /product="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05703"
FT                   /db_xref="GOA:Q1MMU9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMU9"
FT                   /protein_id="CAK05703.1"
FT                   /translation="MQMGNSMRRAGPLVTGCLSLAIGVSGMVPASFATLFAAGEARADS
FT                   DSLVRISQTGSNAHRRLKLGLNKAVVVDLPEDAHDILVSDPTMADAVTRTSRRIYLFGK
FT                   KVGQTNIFVFGAGGQEIVNLDIEIERDVSGLEVNLRRFIRDSNINVEIVSDNIVLTGTV
FT                   RTPQDATQAADLAQVFLKGGEATTRTETASGTGGDSSVALFAEGRQSSQVVNLLQIEGE
FT                   DQVTLKVTIAEVRREVLKQLGFDNLVSNSSGMTVAQLGSPSADSATATVGGGLAALFKS
FT                   SIGKYDISTYLNALEQAKVVKTLAEPTLTAISGQAATFNSGGQQLYSTTDSDGNVTVVP
FT                   FNYGINLAFKPVVLSSGRISLQIKTNVSEPVAGSGNATYQRRSAETSVELPSGGSIALA
FT                   GLIRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQETELVIIATPYLVRPVARNQLNRP
FT                   DDNFSPENDGATFFLNRVNKVYGRREAPVADAQFHGSIGFIYK"
FT   CDS_pept        249273..250025
FT                   /transl_table=11
FT                   /gene="cpaD"
FT                   /locus_tag="RL0215"
FT                   /product="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05704"
FT                   /db_xref="InterPro:IPR013361"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMU8"
FT                   /protein_id="CAK05704.1"
FT                   /translation="MSGARAAAMAENRDQAMAHMNATTPRLGISKALFATVAMSVAILS
FT                   GCAGPHDQLTTGGIPDDYRARHPIIVTEAEQTVDIPVASTDRRLTIAQRDLIRGFAANY
FT                   ISRASGPVYVLSPQGSPNSAAAYQLRNQVRAELTSRGIASSKIVNTSYAAVGPGDAAPI
FT                   RLSFTGTTAVTTQCGQWPKDISNDLTNQNYYNFGCASQNNLAAQIANPEDLVAPRGMTP
FT                   IDAQRRNNAIQEYRTTTTTIEDAGDSGF"
FT   CDS_pept        250040..251317
FT                   /transl_table=11
FT                   /gene="cpaE"
FT                   /locus_tag="RL0216"
FT                   /product="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05705"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMU7"
FT                   /protein_id="CAK05705.1"
FT                   /translation="MSAIEYEIRNPSELRNAEEAVRMADLENMRPLPRISVHAFCESEA
FT                   LQHVMERCANDRRVAKVSMRITSGGVAAAANMFSGAPTPNLIILETKANAANLLGELAP
FT                   LAAVCDPTTKVVIIGYYNDIGLYRELIRNGISEYMVQPVAMPDILTAMASIFVDPDAEP
FT                   LGRSIAFIGSKGGTGASTIAHNCAFGISNLFSTETILADLDLPYGTANIDFDQDPAQGI
FT                   AEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDFDGQAFQPVLDVLQRSAPV
FT                   TVLDVPHAWSEWTRSVLSSVDEVVIAAVPDLANLRNAKNMLDALRKMRPNDRPPHLILN
FT                   QVGMPKRPEISPSDFCEPLEIDPIAIIPFDINLFGNAANSGRMISEVDPKSPTAETFSQ
FT                   ISHIVTGRVAIKKAKKGGLLGLLKRK"
FT   CDS_pept        251351..252826
FT                   /transl_table=11
FT                   /gene="cpaF"
FT                   /locus_tag="RL0217"
FT                   /product="putative component of pilus"
FT                   /db_xref="EnsemblGenomes-Gn:RL0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05706"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMU6"
FT                   /protein_id="CAK05706.1"
FT                   /translation="MFGKRGNEGSGKVGGAIAPPPPAPAAAPAASSPSILVEPSRESAR
FT                   QQVTPPQMQTPQRKRPARTDEYYDTKAQVFSALIDTIDLSQLSKLDGESAREEIRDIVN
FT                   DIITIKNFAMSISEQEELLEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGGK
FT                   TIESEIRFRDNAQLLSICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGPA
FT                   LTIRKFKKDKLTLDQLVRFGAITPEGATVLQIIGRVRCNVVISGGTGSGKTTLLNCLTN
FT                   YIDRDERVITCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIV
FT                   GEVRGPEVFDLLQAMNTGHDGSMGTIHANTPRECLSRIESMIAMGGFTLPAKTVREIIS
FT                   SSVDVVIQAARLRDGSRRITQITEVIGMEGDVIITQDLMRYEIEGEDANGRLVGRHMST
FT                   GVGKPHFWDRARYFNEEKRLAAALDAMEAKTKE"
FT   CDS_pept        252832..253839
FT                   /transl_table=11
FT                   /locus_tag="RL0218"
FT                   /product="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05707"
FT                   /db_xref="GOA:Q1MMU5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMU5"
FT                   /protein_id="CAK05707.1"
FT                   /translation="MFGFDPIVLAIVVLAAVSAAAVAYALLFSKIEADKKSASRINRVK
FT                   SAESDRVKVKAARDRVQELSKRRKSVQDNLKDLEKRQHEKTKKTVSMKSRLVQAGLTIT
FT                   AAKFYLISAVFASVLLLIALVVGASLMVMIGIAVVAGLGLPRWVVGFLIKRRQTKFLNE
FT                   FPNALDVITRSIKSGLPLNDAIRLIATEGTEPVKSEFLRVIEAQQVGLSIPDACARMTI
FT                   HMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSALSMEAKASAVII
FT                   GALPFIVATLVYMTSPNYMMILFTDPRGHFIMGVSAIWMSIGIFVMRNMVNFDI"
FT   CDS_pept        253855..254841
FT                   /transl_table=11
FT                   /gene="tadC"
FT                   /locus_tag="RL0219"
FT                   /product="putative component of pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05708"
FT                   /db_xref="GOA:Q1MMU4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMU4"
FT                   /protein_id="CAK05708.1"
FT                   /translation="MSQDLAATLTNPSMLIALLVAIAVFATFYTIAVPFFERGDLNKRM
FT                   KAVSTEREQIRARERARMNTETGAGKASLRSQNNRSVRQIVERFNLRKALVDENTINKL
FT                   RAAGFRSENALNTFLVARFLLPFLFLALAAFWVFGLGNLAEKGTPIRLFAVIGVGYLGF
FT                   YAPNIYISNRMGKRQHSIKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSPALAE
FT                   EMVLTTAELSFLPDRRVALENLATRTQIELVRSVTQALIQADRYGTPVAQALRVLAQEG
FT                   RDERMNEAEKKAAALPPKLTVPMILFFLPVLIAVILGPAGIQVADKF"
FT   CDS_pept        255044..255676
FT                   /transl_table=11
FT                   /locus_tag="RL0220"
FT                   /product="putative transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05709"
FT                   /db_xref="GOA:Q1MMU3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMU3"
FT                   /protein_id="CAK05709.1"
FT                   /translation="MSSAGIFISIMAALAVGAMSPGPSFVVVSRIAISRSRLDGLAAAL
FT                   GMGAGGVVFAVLALAGLTALLSQFEWLYVLLKVAGGAYLVYIAVNIWRSAGQPLEVSDA
FT                   VNGNRALRLSFMTALLTQLSNPKTIIVYASLFAALLPRTVPLDLIVALPLGVFAVEAGW
FT                   YSIVAFALSARHPRRLYLAAKGWIDRAAGAVMGGLGLRLILSGLSAR"
FT   CDS_pept        complement(255786..256619)
FT                   /transl_table=11
FT                   /locus_tag="RL0221"
FT                   /product="conserved hypothetical protein"
FT                   /product="hypothetical protein atu0215 (agr_c_369p)"
FT                   /db_xref="EnsemblGenomes-Gn:RL0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05710"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014596"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMU2"
FT                   /protein_id="CAK05710.1"
FT                   /translation="MPASLTTTITNRILQGAAASLLVLALAGCSTTKDRMTTGSVPKLT
FT                   KPVEEMDATELRSATDRLGQAYEKNPRDPVTGVNYANLLRMNGRDTQALAVMQQVAIAN
FT                   PGDRNVLAAYGKAQAAAGQFQQALDTIGRAQTPDRPDWKLISAQGAILDQMGRASDARQ
FT                   RYRDALDIQPNEPSILSNLGMSYVLTGDLRTAETYLRSAASQPTADSRVRQNLALVVGL
FT                   QGRFPEAEQIARRELSPQQADANVAYLRGMLSQQNSWQKLAAKDKTPQAGDSNTN"
FT   CDS_pept        256764..258155
FT                   /transl_table=11
FT                   /locus_tag="RL0222"
FT                   /product="putative peptidase"
FT                   /note="Codons 120 to the C-terminus are similar to codons
FT                   80 to the C-terminus of Salmonella typhimurium. PepB
FT                   PEPB_SALTY (EMBL:AE008815) ( Peptidase B (EC 3.4.11.23)
FT                   (Aminopeptidase B).) fasta scores: ungapped id 42.208%
FT                   3.4.11.23 id in E(), and to Rhizobium meliloti
FT                   (Sinorhizobium meliloti). PUTATIVE AMINOPEPTIDASE PROTEIN
FT                   (EC 3.4.-.-). Q92T36 (EMBL:SME591782) (EC ( 463) fasta
FT                   scores: E()=2.1e-157 83.624% id in 458 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05711"
FT                   /db_xref="GOA:Q1MMU1"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMU1"
FT                   /protein_id="CAK05711.1"
FT                   /translation="MAPYQFIERPTPFNTKGGSTLPIFAVTPAHIETGTIDPIALDWAR
FT                   RAGYKAESGSLLLIPTAEGHLGGALYGLGTNPSEQPYITGRLARALPAGDWHIETAPLT
FT                   ANRLALGFGLGSYRFDRYKSEKSPAATLMIPRDADAADIKRQLAGVFLARDLINTPTND
FT                   MGPNQLEAVFRGLAAHYKAEMSVISGDDLLTQNFPLVHTVGRASADAPRLLELRWGKKG
FT                   HRKVTLVGKGVCFDTGGLDIKPAASMLLMKKDMGGAANVMGLALMIMDAKLKVDLRVIV
FT                   PVVENAISSNAFRPGDIYRSRKGLTVQIDNTDAEGRLILADALAYADEEEPELLIDMAT
FT                   LTGAARVALGPDLPPFFTDDANLAHDLTEASLETDDPIWRLPLYSGYEKDIRTKFADLT
FT                   NAPAGGMAGAITAALFLKRFVSKAKSWAHFDIYGWAQSERPHSPGGGEAQAIRALFHHI
FT                   RESLR"
FT   CDS_pept        258334..258684
FT                   /transl_table=11
FT                   /locus_tag="RL0223"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05712"
FT                   /db_xref="GOA:Q1MMU0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMU0"
FT                   /protein_id="CAK05712.1"
FT                   /translation="MPIELTASQALGLWHGVALDQVRHDDRDLTLRQMAILLHIYLVPP
FT                   PHTVRGLAATLEVTKPVITRALDTMGEMGLVDRVRDDADRRNVIIKRTVGGALYLENLG
FT                   DLIRDQARRLPI"
FT   CDS_pept        258696..259553
FT                   /transl_table=11
FT                   /locus_tag="RL0224"
FT                   /product="putative dipeptidyl-peptidase"
FT                   /note="Similar, but extended at the N-terminus to Bacillus
FT                   sphaericus. Dipeptidyl-peptidase VI (EC 3.4.22.-) (DPP VI)
FT                   (Gamma-D-glutamyl-L- diamino acid endopeptidase II)
FT                   (Gamma-D-glutamyl-MESO-diaminopimelate peptidase II)
FT                   (Endopeptidase II). DPP6_BACSH (EMBL:BSEPEPII) (EC 3.4 (
FT                   271) fasta scores: E()=3.1e-06 26.667% id in 270 aa, and
FT                   similar to entire protein of Rhizobium meliloti
FT                   (Sinorhizobium meliloti). Hypothetical protein SMc02827.
FT                   Q92KU2 (EMBL:SME591782) (284) fasta scores: E()=1.2e-68
FT                   64.539% id in 282 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05713"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMT9"
FT                   /protein_id="CAK05713.1"
FT                   /translation="MTMLDCRLHAYRSDLAEAGLEGKVEAPRFTEGTPARVAVPVVALR
FT                   PEPDLARGIDTELLLGEDVTVFDRADGWCWVKAASDGYVGYVKADALLEGRPAATHIVT
FT                   VQRTFLYPEPELRKPHQAILSMGSRIHVAGETEARGNRYVVLEDGTAIFAKHVQPIGAL
FT                   DGADYVEIVARFLETPYLWGGRSGLGIDCSGLVQLAMLMTGRAAPRDTDMQAAGLGQPI
FT                   DRSELRRGDLVFWKGHVAVFEDPETILHANGHSMTVARENFAAAVERIGWLYEQPTGYR
FT                   RPIS"
FT   CDS_pept        complement(259554..260945)
FT                   /transl_table=11
FT                   /locus_tag="RL0225"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05714"
FT                   /db_xref="GOA:Q1MMT8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMT8"
FT                   /protein_id="CAK05714.1"
FT                   /translation="MTETDLTIHELRQRFADKSLSPLEYWLALEDHIAAWEPSISALYL
FT                   YDPESARAQAKASTERWAKAETLGPLDGIPVTLKELIATKGQPVPSGTRAVELKPADAD
FT                   APAAARLREDGAVIFAKTTCPDYGMLSSGLSSFHPLSRNPWDITQNPGGSSAGASAAAA
FT                   AGYGPLHIGTDIGGSVRLPAGWTGIFGFKPSHGRIPADPYYVGRCVGPMARTVEDAAFS
FT                   MATLSRPDWRDGTSLPPNDFNWMDLDIDLSGMKIGLMLDAGCGLAVDDEIRTAVETAAK
FT                   QFEAAGATILSVQPVLTRAMLDGLDNFWRSRLWGDIADLDEERRDSILPYIRDWAMGGA
FT                   DISGVDAVRGFNQTIEMRKSCGRLFTEVDALLSPTNPIISYPAEWASPTNDPALPFEHI
FT                   GFTVPWNMSEQPAASINCGFSRSGMPIGLQIVGPRFDDMRVLRLSKAFEDWMGGVRSWP
FT                   QPPIG"
FT   CDS_pept        complement(260982..261845)
FT                   /transl_table=11
FT                   /locus_tag="RL0226"
FT                   /product="putative transmembrane permease component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05715"
FT                   /db_xref="GOA:Q1MMT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMT7"
FT                   /protein_id="CAK05715.1"
FT                   /translation="MVPIASTAIAGRRRVFRLSRRMNLIAGAVIIGLLVAVALLSLVWT
FT                   PLPPAKMQIIHKLQPPLAFGLLGTDQFGHDVLSMLMAGCWNSLSIAITAVTIGGTLGSI
FT                   AGISAAAIRGPFEALLMRICDVIFALPPILSAMVLGAFLGPGRFTAITAIAVFMIPVFA
FT                   RVTLATSLQAWSRDYVTAARAIGNTRLTISLRHVLPNIISQIIVHGAIQLGLAILTEAG
FT                   LSFLGLGMAPPAPTWGRMLADAQTYLALAPWLAILPGLAIALTVFGFNMLGDGLRDLLD
FT                   PREASR"
FT   CDS_pept        complement(261849..262796)
FT                   /transl_table=11
FT                   /locus_tag="RL0227"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05716"
FT                   /db_xref="GOA:Q1MMT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMT6"
FT                   /protein_id="CAK05716.1"
FT                   /translation="MIPLLARRFVGLIVTLVVVSLLIFAVMDLLPGDPASIMLGTSATP
FT                   ETLAALRHSLGLDQPLLLRYGQWLAGVLSGDLGNSLTYGVPVAGLIVERLAVTLPLALM
FT                   AIVLSVAIALPLGVLAASRRGGIFDVIATLFSQISIAVPAFWVALLLIILFSTMLGLMP
FT                   AGGFPGWSAGLTPALQALVMPAVALAMPQAGVLTRVARSAVLDTMHEDFARTAVAKGLS
FT                   RSAVLWRHIVPNALIPILTMIGLQFTFLVAGAVLVENVFNLPGLGRLALQALSQRDIIV
FT                   MQDVVLFFAGLVIVMNFIVDLSYMAIDPRMRKAA"
FT   CDS_pept        complement(262908..264437)
FT                   /transl_table=11
FT                   /locus_tag="RL0228"
FT                   /product="putative solute-binding component of ABC
FT                   transporter"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Agrobacterium tumefaciens (strain C58/ATCC 33970). ABC
FT                   transporter, substrate binding protein (AGR_L_861p). Q8U7L1
FT                   (EMBL:HS184254) (540) fasta scores: E()=4.5e-149 74.168% id
FT                   in 511 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05717"
FT                   /db_xref="GOA:Q1MMT5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMT5"
FT                   /protein_id="CAK05717.1"
FT                   /translation="MIKLSFAPSARLARRLSLSAALSAGLVMTAMTPAEAAKTTLNLGM
FT                   SVEPTGLDPTIAAPVAIGQVIWQNVFEGLVTIDQAGKIQPQLAKSWEISPDGLTYTFKL
FT                   QTGVKFHDGEAFDAASAKFSLDRARGADSVNPQKRFFASIASIDTPDAETLVLHLSAPT
FT                   GSLIYWLGWPASVMVAPKTAADDKTTPVGTGPFKFASWAKGDKVELARNADYWNKDAAA
FT                   KLDKVTFRFIADPQAQAAALKSGDLDAFPEFAAPELMSSFDGDARLVTRIGNTELKVVA
FT                   GMNTAKKPFDDKRVRQALMMAIDRKTVIDGAWSGLGTPIGSHYTPNDPGYQDMTGVLPY
FT                   DVEKAKALLAEAGYPNGFTFTIKSPQMAYAPRSAQVMQAMFAEIGVTMNIEPTEFPAKW
FT                   VQDIMKDRNFDMTIVAHAEPLDIDIYARDPYYFNYKNPAFNALMKKVQETADPAAQSAI
FT                   YGEAQKILAEDVPALYLFVMPKLGVWDKKLKGLWENEPIPSNVLSGVSWDE"
FT   CDS_pept        complement(264588..265508)
FT                   /transl_table=11
FT                   /locus_tag="RL0229"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /note="Similar to Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970). Transcriptional regulator, LysR family.
FT                   Q8U7L2 (EMBL:AE009372) (332) fasta scores: E()=8.1e-79
FT                   75.168% id in 298 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05718"
FT                   /db_xref="GOA:Q1MMT4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMT4"
FT                   /protein_id="CAK05718.1"
FT                   /translation="MQIRALMYFDELVRTNSMRQAAENLNVAPTAISRQIENLEYHFGA
FT                   PLVERSARGVKLTAAGELLAARAGRTLRELDHVQQLIEDLKGLQRGRVSIYANGATVAN
FT                   LLAPALAEFSLKYPKLRFTVTITSARQAIDAVNSAEADIAVTLFAPPMSGTKVRLRSEI
FT                   GYDLIATPQHPAAAHAEIPLRMLADYALALPDQSFGFRQAFDALFEKEGLSLDPVFVTS
FT                   SLEMLKELVLSGAAVTLLPALTVRREIEAGQLLAIPLAGKTGIRTHVDLCVAPDRQLSF
FT                   AATKLLDFIERFMRERTNRRAETKD"
FT   CDS_pept        complement(265565..266560)
FT                   /transl_table=11
FT                   /locus_tag="RL0230"
FT                   /product="putative peptidase"
FT                   /product="endo-type 6-aminohexanoate oligomer hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05719"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMT3"
FT                   /protein_id="CAK05719.1"
FT                   /translation="MPDLLNLITDIEGVSVGHATDLVLGSGVTVIVFDEPVVASGTVLG
FT                   GAPGGRDTGLLDPSMTVNAVDAFVLSGGSAFGLDAAGGVQAGLRELGRGFAVGPVRIPI
FT                   VPQAILMDLLNGGDKDWGLHSPYRDMGYTALQAAAKGTFALGTTGAGTGATTATVKGGL
FT                   GSASAVSSAGHRVAAIVAVNALGSATIGDGPHFWAAPFEKDAEFGGLGMPDVADHRMRL
FT                   KGMNTPATTIGAVVTDAQLTKAEAHRLSLAGHDGFARALLPAHLPLDGDTVFAASTARH
FT                   QRDDMASLMELCHLATIVMARAIARGVYAATALPVEGAQKAWRDRYASSS"
FT   CDS_pept        complement(266793..267068)
FT                   /transl_table=11
FT                   /locus_tag="RL0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05720"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMT2"
FT                   /protein_id="CAK05720.1"
FT                   /translation="MTFVLLSTVPDKSIRHGCAYRAAGVLSMKKQVIEYAGVPVGIVIP
FT                   DEDRLKFIAVKFHVHDLDEQRFGSPDEVRLAIHDLMTRRHPKPLHA"
FT   CDS_pept        complement(267509..270430)
FT                   /transl_table=11
FT                   /gene="optF"
FT                   /locus_tag="RL0232"
FT                   /product="putative aminotransferase"
FT                   /note="C-terminus from codon 545 is similar to Burkholderia
FT                   cepacia (Pseudomonas cepacia). dgdA DGDA_BURCE (EMBL:PCDGD)
FT                   ( 2,2-dialkylglycine decarboxylase (EC 4.1.1.64) (DGD).)
FT                   fasta scores: ungapped id 35.663% length=432 id in E(), and
FT                   entire protein is similar to Rhizobium meliloti
FT                   (Sinorhizobium meliloti). PUTATIVE AMINOTRANSFERASE PROTEIN
FT                   (EC 2.6.1.-). Q92MC9 (EMBL:SME591791) (( 975) fasta scores:
FT                   E()=0 64.928% id in 978 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05721"
FT                   /db_xref="GOA:Q1MMT1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMT1"
FT                   /protein_id="CAK05721.1"
FT                   /translation="MTDEALVDRMALPRPDVTATDVEEILLAHYSLSGRLAELGSQQDR
FT                   NYRVDSDRGRYVLKICHAAYEIRELEAQNAAIRHLKSRQGAPRVPKVIATNDGREIVVL
FT                   TVRGQGYQVRLLEYLEGQGLTELTYLAPASVAALGALCARLAQALADFNHPGLDRSLQW
FT                   DLRRAGPVAVQLLSAITDSAARDRIAKTMVMAVRRIQPLAPALRLQAVHHDVTGDNVVG
FT                   HRDAHGHIIPDGVIDFGDIIRGWLVGDLAVTCASLLHQADGDPFYILPAVTAYQAIYPL
FT                   SEEELKALWPLIVARAVILVASGEQQISVDPDNDYVRGNLDRERAIFDTAMSVPFDLME
FT                   AAILKAAGADVAAPETSGWLPLLPDIDPAGIAYVDLGVRSPHFSAGNWLNTDMDWRLLA
FT                   RMATENGTAATRYGEYRLSRAGTARGQATCALHVDICLAAGSAIAAPFAGRIGWKDQHL
FT                   TLAGDNMTLHLDGLDLSVDDGAEIAAGDSLGTVFGEASSLGGLRVQLCSVAGLEPPLFA
FT                   SPRAAAAWSVLCPSPSLLLSPQADAPQPETAALFARRRAHLARPQKNYYAAPPQIERGW
FT                   KEHLFDVEGRAYLDMVNNVTILGHGHPRFAAAIGAQWLRLNTNSRFHYAAITEFSERLA
FT                   ALSPDGLDAVFLVNSGSEANDLALRLAQAHSGARNMLCLLEAYHGWSAASDAVSTSIAD
FT                   NPQAPTTRPDWVHTIVSPNTYRGDFRGPDTAADYLGMATPVLEAIDAAGEGLAGFIAES
FT                   VYGNAGGIPLPEGYLKELYAQVRARGGLCIADEVQVGYARLGHYFWGFQQQGVVPDIIT
FT                   VAKGMGNGHPLGAVITTREIAQSLEKEGTFFSSTGGSPVSCVAGMTVLDIMAEEKLQEN
FT                   ARTVGDHLKARLAALIDRHPIAGAVHGMGLYLGLEFVRDRTTLEPATEETAAICDRLLE
FT                   LGVIMQPTGDHQNVLKIKPPLCLSIDSADFFADMLEKVLEEGW"
FT   CDS_pept        complement(270544..271428)
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /locus_tag="RL0233"
FT                   /product="putative formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:RL0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05722"
FT                   /db_xref="GOA:Q1MMT0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMT0"
FT                   /protein_id="CAK05722.1"
FT                   /translation="MTSYVLTVSCKSTRGIVAAISSYLADKGCNIVDSSQFDDLDTGKF
FT                   FTRVSFISEEGVPLAELKEGFEPICKRFAMDAEIHDGNARMKVLLMVSRFGHCLNDLLY
FT                   RWKIGALPIDIVGVVSNHFDYQKVVVNHDIPFHHIKVTKENKLQAEGQIMDIVEQTGTE
FT                   LIVLARYMQVLSDAMCQKMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVT
FT                   ADLDEGPIIEQDTARITHAQSPDDYVSIGRDVESQVLARAIHAHIHHRTFLNGNRTVVF
FT                   PASPGGYASERMG"
FT   CDS_pept        complement(271645..272664)
FT                   /transl_table=11
FT                   /gene="exoZ"
FT                   /locus_tag="RL0234"
FT                   /product="putative expolysaccharide biosynthesis protein"
FT                   /product="exopolysaccharide production protein exoz"
FT                   /note="Similar, but extended at the N-terminus, to
FT                   Rhizobium meliloti (Sinorhizobium meliloti). exoZ
FT                   EXOZ_RHIME (EMBL:B95975) ( Exopolysaccharide production
FT                   protein exoZ.) fasta scores: ungapped id 38.028% length=317
FT                   id in E(), and to length=335 AAQ87046 ( id 36.812%) fasta
FT                   scores: 345 aa overlap id 40.063% id in que"
FT                   /db_xref="EnsemblGenomes-Gn:RL0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05723"
FT                   /db_xref="GOA:Q1MMS9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMS9"
FT                   /protein_id="CAK05723.1"
FT                   /translation="MLVQLQYLRAIAALMVVYFHAVLQLAKVNPAVDATAFVYGETGVD
FT                   IFFVLSGFVMWLTTSGRGMSPIDFARRRIKRIVPLYWLATLFSATVALVAPSLLKSTVF
FT                   DLPHLAASLFFLPWANPADPSTITPVVVPGWTLNYEMFFYFIFALLLPLQEARRIPAMF
FT                   AVFAVILIACRLLPETTVTRFYGEPIMLEFLAGVVLGWLYGQKVLLPNRWAWAALAMGF
FT                   AFLFINEALMPPESRFYAWGIPAIFIVYGAISIDFSKLPVIGWLNYLGDCSYSIYITHA
FT                   FTLAFLRVAADRLPIGILQQPVLFVILSLVLSSIGGAIIHEITSPRRRKVAVASRPPA"
FT   CDS_pept        complement(272824..274014)
FT                   /transl_table=11
FT                   /locus_tag="RL0235"
FT                   /product="putative transmembrane exopolysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05724"
FT                   /db_xref="GOA:Q1MMS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMS8"
FT                   /protein_id="CAK05724.1"
FT                   /translation="MLWLGLLSVLYNGILAFINHNIVPLSLTHVAASEGLIMASAIIYI
FT                   LHKGIYETDLPAFLFLLFTLIVTIYVSVLNRMLFIDHFRNVLIIFCFTGLGGWSNEKTM
FT                   KLAFRWASLAVMIFLIFEIISVPFYVSIVHPSDYFANTRGLLPLSYNTTGLFQNALGFP
FT                   ERFSFGIIDHRSSSIFLEQVSLANFCGVIAVYLISMWEKLSRWDRLLMIGTAVLILVTN
FT                   DTRTMLIFCFACIVGYFVFPKIPKNFNLALMPLIVAAGFLVYVLKPNATGDNFTGRINL
FT                   TMKKIMELDPLAVLGLSVDRVAEFADSGYVYLIYAATIFGVIALWLFVCLFPAGRTAAQ
FT                   RRCAHSLSLFIFLNMMIGGTAVFSMKIAGLLWFVVGYMRFHDSPRIRQDRPADVLS"
FT   CDS_pept        complement(274119..275201)
FT                   /transl_table=11
FT                   /locus_tag="RL0236"
FT                   /product="putative carboxymethyl cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05725"
FT                   /db_xref="GOA:Q1MMS7"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMS7"
FT                   /protein_id="CAK05725.1"
FT                   /translation="MLRFAAIARMPMKTTRHLTALLLAAALIPSPALAAEAPCYRGVNL
FT                   SGGEYGERGGIYGTNYTYPSEDTIGYFAEKGMTIIRLPFRWERLQPALGGRLDEDELKR
FT                   IKDTIGLIRKHGMAVLLDPHNFGYYDKTQVGTAPATDAAFGDFWARLAVEFANQDGVLF
FT                   GLMNEPHDIKATDWLDAANAAIRSIRAVGARNLILVPGTAWSGAGSWEKDVIGGANGTV
FT                   MLGVRDPLDFYAYEVHQYLDADSSGTHPTCEGAGAAVAAINGVTAWLKQNHKRGFLGEF
FT                   GASADKDCMSGLTEIYATMSDNSDVWLGWSYWAAGDWWPANEPFNVQPRKGPERPQMRL
FT                   LAEVAKAGAGTCSAVKPAGK"
FT   CDS_pept        275304..276911
FT                   /transl_table=11
FT                   /locus_tag="RL0237"
FT                   /product="putative exopolysaccharide related transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05726"
FT                   /db_xref="GOA:Q1MMS6"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMS6"
FT                   /protein_id="CAK05726.1"
FT                   /translation="MNQYDRNRVSRLPDWRSFEPSQTAPEGVRVRSPVIRPDDFVRPSP
FT                   EPAPPPFVPPASIAETRQYEPPAPPPPKPPVVDAPPNAEPAAAAPLLDLRSSIAAIWSR
FT                   RLIVFGLALLGALAGGAVAPLIAQKFTAVSSLYFDPRQIGLADAGAQSSGPSPEMISAL
FT                   IDSQVQILTSGNVLRRVAEAMKLDQDPEFTGGRTDGAALIGTLQKALVITREASTYVVS
FT                   LAATTNDPEKSARLANQVVTSFTEEENSASNGIYENTSSTLDGRLDDLRQKVLEAEQAV
FT                   ETFRADNDMAATEGNLISDQRLLSLNTLLVTAQEKTIQAKARADAVANLRVEDIVAGNQ
FT                   AEGGVTSPLVSLRQQYATQAAAVGSLESQMGTRHPRLQAARSSLQSISVEIRGELQRLA
FT                   TSARGEYEQAKAAEDSIAKELAVQKALHASSSDKQVELNELQRKATAARDIYETVLKRS
FT                   SQTSEEQNLNQSNIRVISPAEPPVKADGPGKKILLVAGIIGGFLAGFVVGAGFAILAGL
FT                   FGHPVIRSYFRKSSAAAA"
FT   CDS_pept        277070..277402
FT                   /transl_table=11
FT                   /locus_tag="RL0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05727"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMS5"
FT                   /protein_id="CAK05727.1"
FT                   /translation="MRLLMMLLISLAAVPGLAPASAFAVDWTKSVDSGVQPLYPYKGLP
FT                   GVKAQPDKKEEESYNCRTETVQIRRRYDEIFRSGGMPTLMYVCERDGFVTTGGKVPLRG
FT                   HYQPVR"
FT   CDS_pept        complement(277814..278572)
FT                   /transl_table=11
FT                   /locus_tag="RL0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05728"
FT                   /db_xref="GOA:Q1MMS4"
FT                   /db_xref="InterPro:IPR007072"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMS4"
FT                   /protein_id="CAK05728.1"
FT                   /translation="MTTKDDRLEFEAHKREMSLALGKDEASFQQSLNTLIGLDKFDYSY
FT                   LWSWMGVPIIQLPVDILATQEVIWETKPDVIIETGIARGGSLIFMASILAAMGNDAAKV
FT                   VGVDIDIRAHNRESIETHPMSSRIKMIQGGSVDDDVIVAVKAEIPPSARVMVVLDSDHS
FT                   YEHVLAECRAYGPLVTEGCYLVVADTFIGHLTEEQAFTKRSKVWLRGNEPLKAVTDYLA
FT                   ETDRFEVDPVLNGKLVLSSSPGGYCVCRKA"
FT   CDS_pept        complement(278605..279753)
FT                   /transl_table=11
FT                   /locus_tag="RL0240"
FT                   /product="putative perosamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05729"
FT                   /db_xref="GOA:Q1MMS3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMS3"
FT                   /protein_id="CAK05729.1"
FT                   /translation="MTNRIFYTKPSITQLETDYATDAAATGWGAHCYDYINRFERDFKT
FT                   YLGSGFAIATSSCTGAMHMGLAALGVGEGDEVILADTNWVATVSPIVHLGAKPVFVDVL
FT                   PDSWCIDPSEVERHITPKTKAIIATHLYGNLCDMDALLEIGQRTGIPVIEDAAEAVGSV
FT                   WNGRRAGSMGTFGTFSFHGTKTLTTGEGGMFVTNDAALSERVLTLSNHGRARGQTKQFW
FT                   PDEIGFKYKMSNIQAAIGCAQLERIEELVARKREILAAYMVRLSALPGISMNPEYSGTI
FT                   NGAWMPTAVFHPSTGTTREIMQQAFEAANIDARVFFYPLSSLSMFEDRPENVNAWSIPG
FT                   RAINLPSYHDMSEADIDRVAATLLDVAGGRIYHNRTALRQSV"
FT   CDS_pept        280053..280805
FT                   /transl_table=11
FT                   /locus_tag="RL0241"
FT                   /product="onserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05730"
FT                   /db_xref="GOA:Q1MMS2"
FT                   /db_xref="InterPro:IPR007072"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMS2"
FT                   /protein_id="CAK05730.1"
FT                   /translation="MTTKDDRQEFEANKREMSLALGRDTDVFRQTLDTLVSLDKYDYSY
FT                   LWSWMGMPIIQMPADVMATQEVIWATKPDVIVETGVARGGSMIFQAAMLQLIGKGKVVG
FT                   VDIDIRAHNRQAIESHPMAHRVELIEGPSTSAEIMAKVKASIPEGASVMVILDSDHSKA
FT                   HVLDELRNYAPLVTDGQYLVVADTILGRYEPSQVPTKRSKVLLPGDEPLVALNDYLQET
FT                   DRFELDTIINGKLVLSSSPGGYLRCVRS"
FT   CDS_pept        complement(281701..282939)
FT                   /transl_table=11
FT                   /locus_tag="RL0242"
FT                   /product="putative O antigen biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05732"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMS0"
FT                   /protein_id="CAK05732.1"
FT                   /translation="MSGIKLSICIPTYNREAYLRNALTYCENDYTFTFPFEIVICDNAS
FT                   TDGTQQVVEEFIARGQPIRYYKRETNAGAAANVTSALRLGKGEYLIYLADDDMLIADAV
FT                   ADTIRYLDNNQEVTCAHAPWFFYDEVAKTDIEKFYNVEEDRKFPHGSFGDVFQYICEGH
FT                   IFPEIAIYRSSALRSAWIPREFCFYPFPFLAHFLDQGAVSFLQRPFYRSIVNSAIARDR
FT                   PQEGTNDVMTSWDRYRGGLEYFLYMGVKRGAMTLTPETHLKYEEMCKVFTLNRMAVAFR
FT                   FWAERKNFIKAYELYTRIMWGGMLNHPEIRNFRERLPLMVAIQTLVSEVNSAIGIDTLL
FT                   LGGFSEITALEGLMRELGLNEKVKMTVKLSDSPLESTAVFVSVNSDREYFVALGYLPNL
FT                   VFHEHDLSRHIIM"
FT   CDS_pept        complement(282936..283439)
FT                   /transl_table=11
FT                   /locus_tag="RL0243"
FT                   /product="putative dTDP-4-dehydrorhamnose 3,5-epimerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05733"
FT                   /db_xref="GOA:Q1MMR9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMR9"
FT                   /protein_id="CAK05733.1"
FT                   /translation="MEVDARSDDRGMFARTFDAQTFAAQGLVPVYPQCNVSQNHKRGTL
FT                   RGMHYQAEPRPEIKLVRATRGRVFDVALDLRPDSPSYLKWASVELDAIRHNAFYIPAGC
FT                   AHGFLTLEDDCELYYQMSETYVPELARGVRWDDPAFSIAWPFTPSIINERDAALDSYGQ
FT                   ETSL"
FT   CDS_pept        complement(283475..284710)
FT                   /transl_table=11
FT                   /locus_tag="RL0244"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05734"
FT                   /db_xref="GOA:Q1MMR8"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMR8"
FT                   /protein_id="CAK05734.1"
FT                   /translation="MTAHNCRFCNAPLKHRFVDLGSTPLANAYLTEEQLKLPEPSYPLR
FT                   AFVCTECWLVQADAFVPPEDIFSHYAYFSSYSDGWVEHARQFTIMARERFGLDATSQVI
FT                   EVASNDGYLLKHFVEAGVPVLGIEPAENVAEVARQIGVPTEARFFGKETAADLVSRGLA
FT                   ADIVIGNNVLAHVPDINDFVGGLSAVLKPDGVVSVEFPHLLRLMENIQFDTVYHEHFYY
FT                   LSLLAVEKVFAAHGLKVFDVEELPTHGGSLRVLACRATSMVHAIGHGLAKVRADEAAAG
FT                   FDKVETYEAFQSRVAPIKDGLLAFLTEAKRSGKKVAAYGAAAKGNTLLNFCGVGTDLIE
FT                   YVVDRNPHKQGHFLPGSKLPIYAPEKMDETQPDYVLILPWNIKNEVVAANSRVGAWGGR
FT                   FAVAVPELTVLG"
FT   CDS_pept        complement(284707..285780)
FT                   /transl_table=11
FT                   /locus_tag="RL0245"
FT                   /product="putative CDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:RL0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05735"
FT                   /db_xref="GOA:Q1MMR7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR013445"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMR7"
FT                   /protein_id="CAK05735.1"
FT                   /translation="MEAMGLTDFWNGRRVFLTGHTGFKGSWLSLWLEKLGAEVTAVSLE
FT                   PETNPSLYGRLAPWNGQGHHIADIREAATFKQHFIDFEPEIVIHMAAQALVRRSYENPT
FT                   ETFATNVMGTANVLDAVRETPSVKTALVVTSDKVYANNGSGVPFVETDMLGGKDPYSNS
FT                   KACTELVVRSYRDSFFKGRDIKLATVRAGNVIGGGDWSKDRLIPDFIRAFESSQPILLR
FT                   YPEAIRPWQHVLEPLGGYLAFAEALTLAGEQELPEALNFGPDPQSFATVSELAEALGLA
FT                   HGVNDVWKPALGKHLPEAPALTLSSALALSAIGWRPRLGLKQTIDWTAAWYKANREGAD
FT                   MRAFSLGQIAAYEETIS"
FT   CDS_pept        complement(285762..286535)
FT                   /transl_table=11
FT                   /gene="ddhA"
FT                   /locus_tag="RL0246"
FT                   /product="putative glucose-1-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.33"
FT                   /db_xref="EnsemblGenomes-Gn:RL0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05736"
FT                   /db_xref="GOA:Q1MMR6"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMR6"
FT                   /protein_id="CAK05736.1"
FT                   /translation="MKVVILAGGLGSRLAEETSIRPKPLVEIGGMPILWHIMSIYAHHG
FT                   LNDFIICAGYKGYLIKEYFVNLVLHHNDITVDLASNSINYHGGTRPNWRVTVVDTGMYS
FT                   MTGGRLGRIRDHLTPGEPFCMTYGDGVGDIDIAAEVAFHRSHGLKATMCAVTPPGRYGA
FT                   TNIEGQFITSFVEKPRGDGQRINGGFFVLDPSVVDLIPSDDTIWEAGPLEWLAANNQLA
FT                   AFKHDGFWQPMDTLRERNQLEELWSSGKAPWKLWA"
FT   CDS_pept        complement(286621..287004)
FT                   /transl_table=11
FT                   /locus_tag="RL0247"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMR5"
FT                   /protein_id="CAK05737.1"
FT                   /translation="MVAGLKSLDVFSRRQPTKGGEFRDPEAGEFRDSEVGFFLRPTRRA
FT                   FARRQSAGYLTLFYQDRPRLVGSIAPAWRPLVKLEGRAFGQTGCLERQAVPLLNARPAK
FT                   RAAVGSHTPASLAQERNRIPGQG"
FT   CDS_pept        complement(287084..287374)
FT                   /transl_table=11
FT                   /locus_tag="RL0248"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05738"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMR4"
FT                   /protein_id="CAK05738.1"
FT                   /translation="MIRYATSAASNPPPPKAREVSAAEPPVEMSRTKPVIEVASAGAAL
FT                   AAYPLLPSGESDELGSDTLPKTTKPPRRAATKRKPKVAEADDAPLQLSLEA"
FT   CDS_pept        287869..288288
FT                   /transl_table=11
FT                   /locus_tag="RL0249"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05739"
FT                   /db_xref="GOA:Q1MMR3"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMR3"
FT                   /protein_id="CAK05739.1"
FT                   /translation="MLAPRTLLLAGLLAILTPAIAGADSLKLGKPGVGPLNTGSTLCDF
FT                   RGCFGFGPQQWHRPAYVQPNYRPRGAGPTYYRPGAAGPPQLTYDPPPAQRVQPKARDMN
FT                   RHAAWCSNEYRSYNPRTDRFLTYEGIYKTCRSPYR"
FT   CDS_pept        complement(288300..288662)
FT                   /transl_table=11
FT                   /locus_tag="RL0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05740"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMR2"
FT                   /protein_id="CAK05740.1"
FT                   /translation="MLCEGDCAHAPQALNLSKRKDIAMTEKARVTILYCTQCNWLLRAS
FT                   WMAQELLHTFSDSLGEVALIPATGGNFEIRVNGDLIWERKRDGGFPGPRELKQRVRDIV
FT                   EPGRDLGHVDRASLES"
FT   CDS_pept        288797..289573
FT                   /transl_table=11
FT                   /locus_tag="RL0251"
FT                   /product="putative glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05741"
FT                   /db_xref="GOA:Q1MMR1"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMR1"
FT                   /protein_id="CAK05741.1"
FT                   /translation="MVSSRDRPYQEEPMRVAVIENMRNTGLGALAAALDEAGAEIEWFR
FT                   VWRDGILPKDISGHDALVVLGGEQSALDDETHPYLPELVRLARRFGDAGKAVLGICLGS
FT                   QILARAYGADNHLGIAREFGWHGIGVTAEGRADPLLSPLGGEFTIFEWHADTFSLPEGA
FT                   VRLASSPVAENQAFRIGRAVYGTQFHFEANSAVVAQWKAEFPDTIARIAPGWLENHAEL
FT                   AARHAGAADAAGLAIARAWVSLIEQEEVEMLSQASA"
FT   CDS_pept        289585..290133
FT                   /transl_table=11
FT                   /locus_tag="RL0252"
FT                   /product="putative acyl transferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RL0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05742"
FT                   /db_xref="GOA:Q1MMR0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMR0"
FT                   /protein_id="CAK05742.1"
FT                   /translation="MLASERDKMAAGEWYCCLDDELDLLRRQARLAVHAHNTLPADERG
FT                   AVAPALRALFAQAAPDIFIEAPFHCSYGINITLGERVYFNAGCTVLDSGRVTIGDRSMF
FT                   GPGVQIYCAEHHKEPALRSTGIEIARPVTIGSDVWIGGSAIILGGITIGDGAIVGAGAV
FT                   VTRDVPAGATVVGNPARIR"
FT   CDS_pept        290133..290669
FT                   /transl_table=11
FT                   /gene="gfa"
FT                   /locus_tag="RL0253"
FT                   /product="putative glutathione-dependent
FT                   formaldehyde-activating enzyme"
FT                   /note="Similar to Paracoccus denitrificans. Gfa GFA_PARDE
FT                   (EMBL:PD34346) (Glutathione-dependent
FT                   formaldehyde-activating enzyme (EC 4.4.-.-).) fasta
FT                   scores:E()=0.093 ungapped id 28.800% length=193 id in 143
FT                   aa, and similar, but extended at the N-terminus, to
FT                   Rhizobium meliloti (Sinorhizobium meliloti). Hypothetical
FT                   protein SMc04177. Q92K68 (EMBL:SME591789) (153) fasta
FT                   scores: E()=6.6e-47 76.712% id in 146 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05743"
FT                   /db_xref="GOA:Q1MMQ9"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMQ9"
FT                   /protein_id="CAK05743.1"
FT                   /translation="MPANGRDDLAISTASKAPLDQKANREDIMSERTLPMEGGCRCGRV
FT                   RLKISAPPLLTMACHCTGCQKMTSSGYSLSAAIPSEGFEVTQGEPVIGGLHGVTKHYFC
FT                   PHCMSWMFTRPEGMDWCVNLRVTMLDDPSWFTPFIETWTSEKLSFAETGAVHSYEALPE
FT                   MEAYEGLVKEYMGRG"
FT   CDS_pept        complement(290983..292815)
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="RL0254"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05744"
FT                   /db_xref="GOA:Q1MMQ8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMQ8"
FT                   /protein_id="CAK05744.1"
FT                   /translation="MARMSTNSTTPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAER
FT                   EMSEQVLDNMDIERERGITIKAQTVRLHYQANNGEKYILNLIDTPGHVDFAYEVSRSLS
FT                   ACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVTVLNKIDLPAAEPDRIKEQIEEVIG
FT                   IDASEAVLISAKTGLGIPDVLEAIVHKLPAPKSPGGDKAPLKALLVDSWYDAYLGVMVL
FT                   VRVIDGVLTKGQTVRMMGTDAKYQVERVGVLTPKMVNIDRLGPGEIGFITASIKEVADT
FT                   RVGDTITEDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASFSFE
FT                   MESSAALGFGFRCGFLGLLHLEIIQERLEREFDLDLIATAPSVVYKMFMTDGTERELHN
FT                   PADMPDVVKISEIHEPWIRATILTPDDYLGGILKLCQDRRGIQIELTYVGTRAMLTYDL
FT                   PLNEVVFDFYDRLKSISKGYASFDYTLTDHREGNLVKMSILVNGEPVDALSMMVHRTAA
FT                   EKRGRDMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRKRK
FT                   LLDKQKAGKKRMRQFGKVEIPQEAFIAALKMGDE"
FT   CDS_pept        complement(292892..293593)
FT                   /transl_table=11
FT                   /locus_tag="RL0255"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05745"
FT                   /db_xref="GOA:Q1MMQ7"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMQ7"
FT                   /protein_id="CAK05745.1"
FT                   /translation="MMDASTQSTDTTGSFTAAAWDRIAPIMAEIEALPLLQRLSDGTLP
FT                   PEVFRHYILQDALYLKHYARCLAIVAAKAPDNAQVLRFLGSAQKAITVEQGLHAGFLTQ
FT                   FGITSANVTSAEPSPAGFAYTNFLLATAYHSSYAVALSSILPCFWIYWHVGEAIKNRPV
FT                   IEGNAFQAWINTYGDPQFAAGAREVIALTDMAARAASPVERAQMTDVFIRASQYEWMFW
FT                   DSAWRQETWPV"
FT   CDS_pept        293730..294308
FT                   /transl_table=11
FT                   /locus_tag="RL0256"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05746"
FT                   /db_xref="GOA:Q1MMQ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMQ6"
FT                   /protein_id="CAK05746.1"
FT                   /translation="MDWKMEPELEQAIGIRIRTLRQEKALTLDDLAAASGVSRAMISRI
FT                   ERAEASPTASLLARICAALGLSLSAFFAEEGQASPLARRQEQQVWRDPETGYIRRSVSP
FT                   PGTPSDVDIVEVEFPPGARVSFPPHASAHGMTQHIWLFDGELEMTAGEAVYRLRPGDCL
FT                   FMPVGEGHVFHNPGNAPARYCVVLNRGGR"
FT   CDS_pept        294333..294851
FT                   /transl_table=11
FT                   /locus_tag="RL0257"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05747"
FT                   /db_xref="GOA:Q1MMQ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMQ5"
FT                   /protein_id="CAK05747.1"
FT                   /translation="MPGIRILSAEEARAAVPALSEVLVDCVAGGASVGFMQPYGPDDAE
FT                   PYWRDVADAVATGANLLLVAELDGRIVGTVQVGAAQMPNQPHRGDLKKLLVHRSARGKG
FT                   LARLLMDAAEREAAGRGKTLLVLDTATGSDAEAIYPRLGWQRVGVIPDYALWPEGGFCA
FT                   TTLFYKRLA"
FT   CDS_pept        complement(294867..295478)
FT                   /transl_table=11
FT                   /locus_tag="RL0258"
FT                   /product="putative haloacid dehydrogenase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05748"
FT                   /db_xref="GOA:Q1MMQ4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMQ4"
FT                   /protein_id="CAK05748.1"
FT                   /translation="MKVLMVDVDGVLIHGRPTDGLPHFTYLERDLGLRFDLLQQEFFQT
FT                   HWGDIIIGRAALEPRLAGVLAKIAPHLSAETLIDYWFENDSRLDRNLLEELAGLRQSGI
FT                   TLLLATNQEHRRARYLMEQIGLSAHFDDIIYSAALGHSKPSPDFFRLATERAGVLPGEI
FT                   AFIDDMAVNIEAARQFGWNAAQWTAGATLGGALPVFARPT"
FT   CDS_pept        295612..296637
FT                   /transl_table=11
FT                   /locus_tag="RL0259"
FT                   /product="putative acetylpolyamine aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05749"
FT                   /db_xref="GOA:Q1MMQ3"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMQ3"
FT                   /protein_id="CAK05749.1"
FT                   /translation="MRVIYSEDHKLRDARTELHAGQLVTPFEAPFRAEWILAAVKQAGF
FT                   TDVVAPDAHGLETARKVHDPAYLDFLATVWDRWVAAGFTGEAIANSFAVRRTSQRVPDN
FT                   IVGAIGHYANAADTSITKGSYEAAIASMRCAITGADWLNAGNRFAFALCRPPGHHAGID
FT                   LFGGYCFINNSGVAAQRLLDHGARKVAVLDVDFHHGNGTQDLFYHRGDVFTASLHGDPM
FT                   QAFPYFLGHADEEGEGEGTGANRNYPMPPGTPWDVWSSALADALTRIKAFGAEAIVVAL
FT                   GVDTFERDPISFFSLTSDDFTRMGAMIASAGLPVLACMEGGYGVPEIGLNVANVLKGLE
FT                   A"
FT   CDS_pept        296647..297222
FT                   /transl_table=11
FT                   /locus_tag="RL0260"
FT                   /product="Putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05750"
FT                   /db_xref="GOA:Q1MMQ2"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMQ2"
FT                   /protein_id="CAK05750.1"
FT                   /translation="MTDETVPSDIPTSRMLSWARNSTVYRLERRMMTEKQLFDAIARKA
FT                   KEKFAGISAAQLKAVADFAVKFAYDNKVLDDHAYAEVSTRSAVRGGKSKRAIAQKLAAK
FT                   GVSSDKVEAALEEADDLYAAAIFARKRAFGPFRRVELDEKRKAKELSAFARNGFSFDIG
FT                   RKVFDMSFEDAEEIIVAGRSAAPQHQRS"
FT   CDS_pept        297295..298206
FT                   /transl_table=11
FT                   /locus_tag="RL0261"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05751"
FT                   /db_xref="GOA:Q1MMQ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMQ1"
FT                   /protein_id="CAK05751.1"
FT                   /translation="MDIKNIETGTDGAALIAQPGISPTSGGLAAGVAMCLMSMSSIQFG
FT                   AALSSSAIATYGVAGATWLRLAFAAIILAAVVRPSVLRYSGAQWQATLLLGTTTAAMTL
FT                   CFFAAIQRLPLGLAIAIDFLGPLSVAVFGYGLTWRLTWPLIAAAGILFLAHDGEGWVGN
FT                   SSGVLFALGSAVGWAVYILLTKKVGAAFKGLEGLSMSLIVAGLVATPFGLAETGGAFTA
FT                   QGLVEVLGLAILVPLLPYALEMVALRRMPSASFGILMSLEPALGALAGFLILAQPMTAL
FT                   QMLGTALVVAASAGATASAAKT"
FT   CDS_pept        complement(298251..298718)
FT                   /transl_table=11
FT                   /locus_tag="RL0262"
FT                   /product="putative truncated haemoglobin"
FT                   /db_xref="EnsemblGenomes-Gn:RL0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05752"
FT                   /db_xref="GOA:Q1MMQ0"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMQ0"
FT                   /protein_id="CAK05752.1"
FT                   /translation="MDNDIQGRPAHVAAIRERAEAEMREMGVDAAFIDRLVETFYGRVL
FT                   AHPDLGPVFDARLSGRWPEHMAKMKSFWSAVAFRSGAYGGKPVQAHTGVQNLTPDLFPK
FT                   WLSLFAATLDDIAPTPEAKAWFMATAERIAKSLILSLFYNPALDDPARKPA"
FT   CDS_pept        298892..299875
FT                   /transl_table=11
FT                   /gene="mbfA"
FT                   /locus_tag="RL0263"
FT                   /product="member of rubrerythrin family of electron
FT                   transporters"
FT                   /db_xref="EnsemblGenomes-Gn:RL0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05753"
FT                   /db_xref="GOA:Q1MMP9"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR017040"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMP9"
FT                   /protein_id="CAK05753.1"
FT                   /translation="MLARFFRSSKRSFDSLSEQEILALGIASEEDDARIYLAYADRLRR
FT                   EFPASAKVFEDMAEVEDTHRKSLIEIHRQRFGERIPLIRREHVEGFYERKPDWLRANLS
FT                   LDAMRRETEAMEEQAYRFYVEAAKRTSDASTRQLLGDLALAEQGHEDIARMLGDKHTPE
FT                   DVKHDEDATVHRQFVLTYVQPGLAGLMDGSVSTLAPIFAAAFATQDTWQTFLVGLSASV
FT                   GAGISMGFTEAAHDDGKISGRGSPIKRGLACGIMTALGGLGHALPYLIPHFWTATITAA
FT                   VVVFFELWAIAFIQNRYMETPFLRAAFQVVLGGGLVLGAGILIGNG"
FT   CDS_pept        complement(300040..300639)
FT                   /transl_table=11
FT                   /locus_tag="RL0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05754"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMP8"
FT                   /protein_id="CAK05754.1"
FT                   /translation="MRIKGIFVAMMAMFAMATAAIPAPSRNASMVTGNATSQPIGHYDF
FT                   CQIHRSECGADRNAGPVAMNPGKWSLVRSVNATANRTITPMTDKEIYGKDEVWAYPTTA
FT                   GDCEDFALLKRRMLIQRGFPAADLLMTVVRKPDGEGHAVLTLRTAEGDFVLDNLAADVK
FT                   PWFGTPYSFVKRQSSYNAGRWVTIENGRDVLVGALR"
FT   CDS_pept        complement(300805..301629)
FT                   /transl_table=11
FT                   /locus_tag="RL0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05755"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMP7"
FT                   /protein_id="CAK05755.1"
FT                   /translation="MSDQLSNAQPQFLTVGEGEAAREIATLVRPAQTGNGAPALVWLSG
FT                   YRSDMSGTKAVELDGLAAELGLACIRLDYSGHGLSGGSFRDGTISRWLEEALAVIRHVA
FT                   PDRVILVGSSMGGWIALRLAQELARQGGPKLAGMVLIAPAPDFTSELIEPNLKAKERKS
FT                   LAERGYFEERSQYSPEPNIYTRALIEDGRKNRVLDGIIETGCPVHILQGMKDADVPHAH
FT                   AMKLVEHLPADDVVLTFVRDGDHRLSRPGDIALLLSAVKGIIRSSTNRQMPT"
FT   CDS_pept        301757..302344
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="RL0266"
FT                   /product="putative translation initiation factor"
FT                   /db_xref="EnsemblGenomes-Gn:RL0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05756"
FT                   /db_xref="GOA:Q1MMP6"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMP6"
FT                   /protein_id="CAK05756.1"
FT                   /translation="MGARCCNVPKQREENTTIRRPFKTDAPVKDGPRSNREIRIPKVQL
FT                   IGADGENMGVVPTDQALRMAEEAGLDLVEISPNVEPPVCKILDLGKLKYANQKKAAEAR
FT                   KKQKIVEVKEIKMRPNIDTHDYEVKMKAMGRFFDEGDKVKVTLKFRGREMAHQELGMKL
FT                   LQQVKADTIEFAKVEAEPKLEGRQMMMVLAPK"
FT   CDS_pept        302656..302859
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="RL0267"
FT                   /product="putative 50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:RL0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05757"
FT                   /db_xref="GOA:Q1MMP5"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMP5"
FT                   /protein_id="CAK05757.1"
FT                   /translation="MPKMKTKSSAKKRFKITATGKVKAAAAGKRHGMIKRSNKFIRDAR
FT                   GTMVLAEPDGRKVIKNYLPNGL"
FT   CDS_pept        302898..303302
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="RL0268"
FT                   /product="putative 50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:RL0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05758"
FT                   /db_xref="GOA:Q1MMP4"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMP4"
FT                   /protein_id="CAK05758.1"
FT                   /translation="MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQY
FT                   AYRDRKVNKRNFRALWIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPE
FT                   AFGALVSAAKKALEYLKEAGTANEFEGAVK"
FT   CDS_pept        303453..304535
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="RL0269"
FT                   /product="putative phenylalanyl-tRNA synthetase alpha
FT                   chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RL0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05759"
FT                   /db_xref="GOA:Q1MMP3"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMP3"
FT                   /protein_id="CAK05759.1"
FT                   /translation="MSDIDQLNTSLLAEIAAADDETALEAVRVSALGKKGSVSELLKTL
FT                   GAMTPEERQSKGAAINVLKNAVTEALTARKTTLRQAAIDARLQAETVDVSLPVRSSPAE
FT                   RGRIHPISQIVDEITAIFADMGFSIAEGPDIETDYYNFTALNFPEGHPAREMHDTFFFN
FT                   PDENGERKVLRTHTSPVQVRTMEAQTPPIRIIIPGKTYRQDSDATHSPMFHQVEGLVVD
FT                   KKANVANLRWVLEEFCKTFFEVDSVTMRFRPSFFPFTEPSFEVDIQCDRSGPIVKFGEG
FT                   TDWMEILGCGMVHPNVLRYGGLDPDEYQGFAWGMGLDRIAMLKYGMPDLRDFFNADVRW
FT                   MTHYGFRPLDMPTLFGGLSA"
FT   CDS_pept        304552..306975
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="RL0270"
FT                   /product="putative phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RL0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05760"
FT                   /db_xref="GOA:Q1MMP2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMP2"
FT                   /protein_id="CAK05760.1"
FT                   /translation="MKFTLSWLKEHLETDAGLDEICTRLTEIGLEVEDVDDKAAFKPFV
FT                   IARVVSAEKHPQADRLKVLMVDTGSGAPVQVVCGAPNARAGLVGAFAAPGTYVPGIDVT
FT                   LAVGNIRGVESHGMMCSEKELQISDSHDGIIDLPEDAPVGQSYAAYAHLDDPLIEINLT
FT                   PNRPDCTSIHGIARDLAASGLGTLKMRPAPSFAVEGETPVKLTLDLDDPKLCPGFALRL
FT                   VRGVRNGPSPRWMQQRLIAIGLRPINALVDVTNYMTFDQGRPIHVFDAAKINGNLAVRR
FT                   AAEGETVLALDQREYKLSPNNVVISDENGIESIGGIMGGEHSGCDENTVDVLIESALWD
FT                   PMNIAKSGRSLGIITDARYRFERGVDPEYMVPGLERTTELVLELCGGKAAKAEIVGYQG
FT                   YEPKIVDFPYSEVKRLTGLDVSNEESNTILTRLGFTVSGSGERVSVAVPSWRPDVDGKA
FT                   DLVEEVMRIHGVDNIKPAPLESHAAVNGKILTTLQIRTRLAKRALAARGMLEAVTWSFI
FT                   PEDQAKLFGGGSPALKLANPIAAEMSDMRPSLLPGLLSAAQRNADKGYGDVALFEVSGT
FT                   YENDRPEGQRRVAGGIRRGTASLAGAGRAWSNAAKGGGKPVDVFDAKADALAVIEACGL
FT                   PMGNIQIEQGGPAWYHPGRSGTIKMGPKVVLGYFGEFHPLTLESLDVSGALCGFEVYVD
FT                   AMPEAKRKATRTKPALELSPFQLVRRDFAFVVDKTVEAGAIVKAATGADRKLVTAVNVF
FT                   DIFEGASVGDGKKSVAIEVQIQPVERTLTDEDFEALTQKIVASVAKFTGGVLRS"
FT   CDS_pept        complement(307030..307389)
FT                   /transl_table=11
FT                   /locus_tag="RL0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05761"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039437"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMP1"
FT                   /protein_id="CAK05761.1"
FT                   /translation="MSDRQAVEQTVHLYVEGMAFANEAALKKAFHPKSSIIGHYENAVE
FT                   WLTRDEFIAAILQEEPAPPGTQPYMDIQSVDVEGDAASVKVTDDFAGMRFTDYLSLLKI
FT                   DGRWTIVSKLFHLHR"
FT   CDS_pept        complement(307497..308492)
FT                   /transl_table=11
FT                   /locus_tag="RL0272"
FT                   /product="putative aldo-keto reductase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05762"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMP0"
FT                   /protein_id="CAK05762.1"
FT                   /translation="MKTRKLGNDLTVSAVGLGCMGMSFAYGASDDAESIKTLHRAIDLG
FT                   VTFFDTAEVYGPFTNEVLLGKALKPFRDRVVIATKFGFKIDASKPGIAAITGVDSRPEH
FT                   VRTVAEASLKRLGIETIDLFYQHRVDPDVPIEETVGVMAELVKEGKVRALGLSEAGSAT
FT                   IRRAHAVHPIAALQSEYSLWTRDPEEEVLATCRELGIGFVPYSPLGRGFLTGAIRKAED
FT                   LDADDFRRQVPRFQAENFDANAALVATLERLAAEKGVTAAQLALAWVLNQGDDIVPIPG
FT                   ARKLHHLEQNAAAADIVLSPAELARLEEIIPAGQVAGKRYSDASLAMTNI"
FT   CDS_pept        308617..309525
FT                   /transl_table=11
FT                   /locus_tag="RL0273"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05763"
FT                   /db_xref="GOA:Q1MMN9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMN9"
FT                   /protein_id="CAK05763.1"
FT                   /translation="MNRTQLSQLAVLAAVSEHRSFRAAAKELLVAPSAISHAISSLEES
FT                   LGVRLLARTTRSVAPTEEGRLLLERLRPALEEIDIALEAVRDTRAKPAGNLRITAPRFA
FT                   SDLLLAPRLGDFLNLYPDITLEIANEDGFTDIVKEGFDAGIRLEESLEADMIAVRVSPD
FT                   LTTVIAASPEYFEHHPKPEHPRDLVHHRCIKRRFTNGSIYRWEFEKDGQELVVSVDGPL
FT                   IVSEDRLALLAALNGAGLAYLFDMRVYDELAGGTLVRVLEDWCAPYSGPFLYYPTRRQM
FT                   RPALRAFIDFFRYSEQDTGGR"
FT   CDS_pept        complement(309571..310068)
FT                   /transl_table=11
FT                   /locus_tag="RL0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05764"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMN8"
FT                   /protein_id="CAK05764.1"
FT                   /translation="MAKEKTLEDLFYDTLKDIYFAERQILRALPKMARAAQSPELKKGF
FT                   EKHREETEGQVERLQQVFELIGKRAQGKTCEAIQGIIAEGEEIMEEFKGTVALDAGLIS
FT                   AAQAVEHYEIARYGTLKTWAATLGLKEVVGLLDQTLQQETATDKTLSQLATTAANQKAK
FT                   AA"
FT   CDS_pept        310215..310832
FT                   /transl_table=11
FT                   /locus_tag="RL0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05765"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMN7"
FT                   /protein_id="CAK05765.1"
FT                   /translation="MRKPGSMKGLEDLGRVRLSQNFFLRDFLHSEIADFYRIPNIPEDP
FT                   DLAIETGKRLCEELLEPLEATFGRLHIRSGYRSPAVNRFGNENKLNCSTNASTAAHHIW
FT                   DMRDFDGCMGAAVCIAVPWMVDHYRVESDWQRLAWWIHDHLPYASLCFFPKLWAFNIQW
FT                   HERPKRVIQSYVSPRGILTKPGMANWESDHSEWYTGFPLLKS"
FT   CDS_pept        complement(310822..311265)
FT                   /transl_table=11
FT                   /locus_tag="RL0276"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05766"
FT                   /db_xref="GOA:Q1MMN6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMN6"
FT                   /protein_id="CAK05766.1"
FT                   /translation="MTVTIREARPEDEARWRELWAAYLVFYDVTVDADITDSTWRRVFD
FT                   PASAIAMRVAEVDGRMMGFALYLTHEGTWIRGRDCYLEDLFVDADARGQGVGRALMDDL
FT                   VSTCKAKGWSRLYWHTSEQNRTARALYDSYVESDGHIRYRISF"
FT   CDS_pept        complement(311280..312290)
FT                   /transl_table=11
FT                   /locus_tag="RL0277"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05767"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMN5"
FT                   /protein_id="CAK05767.1"
FT                   /translation="MVRAAFCRIRDFNSFTLLESVMEMRRLGKTGLSVAPIVIGGNVFG
FT                   WTADEKTSFAILDAFFDAGLNTIDTADVYSSWVPGNKGGDSEEIIGRWLSQAKVSRDKA
FT                   LIVTKVGSDMGQGKTLKETYILKAVEDSLRRLQTDYIDVYLSHWPDEDTPHEETLGAYA
FT                   KLKQQGKIRAIGCSNYDAKLLQASFDAAEKAGLPRYDVLQPEYNLYERSSFEGPLADLC
FT                   VKEDIGVITYFSLAAGFLTGKYRSKSDTQGRAREGRVSKYLDDKGLRILAALDKVSAET
FT                   GAKPAEISLAWLLRKKGVTAPIASATSLSQLESLAKSATLALSDDAMALLDQAGA"
FT   CDS_pept        312406..313392
FT                   /transl_table=11
FT                   /locus_tag="RL0278"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05768"
FT                   /db_xref="GOA:Q1MMN4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMN4"
FT                   /protein_id="CAK05768.1"
FT                   /translation="MLRFGIISTAKIGRDNVVPAIQDAENCVVTAIASRDLARAREMAD
FT                   RFSVPHAFGSYEEMLASDLIDAVYIPLPTSQHIEWSIKAADAGKHVLCEKPLALKADDI
FT                   DDVIAARDRNRVVVTEAYMITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDPANMR
FT                   NVPELGGGGLPDIGVYPVMGTRFSTGKEPLWIQAITERDADFGTDIYSSVKADFGDFEL
FT                   SFYISTQMANRQVMVFHGTEGYIEVKSPFNANRWGPEEIELADRSHSESRIFRFQDSRQ
FT                   YKRQVEAFARAVKNGKEEIVTLENSKLNQKVIDAIYRASEKDGWEAV"
FT   CDS_pept        complement(313495..313872)
FT                   /transl_table=11
FT                   /locus_tag="RL0279"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05769"
FT                   /db_xref="GOA:Q1MMN3"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMN3"
FT                   /protein_id="CAK05769.1"
FT                   /translation="MRKLIHFAIAGGIGFLVDAGILSALLALTPLGPFLARLVAIAFAM
FT                   AATWAFNRSFTFDRSGRSLAAEGFRYGSVGVTAALVNYGLYSALLLSLPALQPLAAMVI
FT                   ASIASMIFSFFGYSRFVFRAE"
FT   CDS_pept        complement(313869..314876)
FT                   /transl_table=11
FT                   /locus_tag="RL0280"
FT                   /product="putative glycosyltransferase"
FT                   /note="N-terminus to codon 240 is similar to Actinobacillus
FT                   actinomycetemcomitans. DNA for glycosyltransferase, lytic
FT                   transglycosylase, dTDP-4-rhamnose reductase, complete cds.
FT                   O05377 (EMBL:AAAB2668) (234) fasta scores: E()=0.00011
FT                   25.688% id in 218 aa, and enitre protein is similar to
FT                   Anabaena sp. (strain PCC 7120). All0042 protein. Q8Z0P8
FT                   (EMBL:AP003581) (315) fasta scores: E()=1.6e-55 54.054% id
FT                   in 296 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05770"
FT                   /db_xref="GOA:Q1MMN2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMN2"
FT                   /protein_id="CAK05770.1"
FT                   /translation="MARSRTDNLNIAVLLPCYNEAATISAVVQGFRATLPDAAIHVYDN
FT                   NSTDGTALQAMLAGAHVVRERRQGKGHVVRRMFADIDADIYIIADGDGTYAPGDAEELV
FT                   RTLLTERADMVVGTRRGVHSDAGRQGHALGNRLFNLLYRMIFGPDFTDIFSGYRAFSRR
FT                   FVKSFPAVSGGFEIETEMSVHASRLKLPVSELELDYGRRPEGSHSKLSTFRDGAKILWM
FT                   FAMLMKETRPFAFFSAISATFMLASLGFMAPVLAEYFETGLVSRMPTWVLSTALLMISF
FT                   MLFTAGVILDSVARARAEQLRIHYMGLERPSALKAPLSDAGPVSRARPGKADAA"
FT   CDS_pept        315036..316904
FT                   /transl_table=11
FT                   /locus_tag="RL0281"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05771"
FT                   /db_xref="GOA:Q1MMN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMN1"
FT                   /protein_id="CAK05771.1"
FT                   /translation="MNAVQPIPHASSAIDAPRGGLPAPRDGLRDLLTRLWPTVIAYSVI
FT                   LAAAILITKLSGATDYVGPDNDDGMRLVEVRDFLAGQGWFDLMQYRLGLDGGTLMHWSR
FT                   LIDLPIASLIWFFGLFAPRETAEALALAVWPVSLILPAMLAMAVAGRRIGGVAAMHISL
FT                   GLTSLAIYTGNRFAPGAIDHHNVQLALVATMIAMLLDPERRAWSYAVAGIAAAVAIAIG
FT                   AETTPFVAAVCLTIALLWAWEGENFAAAAKAFGLALAIAISILFFATVPPRLYSTVTCD
FT                   NLSLGYYSLAAIGGGLLLFSAVFASRLRRPLRFAALAVVGAGVLGSAIVIAPQCLSDPL
FT                   AGLDPMLVELWLRNVSEAQSIFALGRTDLFSIGGFYAAGLFGIAVCIFRVVQRDRVQIH
FT                   LVLLFLLMTSWAIALVQVRGSTFSNLISILPLALLIIDVRRISNGDSENVAAAFVYIVT
FT                   VLASAPAAWAVGGGFVSLQMQNAAQKKAAEPAKKISCTSQAALAPLAGLPAGLVSAPSE
FT                   MGVPILRFTANRVLSAPYHRNQGGMLTELHIGMAEPQEAEAFLKGTGVTVLAFCPSDLQ
FT                   TREITKLKPDGLYAELGKSNIPPYLEPLPKAADVGVQFFRYRPATN"
FT   CDS_pept        317593..319173
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="RL0282"
FT                   /product="putative exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:RL0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05772"
FT                   /db_xref="GOA:Q1MMN0"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMN0"
FT                   /protein_id="CAK05772.1"
FT                   /translation="MSNVFDGDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGY
FT                   RGPHSSGHAYFALKDDRARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQI
FT                   VIETLEPAGAGALMALIEERKRKLGAEGLFDAARKKRLPFMPGVIGVVTSPTGAVIRDI
FT                   LHRISDRFPVHVLVWPVKVQGEGSGEEVANAIRGFNALEPSGTIPRPDVLIVARGGGSL
FT                   EDLWSFNDEIVVRAAAESAIPLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAE
FT                   LEAQAAGLAARLQGCMNRQMDQRRQSVRALMRALPSLDQLLALPRRRFDEAATGLGRGL
FT                   ELNTINKRRGFERVAAHLRPDLLAGRIAERRQTLNERMARAERMVERLIDRSKSRVDRA
FT                   EAILASLPARLKTQTDRGRERLGNLSRHADTAVRHQLTRARSELSAQDRVLQSLSYKNV
FT                   LKRGYAVIRDEDNRPVSQAAHLSAGMGIAIEFADGRVGAMTTEGGTPPAGAKKRSTKPA
FT                   EPPKQGSLF"
FT   CDS_pept        319176..319769
FT                   /transl_table=11
FT                   /locus_tag="RL0283"
FT                   /product="putative NAD(P)H oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05773"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMM9"
FT                   /protein_id="CAK05773.1"
FT                   /translation="MRILLVLAHPLEDSFAAAVARTAREALEASGHVVDLFDLYAENFD
FT                   PRLSKAERGGYFDQPYDTSAVADIVARLKAADGLILVFPQWWFNFPAILKGFFDRVFAP
FT                   GVAFSHDAAGGRIVPQLTHIRLLYALTTTGSPWWLVRLYMGDPVRRLLKRGIAAFCSKG
FT                   LNFRMLSLHDMDRASDVKRRAHLDRVRKLLSAIR"
FT   CDS_pept        complement(319773..320273)
FT                   /transl_table=11
FT                   /locus_tag="RL0284"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05774"
FT                   /db_xref="GOA:Q1MMM8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMM8"
FT                   /protein_id="CAK05774.1"
FT                   /translation="MSEDGKMDHVDKILAQWRRERPDLDVEPMGILGRLKRLSTHLGRE
FT                   VEAVLMKQGLSSSAFDVLATLRRAGAPHRLSPGELLEMTMVSSGTMTNRIDQLEKAGYV
FT                   ERILNPEDRRSVLIALTEKGLATVETAVDAHVVNQHRLSKNLSAADKAELDRLLRKFLA
FT                   DFE"
FT   CDS_pept        320355..321266
FT                   /transl_table=11
FT                   /locus_tag="RL0285"
FT                   /product="putative transmembrane transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05775"
FT                   /db_xref="GOA:Q1MMM7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMM7"
FT                   /protein_id="CAK05775.1"
FT                   /translation="MKTNSRYVADLAATALAPAIWGSTYIVTTTFLPAGYPLTVAMLRA
FT                   LPAGLLLLFLVRKLPFGIWWGRAFVLGALNFSFFWAMLFVSAYRLPGGVAATVGAVQPL
FT                   IVIALSQLFLGKPVRPLAVLAGLAGMAGVGLLVLTPKAGLDPIGVAAGLAGAVSMAFGT
FT                   VLTRRWAPPVSNLTFTAWQLTAGGMLLVPFAFFLEPALPMPTAANIAGIAYLGLIGAAF
FT                   TYLLWFRGLSRIEPSAVASLGFLSPLVATLLGWLALGQSLTPVQIGGLAMVLASVWLSQ
FT                   RTMMPLRPIRPAASPEPVNHPA"
FT   CDS_pept        complement(321214..322467)
FT                   /transl_table=11
FT                   /locus_tag="RL0286"
FT                   /product="putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05776"
FT                   /db_xref="GOA:Q1MMM6"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMM6"
FT                   /protein_id="CAK05776.1"
FT                   /translation="MTFMPQSQNTVDPVKLEKLAEVAVKVGLQLQKGQDLVITAPVVAL
FT                   PLVRLITKHAYKAGAGLVSAFYSDEETTLARYQYGSDESFDRASGWLYEGMAKAYANGA
FT                   ARLAVAGDNPMLLSEQDAGKVGRANRANSTAYKPALEKISNFDINWNIVSYPNPSWAKV
FT                   VFPDDPEPIAIAKLAKAIFAASRVDVSDPVAAWAEHNANLGKRSAWLNGERFASLHFRG
FT                   PGTDLTIGLADGHEWHGGASTAKNGITCNPNIPTEEVFTTPHALRVEGHVSSTKPLSHQ
FT                   GTLIDNIQVRFEGGRIVEAKASRGEEVLNKVLDTDEGARRLGEVALVPHSSPISASGIL
FT                   FYNTLFDENASCHIALGQCYSKCFLDGATLSQEQIKAQGGNSSLIHIDWMIGSDKVDID
FT                   GLKPDGSRVPVMRQGEWA"
FT   CDS_pept        complement(322594..323340)
FT                   /transl_table=11
FT                   /locus_tag="RL0287"
FT                   /product="putative glutathione S transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05777"
FT                   /db_xref="GOA:Q1MMM5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMM5"
FT                   /protein_id="CAK05777.1"
FT                   /translation="MNFAASTIRCIYIYHRRVETAMSKLTLVSHHLCPYVQRATIALLE
FT                   KGVPFGRINIDLADKPDWFLQISPLGKVPLLRIEEEDGSQAVLFESSVICEYLEETQPG
FT                   VALHPRDALTRARHRGWMEFGSSLLSDLWGYETAEDAAQLEAKRTALISKFATVEKVLT
FT                   DGPYFAGNDFSLVDAVFAPVFRYFDLFETLGDSDIFEGLERVKRWRKTLSERSSVKAAV
FT                   GEDYPQRLMEFLEKHNSILLRLPAAA"
FT   CDS_pept        323360..323803
FT                   /transl_table=11
FT                   /locus_tag="RL0288"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05778"
FT                   /db_xref="GOA:Q1MMM4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMM4"
FT                   /protein_id="CAK05778.1"
FT                   /translation="MSEKPSNPSEAVTSAWTSIMRARERLLGAIEADLKAAGMPPLAWY
FT                   DVLWELARSQDGKLRPYEIEERTLLAQYNLSRLLDRLEREGLVRREVFAEDGRGRWVVL
FT                   SDAGRKLRERMWIVYAKSIDTHIGCKLAENEAKAIAGLLDRFL"
FT   CDS_pept        complement(323880..324353)
FT                   /transl_table=11
FT                   /locus_tag="RL0289"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05779"
FT                   /db_xref="GOA:Q1MMM3"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMM3"
FT                   /protein_id="CAK05779.1"
FT                   /translation="MSKTTRATQLLSQAGVAFTVHAYDYDPNAERVGLQAAEALGEAPH
FT                   RVLKTLMAEVDGKPVCVVVPSDREVSMKKLASAFHGKSAHMMKPADAERLTGYHVGGIS
FT                   PFGQKKTVPTAIEEAALAEPLVYINGGQRGLQVRLDPKAALKALKAVAAPLIA"
FT   CDS_pept        complement(324386..324736)
FT                   /transl_table=11
FT                   /locus_tag="RL0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05780"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMM2"
FT                   /protein_id="CAK05780.1"
FT                   /translation="MAVTIYGIKNCDTMKKARNWLEEHSVAYEFHDYKALGIDRTHLEA
FT                   WIDEAGLDTVLNRAGTTFRKLPDAERENLTREKAIQLMLDQPSMIKRPVLEAEGKLLVG
FT                   FKPEIYAGTFGS"
FT   CDS_pept        complement(324858..325919)
FT                   /transl_table=11
FT                   /locus_tag="RL0291"
FT                   /product="putative arginine catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05781"
FT                   /db_xref="GOA:Q1MMM1"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMM1"
FT                   /protein_id="CAK05781.1"
FT                   /translation="MDVSEIIIPGDTPGTEWRLPVLRFKGHDPKAPKIYIQAALHAGEL
FT                   PGTVLLHFLCERLRQAEDQGGIAGDITIVPQANPIGAAQSHFGELQGRFDLGSRTNFNR
FT                   DFPLISIVDRATLTEDLDDYPATDRLKRQLLHMALGADLVLDLHCDDESLQYAYIDEAF
FT                   WPEAADLAAALEMEAVLLSDGESSAFEEAVGFAWKYEVPGERRPRLPGKLSVTVELRGK
FT                   RDVDPVLAKKDADGLWHFLSARGIVGDGKPAATVFSGPAVPLDNVEIIRTPEGGAVLFH
FT                   RDIGERVAEGDLLATIVTRPGQPGGSIELTAPQDGLILTRTSDRLVRRRGDLMKIVCDE
FT                   PSKASRKAGTLEN"
FT   CDS_pept        complement(326021..326629)
FT                   /transl_table=11
FT                   /locus_tag="RL0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05782"
FT                   /db_xref="GOA:Q1MMM0"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMM0"
FT                   /protein_id="CAK05782.1"
FT                   /translation="MNQISFDFEDRRSRRRRPGENHSGGHRLFFALCPPAAVERQAASI
FT                   ADDYGKAFSLSAKPRLTTLHVTIIGIDDYEELPEDAVFAARQAGATVESAPIAITFDRI
FT                   MSFRREGKARPLVLYGEGGLRLLTRLHVQLGVGMHNAGLRHNISRDFTPHMTLLYDRKT
FT                   VPTASLDTPVSWTASEFLLIHSVLGKTEHRIIDRWPLLG"
FT   CDS_pept        326890..327453
FT                   /transl_table=11
FT                   /locus_tag="RL0293"
FT                   /product="putative methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="Codons 50 to the C-terminus are similar to codons 35
FT                   to the C-terminus of Mycobacterium bovis. Ogt
FT                   UniProt:OGT_MYCTU (EMBL:HS768224) (165 aa) fasta scores:
FT                   E()=8.5e-11, 41.129% id in 124 aa, and entire protein is
FT                   similar to Rhizobium meliloti (Sinorhizobium meliloti).
FT                   putative methylated-DNA--protein-cysteine methyltransferase
FT                   (ec 2.1.1.63). UniProt:Q92TT2 (EMBL:RME591985) (183 aa)
FT                   fasta scores: E()=2.1e-53, 79.670% id in 182 aa, and to
FT                   Mycobacterium bovis. ogt UniProt:OGT_MYCTU (EMBL:HS768224)
FT                   (165 aa) fasta scores: E()=8.5e-11, 41.129% id in 124 aa,
FT                   and to Rhizobium meliloti (Sinorhizobium meliloti).
FT                   putative methylated-DNA--protein-cysteine methyltransferase
FT                   (ec 2.1.1.63). UniProt:Q92TT2 (EMBL:RME591985) (183 aa)
FT                   fasta scores: E()=2.1e-53, 79.670% id in 182 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05783"
FT                   /db_xref="GOA:Q1MML9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MML9"
FT                   /protein_id="CAK05783.1"
FT                   /translation="MAETTHHYLIFETAGGFCGIAWSDAGITRFQLPTKSAEATERLLL
FT                   RRLPDAEAGAPTPAVLETVAAVKRYFQGEETDFSGVDLDLAGQDAFFRDIYAAARRVGW
FT                   GRTTTYGALAKELGVGPEAARDVGQAMAKNPVALIIPCHRVLAAGGKIGGFSAPGGSSS
FT                   KARMLELEGVNLGPPPPAQQSLGF"
FT   CDS_pept        complement(327565..328299)
FT                   /transl_table=11
FT                   /locus_tag="RL0294"
FT                   /product="putative short-chain
FT                   dehydrogenase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05784"
FT                   /db_xref="GOA:Q1MML8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MML8"
FT                   /protein_id="CAK05784.1"
FT                   /translation="MSDIKGKVIAITGASSGIGEAAAKVLAAAGAHIVIGARRTERLEE
FT                   LAGEIAATGGTVRLRQLDVTDRSQVEAFAGFARSEFGRLDVIVNNAGVMPLSPLEALKV
FT                   DEWDRMVDVNIKGVLYGIAAALPIMKAQGSGQIINLSSIGGHSVSPTAAVYCATKFAVR
FT                   AISDGLRQETDRIRVTVISPGTTTSELADTITDPTARDAMKAFRAITISPEAVANSILY
FT                   AVSQPDDVDVSEIIIRPTASPH"
FT   CDS_pept        complement(328444..328818)
FT                   /transl_table=11
FT                   /locus_tag="RL0295"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Codons 50 to the C-terminus are similar to Rhizobium
FT                   meliloti (Sinorhizobium meliloti). hypothetical protein.
FT                   UniProt:Q930M5 (EMBL:B95283) (83 aa) fasta scores:
FT                   E()=1.2e-24, 85.526% id in 76 aa, and entire protein is
FT                   similar to Agrobacterium tumefaciens (strain C58/ATCC
FT                   33970). hypothetical protein atu0859 (agr_c_1570p).
FT                   UniProt:Q8UH26 (EMBL:A97464) (116 aa) fasta scores:
FT                   E()=5.8e-24, 59.459% id in 111 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05785"
FT                   /db_xref="InterPro:IPR020955"
FT                   /db_xref="InterPro:IPR038646"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MML7"
FT                   /protein_id="CAK05785.1"
FT                   /translation="MRRIFKSPVLRFFTAVTLAGAATSSFGADTVNDRETQQQQTSENR
FT                   MQQHPYVGMWVTDDGRVRHELLPNGRYDEARGSRESAYRGRYEVTGSHIEYWDDTGFTA
FT                   DGDFVDGNTLHHGGMVLRRK"
FT   CDS_pept        328924..329817
FT                   /transl_table=11
FT                   /locus_tag="RL0296"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05786"
FT                   /db_xref="GOA:Q1MML6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MML6"
FT                   /protein_id="CAK05786.1"
FT                   /translation="MVDDLEGISVFLAVAEARNFRLAGERLGVTRSAVSQALQRLEDRV
FT                   GVALVQRTTRSVSLTEAGEVFFDAVRPSVRQVKDAMQTVREMQARPSGLLRITVSSIAE
FT                   NFLSGTLLAGFMEACPDIKLDITITDDEFDIVEAGFDAGVRLGEVIEQDMIAISVSEEQ
FT                   RQCAAASRSYLERRGHPRHPGELQKHACIGWRPRPDTAPYRWEFTENDRDFDVSVDPTV
FT                   TTNDMGMMIRMACAGAGITFGMVETFQPYIERGELVPLLEDFCPPFAGFYLYYPRRQRQ
FT                   PLKLRALVDYVRKSKG"
FT   CDS_pept        complement(329814..330104)
FT                   /transl_table=11
FT                   /locus_tag="RL0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05787"
FT                   /db_xref="GOA:Q1MML5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MML5"
FT                   /protein_id="CAK05787.1"
FT                   /translation="MAHSENLIATVSTNGQIILPKTIRQRREWEAGTRLIVEEAAEGVL
FT                   LRQAPAFSQTKPDDVFGMLPFSGEPKTLEDMEADVLAEARRRDGLEFADGI"
FT   CDS_pept        complement(330292..330726)
FT                   /transl_table=11
FT                   /locus_tag="RL0298"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05788"
FT                   /db_xref="GOA:Q1MML4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MML4"
FT                   /protein_id="CAK05788.1"
FT                   /translation="MSTESIFQTHLVLGYVAWLICFGAYILPWLTSMDRVRAHRAIATL
FT                   HSFRFFGLVFILPGVVGPNLPASFAAFAAYGDLAAGLLAMLALITIRIRPIFWLFVVAF
FT                   NLVGMGDLALDYYHAIQAGLPAQAGSWAPHMRYRSFTCPC"
FT   CDS_pept        330805..331776
FT                   /transl_table=11
FT                   /locus_tag="RL0299"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05789"
FT                   /db_xref="GOA:Q1MML3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MML3"
FT                   /protein_id="CAK05789.1"
FT                   /translation="MKQNFTVRQGALDGVEAFLSVAQHRSFRKAAGELGVTPSAISQAV
FT                   RALEERVGAVLFIRTTRSVGLTEAGERFLTRAKPAFEELVAASALARELGQRPAGLLRL
FT                   TVPPAVVPILLEPLIASFCQAFPEIEVEIAANEELVDIAADGFDAGIRLGQFIAADMVA
FT                   VRLTPSFPLVVVGSPEYLRRRGWPERIDDLRQHACIRMRRSNGSIAPWSFVIGKKPIEA
FT                   VVSGPLIAHDFPTMLGATIGDMGLAQVPEPIAAGPVKAGKLVRVLEVFEPVAPGVFLYY
FT                   PSRHQVMPKLRAFIDHVKSRADAADKTRIHIDDRQTPATKMR"
FT   CDS_pept        complement(331965..332456)
FT                   /transl_table=11
FT                   /locus_tag="RL0300"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05790"
FT                   /db_xref="GOA:Q1MML2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MML2"
FT                   /protein_id="CAK05790.1"
FT                   /translation="MSNVEKTMIIELTSHDFEAVLKGMAPHHLRLVQDSAIAPPDVLAM
FT                   LSRLAAEIGADFSPSAWMIVDDGEIVGLCSIVRVPQDGNIHIGYGIAPSRQGRGCTTRA
FT                   IGQLLEWARDDPRVALISAETGFENIASQRVLERNGFIRVGERIDAEDGPLICWEAMTV
FT                   "
FT   CDS_pept        332744..333625
FT                   /transl_table=11
FT                   /locus_tag="RL0301"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05791"
FT                   /db_xref="GOA:Q1MML1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MML1"
FT                   /protein_id="CAK05791.1"
FT                   /translation="MTAALRNYHERMLRVLDYVDQHLDDDLDLDLLSGVAAFSKFHFHR
FT                   QFTATFGLSVHRYIQLARMKRASYRLVYRDEERVTDIAMDAGYDAPDAFARAFRQRFGQ
FT                   SPSSFRKSPDWEPWLAAFGPLDNARSKLMQKTFTTDDVIIRNVPTTPVAIMEHRGDPAT
FT                   LGATIQRFIAWRKAAGLHPRTSPTFNVWRSERRPQSPTDYSVDLCVGTDQAIEANGEEI
FT                   KAGEIPGGRCAVLRVVGNTDNLEPAALYLYRDWLPASGEEVRDFPIYCQRLSFFPEVPE
FT                   HEAVAELFLPLK"
FT   CDS_pept        complement(333866..334813)
FT                   /transl_table=11
FT                   /locus_tag="RL0302"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /product="putative arac-like transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05792"
FT                   /db_xref="GOA:Q1MML0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MML0"
FT                   /protein_id="CAK05792.1"
FT                   /translation="MTTDPFSDILKLARAETLVTGGFTAGGPWAIRFPVPKTIKFFAVV
FT                   KGGCWVTLDGEAPIRFATGDVGLLSAPRAFVLASDPDVSPVDAMTLFSGVGRTTAQLGD
FT                   GDDFAHVGGHVLLDPVSGRLLADVLPPWIHVQANLPAATTFRWLLDRLVEERTSDLPGA
FT                   ELASAQLAQLLFIQILRAHLAGAHCAGSGWLRALSDPRIAPALRLMHEDPARAWHLEDL
FT                   AAACAMSRTTFADRFRTVAGVAPLTYLTQWRMRLAEQALRDEAGKSVALIARSVGYTSE
FT                   SAFSNAFKRVAGKSPKSYRDNNMHKRSLTQVKDI"
FT   CDS_pept        334915..335910
FT                   /transl_table=11
FT                   /locus_tag="RL0303"
FT                   /product="putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05793"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMK9"
FT                   /protein_id="CAK05793.1"
FT                   /translation="MILSKRQLGHQGLKVGAIGLGCMGMSQSYGPANEAESIATLHRAI
FT                   ELGCDFFDTAEGYGPHTNEELLGRAFGDRREKVVLATKFGFRFENGRQLGTETDSSPAA
FT                   IRQTVEGSLRRLQTDHIDLLYQHRIDRKVPIEDVAGTVGELVKEGKVRFFGLSEVGAAT
FT                   LRRAHATHPVSALQSEYSLWERNLEADVIPVLRDLGIGLVPFCPLGRGFLAGGVKRAED
FT                   YPEGDTRRIDERYQGENYGANLRAARAVLDIAEAKGVKPAQIALAWLLHKGDFIVPIPG
FT                   TKRRAYLEQNVAADAVRLTPAEMQTLDDALATGTVSGNRYPDWIMAGIDR"
FT   CDS_pept        335939..336973
FT                   /transl_table=11
FT                   /locus_tag="RL0304"
FT                   /product="putative CoA reductase"
FT                   /note="N-terminus to codon 270 is similar to the N-terminus
FT                   to codon 280 is similar to Zea mays (Maize). Ccr2
FT                   UniProt:Q84J56 (EMBL:AY227029) (341 aa) fasta scores:
FT                   E()=1.5e-21, 37.407% id in 270 aa, and to entire protein of
FT                   Rhizobium loti (Mesorhizobium loti). probable cinnamoyl-CoA
FT                   reductase. UniProt:Q98JE8 (EMBL:BA000012) (355 aa) fasta
FT                   scores: E()=1.5e-96, 70.381% id in 341 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05794"
FT                   /db_xref="GOA:Q1MMK8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMK8"
FT                   /protein_id="CAK05794.1"
FT                   /translation="MSGELVLVTGGSGFIAQHCILALLRAGYRVRTTLRSLSREAEVLS
FT                   NLRTGGAEPGDRLSFIAADLTADDGWAEAAAGCTYVIHGASPTPSGDQVCEEDWVRPAV
FT                   DGNMRVLRAARDAGVKRVVLTSAFGAIGVGHKPRSRPFVETDWSDLNGHVAPYQRSKTL
FT                   AERASWDFIAREGGGLELASVNPTTVLGPALGPDYSHSIRLIKNLLDGQQGCPKINTCV
FT                   VDVRDVADLHLRAMTDPAARGERFLAASGESLWMVEIARLLKQRLGKGASKVSTRVLPN
FT                   WFVRVVALFNPAMKGIVPHLGVNMNASSEKAQRLLGWEPRSREEAIGATADSLIRLGRV
FT                   NMKD"
FT   CDS_pept        337174..337704
FT                   /transl_table=11
FT                   /locus_tag="RL0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05795"
FT                   /db_xref="GOA:Q1MMK7"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMK7"
FT                   /protein_id="CAK05795.1"
FT                   /translation="MAKLVFGMNQSLDGYVDHTAFGPSPTLFRHFIEEAQRQAGSVYGR
FT                   QMYEVMRYWDDEHPEWDAERHAFAAAWRNQPKWVVSRSSKSVGPNARLVEEDLAAAIRE
FT                   LKAERDGEIEVAGPNLAQSLTELGLIDEYRIYLHPVVLGHGKPYFAGPRPPLRLMAHDR
FT                   IGEDVIRLTYVPA"
FT   CDS_pept        complement(338008..338655)
FT                   /transl_table=11
FT                   /locus_tag="RL0306"
FT                   /product="putative isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05796"
FT                   /db_xref="GOA:Q1MMK6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMK6"
FT                   /protein_id="CAK05796.1"
FT                   /translation="MTFRNGLASLLRPEDSVLVLIDHQPYQLANLNSHDPHAVVNNSTA
FT                   LAKAARAFGVPTILTSVIADRGGLIFPQITDVFPGQEVIDRTFINTWEDRKVVDAVKAT
FT                   GRKQLIIAGLWTEICVAMPVIQALGEGWDVTVITDASGGTSVEAHEVAIQRMIAAGANM
FT                   MTWLALASEWQRDWARTEHAAELTEVLKQHAAGSGIAYLWEQQLLNTPVPRA"
FT   CDS_pept        338809..339708
FT                   /transl_table=11
FT                   /locus_tag="RL0307"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05797"
FT                   /db_xref="GOA:Q1MMK5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMK5"
FT                   /protein_id="CAK05797.1"
FT                   /translation="MDIEELQTFVEVADAGGVSPAALRLGVSKSIVSRRLFRLEAELGV
FT                   QLLARTTRGAALTEAGVTFRDYAARVCAEIDVARETILPAGDLRGRLRVAVPLSFGQTH
FT                   FAPILAEMARRHPQLHIHTCYSDRFVDLITEGYDCAIRVGYLQDSNLIARRVGPIYGKF
FT                   VASPDYIKAHGSPETPEELIAHEALMQGTEAWQLMDGDKIITVRPQGRFKADNGTALVA
FT                   AAVAGLGIAYLPDCLTHEFIASGALVPVMTHYPPPPAGAYVIRPPGQHPARKIRVLTEL
FT                   LIEYCEPAPSFHDLGWAD"
FT   CDS_pept        complement(339705..342569)
FT                   /transl_table=11
FT                   /locus_tag="RL0308"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05798"
FT                   /db_xref="GOA:Q1MMK4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMK4"
FT                   /protein_id="CAK05798.1"
FT                   /translation="MEELEEANVTTYCFGDCRFIPARQLLLHREVPIRVGSRAIDLLHA
FT                   LVRRPGIVVSKDELFRAAWPNVFVDESNLKVNIAVLRRALAQVEPDLTCIATVPGRGYR
FT                   FVAPLRVLGVADEAALSDAVRGISGELPAPPALIGRDEAMADLAGALAETRLLTIVGPP
FT                   GVGKTSVAVATARQVGESLKDGVCFVDLAAIDSPQLVAPAIAFACGLNSNLVNILAGLV
FT                   EMLRDRELLLVLDNCEHVLNAAATVADHLNHALPRLLVVTTSREPLRCRRESVYRLAPL
FT                   RFPPAGSELDAAAALDFSAVELLVQRAVTQGYRLDDADASSLAAISRRLDGIALAIELA
FT                   APRLSTDGPAKLADLLENAFDAFVLQGNAAAPRHMTLMAMLDWSYRLLPEREACLLRHL
FT                   SLFSGTFTLNDVVGVCGHLGSAEDVGAWLESLAARSLSSVSYHSGHRYYRLLDSTRSFA
FT                   SERLRASGEEQAAMASYTHYLLALFEQGEVEWNWRAREDWTARYGRWGNDLHRAIDWAW
FT                   RDGHNRELGIRLTAAAIPLWNELSSLSETRTRVAEVVEGLNGLAMDDVVLRLKLVSAHA
FT                   LNLNFGDDRGPEIEAAWREARTLADETGNVEYRLRTTMGWAGAKTFAGNHRQVLSALSE
FT                   LRGLLNQEGGHSAVPDVTRLELVNRFYCGDIETSVAGLKALARSHSTVAYRSQTSRFQL
FT                   DRFVGIRSYLAPMLWVVGEHREAFDVAQECILAATTIGHPVSLMHALAVGGLSVSLWSG
FT                   LLDVAQDQLKRLEAQYQICQLDIWPPLIRFYRAAIDTAGRDAQAVDRMRDAIGGLRSRN
FT                   LRIHFAMNLAMLADAALSHNRLDVARAVAAEASDYLERDEAWCRSELFRVIGLTRWREG
FT                   DVLSAAENLAMAVRAAQRSGALTLELRAATQQAKLALQTGHGDIALSHLACVYQRFESG
FT                   LHTADVVAARDQLEVGQMISRGGS"
FT   CDS_pept        342817..343248
FT                   /transl_table=11
FT                   /locus_tag="RL0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05799"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMK3"
FT                   /protein_id="CAK05799.1"
FT                   /translation="MPRTLNTLTLSDAKQMLQAGEAKAANLGIPYNIAVVDAGGALIAF
FT                   TRQDGALAGSIDLAIGKAKTARLFDKTTEYLAELAQPGAPLFGIEQSNGGNVVIFGGGL
FT                   PVKYDNQIIGAVGTSAGSVEQDIAVAVAAAEAISPNAKP"
FT   CDS_pept        343260..344315
FT                   /transl_table=11
FT                   /locus_tag="RL0310"
FT                   /product="putative alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RL0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05800"
FT                   /db_xref="GOA:Q1MMK2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMK2"
FT                   /protein_id="CAK05800.1"
FT                   /translation="MKAARILEYKKALVLEDIPVPDIQPDEVLVKVAACGMCRSDVLLI
FT                   DGFFQGYGDIPPPVIPGHEITGTIEKIGSVVPKVAGIEEGDHVVVAPGWGDGVCRHCMV
FT                   GDTHICPNVRWPGFGPDGGFAEYIPVPARYVIKVPKHLKFEQLAPLTDAGLTPYRGLKK
FT                   IRNAGGLGPDRVIGVFGIGGLGAYAVQYAKLLGAGGPVVAVARNEEKLQVAKKYGADHI
FT                   IAIEGKSSEDVGKELRKATGQDKFDAIIDCAGATEMMQLAFSRLAISGHYADVGFIGDR
FT                   IDIPLFPRVSGEQTFHGSFWGNNADLTEVMALAAEGKIQHTIKTISFDDINEYIDLMRD
FT                   NKIVGRAVVTF"
FT   CDS_pept        344437..345120
FT                   /transl_table=11
FT                   /locus_tag="RL0311"
FT                   /product="putative DJ-1/PfPI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05801"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMK1"
FT                   /protein_id="CAK05801.1"
FT                   /translation="MTQHVLFIVTNAAVIGPHSRKTGFFFAEVAHPFDVLDKAGIAVEF
FT                   ASPAGGWTPYDAYDEKDPAQKEFLESKAFRRLNHSRKLSEVDAADYDAILVPGGLGPMV
FT                   DIQRNADVQKAIVRAWTTGKLVTAVCHGPCALLSVDLGDGTPFVRGKKLTSFSKKEEYD
FT                   YARDDVPYELEDALRAEGAEYSSASNWEPHVVVDGRLITGQNPASAGPLGKELVAALKR
FT                   AAVPA"
FT   CDS_pept        345230..345529
FT                   /transl_table=11
FT                   /locus_tag="RL0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05802"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMK0"
FT                   /protein_id="CAK05802.1"
FT                   /translation="MTQSPAKITAVLTAHPGKAADLRSLLVGMAPLCRAEPGNLRWDVW
FT                   RDQAVPERYVLDELYRDGEAVEAHRRTPHYQDYLTRIPSLAERSALVLEAVAVS"
FT   CDS_pept        345555..346931
FT                   /transl_table=11
FT                   /locus_tag="RL0313"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05803"
FT                   /db_xref="GOA:Q1MMJ9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMJ9"
FT                   /protein_id="CAK05803.1"
FT                   /translation="MLEVVQAFDRKHIADLPTDDAAALESKLETARARFLNRNDWLAPH
FT                   ERMAVLRRLADLVGLQREVFAKRIACEGGKPYTDALVETDRAIDGIRNAADVLRTRGGV
FT                   EIPMGLTQASDNRRAWTIQEPIGVVAAISAFNHPLNLIVHQMAPAIATGCPVIIKPAAA
FT                   TPLCCLELVKLVHEAGMPEGWVQAFLPESRVLSSAFASDARIAFLSFIGSAEVGWRLRA
FT                   NLAPGTRCALEHGGVAPVIVDRSADLDAIIEPLAKGGYYHAGQVCVSVQRIYVHAELKE
FT                   AFIERFAARVEQLRVGDPTHAETEVGPLITPAEATRVETWIDEAATAGARRIGGGRLSD
FT                   TTLKPAILVDPPRDTKVSTHEIFGPVTCIYGYDEVEDAIAAANSLPVAFQASIFTRDLD
FT                   VAFNAAEKLDASAVMVNDHSAFRTDWMPFAGRRESGYGVGGIPFTAREMTAEKMIVFKR
FT                   "
FT   CDS_pept        346987..348213
FT                   /transl_table=11
FT                   /locus_tag="RL0314"
FT                   /product="putative transmembrane transporter protein"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Agrobacterium tumefaciens (strain C58/ATCC 33970). MFS
FT                   permease. MFS permease. UniProt:Q8UGN6 (EMBL:HS481254) (428
FT                   aa) fasta scores: E()=1.7e-50, 42.175% id in 377 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05804"
FT                   /db_xref="GOA:Q1MMJ8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMJ8"
FT                   /protein_id="CAK05804.1"
FT                   /translation="MFGKAYEAQCQATKFAPSSAHHESQALALFSLALGSFCIGTSEFA
FT                   SMGIIQLYAEDFGIDIPTATNAITGYAFGVVLGAPLATLVAARLNRRTLLLCLMALWVV
FT                   GNVLSSMASNIGLFAAARFISGVPQGAYFGAGAVIAAYFFGADRAGKAFALVMTGLTIA
FT                   TIFGSPLATFLGQTLGWRNTYLAMAALGAVAFLALFLFVPRTEALNGGSVLHELSGLRR
FT                   WNVWAMIVVAALGISSIFAVYAFIGPLVTDVVQLDQSTIPLALGVFGVGMTVGNAVGGQ
FT                   LADIFAFRGLILGYGITLILLVILSCFGTKVWVFMPCLFGLGAAMMAAIPTIQVRMTHF
FT                   APEAPTLMGAMNLAALNVANALGAWGGGLVIAAGYSVLFSPLAGFVLTAAGLLVYFIAL
FT                   PRSASVVQA"
FT   CDS_pept        complement(348345..349907)
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="RL0315"
FT                   /product="putative GMP synthase [glutamine hydrolysing]"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:RL0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05805"
FT                   /db_xref="GOA:Q1MMJ7"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMJ7"
FT                   /protein_id="CAK05805.1"
FT                   /translation="MTQTAHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEG
FT                   FHRLQPKAVILSGSPASTVDEGSPRAPDIIFDSGLPVFGICYGQQTMCMQLGGKVESGH
FT                   HREFGRAFLEVDRDCQLFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPYAFI
FT                   ADEKRKYYGVQFHPEVVHTPDGAKLIGNFIHNIAGIKGDWSMSAYRQKAVEQIRAQVGD
FT                   KRVICALSGGVDSSVAALLIHEAVGDQLTCILVDHGLMRKDEAAGVVAMFREHYNLHLL
FT                   HVDAADRFIGELEGVSDPETKRKIIGRLFIETFEEEARKLGGADFLGQGTLYPDVIESV
FT                   SFTGGPSVTIKSHHNVGGLPERMKMQLVEPLRELFKDEVRALGRELGLPDSFIGRHPFP
FT                   GPGLAIRCPGGITREKLEILREADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDG
FT                   RTYEFVCALRAVTSVDGMTADFYHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTI
FT                   EWE"
FT   CDS_pept        complement(350000..350638)
FT                   /transl_table=11
FT                   /locus_tag="RL0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05806"
FT                   /db_xref="GOA:Q1MMJ6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010050"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMJ6"
FT                   /protein_id="CAK05806.1"
FT                   /translation="MKFELKSVAGKSILFVMAAEAEYGPFLRSRIEPLMTGVGPVEAAI
FT                   ALSKTLARLDAVDDLPDLVVSLGSAGSAKLEQTEIYQVTSVSYRDMDASPLGFEKGKTP
FT                   FLDLPATLELPLRIPGIAEASLSTGGNIISGVAYTNIDADMVDMETYAVLRACQGYKLP
FT                   LIGLRGISDGAVELQHISGWTEYLHIVDRKLSYGVDSLFTALEDGVFWF"
FT   CDS_pept        complement(350635..351144)
FT                   /transl_table=11
FT                   /locus_tag="RL0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05807"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMJ5"
FT                   /protein_id="CAK05807.1"
FT                   /translation="MSSLSNAARHANFAAARGADMSETDRGDFRARIRRNFARQAAMET
FT                   IGAELTRVEHGVVEIELPFDVKLTQQHGILHAGIISAALDSACGFAAYSVIDPEASILT
FT                   IEFKVNLMSPGRGDRFLFRGEITKPGSTIIVADGRGYAISDGPAKLIASMTGTMMVIRG
FT                   REGITG"
FT   CDS_pept        351355..352431
FT                   /transl_table=11
FT                   /locus_tag="RL0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05808"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMJ4"
FT                   /protein_id="CAK05808.1"
FT                   /translation="MTTISQSVRNFEAWLAGELGDDLVKDDLREKHEKMRSDDFVFLRA
FT                   TYWRWCEIILDICPELTGAPQVLAIGDTHLENFGTWRDVEGRLVWGVNDFDDAAVMPYA
FT                   LDLVRLAASAVLARSGDGPSVRMIGELILSGYRRGLENPLPVILERDHKWLRKALLLPN
FT                   SERREFWEKYEMLQPGKKPAPPAYVKALADALPLGSGPFLAKPRSGGTGSLGRPRFVAY
FT                   AEWQGGPVLREAKALVPSAWSLRHNPQDVAIHASEIANGRARSADPHYRASGRILVRRL
FT                   SPNSCKVEIDRHPEILLSPTMLELMGFEIANCHSGDAAAAAAILKDLAARGNEWLHEAA
FT                   RAAASSISTEQKAYSRAG"
FT   CDS_pept        complement(352488..353567)
FT                   /transl_table=11
FT                   /locus_tag="RL0319"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05809"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008311"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMJ3"
FT                   /protein_id="CAK05809.1"
FT                   /translation="MMQSAAINRRSFVKAAGLGFLATLTPRSLMALERADAVYASGIRA
FT                   ADGSFAIATVTERGEIVDQVALPARAHGIAFSASTGKTVAFARRPGTYAMIFDPWNKSE
FT                   PIVISSREDRHFYGHGAFSPDGRLLYASENDFDGNRGMIGLYDATDRFTRIGEFETYGI
FT                   GPHDMTVSDDGRLLIVANGGIETHPDFGRTKLNLGEMQPSLALIDAATGALVEKHVLPA
FT                   EWAELSTRHVDLDGAGRIWFACQYEGHRKDLPPLVGHFAKGEDLSFIDLPEETTRRLAN
FT                   YVGAIAVNRSEGLVGITSPKGGASVTIDARTGKMLAETSVPDAAGIAPARNGFAVSSYD
FT                   GDFLSTRSDVAWDQHIVRI"
FT   CDS_pept        complement(353572..354675)
FT                   /transl_table=11
FT                   /locus_tag="RL0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05810"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMJ2"
FT                   /protein_id="CAK05810.1"
FT                   /translation="MMRLWHPLLCLTLIGLATSAAAQTATPPAGLNEDAVPAVMQRAVD
FT                   EVIRPGYRNMQQSAARLTTAMKDLCSDGTQQTLDKAKSTFDDTIRYWSIIEIVQTGPVI
FT                   QDNLFEHILFYPDRKGVGLKQVQALIAKADPNDATVDAIAGKSVALQGLTALEYVLYGN
FT                   GSDDLVGQKGSFRCLYGEAVAGNIQREAGEVVAAWEKPDGVQASWKHPGPQSNDFMDNK
FT                   EAVTALLGILVHGAENVRDQRLEQFYKGKDTAPRPRMAIYWRSKNTWKSMAANLEGLRT
FT                   LWQKAGMAELLPPDKQSIAASIDEDFKSLLDSVPKLNPDIDVAISDAEKAKLDTLLAES
FT                   RDLITRISDEYGAAIGLSAGFSFSDGD"
FT   CDS_pept        complement(354672..356210)
FT                   /transl_table=11
FT                   /locus_tag="RL0321"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05811"
FT                   /db_xref="GOA:Q1MMJ1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMJ1"
FT                   /protein_id="CAK05811.1"
FT                   /translation="MSHAPARRLIASAALCATLAGFSVSIAAGFDLPRKRTDLSEADLK
FT                   RVADVTRPTADFSKAEQYEAMQAGATTSIDPVTEDSFSHISANIPFEEEQNFKLGNALF
FT                   RKLWVSSPSSTQASDGLGPLFNARSCMSCHVNDGRGRPPEGAASATSMFLRLSRAATTP
FT                   EEEKAVARADVVNFPDPVYGHQLQDLAVPGLAAEGKMAISYREERVTLGDGETVSLRRP
FT                   SYAVTNLGYGPLDPATTISPRVASAMIGLGLIEAIREADILAHADPDDADGDGISGKAA
FT                   IVRDHRSGKIALGRFGWKAQNATVRDQSADAFANDIGISTPDQPNAQGDCTKAEEKCLD
FT                   MPTGVQKRLGAEEAPGPILDLVTFYSENLAVPARRKASFAETLRGKRIFYESGCISCHV
FT                   PKFVTRRDTPEKAQSFQLIWPYSDFLLHDMGDGLADGQQVGLASGREWRTPPLWGIGLT
FT                   RTVSGHSFFLHDGRARSLTEAILWHGGEAERARNAFSSLPKDDRAALITFLESL"
FT   CDS_pept        complement(356258..357532)
FT                   /transl_table=11
FT                   /locus_tag="RL0322"
FT                   /product="putative iron-regulated protein"
FT                   /note="N-terminus to codon 130 is similar to N-terminus to
FT                   codon 150 of Synechococcus sp. (strain PCC 7942) (Anacystis
FT                   nidulans R2). IrpA UniProt:IRPA_SYNP7 (EMBL:SSIRPA) (356
FT                   aa) fasta scores: E()=0.0048, 32.558% id in 129 aa, and
FT                   entire protein is similar to Agrobacterium tumefaciens
FT                   (strain C58/ATCC 33970). hypothetical protein atu0288.
FT                   UniProt:Q8UIK5 (EMBL:AE009000) (447 aa) fasta scores:
FT                   E()=1.2e-127, 81.446% id in 415 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05812"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMJ0"
FT                   /protein_id="CAK05812.1"
FT                   /translation="MKLNTFRAAVLAIAPAALLALPAHAETDAAAVVKHYADVAHAKYE
FT                   DSLTTAKALDAAIDAFLKAPTDATLKAAREAWIKARVPYQQTEVYRFGNPIVDDWEGKV
FT                   NAWPLDEGLIDYVDASYGTESDENSLYVANVIANKTIKIDGKDVDASKLTPEFISGTLA
FT                   EAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYDLKNCTHGNCDRRAEYLKS
FT                   ASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGELAGERMKLGLL
FT                   LHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDLVAAKDKALD
FT                   AEVEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAIDGLIDQTKSVQRV
FT                   IAALDLGTVQLEGSDSLDNPNAVFQ"
FT   CDS_pept        complement(357822..359111)
FT                   /transl_table=11
FT                   /locus_tag="RL0323"
FT                   /product="putative methyltransferase"
FT                   /note="Codons 125 to the C-terminus is similar to codons
FT                   145 to the C-terminus of Escherichia coli. RsmB
FT                   UniProt:RSMB_ECOLI (EMBL:CEK131EZR) (429 aa) fasta scores:
FT                   E()=1.2e-21, 30.392% id in 306 aa, and to Agrobacterium
FT                   tumefaciens (strain C58/ATCC 33970). Sun UniProt:Q8UIK4
FT                   (EMBL:AE007967) (AGR_C_495p aa) fasta scores: E()=4.5e-121,
FT                   74.533% id in 428 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05813"
FT                   /db_xref="GOA:Q1MMI9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMI9"
FT                   /protein_id="CAK05813.1"
FT                   /translation="MRLGGRLEGAISVLADIDARKRPVADALKDWGLAHRFAGSGDRAA
FT                   IGNIVYDALRMRLSHAWLMDDDSPAAIAHGVMFRQWGFSPDSLATELADDKFAPAPLSA
FT                   DAVSAFQSRSLDDAPPHIRGDIPEWVQPSFEQAFGAGWLAEAQALAARPTLDLRANLLK
FT                   ASRDKVVKALERANAHAAKIARYGIRIAAGEGASRLPNVTAELSFQKGWFEVQDEGSQI
FT                   VADLVLAHDGEQVLDYCAGGGGKTLAMAAAMQNKGQVHAYDADRKRLAPIIERLKRAGT
FT                   RNVQVHDDARALSALAGRCDKVLVDAPCTGTGTWRRRPDTKWRLTAKNLDERTAQQQDA
FT                   LAQASSFVKSGGELIYVTCSVLPQENEEQARRFTADNPDFQIVSALPAWDQLFGKDAPR
FT                   PHSSDGLSVTLTPASTDTDGFFFCRMQRKG"
FT   CDS_pept        complement(359256..359618)
FT                   /transl_table=11
FT                   /locus_tag="RL0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C-terminus from codon 280 of Anabaena sp.
FT                   (strain PCC 7120). RlpA-like protein. UniProt:RLPA_ANASP
FT                   (EMBL:AP003591) (371 aa) fasta scores: E()=1.8e-15, 61.702%
FT                   id in 94 aa, and to entire protein of Agrobacterium
FT                   tumefaciens (strain C58/ATCC 33970). rare lipoprotein a
FT                   (agr_c_498p). UniProt:Q8UIK3 (EMBL:HS393249) (122 aa) fasta
FT                   scores: E()=1.3e-31, 75.630% id in 119 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05814"
FT                   /db_xref="GOA:Q1MMI8"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMI8"
FT                   /protein_id="CAK05814.1"
FT                   /translation="MKNIRRSIIAAVTIAACSSMLPAEGFAGNGCGGASWYALRSKTAS
FT                   GERMNPAILTAAHRSLAFGTKVKVTNRNNGRTVVVRINDRGPFIRGRVIDLSRAAAQNI
FT                   GMVSSGTAKVCYQVVS"
FT   CDS_pept        complement(360028..360897)
FT                   /transl_table=11
FT                   /locus_tag="RL0325"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05815"
FT                   /db_xref="GOA:Q1MMI7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMI7"
FT                   /protein_id="CAK05815.1"
FT                   /translation="MHVMIFGCGYSGTAIAKAFAGDGVRVSGTTRSPDKMDMLRQKGIE
FT                   AFLFDGESMEEGLRQALDSVTHLVQSIAPGKADPLLRLLGKDGARLLPKLEWIGYLSTV
FT                   GVYGDHQGAWVTEETPCLPVSGRSTERLEAEEGWLAMGRERGVPAAVLRLSGIYGPGRN
FT                   AFSNLDKGTARRLIKKDQVFNRIRVEDIGAAARFLSERGLGGIYNVTDDRPGPPQDVIV
FT                   EAARLMGVEPPPEQAFETAELTPMARTFYGENKRVSNAKLKAAGFAFSFPNYPMSLAQL
FT                   WRDGRWRG"
FT   CDS_pept        complement(360897..362054)
FT                   /transl_table=11
FT                   /locus_tag="RL0326"
FT                   /product="putative 4Fe-4S ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05816"
FT                   /db_xref="GOA:Q1MMI6"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMI6"
FT                   /protein_id="CAK05816.1"
FT                   /translation="MPEPDNDDKERRRRDNLTEFVRAESAAKGFDLCRITRPDAIPQAK
FT                   ERLGQFIDAGRHGTMDWMAETRDRRGDPRTLWSEVRSVVVFGLNYAPEEDPRAILDKPD
FT                   KAAISVYARNRDYHDVIKGRLKEIATRFAARAGADVKVFVDTAPVMEKPLAAAAGIGWQ
FT                   GKHTNLVSRVHGSWLFLGTMFTTADLVVDAPEADHCGSCRACLDICPTAAFPAPYQIDA
FT                   RRCISYLTIEHKGPIDADLRVLIGNRIYGCDDCLAACPWNKFASSASEMKLQAREDLKE
FT                   PSIAFLLTLGDAAFRAFFSGSPVKRIGRDRFVRNVLIAAGNSGDKVLIGPCRLLSDDPS
FT                   PVVRGMAVWALSRLMEAGEFAAFAAQRADERDDDVLNEWRLAGVG"
FT   CDS_pept        complement(362067..362759)
FT                   /transl_table=11
FT                   /locus_tag="RL0327"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05817"
FT                   /db_xref="GOA:Q1MMI5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMI5"
FT                   /protein_id="CAK05817.1"
FT                   /translation="MPTLYHHPMSSASRFVRLILAEYGYQADLIEEQTWEKRRDFLALN
FT                   PAGTLPVYVDDSMRALCGASVISEYLDETHGVLKRDRRLLAEDPFQRAEIRRLTEWFMQ
FT                   KMENDVTKPLARERVYKLQMTADQGGGAPDSKILRTARANIRQHMRYLTWLAGSRQWLA
FT                   GERMSYADLAAAASISILDYLGEIEWADSPVVKDWYQRLKSRPSFRPMLTERVRGLTPV
FT                   SHYADLDF"
FT   CDS_pept        362992..363789
FT                   /transl_table=11
FT                   /locus_tag="RL0328"
FT                   /product="putative undecaprenyl-diphosphatase"
FT                   /product="undecaprenyl-diphosphatase (ec 3.6.1.27)
FT                   (undecaprenyl pyrophosphate phosphatase) (bacitracin
FT                   resistance protein)"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:RL0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05818"
FT                   /db_xref="GOA:Q1MMI4"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMI4"
FT                   /protein_id="CAK05818.1"
FT                   /translation="MDYINAAILGVIEGITEFLPISSTGHLIIAEQWLGHRSDMFNIVI
FT                   QAGAILAVTIIYWRRLVDLVLGWRDPVNRDYAAKLIVAFLITAILGLVVKKLGFELPET
FT                   ATPIAWALIIGGIWMIFAEWAAARRPPHKEITWLVAILVGIAQIVAGVFPGTSRSGATI
FT                   FVAMLAGTGNRASATEFAFLVGIPTMYAASAYELLKTFRDGGAAGEDWTALGIAFVVST
FT                   VVAFIAVKWLLAYIRSNRFTLFAIYRIILGVLLLGMAATGLIA"
FT   CDS_pept        complement(364471..365451)
FT                   /transl_table=11
FT                   /locus_tag="RL0329"
FT                   /product="putative NADH-ubiquinone oxidoreductase subunit"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Neurospora crassa. nuo-40 UniProt:NUEM_NEUCR (EMBL:NCNUO40)
FT                   (375 aa) fasta scores: E()=2.1e-19, 29.032% id in 310 aa,
FT                   and to Rhizobium meliloti (Sinorhizobium meliloti).
FT                   putative oxidoreductase protein (ec 1.-.-.-).
FT                   UniProt:Q92SP0 (EMBL:SME591783) (EC ( 326 aa) fasta scores:
FT                   E()=3.5e-96, 77.301% id in 326 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05819"
FT                   /db_xref="GOA:Q1MMI3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMI3"
FT                   /protein_id="CAK05819.1"
FT                   /translation="MTLANLPPLVTVFGGSGFVGRHVVRALAKRGYNIRVAVRRPDLAG
FT                   FLQPLGNVGQISFVQANLRYRSSIDRAVDGASHVVNCVGILHETGRNTFDAVQEFGARA
FT                   IAEAARGAGATLTHISAIGADVKSDSDYGRTKGRAETAILSVKPDAVIFRPSIVFGPED
FT                   SFFNKFAEMARMSPILPLIGGGKTKFQPVYVEDIAEAVARAVDGKVAGGKVYELGGPEV
FT                   LSFRECLETMLKVTCRKNPLVSLPFGVASMIGSIASLIPFITPPITPDQVRMLKRDNVV
FT                   SPEAEAEGRTLKGLGIAPTMVASVLGSYLVHYRPHGQYTGTGKAA"
FT   CDS_pept        complement(365564..365851)
FT                   /transl_table=11
FT                   /locus_tag="RL0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05820"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMI2"
FT                   /protein_id="CAK05820.1"
FT                   /translation="MAKGYWIARVDVRDAERYKDYVAAAKPAFEKYGANFLARGGAFTE
FT                   LEGKARVRNVVIEFPSMQHAVDCYNSPEYQIAAKIRQEVADAEMVVVEGV"
FT   CDS_pept        complement(365881..366588)
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="RL0331"
FT                   /product="putative orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RL0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05821"
FT                   /db_xref="GOA:Q1MMI1"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMI1"
FT                   /protein_id="CAK05821.1"
FT                   /translation="MGARERLIVGLDVPTIGEAERLVSTLGDDILFYKIGYQLVFAGGL
FT                   EFARDLAASGKKIFLDMKLLDIDNTVASGVENIAKMGMSMLTLHAYPKAMKAAVEAAAG
FT                   SGLCLLGVTVLTSMDADDLAEAGYSQDPHSLVLRRAGQARAAGMGGIVCSAEEAAAVRE
FT                   IVGPDMAIVTPGIRPDGSDKGDQKRVMTPFDALKAGATHLVVGRPIVKAPDPRDAARAI
FT                   LSEMVSALWPANR"
FT   CDS_pept        complement(366595..367176)
FT                   /transl_table=11
FT                   /locus_tag="RL0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05822"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMI0"
FT                   /protein_id="CAK05822.1"
FT                   /translation="MFGIYITHPQVRIDANVPVPKWGLSDVGAARARKAAESGWARQLR
FT                   RIVSSDETKAIETAEILAKASGVTVEIVHAMHENDRTATGFLPPPQFEEAANWFFAHPE
FT                   QSFKGWERAVDAQDRIVEAVNAVLATHDATAPIAFVGHGGVGTLLKCHLAGRPISRDRD
FT                   QPGGGGNLYAFGLADRRLTCDWTPIEDWQG"
FT   CDS_pept        complement(367178..367777)
FT                   /transl_table=11
FT                   /gene="pmtA"
FT                   /locus_tag="RL0333"
FT                   /product="putative phospholipid N-methyltransferase"
FT                   /EC_number="2.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RL0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05823"
FT                   /db_xref="GOA:Q1MMH9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMH9"
FT                   /protein_id="CAK05823.1"
FT                   /translation="MSLRVKVKERLGKRFDDEIRFFRGMMQGPKTVGSIVPTSSITAKR
FT                   MASVVDIHSGLPVLELGPGTGAITKAILGRGVRPENLVAIEYSTDFHKHLQRTYPGVHF
FT                   INGDAFDLQATLGNFSGLTFDSVVSGIPLLNFPMAKRISLLESLLDRLPAGRPMVQISY
FT                   GAISPIAANPDRYHIQHFDFVMRNIPPAQLWIYKRG"
FT   CDS_pept        complement(367988..369106)
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="RL0334"
FT                   /product="putative DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RL0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05824"
FT                   /db_xref="GOA:Q1MMH8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMH8"
FT                   /protein_id="CAK05824.1"
FT                   /translation="MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQKLDMK
FT                   ATDLDLEITEATPASVEQPGATTVPAHLLYDIVRKLSDGSEVLLATSSDGGSMTVQSGR
FT                   SKFSLQCLPESDFPDLTAGTFTHSFKLKATDLKMLIDRTQFAISTEETRYYLNGIFFHT
FT                   IESNGQLKLRAVATDGHRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEVMVTV
FT                   EVSDAKIRLTIGSIVMTSKLIDGTFPDYQRVIPTGNDKEMRVDCTSFAQAVDRVSTISS
FT                   ERGRAVKLALSEGQLMLTVNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDITAQLSGE
FT                   EAIFLLADAGSPTLIRDTAGDDALYVLMPMRV"
FT   CDS_pept        369366..370283
FT                   /transl_table=11
FT                   /locus_tag="RL0335"
FT                   /product="putative tetrapyrrole-methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05825"
FT                   /db_xref="GOA:Q1MMH7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMH7"
FT                   /protein_id="CAK05825.1"
FT                   /translation="MNEETTADAASRRSFRLHNMAVPARPLEPALYLVATPIGNLGDIT
FT                   LRALETLAGADVLACEDTRVTRVLLDRYGIQNRPFAYHEHNADEAGPRLLQALEAGRSV
FT                   ALVSDAGTPLVSDPGYRLAQQAIAAGYRVIPIPGASAPLAALVGSGLPNDAFLFAGFLP
FT                   AKDKARRDRLGELAAAPATLIFFESPHRIGATLLAAADVLGPTRPASVCRELTKTYEEF
FT                   RRGTLAELAAHYQQVENVKGEIVLVIGPPEPVETDEADVEAMLADLSKTMPTAGAATEA
FT                   ARLTGLPRKVLYQRLLEIKNADGR"
FT   CDS_pept        370273..370641
FT                   /transl_table=11
FT                   /locus_tag="RL0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05826"
FT                   /db_xref="GOA:Q1MMH6"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMH6"
FT                   /protein_id="CAK05826.1"
FT                   /translation="MGDSDLTAIRRKALRRGRISEYVAAVFLMLKGYRILALRHRTRLG
FT                   EIDIIARKGDLAVFVEVKARHGEAAAVDAVSVAAQKRIRAASDLWLARQADQARLSQRY
FT                   DIVAIMPGRLPRHFLDAF"
FT   CDS_pept        370769..371257
FT                   /transl_table=11
FT                   /locus_tag="RL0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05827"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMH5"
FT                   /protein_id="CAK05827.1"
FT                   /translation="MLASAVAMAARSVPYAVAKPAGKSFVAHASDLLPLKSTPINPDWI
FT                   VSGNPQARTAEHSRGHDEASLTAIWDCTAGEFRWYFGWDETVMILEGEVHITAEDGTER
FT                   TLSAGDVAFFAGGTWASWRVDNYVRKVAFLRKPFPKPLAIAYRLRNMLRNSGNQGIAA"
FT   CDS_pept        371352..372299
FT                   /transl_table=11
FT                   /locus_tag="RL0338"
FT                   /product="putative glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05828"
FT                   /db_xref="GOA:Q1MMH4"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMH4"
FT                   /protein_id="CAK05828.1"
FT                   /translation="MAKITNVAVQMDHVEGINIAGDSTFAMSLEAQVRGYNLFHYTPDR
FT                   LSFRDGKLYASVEPMVLRDLKGDHYELGVPERVDLATMDVVLLRQDPPFDMAYITSTHL
FT                   LERIHPKTLVVNDPAWVRNSPEKIFVTEFSDLMPKTLITKDAAEIRRFRDEMGDIILKP
FT                   LYGNGGAGVFHSTRDDRNLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDGEFAG
FT                   AINRVPAEHDSRSNMHVGGRAEATELTPREQEICTRIGPALRERGFLLVGIDVIGDYMT
FT                   EINVTSPTGIREVKKFGGADIASLLWDAIERKRG"
FT   CDS_pept        372474..374006
FT                   /transl_table=11
FT                   /locus_tag="RL0339"
FT                   /product="putative Mg2+ chelatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05829"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMH3"
FT                   /protein_id="CAK05829.1"
FT                   /translation="MVARVSTVAFQGIEGVPVEVQVMVAPGKVGMQIVGLPDKAVAESR
FT                   ERVQAALHASGLALPAKRVTVNLAPADLPKEGSHFDLPIALALMAALGAIPADALSDFV
FT                   VVGELNLDGTIAAISGALPAAIGANALGKGLICPAESGAEAAWAGAEVDILAPRSLIAL
FT                   ANHFRGTQVLSRPEASIRANAANLPDLAEIKGQESAKRALEVAAAGGHNLLMVGPPGSG
FT                   KSMLAARLPSILPPLSAAELLEVSMVHSIAGQLSGGKLSDRRPFRTPHHSATMAALVGG
FT                   GLRARPGEASLAHHGVLFLDEFPEFTPQALDALRQPLEGGECVIARANHRVSYPAKFQL
FT                   IAAMNPCRCGMAGEPGHTCARGSRCMSDYQARISGPLMDRIDIRIDVPAVSAADLIRPM
FT                   AAESSADVARRVARAREIQQERFESTGAKGIGTNARCSTAMIEKLAEPDASGLQLLRDA
FT                   AEKMKFSARGYHRVLKVARTLADLDGKPTVGRIHLAEAISYRIAGERLTAAA"
FT   CDS_pept        complement(374234..375196)
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="RL0340"
FT                   /product="putative cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05830"
FT                   /db_xref="GOA:Q1MMH2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMH2"
FT                   /protein_id="CAK05830.1"
FT                   /translation="MSHKPGRGRIYSSITETIGDTPLVRFDKLAREKGVVANLIGKLEF
FT                   FNPIASVKDRIGVAMIEGLEAQGKITPGKTVLIEPTSGNTGIALAFAAAAKGYRLILTM
FT                   PETMSVERRKMLALLGAELVLTEGPKGMKGAIAKAEELASSLDDAVIPQQFENPDNPEI
FT                   HRKTTAEEIWNDTDGTVDIVVSGIGTGGTITGVGQVLKSRKPEIKIIAVEPADSPILSG
FT                   GNPGPHKIQGIGAGFAPKILDTGIYDEVVTVTNDEAFEQARLVARLEGVPVGISSGAAL
FT                   TAAIKVGIRPENAGKNIVIIIPSFAERYLSTALFEGLGS"
FT   CDS_pept        complement(375342..375959)
FT                   /transl_table=11
FT                   /locus_tag="RL0341"
FT                   /product="putative LysE family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05831"
FT                   /db_xref="GOA:Q1MMH1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMH1"
FT                   /protein_id="CAK05831.1"
FT                   /translation="MSLTVLITYAGALFIAAAIPGPGITAIVARALGSNFRETFFMGLG
FT                   LVLGDMIYLTAVILGLAFVAQTFTEVFITIKIAGVLYLGYIAWKLWTAGLLPQDIAARK
FT                   STNIGLSFLSGLLVTLGNPKTMLFYVALVPTLIDIGNIGLRDYALLLTATFVVLIVVLV
FT                   PYMLLASRARTMLKQPRALQALNRVASGILAGTAAFIATRAG"
FT   CDS_pept        376192..376710
FT                   /transl_table=11
FT                   /locus_tag="RL0342"
FT                   /product="putative ferritin-family protein"
FT                   /note="Similar to Bacillus brevis (Brevibacillus brevis).
FT                   Dps protein. UniProt:P83695 (149 aa) fasta scores:
FT                   E()=5.8e-07, 28.767% id in 146 aa, and to Agrobacterium
FT                   tumefaciens (strain C58/ATCC 33970). hypothetical protein
FT                   atu4777. UniProt:Q8U6N0 (EMBL:AE009406) (212 aa) fasta
FT                   scores: E()=2.5e-46, 76.331% id in 169 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05832"
FT                   /db_xref="GOA:Q1MMH0"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMH0"
FT                   /protein_id="CAK05832.1"
FT                   /translation="MSHTPAETRRLSPLKTPSSLSTNATTDISAALTALLADVFTLYVK
FT                   TKNFHWHMSGPHFRDYHLLLDEQAEQIFAMTDDIAERARKIGGTTLRSIGQIARQQRLL
FT                   DNDADFVTPEDMLSELREDNVQLVSLLREVHGLCDEHNDVATASLIENWIDEGERRTWF
FT                   LFETTRPQR"
FT   CDS_pept        complement(376758..377672)
FT                   /transl_table=11
FT                   /locus_tag="RL0343"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05833"
FT                   /db_xref="GOA:Q1MMG9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMG9"
FT                   /protein_id="CAK05833.1"
FT                   /translation="MEAIMGSDIRRGTAEMTAAMLISGTIGWFVVMSGQPVSGVVFWRC
FT                   LFGALTLLVICGALGLLRPGIITLRAFGIAIFGGIAIVLNWLLLFASYSHATISIATTV
FT                   YNTQPFMLLVLGALFLGEKITATKLFWLTLAFAGMIAIVEAKPETGGSTSDGYGLGILM
FT                   ALGAAFFYALAALAAKWLKGTPPHLIALIQVATGMLMLAPMTDFSHPPGDVRSWAILVT
FT                   VGVVHTGLMYVLLYGAIQRLPTHLTGALSFIYPIAAILVDRLAFGHALQPMQILGAAII
FT                   LLAAAGMNLGWTPRWLRPRALES"
FT   CDS_pept        377772..378236
FT                   /transl_table=11
FT                   /locus_tag="RL0344"
FT                   /product="putative AsnC family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05834"
FT                   /db_xref="GOA:Q1MMG8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMG8"
FT                   /protein_id="CAK05834.1"
FT                   /translation="MANDVQSLDEIDQAILEALAGNARISLKELAQQVGLSSPSAAERL
FT                   RRLEERGVIKAFTIDLDLATIGYPLQAIVRVRPLPGQLHIVERIIQDIPEIIECDKVTG
FT                   DDCFIARLVIRSMADLDGILDRVAERAETNTAMIKASPVKRRLPPLSRRK"
FT   CDS_pept        complement(378243..379142)
FT                   /transl_table=11
FT                   /locus_tag="RL0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05835"
FT                   /db_xref="GOA:Q1MMG7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMG7"
FT                   /protein_id="CAK05835.1"
FT                   /translation="MAQRLDSAGLTFRQDYFGDPAGWAALVCLLRDIFGIDIGPLQQLG
FT                   GPDPTSMPFGWFDADGGLAANISAFALPFVLNDRIVHAAGLQSGAVRPPWRGRGLYRDV
FT                   TVKALDWCEKQGFEAVILYTDKPSLYEAYGFRAIPLHRYEGAAPAPSTPAAPARPLLPT
FT                   NADDLALLHSLLKGRSPVSTSLAVTGNAAMFLINTRLDPDVRISFLEDKQAVIAWKIDE
FT                   TGRFSLLDVVAADMPPLAAILAGLEIAPASVEVLFRPDKLGWEGVPQSLESGTRLMLRG
FT                   LGDATPDFPAMLSPMAEF"
FT   CDS_pept        complement(379142..379612)
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="RL0346"
FT                   /product="putative deoxyuridine 5'triphosphate
FT                   nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RL0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05836"
FT                   /db_xref="GOA:Q1MMG6"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMG6"
FT                   /protein_id="CAK05836.1"
FT                   /translation="MTIHHDLSPTLNLIRLANGEGLDLPAYESKGAAGMDLRAAVDEAA
FT                   PLTLLPGKRALVPTGFIFEIPEGFEGQVRPRSGLAFKNGITCLNSPGTVDSDYRGEVKV
FT                   LLANLGEEAFVISRGMRIAQMVIAPVTQMRVAEITEASETMRGAGGFGSTGV"
FT   CDS_pept        379704..381287
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="RL0347"
FT                   /product="putative peptide chain release factor (RF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:RL0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05837"
FT                   /db_xref="GOA:Q1MMG5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMG5"
FT                   /protein_id="CAK05837.1"
FT                   /translation="MAESLAEAVSRRRTFAIIAHPDAGKTTLTEKLLLFGGAIQLAGEV
FT                   KAKKDRMQTRSDWMKIERERGISVVTSVMTFEYNDNVFNILDTPGHEDFADDTYRTLTA
FT                   VDAAVMVIDAAKGIEPRTLKLFEVCRMRDIPIITFINKMDRESRDPFEILDEVEEKLAL
FT                   DTAPITWPIGRSKTFCGSYNIAANTVRGSDTEIEGTPVNGPQSVAGRLPENERQVFVEE
FT                   TELAIEACRPFDRQAFLEGHMTPVFFGSALRNYGVRDLINALGDFAPPPRDQVADTRTV
FT                   HATDDKMTAFVFKIQANMDPNHRDRIAFARICSGKLERGMKARLARTGKQLGLTAPQFF
FT                   FASQRQLADTAYAGDVVGIPNHGTLRIGDTLTEGESLVFQGVPNFSPEILRRVRLEDAM
FT                   KAKKLKEALQQMAEEGVVQLFSPEDGSPAIVGVVGALQLDVLKERLMAEYGLPVSFEMS
FT                   RFSVCRWISAEQPADLEKFLTVKRGDIARDLDGDPVFLAQDGFSLRYESERHPAIKMVA
FT                   IKEYHAAKAA"
FT   CDS_pept        complement(381291..382181)
FT                   /transl_table=11
FT                   /locus_tag="RL0348"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05838"
FT                   /db_xref="GOA:Q1MMG4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMG4"
FT                   /protein_id="CAK05838.1"
FT                   /translation="MALFNLNDLHLFVQAVDSGSFTAAARHLGIPKSTVSKRVAELEAR
FT                   LGVRLIQRTSRSFALTELGREFFQHAQASIIEAEMAEGIVRRHLAEPAGSVRLTASVPT
FT                   AQFTLTEHLPALAVRYPKLRLSVHVTDRFVDIVQEGFDIALRSHRTPLPDSALVQRKLA
FT                   SHPFFILASPDYVSVHGQPRRPEELAQHATIMTSLTEDLWRLYSGGDEVLVALQSVMAA
FT                   DEPYVLMEMAMSGLGITCLPTSVCRKALADGRLVRVLPEWTAGSIETTILMPHRRGQLP
FT                   AVRAVVDFLAERLAG"
FT   CDS_pept        382296..383003
FT                   /transl_table=11
FT                   /locus_tag="RL0349"
FT                   /product="putative glutathione-S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05839"
FT                   /db_xref="GOA:Q1MMG3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMG3"
FT                   /protein_id="CAK05839.1"
FT                   /translation="MSPILFYGVPEGCSFGSIVALEWSGLPYRLCRVEMPEIVSSEEYK
FT                   RINMVGETPSLLLEDGRTISESMAILHHIGACTIGSGLGFAQGSADFDRLNQMLAFLNT
FT                   TFFQAFGPLWYAIEHPLEPEEKQALTAYGIAAVEKAHHRLERLLDGREWLLGNGPSLAD
FT                   AYFVGIARWNDFHKVVDRRQFPGLHRLYERMQQEPAVRFAHAIEHRQEAKSSGGFRGEV
FT                   DLAEGLGLLKQAA"
FT   CDS_pept        complement(383049..383435)
FT                   /transl_table=11
FT                   /locus_tag="RL0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05840"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMG2"
FT                   /protein_id="CAK05840.1"
FT                   /translation="MEMIAHNPANGIYAASPDYIHALEVRQSSRLLFVSGTMGLDQQGM
FT                   AAADLEGQLELIWFNLRAILTSADMTVDNIVRLTSYLSDGVFMEANQNARVRALGGRAV
FT                   PTTAIIVETLRDDWLVEIEIIAAG"
FT   CDS_pept        383463..384044
FT                   /transl_table=11
FT                   /locus_tag="RL0350A"
FT                   /product="putative AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0350A"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05841"
FT                   /db_xref="GOA:Q1MMG1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMG1"
FT                   /protein_id="CAK05841.1"
FT                   /translation="MKNVSIGDYSSAERGVCGMAKNTDDLRLGRRQQPVIDAFDRRILA
FT                   ALAADSSQSYARLGEAVGLSAPAVHERVRRLRQSGAIKGVHAALDGAALGKPLLAFVHV
FT                   EAAGWGKSERLMQVLQFPEVEEMHSVAGDTSVLFKVRTASPQALEAFLAQIHAVPGVTG
FT                   TRSYIALSTYLERPVQAGVTDSWPDMPLPE"
FT   CDS_pept        complement(384071..384472)
FT                   /transl_table=11
FT                   /locus_tag="RL0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05842"
FT                   /db_xref="GOA:Q1MMG0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMG0"
FT                   /protein_id="CAK05842.1"
FT                   /translation="MHITGGCHCGAIRYQAEIDPQRVSICHCTDCQRLTGSAYRITAPA
FT                   RPESFTLTSGEPRGYAKYGDSGGLSRQFFCPNCGSPLYRTDGEGGAIGIRVGSIDQRQE
FT                   LVPRKQIWCRSALPGVENIETLPRFEGED"
FT   CDS_pept        complement(384539..386068)
FT                   /transl_table=11
FT                   /locus_tag="RL0352"
FT                   /product="putative exported peptidase"
FT                   /note="Codons 75 to 240 are similar to codons 75 to 305 of
FT                   Lycopersicon esculentum (Tomato). wound-inducible
FT                   carboxypeptidase. UniProt:Q9M513 (EMBL:AF242849) (498 aa)
FT                   fasta scores: E()=0.00038, 25.568% id in 176 aa, and entire
FT                   protein is similar to Xanthomonas campestris (pv.
FT                   campestris). carboxypeptidase-related protein.
FT                   UniProt:Q8PA00 (EMBL:AE012270) (501 aa) fasta scores:
FT                   E()=2.1e-56, 35.573% id in 506 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05843"
FT                   /db_xref="GOA:Q1MMF9"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMF9"
FT                   /protein_id="CAK05843.1"
FT                   /translation="MRIRTLFLLATFMASLAPALSHAQESNQPRANVQSGARDGVLKLL
FT                   PPDSVTEHALTIGDRKFAYTATAGTLDLFGQDGAQTGAIFYTAYVARDSGANRPLTFAF
FT                   NGGPGAASAYLHLGLVGPKVLDFGPDGRDGANAKLVDNPQSWLDFTDLVLIDPIGTGWS
FT                   RTTKADDANYYNVDADAQSIAKAIALYVAHNNRSTSPKYLLGESYGGFRAAKVASVLQQ
FT                   SQGIIVAGAVMLSPLIEGQLMFNADQFALGAALELPSLAAAELDRHKAFDEEKQKEAET
FT                   FALGDYLTTLAGPPPTGADAAAFYGRIARLTGIPEDIVSRNRGFLGSSFVKHSDAGSGE
FT                   VMSSYDASFAAPDPYPESDYDRGDDAILDGFTRAYGGAFADYARNELGFRTEMTYSLLD
FT                   GDISRRWEWGGGRGGGSRFQASATDDIRQLLAANPAFHLLIAHGYSDVVTPYGVSRYVV
FT                   DHLPPSLAGGRVGLKLYRGGHMFYTRAEQRAAFTADAKAFYATHLAAQPAD"
FT   CDS_pept        complement(386169..387359)
FT                   /transl_table=11
FT                   /locus_tag="RL0353"
FT                   /product="putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05844"
FT                   /db_xref="GOA:Q1MMF8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMF8"
FT                   /protein_id="CAK05844.1"
FT                   /translation="MRGAAGRFLLGASLVLIAFNLRPVFSSASALLPEIRSELGLSALG
FT                   ASLLTTLPVVCLGAFSPLAPRLAQRFGTERTLLGVLLLLALGTGLRGLSSVPLLFIGTA
FT                   LAGACIAVGNVLLPGLVKRDFAGRAALMTGFYTMALCAGAASAAGLTLPIEHALGGSLE
FT                   GALAVWALPALIVSLLWLPEVLRSGRQARRNGFHVKGLWRDRLAWQVTLFMGLQSALAY
FT                   CVFGWLVPILRERGLDGVTAGAIVSLSVMVQAASCLIVPHIAVRGRDQRLINASLCGVA
FT                   VTALLGLLFAPLSTVWLWAVLQGIGQGGLIAAAMTTIVLRSRDPDVAAHLSGMAQCVGY
FT                   LLAAIGPLIVGLIRGWTGSFSWCAALFVALGLGAAINGWKAGRAVEINVHAAEKDG"
FT   CDS_pept        complement(387458..388135)
FT                   /transl_table=11
FT                   /locus_tag="RL0354"
FT                   /product="putative GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05845"
FT                   /db_xref="GOA:Q1MMF7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMF7"
FT                   /protein_id="CAK05845.1"
FT                   /translation="MRALSKTNLADEAIEAIRGDILGKRWAVGEKLPNEASLSAMLSVS
FT                   RGTVREAVRVLVSQGYLETRQGSGTYVRATSDAGRPLTMARRASLRDQFEARLALDVEA
FT                   ARLTAIRKTPEIVAGLRRLLAERGNYDGGNQAAFIERDLAFHKAVIAASGNRAMIEIYD
FT                   FFSASIADTIAATLGKDIPEPDMQAHAEIVDAIETGDPDKADAAVRRFMAPVLAALERM
FT                   ILS"
FT   CDS_pept        complement(388468..389379)
FT                   /transl_table=11
FT                   /locus_tag="RL0355"
FT                   /product="putative pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05846"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMF6"
FT                   /protein_id="CAK05846.1"
FT                   /translation="MSIRPVKHESTATPTMEGAGVKLHRVFGFGDPAMTDPFLMMDDFR
FT                   NDNPAEYIRGFPWHPHRGIETITYVLAGTVEHGDSLGNSGLLGAGDIQWMTAGSGIMHQ
FT                   EMPKGDFAGRMHGFQLWANLPSSLKMTPPRYQDVKSIDIPIVVDDDGTAVRVICGDFWG
FT                   KAGPVDGVAAEPIYLDVSVPPGRKKRLPVDTYRNAFAYIFAGSGTFRDASKPFGVRVEK
FT                   EVDGEELNIRDMSGNRTLVVFDSGDEVTVQAGDQGIRFLLVSGKPIEEPVAWHGPIVMN
FT                   SREEIMQAMRELQNGTFIKAAH"
FT   CDS_pept        389586..390449
FT                   /transl_table=11
FT                   /locus_tag="RL0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Rhizobium meliloti (Sinorhizobium meliloti). hypothetical
FT                   protein smc01162. UniProt:Q92SL4 (EMBL:SME591783) (271 aa)
FT                   fasta scores: E()=2.1e-84, 78.039% id in 255 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05847"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMF5"
FT                   /protein_id="CAK05847.1"
FT                   /translation="MSFQHFPPMRRVPEQRAMCRWAAYRGDPLYLEELVSSPAHSLIEQ
FT                   SHCATRAKTATNGDGFGIAWYGDRPEPGRYRDILPAWSDCNLKSLARQIRSPLFLAHVR
FT                   AATGGGTRRDNCHPFTQGTWSFMHNGQISGFERLRRPMEAMLDDELFNARGGTTDSELM
FT                   FLLALQFGLREAPVAAMAEMIGVIEDLAESVIGSILLRFTAAFSDGKALYAIRYATDRK
FT                   APTLYASPVGAGYCLVSEPLNDDVDAWAEIPDGSAVTVGKDGIDVADFRPEKRSAAKPL
FT                   RVAIPA"
FT   CDS_pept        complement(390460..391665)
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="RL0357"
FT                   /product="putative coenyzme A biosynthesis bifunctional
FT                   protein"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:RL0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05848"
FT                   /db_xref="GOA:Q1MMF4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMF4"
FT                   /protein_id="CAK05848.1"
FT                   /translation="MALSGKRILLIISGGIAAYKSLDLIRRLRERGASVRPVMTKGAQE
FT                   FVTPLAVGALAADHVFLDLFSRQDEQDIGHIRLARECDLVLIAPATADLMAKMANGLAD
FT                   DLASTVLLATNRPVLAAPAMNPAMWAHPATRRNAAMLRADGIRFVGPMAGEMAESREAG
FT                   LGRMAEPLEIVAAAETMLDDGDKPLKGRKAIVTSGPTHEPIDPVRYIANRSSGRQGHAI
FT                   AAALAKLGAEVTLVSGPVTIADPVGVNVVHVERAEEMRDAVLAALPADIAVMVAAVADW
FT                   RVASAADQKLKKHPGESIPTLALTENPDILKTVGHHTMRPKLVIGFAAETQDVEINAKA
FT                   KLERKGADMIVANDVSPATGIMGGSRNRVKLVRRDGVEQWPDLAKEEVAERLAALIAKQ
FT                   FS"
FT   CDS_pept        complement(391841..392590)
FT                   /transl_table=11
FT                   /locus_tag="RL0358"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:RL0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05849"
FT                   /db_xref="GOA:Q1MMF3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMF3"
FT                   /protein_id="CAK05849.1"
FT                   /translation="MSRLQNKTALITGGTSGIGLETARQFIAEGARVVVTGSSTASVEA
FT                   ARAELGGKATVIQADAGNAVGQKAVADSVREAFGTLDILFVNAGVAEFGPLEQWSEAAF
FT                   DKSVDINVKGPFFLIQSLLPIFSKQAAIVLNTSINAHIGMPNSSVYSLTKGALLTLAKT
FT                   LSGELIGRGIRVNAVSPGPIATPLYSKLGASEAQSKAMAEQIQAQIPVGRFGNPSEVAK
FT                   TIVFLASDEAAYIVGSELIIDGGMSNL"
FT   CDS_pept        complement(392726..393490)
FT                   /transl_table=11
FT                   /locus_tag="RL0359"
FT                   /product="putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05850"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMF2"
FT                   /protein_id="CAK05850.1"
FT                   /translation="MNRLNNKVAIVTGASSGIGRATAKLFAAEGAKVVVGARRQGELDS
FT                   LVAEIKAEGGDAIAIAGDVRSEDYHKALVAAAVTKYGKLDIAFNNAGTLGEAGASTGVS
FT                   EAGFSEALAINLTASFLAAKHQIGAMVENGGGSVIFTSTFVGYSFAFPGVAAYAASKSG
FT                   LIGLTQALAAEFGQQGVRVNAILPGAVDTDMYRDMNDTPEKQAFVTNLHALKRVATPEE
FT                   LARSVLYLASDDASFVTGTASLVDGGASITRS"
FT   CDS_pept        393617..394522
FT                   /transl_table=11
FT                   /locus_tag="RL0360"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05851"
FT                   /db_xref="GOA:Q1MMF1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMF1"
FT                   /protein_id="CAK05851.1"
FT                   /translation="MIRIEGIAAFVAVVEAGSVSEAARRLRLSKSVVSERLAELEKSLG
FT                   GMLLHRTTRKLTLTEDGTVFLGRAARIVREIEEAAADMAERRGTLSGPIRIAAPVTFGR
FT                   MHLGPALYPFLAEHPEIELTLDIDDRRVDAASDGYDAIIRNGPIADSRLVAWKLAHSRR
FT                   LLCASPDYLARQGIPSSLADLNSHRGIFYTNRGVADWRFQTFDGAIVVRAKLALGINNG
FT                   DMLRDAAIAGLGIALLPAFIAGPAIREGRLAEIDVGHKPEAEFIYMAHPEGRNPSAKLR
FT                   AIADHLKKSFGDPPYWDPVG"
FT   CDS_pept        complement(394524..395408)
FT                   /transl_table=11
FT                   /locus_tag="RL0361"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05852"
FT                   /db_xref="GOA:Q1MMF0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMF0"
FT                   /protein_id="CAK05852.1"
FT                   /translation="MAMELRHLRYFLAVAEEGNFTRAAGKLGIGQPPLSQQIRDLEREV
FT                   GAALFHRVPHGAELTAAGTAFLGEAKASLAAAEKAKLAAQSANRGETGRLSLGFTASSA
FT                   FNPVVSTTIRRFRACWPEVQLSLTEMNTLALMQKLERGELDATFMRPSLDDPAGIRLRR
FT                   LPDEPMVIALPAGHPLARRSKLPLAALADEPFILFPRLVGLSLYDDVVLACRKAGFELT
FT                   VAQEAPQISSVVNLVAADLGVSIVPASISQIKLEGVAYRPIEGPPAVARLALAILKTHR
FT                   SPVTENLISLLST"
FT   CDS_pept        395494..396744
FT                   /transl_table=11
FT                   /locus_tag="RL0362"
FT                   /product="putative MFS family transmembrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05853"
FT                   /db_xref="GOA:Q1MME9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MME9"
FT                   /protein_id="CAK05853.1"
FT                   /translation="MPTSVHAVKTAETAAIPGQKQYLTRGTGAYHRASLALFLSGFSTF
FT                   SLLYCVQPLLPIFSQQFSVSPAESSLSLSLSTGSLAVAIVCAAAVSEGLGRRSLMSISL
FT                   VGAALLTIATAFAPNWHLLLVIRALQGLVLGGVPAVAMAYLAEEIDPRGLGATMGLYVG
FT                   GTAFGGMSGRVLTGIFAEYLTWRPALFIIGAIGLAAAIGFIALLPPSRNFVRRPGFDPR
FT                   FHAKAWLGHLTNPALPFIFAIAFLAMGSFVTIYNYAGFRLMAPPYGLNQTELGLIFTVY
FT                   LFGIGASSIGGLLGDRIGHFSVLLFGLALTAAGSALTLAASLPVIILGIIVLTTGFFMS
FT                   HSIASGLVGKLAHGTKGHASSLYMLAYYVGSSLMGSAGGWFFAVEGWAAVVIFTLAMLA
FT                   LAFVSACLAQHLARRKA"
FT   CDS_pept        396741..397127
FT                   /transl_table=11
FT                   /locus_tag="RL0363"
FT                   /product="putative glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05854"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MME8"
FT                   /protein_id="CAK05854.1"
FT                   /translation="MIRIDRLDHLVLTVADIAITCDFYSRILGMSVETFAEGRKALKFG
FT                   GQKINLHQAGHEFDPKATHPTPGSGDLCFIAETPLADVIADLQAAGVAIEEGPVERTGA
FT                   TGRLRSVYFRDPDGNLIEVSNLIA"
FT   CDS_pept        complement(397145..398806)
FT                   /transl_table=11
FT                   /gene="hutU"
FT                   /locus_tag="RL0364"
FT                   /product="putative urocanate hydrolase"
FT                   /EC_number="4.2.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:RL0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05855"
FT                   /db_xref="GOA:Q1MME7"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MME7"
FT                   /protein_id="CAK05855.1"
FT                   /translation="MPKANPRHPKFPIPGGPELRAKGWRQEALLRLLENVLSVGEDPDN
FT                   LIVYAALGKAARNWAAHRGIVKALTEMEEDQTLLIQSGKPIGLVRTHAKAPLVIMANCN
FT                   IVGQWAKAEVFYELQRKGLICWGGLTAGAWQYIGSQGVIQGTYEIFMRIAERRFGGDLL
FT                   GRFVLTAGLGGMGGAQPLAGRMAGAAILCVDIDPERARKRQQIGYLQEIAPDLDSALQM
FT                   IDAAVKDKRALSVGLVGNAAEVYPEIARRGIVPDIVTDQTSAHDLVYGYVPKGMNLDQV
FT                   KGLRDDGQGQLMAASRASIVEHVTAMLEFQKKGSEVFDNGNLIRTQAKEGGVANAFDIP
FT                   IFTEAYLRPLFARAIGPFRWMALSGEESDIARIDDLLLEMFPDNKIITNWIRLAREHVP
FT                   FEGLPARIAWLGHGERTALARRVNALVASGELKGPVAFSRDHLDAGAMAHPNIMTEGMK
FT                   DGSDAIADWPLIDAMMLCSSMADLVVIHSGGGGYAGYMTSCGVTVVADGTDDADERLDH
FT                   ALTNDTALGVMRYADAGYEEALDEVAKKDVPYIRLG"
FT   CDS_pept        complement(398825..399154)
FT                   /transl_table=11
FT                   /locus_tag="RL0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05856"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MME6"
FT                   /protein_id="CAK05856.1"
FT                   /translation="MARDPGLEELMREELGGQPGLAEKSMFGGWAFMLNGNLLCCARQD
FT                   GMLIRLGKGNDGWALALPGVIQMLSGERVMHGWVRGNAKVYGDDALRRRLLDAALAYVE
FT                   SLPSK"
FT   CDS_pept        complement(399158..400255)
FT                   /transl_table=11
FT                   /locus_tag="RL0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar, but extended at the N-terminus, to
FT                   Pyrococcus horikoshii. hypothetical protein ph1052.
FT                   UniProt:O73999 (EMBL:H71098) (307 aa) fasta scores:
FT                   E()=1.4e-33, 39.297% id in 313 aa. This CDS overlaps 17 nt
FT                   at the N-terminus with RL0367"
FT                   /db_xref="EnsemblGenomes-Gn:RL0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05857"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MME5"
FT                   /protein_id="CAK05857.1"
FT                   /translation="MGRILVEKDVEAAVKGGSVYAAGGGGWADHGRMLGYAAVNVGKPE
FT                   LVSIDELRDEDWIATAAAIGAPASTTPWEMQGIDYVKSVQLLQEALGEKLSGLIIGQNG
FT                   KSSTLNGWLPSAILGTKVVDAVGDIRAHPTGDMGSIGMAGSPQQMIQTAVGGNRSENRY
FT                   IELVVKGATAKISPVLRAAADQSGGFIASCRNPLRASYVRTHAALGGISMALALGEAII
FT                   AAEKRGGSAVIDAICKTTGGHILAEGVITRKDVVYTKEAFDIGTITVGASEKSVTLHVM
FT                   NEYMAVDDADGKRLATFPAVITTLSPEGEPLSVGQLQSGMHVFILHVPMEIIPLSASVL
FT                   DPTVYPVVEKAMGIEIARYALATKA"
FT   CDS_pept        complement(400236..401516)
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="RL0367"
FT                   /product="putative N-carbamoyl-L-amino acid hydrolase"
FT                   /EC_number="3.5.1.87"
FT                   /note="This CDS overlaps 17 nt at the C-terminus with
FT                   RL0366"
FT                   /db_xref="EnsemblGenomes-Gn:RL0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05858"
FT                   /db_xref="GOA:Q1MME4"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MME4"
FT                   /protein_id="CAK05858.1"
FT                   /translation="MSRNLPVNASRIAEDIEALAGITEPGHPWTRRAFSPLFLDGRAYI
FT                   EGRMKAAGLETRIDAAGNLIGRRTGRKPWLGTIMIGSHSDTVPDGGRFDGIAGVISALE
FT                   VARALVDQNIELDHDLEIVDFLAEEVSIFGVSCIGSRGMTGQLPEAWLSRVSDGRDLAE
FT                   GIAQVGGRPDVLMQQNRPDIAGFLELHIEQGPVLEAEKEDVGIVTAISGITRVEITVEG
FT                   RADHAGTTPMDRRADALVAAAQLVLDIRNAAAELAKSPGHFAATVGEFRIEPNAANVVP
FT                   SKVVLLIDGRAEIRADMEAFCRWLDGHVEKLAGAYGVTIKTPNRVSDNQPTPADPGLLS
FT                   MLEAACERVGAKHRRMASGAGHDTAWIAKVAPAAMIFVPCREGRSHSADEWADNDDITL
FT                   GTAVLFEAVREMDTSLNQERTDGTHTR"
FT   CDS_pept        complement(401513..402892)
FT                   /transl_table=11
FT                   /gene="pucH"
FT                   /locus_tag="RL0368"
FT                   /product="putative allantoinase"
FT                   /EC_number="3.5.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:RL0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05859"
FT                   /db_xref="GOA:Q1MME3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MME3"
FT                   /protein_id="CAK05859.1"
FT                   /translation="MDFDLVLQGTVVLPDRIVDEGYVAVRDGKIAEVGLGVPPAGRERH
FT                   LLGKALILPGAIDAQVHSLSQKDQEDFLWSTRSAAAGGVTVIVDMPYDEGNLVCSAAAV
FT                   KRKIDHAGPQALVDYALYGTVDPEEGPVRIREMVEAGVAAFKFSTFGTDPKRFPRIPPA
FT                   LLDACFAAIAPTGLTAGVHNEDDEAVRTYMEQVKASGITDWRAHGLSRPPITELLAMHT
FT                   IFETGANTGCPAHVVHCSLGRGYDIARAYRRDGFAATVECCIHYLTLDEESDVKRLGGK
FT                   AKINPPVRPRAEVERLWRKVAEGDVWLVSTDHVSWSENRKTNPDMLANASGVPGLEVMV
FT                   PLFVKGAVERGIPLTWAARLMAENPAKHFRLDHIKGALTPGKDADIVVLEPRESVYDAA
FT                   ASGNNVVGWSPYNGIRLPWTVSATYLRGEKIAEGAKVLAKPGTGRFVRPLPRQVIAGAE
FT                   A"
FT   CDS_pept        complement(402916..404502)
FT                   /transl_table=11
FT                   /gene="hutH2"
FT                   /locus_tag="RL0369"
FT                   /product="putative histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RL0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05860"
FT                   /db_xref="GOA:Q1MME2"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MME2"
FT                   /protein_id="CAK05860.1"
FT                   /translation="MKHERPGIELSGRPLGFAEMVTIGAGKAAVSASATGMARIAIARE
FT                   VVEDAIASGMPVYGSTTGVGAMKDVEWSADELDTFNLGLVRAHHFGTGTPFSCNIVRNA
FT                   MAIRINTALTGQVGCTPELIQAYIRMLEADLIPVVRRTGSIGCADIGLMGQIGAVLTGV
FT                   GEAIYRGNRMQAAEAFQAAGLEPMRMAPRDSLASLSVNAVSFASAAETTRNAAASIRVL
FT                   LATAMMAAGALGASRDPWKAVRHVGTAREALIGAWLCNASDEWNWPVATHVQDPLSLRM
FT                   IAQVFGAVIENLLSTGHKILAATGRSDDNPVVVEGRVMTSGGSLPLDVTILLESAALCM
FT                   AHAARNAFNRCVILGNGQRRDLPVNLVPPGRIATGFGPIIKLAGEIFSRVLSMSNPVSA
FT                   QSLVVAAGLEDEAAFLPLVIERFDRQMRALKRLAALEALLSAQAIDILGDEPKGVAAML
FT                   YEVVRKHADFYTVDRPLSAEVEAIEEELGSDEFVTKLTEQVPIASFDDFFALGSLQRIE
FT                   ERLTHHEPAAV"
FT   CDS_pept        complement(404695..406269)
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="RL0370"
FT                   /product="putative ubiquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05861"
FT                   /db_xref="GOA:Q1MME1"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MME1"
FT                   /protein_id="CAK05861.1"
FT                   /translation="MSTFGAYFRLWRVGWVLVREGVVSALPSEGLPPPVALAKSFVTIF
FT                   ERSKARHQKRSDRLAQAVERLGPSYVKIGQFLATRPDVVGVEFANDLSQLQDRMAFFPS
FT                   AAAKANIEGSLGRPISELYASFGDPIAAASIAQVHPAEVESAEGRKKVAVKIVRPGVRQ
FT                   RFAHDIEAMYLVAHMQERFLPSSRRLRPVEVTKTLEQTTKVEMDLRLEAAALSEIAENT
FT                   ERDPGFRVPKVDWERTGRDVITMEWIDGTRMSDVEGLRAAGHDLNLLADTLIQSFLRHT
FT                   LRDGFFHADMHPGNLFVDADGMIVAVDMGIVGRLGKKERRFLAEILYGFITRDYIRVAE
FT                   VHFEAGYVPGHHNVESFAQAIRAIGEPIHGQPAETISMGKLLTLLFEVTELFDMETRPE
FT                   LVMLQKTMVVVEGVSRMLNPRFNMWKASEPVVGDWIRTNLGPKRIATDLKDGLKAAVKL
FT                   AEAVPEIAAKTEKFHHQLLHMSEHGLRFDAETAEAIGKAEARHNRSAKIALWIIALTLV
FT                   YIAWVLS"
FT   CDS_pept        complement(406332..407108)
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="RL0371"
FT                   /product="putative Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RL0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05862"
FT                   /db_xref="GOA:Q1MME0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MME0"
FT                   /protein_id="CAK05862.1"
FT                   /translation="MSESRTSADGGMETSYGFREVPDGQKQGLVNQVFHKVAKRYDIMN
FT                   DVMSMGMHRAWKDAMISALNPRKEPGYKVLDVAGGTGDIAFRIVEASGRQAHATVLDIN
FT                   GSMLGVGAERAEKKKLSGNLTFVEANAEELPFEAGSFDAYTIAFGIRNVPRIDAALSEA
FT                   YRVLKRGGRLLVLEFSEVDMPLLDKIYDAWSFNAIPQFGKAITGDAEPYQYLVESIRKF
FT                   PNQENFAAMIRQAGFSRVTFTNYTGGIAALHSGWKL"
FT   CDS_pept        407258..408148
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="RL0372"
FT                   /product="putative formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:RL0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05863"
FT                   /db_xref="GOA:Q1MMD9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMD9"
FT                   /protein_id="CAK05863.1"
FT                   /translation="MPELPEVETVKRGLTPAMEGTRVTRLELRRGDLRFPFPDAFADRV
FT                   SGRTIVGLGRRAKYLLVDLDDGNTLISHLGMSGSFRIEEGAASGVPGEFHHARSKDEKH
FT                   DHVVFHLQAASGLRRVVYNDPRRFGFMDMVGRADLATHPFFRDLGPEPTGNELSAAYLA
FT                   ERFRDKAQPLKSALLDQKNIAGLGNIYVCEALWRSHLSPIRAAGTLVTAGGRPKAQLDL
FT                   LVASIRDVIADAIAAGGSSLRDHIQTDGSLGYFQHSFSVYDRESQACRTPGCGGTVARI
FT                   VQAGRSTFYCATCQK"
FT   CDS_pept        408188..408961
FT                   /transl_table=11
FT                   /locus_tag="RL0373"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05864"
FT                   /db_xref="GOA:Q1MMD8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMD8"
FT                   /protein_id="CAK05864.1"
FT                   /translation="MAYETLIVETRGNVGLVTLNRPQALNALNSTVLKELKEAYAAFHA
FT                   DETVGAIVLTGSERAFAAGADIKEMQPLQFADIYKSDFISGWDEVAKARKPVIAAVSGF
FT                   ALGGGCELAMMCDFIIASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGR
FT                   MMDAAEAERSGLVSRVVAPERLLDEAFAAAEKIASLSRPSVMMAKEAVNRAFETTMEEG
FT                   LRFERRLFHSLFATDDQKEGMAAFVEKRKPAFTHR"
FT   CDS_pept        409154..409432
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="RL0374"
FT                   /product="putative 30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:RL0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05865"
FT                   /db_xref="GOA:Q1MMD7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMD7"
FT                   /protein_id="CAK05865.1"
FT                   /translation="MANTTSAKKATRKIARRTDVNKARRSRVRTFVRQVEEAIASGDAA
FT                   KAKEAFLAAQPELARAASKGVLHSNTASRKVSRLAARVKALSVTTTA"
FT   CDS_pept        410392..411840
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RL0375"
FT                   /product="putative chromosomal replication initiator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05866"
FT                   /db_xref="GOA:Q1MMD6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMD6"
FT                   /protein_id="CAK05866.1"
FT                   /translation="MKQSILFERVSARLKAQVGPDVYASWFARLKLHSVSKSVVRLSVP
FT                   TTFLKSWINNRYLDLITGLFQAEDPEILKIEVLVRTATRHGTKALDEVVAPEPAAPTQM
FT                   RRPTSAQPAGQAVQQAVSAVAAARPASFGSPLFGSPLDSRFTFDTFVEGSSNRVALAAA
FT                   KTIAEAGQGAVRFNPLFIHSTVGLGKTHLLQAVANAAVQNPRSLRVVYLTAEYFMWRFA
FT                   TAIRDNDALTLKDSLRNIDLLIIDDMQFLQGKMIQHEFCHLLNMLLDSAKQVVVAADRA
FT                   PWELESLDPRVRSRLQGGVAIEFDAPDYEMRLEILKRRLAVARLEDPSLEIPAELLQHV
FT                   ARNVTASGRELEGAFNQLVFRRSFEPNLSIERVDELLAHLVGSGEPRRVRIEDIQRIVA
FT                   RHYNVSRQELVSNRRTRVIVKPRQIAMYLSKTLTPRSFPEIGRRFGGRDHTTVLHAVRK
FT                   IEELISGDTKLSHEVELLKRLINE"
FT   CDS_pept        411978..413060
FT                   /transl_table=11
FT                   /locus_tag="RL0376"
FT                   /product="putative L-lysine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05867"
FT                   /db_xref="GOA:Q1MMD5"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMD5"
FT                   /protein_id="CAK05867.1"
FT                   /translation="MSFEKIAVLGLGKVGRLAATLLHEGGFEVIGVDAQLPLSDVPFKC
FT                   RTGDISDPQVIGELLSNVEAVLSCLPYHLNIELARAAHLAGIHYFDLTEDVPTTNFIIE
FT                   LSKTARGLMAPQCGLAPGFVGIVGASLADGFDRCRSIRMRVGALPQHPTGLLGYAFNWS
FT                   PEGVVNEYLNDCEVIEGGVRKLVSPMEWHETVYVGGVKLEAFTTSGGLGTMCDTMLGKI
FT                   DNLDYKTMRYPGHMELMNFFFHELLMRDKRKLAGEILTNAKPPVEDDVVYVHVAAEGTE
FT                   NGSLRRKEFVRAYYPIEIAGARRTAIAWTTSASVVAVIEMVRDGLLPVTGFLHQEHIPL
FT                   EMFLKTPTGSLFKAGATSHG"
FT   CDS_pept        complement(413129..414331)
FT                   /transl_table=11
FT                   /gene="hemN2"
FT                   /locus_tag="RL0377"
FT                   /product="putative oxygen-independent coprophorphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05868"
FT                   /db_xref="GOA:Q1MMD4"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMD4"
FT                   /protein_id="CAK05868.1"
FT                   /translation="MDNFDTPSTSRDAALLPDTGEPGFGVYVHWPFCAAKCPYCDFNSH
FT                   VRHQPVDQERFTSAFLTEMAAVRSMSGPKTVTSIFLGGGTPSLMKPETVSAILDGIARH
FT                   WHVPDGIEITMEANPSSVEAERFRGYRAAGVNRVSLGVQALNDRDLKFLGRLHDVADAL
FT                   KAIRLARDIFPRMSFDLIYARPEQTVEEWEKELKEAISYAVDHLSLYQLTIEEGTPFYG
FT                   LHKAGKLIVPDGEQSALLYEATQEITAREGMPAYEVSNHARPGAESRHNLTYWRYGDYA
FT                   GIGPGAHGRLTRGPEKLATATERKPETWLDMVERDGHGILDEERLGFEEQSDELLLMGL
FT                   RLREGVDLARWQQLSGRDLDPKREEFLLEHKFIERIGNSRLRCTPSGMLILDSVVADLA
FT                   C"
FT   CDS_pept        complement(414341..414985)
FT                   /transl_table=11
FT                   /locus_tag="RL0378"
FT                   /product="putative HAM1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05869"
FT                   /db_xref="GOA:Q1MMD3"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMD3"
FT                   /protein_id="CAK05869.1"
FT                   /translation="MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPD
FT                   ETGTSFEENATIKAVASANASGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFD
FT                   MAMAKVEKALQDAGATKPEQRTARFISVLCLAWPDGHTELFRGEVEGSVVWPPRGTQGF
FT                   GYDPVFQPEGYDITFGEMSGEEKHGWNVGKPQALSHRARAFKLFVETCLEA"
FT   CDS_pept        complement(414986..415411)
FT                   /transl_table=11
FT                   /locus_tag="RL0379"
FT                   /product="putative glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05870"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMD2"
FT                   /protein_id="CAK05870.1"
FT                   /translation="MNPMLEGMLETALYARDLDKAETFYEDVLGLEKIARAANRHVFFR
FT                   CGPGVLLIFNPKETVKPPAPEALQVPPHGTSGQGHACFRVSGRNIDAMAERLTAAGVAI
FT                   ESEVRWPNGGRSIYFRDPDGNSLECAEAKIWGIEQDI"
FT   CDS_pept        complement(415408..416127)
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="RL0380"
FT                   /product="putative ribonuclease"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:RL0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05871"
FT                   /db_xref="GOA:Q1MMD1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMD1"
FT                   /protein_id="CAK05871.1"
FT                   /translation="MRPSGRKIDQMRKVSFERNFSKHAEGSCLVKFGDTHVLCTASLEE
FT                   KTPPWLRNTGKGWVTAEYGMLPRATGERMKREAAAGKQGGRTQEIQRLIGRSLRAVVDL
FT                   QALGERQITLDCDVIQADGGTRTASITGGWIALYDCLKWMESRNMIKVDRVLKDHVAAI
FT                   SCGIFASQPVIDLDYLEDSSAETDANFVMTGTGGIVEIQGTAEGTPFSEGEFTSLMQLA
FT                   RNGIGELVALQKQAVEG"
FT   CDS_pept        416256..417344
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="RL0381"
FT                   /product="putative heat-inducible transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05872"
FT                   /db_xref="GOA:Q1MMD0"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMD0"
FT                   /protein_id="CAK05872.1"
FT                   /translation="MGIRSTSVSDAVAALDERSREIFRRIVEGYLESGEPLGSRNLSRI
FT                   LPMSLSPASVRNVMSDLEELGLIYSPHVSAGRLPTQIGLRFFVDAFMQVGDLSAEERAS
FT                   IDRQVRVESGGNPVESMMNEASRMLSGISRGAGLVITSKSDPVLKHVEFIRLEPTKALA
FT                   VLVGDHDQVENRIIELPAGVTSSQLTEAANFLNAHMSGQTLPELRKQLSRLKDDVRHEL
FT                   DALSRDLVERGIAVWAGSPDEGKPTQLIIRGRANLLEGLAGAEDLDRLRLLFDDLEKKD
FT                   SLIEILNLAESGSGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIVGAVGVIGPTRLNY
FT                   SRIVPMVDYTAQLVSRLSRSQL"
FT   CDS_pept        417455..418087
FT                   /transl_table=11
FT                   /locus_tag="RL0382"
FT                   /product="putative GrpE heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05873"
FT                   /db_xref="GOA:Q1MMC9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMC9"
FT                   /protein_id="CAK05873.1"
FT                   /translation="MTDDTTKNGPDATAADAAADATAYVENETAQQEPAQPDPIELLKA
FT                   ENGELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAISPE
FT                   TKATADAGLSTLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPDVP
FT                   NNTVVQVVQAGFTIGERVLRPAMVGVAKGGPKPAEAETNSVFDEKDA"
FT   CDS_pept        complement(418126..419070)
FT                   /transl_table=11
FT                   /gene="iunH1"
FT                   /locus_tag="RL0383"
FT                   /product="putative inosine-uridine preferring nucleoside
FT                   hydrolase"
FT                   /EC_number="3.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RL0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05874"
FT                   /db_xref="GOA:Q1MMC8"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMC8"
FT                   /protein_id="CAK05874.1"
FT                   /translation="MASARKIIIDTDPGQDDAAAIMLAFGSPDELEVLGITTVAGNVPL
FT                   SLTSRNARIVCELCSRTETKVFAGADAPIARKLVTAEHVHGKTGLDGPELSEPTMALQP
FT                   GHAVDFIIETLRREPEGTVTLCTLGPLTNIGLAFQKAPDIVPRIRELVMMGGGFFEGGN
FT                   ITPAAEFNIYVDPEAADIVFRSGVRVVMMPLDVTHQLLTRKDRVKRMAEIGTAPAKAMV
FT                   EMLEFFERFDIEKYGSDGGPLHDPTVVAYLLKPELFKGRDCNVEIEVQSELTVGMTVVD
FT                   WWHVTERKRNAKVMRHVDADGFFDLLIERFARI"
FT   CDS_pept        419349..419774
FT                   /transl_table=11
FT                   /gene="hspH"
FT                   /locus_tag="RL0384"
FT                   /product="putative small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05875"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMC7"
FT                   /protein_id="CAK05875.1"
FT                   /translation="MSRITPFASPLLLGFDAMEKTLERISKASDGYPPYNIERIAADTG
FT                   APERLRITLAVAGFSEEELDVSIEENQLVIRGRQVEQGERDYLYRGIAARQFQRTFVLA
FT                   DGMQVLGAGLKNGLLSVDLIRPEPARMVKKINISVSQ"
FT   CDS_pept        419822..420079
FT                   /transl_table=11
FT                   /locus_tag="RL0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05876"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMC6"
FT                   /protein_id="CAK05876.1"
FT                   /translation="MLMKEATSHLTKSELAHIGNGEVAYIRKMRTDEVAKCFPEAPDID
FT                   PNVDLWALFGADGTPILLTDNRSSTFFKAAEDELKTVSLH"
FT   CDS_pept        complement(420131..420397)
FT                   /transl_table=11
FT                   /locus_tag="RL0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05877"
FT                   /db_xref="InterPro:IPR018735"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMC5"
FT                   /protein_id="CAK05877.1"
FT                   /translation="MCRNIKPLFNFDPPATDDEIHDAALQFVRKVSGTTKPSKRNEVAF
FT                   EHAVSSIAACARELLDSLETSQPPRDREEVAAKARARTAVRFA"
FT   CDS_pept        420574..421140
FT                   /transl_table=11
FT                   /locus_tag="RL0387"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMC4"
FT                   /protein_id="CAK05878.1"
FT                   /translation="MDLIELKSEFVSSSEAAVGDVSLRRQQRSSVRVPFHATSSASIPR
FT                   WLVHGRRRKELALNQSQPNRFPFHTQCPRDDGCGVFVLQMLTGMSYDDVAAMIDWGDKS
FT                   AHYTTWNDLCGVLAEIGLSVETPIKTSRWSDIQGVAIVHVQGDHFMLYDAENGLFYDPA
FT                   EMEGPRVASARVPTSYLTVYGPNHR"
FT   CDS_pept        complement(421197..421898)
FT                   /transl_table=11
FT                   /locus_tag="RL0388"
FT                   /product="putative tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RL0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05879"
FT                   /db_xref="GOA:Q1MMC3"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMC3"
FT                   /protein_id="CAK05879.1"
FT                   /translation="MTDMERRGRATEAFFGRRKGKALREQQAETLNSLLPAFLIDLSAA
FT                   PPEPLTSLFPVPVERLRLEIGFGGGEHLIHRALETPSTGFIGVEPFVNSMQKLLSRIGE
FT                   TGASNIRVYNDDATQLLDWLPDGALDQIDLLYPDPWPKRKHWKRRFVSKTNLDRFHRVL
FT                   KPGGLFCFASDIDTYVNWTLIKCRDHGGFEWIADNAADWLTPYEGWPSTRYEAKARREG
FT                   RSSAYLTFRKV"
FT   CDS_pept        complement(421907..423145)
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="RL0389"
FT                   /product="putative S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RL0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05880"
FT                   /db_xref="GOA:Q1MMC2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMC2"
FT                   /protein_id="CAK05880.1"
FT                   /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLVYREAAKTGVNPWG
FT                   VRIACETLATTNRVVIAGEVRLPPSLMKKDKDGKDVINPSKFKAAARRAIKDIGYEQDG
FT                   FHWKKAKIDVLLHSQSADIAQGVDSAADQQGDEGAGDQGIMFGYACRETPDLMPAPIYY
FT                   SHKILQLLAVARKKGDGEVAKLGPDAKSQVTVRYVDGKPSEATSIVLSTQHLDESWDSK
FT                   KVRAVVEPYIREALGELKIADDCKWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAP
FT                   HGGGAFSGKDTTKVDRSAAYAARYLAKNVVAAGLADRCTIQISYAIGVAQPLSIYVDLH
FT                   GTGKVTEDQIEAAIRKNMDLSPTGIRRHLDLNKPIYAKTSAYGHFGRKAGRDGSFSWER
FT                   TDLVKALKESVKA"
FT   CDS_pept        complement(423324..423740)
FT                   /transl_table=11
FT                   /gene="phrR"
FT                   /locus_tag="RL0390"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05881"
FT                   /db_xref="GOA:Q1MMC1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMC1"
FT                   /protein_id="CAK05881.1"
FT                   /translation="MIENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQIQ
FT                   KYEKGTNRVGASRLQNISNILNVPVSFFFEDAPGEHSSAGGGMEASSSNYVVDFLSSSE
FT                   GLQLNRAFVKISDPKVRRKVVELVKALAAEADAD"
FT   CDS_pept        complement(423893..425524)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="RL0391"
FT                   /product="putative transmembrane acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05882"
FT                   /db_xref="GOA:Q1MMC0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMC0"
FT                   /protein_id="CAK05882.1"
FT                   /translation="MIRGLMGVRMERLADRVILVWGFKRSLLAIAAGAFAVLALPPIGF
FT                   FAAMFVSFTLLVWLIDGAAASPESGLIGRLWPAFATGWLFGFGYFVAGLWWLGHALLVD
FT                   QEEFAWALPLAIFGLPACLAIFYGLAAALARIVWSDGMGRIAALAAGFGLMEWLRSVIL
FT                   TGFPWNAIGYGIMPVPLMMQSAHVIGAMGVTALAVFVFSAPALAGTRQGARTGIALAAL
FT                   FFAAHLGYGAYALHLAPRPDTLPEDKRPVVRLVQPAIDQTEKMDNDVDRAAIFETHLKL
FT                   SAEAPKNGGRKPDIIVWPETSIPFILTDNQDALTRIADTLDDDQILIAGAVRAEEMGPG
FT                   TPPRYYNSIYVIDGRGQIIAASDKVHLVPFGEYLPFEDVLTEFGIQNVVEIPGGFSAAA
FT                   SRHLLALPGGLNLYPLICYEIIFPGEMTGDIKDANAILNITNDAWFGVTPGPYQHFQQA
FT                   RVRAVETGLPLIRDANSGISALVNAHGEIIAGLDLGETGFVDATLDSISDGVGTTFPRQ
FT                   TYFWLTEVLLILIALISRRGFISGLN"
FT   CDS_pept        complement(425578..426723)
FT                   /transl_table=11
FT                   /locus_tag="RL0392"
FT                   /product="putative hemolysin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05883"
FT                   /db_xref="GOA:Q1MMB9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMB9"
FT                   /protein_id="CAK05883.1"
FT                   /translation="MSDFTTKPAADAKDSEPSSSSDEAGSSSRPSGRSQSFWSRAARIL
FT                   RPQQGSRLREDLADALMTDAAGDDAFSPDERAMLNNILRFREVRVADVMVPRADIEAVD
FT                   QNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNKRRGPTKPTT
FT                   VVPAIEVAPENIQKTARSAKQNFDLARVDLQKTLAEAGIIRKILFVPPSMLASDLLRRM
FT                   QVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDMFIADARV
FT                   ELEEIAQAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPGFEFHILDADPR
FT                   RIKRLRITRKRHAIRRRAKADGDAAPGSETGDDRPAKSTAN"
FT   CDS_pept        complement(426720..427235)
FT                   /transl_table=11
FT                   /locus_tag="RL0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05884"
FT                   /db_xref="GOA:Q1MMB8"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMB8"
FT                   /protein_id="CAK05884.1"
FT                   /translation="MAELDIQISVEDIGWPGEETLLSFCERVLGAAAVYLRDSEKQPFP
FT                   TMAPEVSLVFTDDASIQDINAEWRGKDKATNVLSFPAFPVQPGKMPGPMLGDIIIARET
FT                   LEREAAELEKSFDDHLTHLLVHGFLHLLGYDHMNSAEAEIMEGLETRILAQLGLSDPYE
FT                   GQDLKMEP"
FT   CDS_pept        complement(427235..428284)
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="RL0394"
FT                   /product="putative phosphate starvation-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05885"
FT                   /db_xref="GOA:Q1MMB7"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMB7"
FT                   /protein_id="CAK05885.1"
FT                   /translation="MNGQELVSSSPRHPRTPSDTNHFVLTFENNRFASELFGQFDQNLK
FT                   LLEQRLNIDARARGNSVVITGDIVTTNQARRTLDYLYEKLQKGGSVERSDVEGAIRMAV
FT                   AADDQLSLPTMERKAKLTMAQVSTRKKTIIARTPTQDAYIRALERAELVFGVGPAGTGK
FT                   TYLAVAHAAQLLERGAVEKIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDMI
FT                   PADKVDRAITAGVIEIAPLAFMRGRTLANAAIILDEAQNTTSMQMKMFLTRLGENARMI
FT                   VTGDPSQIDLPRGVKSGLVEALQLLNGVEGISIVRFTDTDVVRHPLVGRIVRAYDSTYA
FT                   VAEDVSRQG"
FT   CDS_pept        complement(428303..429724)
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="RL0395"
FT                   /product="putative MiaB protein (methylthiolation of
FT                   isopentenylated A37 derivatives in rRNA)"
FT                   /db_xref="EnsemblGenomes-Gn:RL0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05886"
FT                   /db_xref="GOA:Q1MMB6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMB6"
FT                   /protein_id="CAK05886.1"
FT                   /translation="MTQDSALLQAPEAIPSESLRDGSNSRKVFIKTYGCQMNVYDSMRM
FT                   SDALARDGYEPTEDMEVADLVLLNTCHIREKAAEKVYSALGRLREMKKKKAADGREMMI
FT                   GVAGCVAQAEGEEILRRAPAVDVVIGPQTYHRLPEALRRAKQGQRVVDTEYAIEDKFEH
FT                   LPIAESRRIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSEVSRSVSQIVEEAEKLADSG
FT                   VREITLLGQNVNAWHGAGSQGEAWSLGDLLYRLAEIPGLARLRYTTSHPRDMDDRLINA
FT                   HRDLSALMPYLHLPVQSGSDRILKAMNRRHTAAEYLALIERIRTVRPDIALSGDFITGF
FT                   PGETDEDFKDTLRLVEEVRYAQAFSFKYSTRPGTPGAELKDQVPEEIKAERLERLQMLL
FT                   LKQQQEFAESCVGKEIDLLLEKPGRMPEQLIGRSPWLQSVNVDAKASQIGDIIKVRITG
FT                   TGTNSLFAEHAEAAV"
FT   CDS_pept        complement(430128..430925)
FT                   /transl_table=11
FT                   /locus_tag="RL0396"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05887"
FT                   /db_xref="GOA:Q1MMB5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMB5"
FT                   /protein_id="CAK05887.1"
FT                   /translation="MIAWLRIAFAAVVILAVSIVLMPLQVLALRFDWRLRRRLPRAWHR
FT                   IVCYCLGIRVRVSGKLEDRRPLMLCSNHSSWLDIMVMSAVADVVFIAKIEVREWPIFGT
FT                   LAKLQKSVFVVREERRKTGHQANEIAGRMADGEIVVLFPEGTTSDGNRLLEVKSSLFGA
FT                   AAMAVPYSPTGTVVVQPVAVAYTRVHGIAMGRYHRPLAAWPGDIELLPHLLDIVRCGAI
FT                   DAEVSFGEAVDYRAETSRKEVSATISLRIRNLLNSRLRGREIS"
FT   CDS_pept        complement(430953..431381)
FT                   /transl_table=11
FT                   /gene="mur"
FT                   /locus_tag="RL0397"
FT                   /product="manganese responsive transcriptional regulator
FT                   member of Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:RL0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05888"
FT                   /db_xref="GOA:Q1MMB4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMB4"
FT                   /protein_id="CAK05888.1"
FT                   /translation="MTDVAKTLEELCTERGMRMTEQRRVIARILEDSEDHPDVEELYRR
FT                   SVKVDAKISISTVYRTVKLFEDAGIIARHDFRDGRSRYETVPEEHHDHLIDLKTGTVIE
FT                   FRSPEIEALQERIAREHGFRLVDHRLELYGVPLKKEDL"
FT   CDS_pept        complement(431464..431964)
FT                   /transl_table=11
FT                   /locus_tag="RL0398"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05889"
FT                   /db_xref="GOA:Q1MMB3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMB3"
FT                   /protein_id="CAK05889.1"
FT                   /translation="MTMLEAYLTLKPEFEIIAMEREDCRDVAVLHGERFARPWGDGEFH
FT                   GLLMQDTVFGFVARQTNAILKKPLPGFILARHVAGEAEILTIAVQAKVARAGLGWRLMQ
FT                   AAMREARSRGGESMFLEVDNGNTAALGLYRKLGFEKVGERQGYYKQENGALSTALVMKR
FT                   VLR"
FT   CDS_pept        complement(431961..432623)
FT                   /transl_table=11
FT                   /locus_tag="RL0399"
FT                   /product="putative endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05890"
FT                   /db_xref="GOA:Q1MMB2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMB2"
FT                   /protein_id="CAK05890.1"
FT                   /translation="MIILALDTAGVDCAAAVYDSGRDTVLGEASDMIGKGHAEHMIGIV
FT                   DRALDQAGLALSDIDRLAVTIGPGSFTGIRVGVAAARGFALSLNVPAVGVTTLEVMASA
FT                   QRDKTPHRAVLAAMDAKRDEIYLQSFAADGSPLDAPRAVSVAEAQAFAAGFDGEITGSA
FT                   TSLLKADAGGDHTNRFPISVVARLGAAASPNAGKPKPLYLRGPDAKPQAGYAIARRV"
FT   CDS_pept        complement(432712..433278)
FT                   /transl_table=11
FT                   /gene="fssA"
FT                   /locus_tag="RL0400"
FT                   /product="putative nifU iron-sulphur cluster scaffold
FT                   protein"
FT                   /note="Similar, but truncated at the N-terminus, to Homo
FT                   sapiens (Human) cytosolic iron-sulfur cluster scaffold
FT                   protein Nfu. UniProt:Q7Z5B1 (EMBL:AY286307) (230 aa) fasta
FT                   scores: E()=1e-30, 49.198% id in 187 aa, and similar to
FT                   entire protein of Rhizobium meliloti (Sinorhizobium
FT                   meliloti) hypothetical protein smc01119. UniProt:Q92SI8
FT                   (EMBL:SME591783) (188 aa) fasta scores: E()=8.5e-57,
FT                   82.796% id in 186 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05891"
FT                   /db_xref="GOA:Q1MMB1"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMB1"
FT                   /protein_id="CAK05891.1"
FT                   /translation="MFIQTEATPNPATQKFLPGKVVMENGTAEFRSTEEAQASPLAARL
FT                   FEISGVTGVYFGYDFISVSKDNADWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADA
FT                   DDEFFDEGDESIVLTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSS
FT                   TATLKHGVQNLLRHFVPEVQEVIAA"
FT   CDS_pept        complement(433498..433989)
FT                   /transl_table=11
FT                   /locus_tag="RL0401"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05892"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMB0"
FT                   /protein_id="CAK05892.1"
FT                   /translation="MVSKRLSRLEGHRRKFMAVIDGTPECQRAVHYAGRRAKNSNGGLV
FT                   LLYVIPDGDFQQWLGVEEIMRAEAREEAEAVVAKIAQIVRETIGIEPEVVIREGGAAEQ
FT                   INAVIEEDRDVAILVLAAGSAKEGPGPLVSSVAGRAAAFPIPVTVLPDTLTNEEIDALC
FT                   "
FT   CDS_pept        complement(434120..435184)
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="RL0402"
FT                   /product="putative tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RL0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05893"
FT                   /db_xref="GOA:Q1MMA9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMA9"
FT                   /protein_id="CAK05893.1"
FT                   /translation="MNEFKKLVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCIYCVVD
FT                   MHALTAQLVHEDMPSQTRSIAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIG
FT                   WMNRMTQFKDKAGKDREQASLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIA
FT                   MKFNLDYAEHISRTGYGVDITVGNEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSD
FT                   PSDLSRINLMDDEDAISKKIRKAKTDPDGLPSEIDGLQGRPEADNLVAIYAALADKSKA
FT                   DVLAEFGGQQFSVFKPALVDLAINVLAPITGEMRRLMDDTSHIDAILRKGGERARARAE
FT                   VTMRQVRDVIGFLY"
FT   CDS_pept        complement(435315..435758)
FT                   /transl_table=11
FT                   /locus_tag="RL0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05894"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMA8"
FT                   /protein_id="CAK05894.1"
FT                   /translation="MPLTTGINISNARQHMVIQSLFLVTLVVDDYDRAKAFYCDGLGFE
FT                   CLQDELQPEGKRWVVVKPRGEDGAAFLLAQAADETQRAAIGNQTGGRVGFFLKTDNFAR
FT                   DHAAMLAVGVRFLEEPRHEVYGTVAVFADPYGNTFDLIQHTAA"
FT   CDS_pept        complement(436353..437933)
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="RL0404"
FT                   /product="putative transmembrane mviN virulence factor
FT                   homologue"
FT                   /db_xref="EnsemblGenomes-Gn:RL0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05895"
FT                   /db_xref="GOA:Q1MMA7"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMA7"
FT                   /protein_id="CAK05895.1"
FT                   /translation="MSLVKKFATVGGATLGSRIFGFARETLMAAALGTGPMADVFYAAF
FT                   RFPNLFRRLFAEGAFNAAFVPLFAKEIEANGTDGAKRFSEEVFGVLFSVLLLITIVMEL
FT                   AMPLLVRFVIAPGFADDPEKFSITIRMAAVMFPYLMCMSLTAMMSGMLNSLHHFFAAAI
FT                   APVFLNVVMIGALFYALYTGADPLATAWYLSWGVLAAGVLQLAVVYAGVLAAGMSIGFR
FT                   FPKMTPNVKRLLILAVPAAVTGGITQINQLIGQAIASSRDGAIAALQYADRIYQLPLGV
FT                   VGVAVGVVLLPELARALKGGNLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLY
FT                   ERGAFHQENTAVVGSILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCA
FT                   TALTLFPYMGAPGIAVAEATAGWISTVLLFATLLRRGHLTWEWALAKRTALLIVAAAVM
FT                   GAAIVFLKQYWAPSLASGAPLLTKIGTLGLLIAIAMLIYFAAAFLVGGANLSMIRRNLN
FT                   RKPAPAKDG"
FT   CDS_pept        complement(437986..440892)
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="RL0405"
FT                   /product="putative [Protein-PII] uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:RL0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05896"
FT                   /db_xref="GOA:Q1MMA6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMA6"
FT                   /protein_id="CAK05896.1"
FT                   /translation="MQTKQAAGREPAVRHEQETAPATAMRDLDFTNILDVELLQKQCDA
FT                   VAEANRNRPDVLRADLLAVLKKASTEGRQKAREALMADGGGLNCAYRISWLQDQITTVL
FT                   YNFATAHIFPQQKDKFAVTAVGGYGRDTLAPGSDIDLLFLFLPRPAEETHKAVEFMLYV
FT                   LWDMGFKVGHATRTVEECIALSKSDMTIRTAILEMRYICGLQRLETELETRFDKEIVTG
FT                   TGPEFIAAKLAERDERHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWISKYYYHVRDQAE
FT                   LVKLGVLSKHEYRLLEKADDFLWAVRCHMHFLTGKAEERLSFDIQREIAEAFGYHTRPG
FT                   LSAVERFMKHYFLVAKDVGDLTRILCAALEDQQAKSIPGLTGVISRFTHRNRKIAGSVE
FT                   FVEDRGRIALADPEVFKRDPVNIIRLFHVADINGLEFHPDALKRVTRSLALIDNALREN
FT                   DEANRLFMSILTSKRDPALILRRMNEAGVLGRFIPEFGKIVAMMQFNMYHHYTVDEHLI
FT                   RTVDILSEIDKGRAEDLHPLANKLMPGIEDREALYVAVLLHDIAKGRQEDHSIAGARVA
FT                   RKLCVRFGLSQKQTEIVVWLIEEHLTMSMVAQTRDLTDRKTITDFADRVQSLDRLKMLL
FT                   ILTICDIRAVGPGVWNGWKGQLLRTLYYETELLLAGGFSEVSRKERANAAAEALHSALA
FT                   DWSQKDRNTYTKLHYQPYLLSVPLEDQIRHAHFIRQADKAGQALATMVRTDSFHAITEI
FT                   TVLSPDHPRLLAVIAGACAAAGANIVDAQIFTTSDGRALDTIHVSREFTDDADELRRAA
FT                   TIGRMIEDVLSGRKRLPEVIATRARNRKKSKAFVIPPSVNITNSLSNKFTVIEVECLDR
FT                   PGLLSEITAVLSDLSLDIQSARITTFGEKVIDTFYVTDLVGQKISGDSKRANITARMKA
FT                   VMAEEEDELRERMPSGIIAPAATARTPPASEKKAGSPI"
FT   CDS_pept        complement(441335..444061)
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="RL0406"
FT                   /product="putative DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05897"
FT                   /db_xref="GOA:Q1MMA5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MMA5"
FT                   /protein_id="CAK05897.1"
FT                   /translation="MNARIDTGNEAFSAAELATAESRASATPMMEQYIEIKANNPDSLL
FT                   FYRMGDFYELFFEDALEASRALGITLTKRGQHMGQDIPMCGVPVHAADDYLQKLISLGF
FT                   RVAVCEQIEDPAEAKKRGAKSVVRRDVVRLVTPGTITEEKLLSPSESNYLMALTRIRGS
FT                   GEALLALAWIDISTGVFRLAETEASRLLADILRIDPRELILPDTIFHDPELKPVFDVLG
FT                   RTAVPQPSVLFDSASAEGRIARYFGVATLDGFGTFSRAELAAAAAAVAYVEKTQIAERP
FT                   PLGKPERESAASTLFIDPATRANLELARTLSGDRNGSLLKAIDRTVTGGGARLLAERLM
FT                   SPLTDPARINARLDSIGFLIDEPLLCGNLRDTLKHVPDMPRALSRLALDRGGPRDLSAI
FT                   RQGLDAAGGVAVMLGKAVLPEELGQALSELQALPATLEKLLAETLAEELPLLKRDGGFL
FT                   RDGANAELDEVRALRDQSRRVIAGLQLQYAEETGIRSLKIKHNNVLGYFIEVTAGNASP
FT                   MTETADAKARFIHRQTMANAMRFTTTELADLESRIANAADQALTIELEAFDRMTAAVVA
FT                   EAEAIKSGARALAVIDVAAGLALLAEEQAYCRPQVDGSKMFAIESGRHPVVEQALRRQA
FT                   GGPFVANHCDLSPKTGDRDGAIWLLTGPNMGGKSTFLRQNALISILAQMGSFVPATSAH
FT                   IGIVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQASDRSLVILDEIGRGTATFDGL
FT                   SIAWAAVEHLHEANRCRGLFATHFHELTVLSEKLGRLSNATMRVKEWDGDVIFLHEVGP
FT                   GAADRSYGIQVARLAGLPASVVARARDVLTRLEDADRKNPASQLIDDLPLFQVAVRREE
FT                   TARGASKVEEALKAMSLDDMTPREAMDALYDLKKKLK"
FT   CDS_pept        444175..446460
FT                   /transl_table=11
FT                   /gene="tme"
FT                   /locus_tag="RL0407"
FT                   /product="NADP-dependent malate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:RL0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05898"
FT                   /db_xref="GOA:Q1MMA4"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMA4"
FT                   /protein_id="CAK05898.1"
FT                   /translation="MPDIDKKDRPVTSVTDQEALDFHAMGRPGKLEINPTKPMATQRDL
FT                   SLAYSPGVAVPVKAIAADPQTAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGK
FT                   AVLFKRFADVDSIDLEIDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFVIESRLREL
FT                   MDIPVFHDDQHGTAIIAAAGLINALELTGRDLKTTKLVCNGAGAAAIACVELIKAMGFA
FT                   PENVILCDTKGVIYQGRTEGMNQWKSAHAAKTDTRTLEEAMKGADVVFGLSQKGAFSAK
FT                   MIRSMAERPIIFAMANPDPEITPEEVARIRDDAIMATGRSDYPNQVNNVLGFPYIFRGA
FT                   LDVRASTINDAMKIAAVNALANLAREDVPDDVVAAYQGNRPRFGSQYIIPVPFDPRLIS
FT                   AIPVAVAQAAIESGVARKVITDMAGYARELSARRDPIASTLASLYERVRRRPKRIVFAE
FT                   AEEEQVLRAAMSYANQQLGTAILLGREDLIRATAERAGIDLNRPGLEIVNARLSTRVEA
FT                   YIDYLYARLQRHGYLHRDAQRLIHNDRNHFAATMVALGDADGMVTGITRNYSTALEDVR
FT                   RCIDEKPGHRVIGVSLALCRGRTVFVADTAVHDMPTAEELADIAEEAAGLARRMGYPPR
FT                   VAMLAYSTFGHPSGERSERVREAVKILDKRRVDFEYDGEMAADVALNRKVMEQYPFCRL
FT                   SGPANVLVMPAFHSASISTKMLQELGGSTVIGPILVGLDKPVQITSMGAKDSDIVNMAA
FT                   IAAYGAGS"
FT   CDS_pept        complement(446840..447718)
FT                   /transl_table=11
FT                   /locus_tag="RL0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05899"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMA3"
FT                   /protein_id="CAK05899.1"
FT                   /translation="MSAIDILNRDTTAEAARPSTAAVQKDGDILGRIGNLETRLARTAR
FT                   EIDAAQAVRYRVFVDEMKAQLPLDAMRRQRDVDAYDAVCDHLLVLDRSIEGDPEDQIVG
FT                   TYRLLRQDVAIANGGFYSASEFEIEGLIAKHPDKRFMELGRSCVLPEYRTKRTVELLWQ
FT                   GNWAYALKHGVSAMFGCASFPGVYAESHALALSFLYHNVLAKNEWAVGALPHLARNMDL
FT                   MPVEAINPKRALMALPPLIKGYLRLGAMVGSSAVVDHAFNTTDVLIVLPITSISDRYLN
FT                   YYGADAGRFAS"
FT   CDS_pept        complement(447827..450079)
FT                   /transl_table=11
FT                   /locus_tag="RL0409"
FT                   /product="putative transmembrane two-component sensor
FT                   histidine kinase/response regulator hybrid"
FT                   /note="C-terminus from codon 225 is similar to the
FT                   C-terminus from codon 275 of Pseudomonas chlororaphis
FT                   (Pseudomonas aureofaciens) GacS. UniProt:Q93LL1
FT                   (EMBL:AY037869) (917 aa) fasta scores: E()=3.7e-35, 31.387%
FT                   id in 548 aa, and entire protein is similar to
FT                   Agrobacterium tumefaciens (strain C58/ATCC 33970) bara two
FT                   component sensor kinase/response regulator hybrid.
FT                   UniProt:Q8UIF4 (EMBL:AE009005) (746 aa) fasta scores:
FT                   E()=2.6e-118, 53.785% id in 634 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05900"
FT                   /db_xref="GOA:Q1MMA2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMA2"
FT                   /protein_id="CAK05900.1"
FT                   /translation="MSAAFGGPAAKPLEKRMEVFSPRPNAAAPRGADDRQGGPAPTRRL
FT                   LFYWLGGAGLLAATILMLLAHAGDPLLLSGGLVVLGLAVIASYALLMVRSRRAGQRPGQ
FT                   TMPDGNGGAKLFADVHDVLGDITVSRTMDRRIISANDTFRRLTGRLRPEGKTCEEIGLA
FT                   FRPGPIPHCYDVEISTPEGQRIFLWRDVVTRDPANGRLLLQSVARDVTDERLIAQGREE
FT                   ARQKAEYNSAAKSRLLATVSHEVRTPLSGILGMTHLIAETRLTQEQQNYLASIRQSGHA
FT                   LTQLVEDLLDFSTIEVGRFALHPRSESLRKLLESVVEMLAHRAHEKGIEIGATVSSDVP
FT                   ENMSFDPARLRQVLFNVIGNAVKFTQVGGVFIRVSLDGDDLSITVTDSGPGMTAEEQAR
FT                   VFGEFEQGGSVTDKSSGTGLGLAISARIMREFNGALTVASEKGRGSEFTIRFPVDIGSE
FT                   RPDRRNTLLAGNSVVLLAPAGAARTAIAETITALGGLCHLVGDGETARATLLELAKGGR
FT                   RPTDIIIDHRMSAEFSAHLADRADIAALGLRKVLLVNPEERSAHPLDLFDAWLIRPLRE
FT                   QSLIDVLRGRMRGMEKRDALNDNQPGFGLSVTETMVATRGLSILLGEDDPINAMLVRVV
FT                   LEKGGHKVRHVEDFETLLDYALCEANDRPDIIISDLSMPGGNGIDMLGRLRGHERRLDL
FT                   ASVPVIVLTADKSDESRRQVLLNGANRVMIKPVDPVRLLTEVQAVAALSARRAEAR"
FT   CDS_pept        complement(450165..450668)
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="RL0410"
FT                   /product="putative transmembrane lipoprotein signal
FT                   peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:RL0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05901"
FT                   /db_xref="GOA:Q1MMA1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMA1"
FT                   /protein_id="CAK05901.1"
FT                   /translation="MTEQTHARPALFSRPAPILFFIVVAVLIDQAVKIAVDHYLPLQEA
FT                   VPVVPMLALYRTYNLGVAFSMLSGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWIAHLGY
FT                   ALIIAGAIGNLVDRFAYGHVIDYILFYTESWSFAVFNLADSFITIGAGCVILDELLLPK
FT                   KAGR"
FT   CDS_pept        complement(450665..451480)
FT                   /transl_table=11
FT                   /locus_tag="RL0411"
FT                   /product="putative rRNA methyltransferase"
FT                   /product="rrna methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05902"
FT                   /db_xref="GOA:Q1MMA0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MMA0"
FT                   /protein_id="CAK05902.1"
FT                   /translation="MKEVTSLANPIIKDIKALTNKKSREESGTFLAEGLKLVIDAIELG
FT                   WAIRTLVYAKAAKGKPLVEQMAAKTVASGGLVLEVSEKVIASITRRDNPQMVVGIFEQR
FT                   WRPLKGIRLSEGETWVALDRVRDPGNLGTIIRTADAAGASGIILLGETTDPFSLETVRA
FT                   TMGSVFAVPLARATPEEFIAWRKSAGVSVVATHLAGAVDYRTIDYRKKPVVLLMGNEQS
FT                   GLPEQLAREADALARIPQQGRADSLNLAVATAVMLFEARRHLLSLAEGK"
FT   CDS_pept        complement(451522..452619)
FT                   /transl_table=11
FT                   /locus_tag="RL0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05903"
FT                   /db_xref="GOA:Q1MM99"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM99"
FT                   /protein_id="CAK05903.1"
FT                   /translation="MKQREGRPGQKKTSGPSGESRRDDRAGRPPKPVARPAATREAVRE
FT                   AAVPAAVARPLMTRSGERPTERVPVILESLGAGDFHLIDSGNGEKLEQYGPYRIIRPEA
FT                   QALWRPSLPGHIWEKVDAAFTGDTDEEGTGRWRFPKEALGETWPLNLLGVDFLGRFTSF
FT                   RHVGVFPEQIVHWSWMKDEVEKAGRPLKVLNLFGYTGVASLVAAAAGAEVTHVDASKKA
FT                   IGWARENQALGRMEKLPIRWICEDAMKFILREERRGSQYDIILTDPPKFGRGPNGEVWH
FT                   LFEHLPLMLDVCREILSPKAVGLVLTAYSIRASFYSIHELMRETMRGAGGVVESGELVI
FT                   REAGTDGKTQGRALSTSLFSRWVPK"
FT   CDS_pept        complement(452806..453453)
FT                   /transl_table=11
FT                   /locus_tag="RL0413"
FT                   /product="putative MutT/NUDIX family ADP compounds
FT                   hydrolase"
FT                   /note="Codons 68 to the C-terminus are similar to codons 50
FT                   to the C-terminus of Escherichia coli NudE ADP compounds
FT                   hydrolase NudE (ec 3.6.1.-). UniProt:NUDE_ECOLI
FT                   (EMBL:H65134) (186 aa) fasta scores: E()=0.0031, 29.452% id
FT                   in 146 aa, and to Caulobacter crescentus MutT/Nudix family
FT                   protein. UniProt:Q9A2B5 (EMBL:H87701) (187 aa) fasta
FT                   scores: E()=9.1e-22, 42.553% id in 188 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05904"
FT                   /db_xref="GOA:Q1MM98"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM98"
FT                   /protein_id="CAK05904.1"
FT                   /translation="MLSAGFRSGTHLTHIGDGPMNDELKPWSVTASRISYEDRWIRVRS
FT                   DDCITADGTVVAPFHVLDYPDWINVIPVMPDGRVLLTREYRHDRGEIVLGLVAGSLEPG
FT                   DSKTGDAAMAAARRELREETGYEASTFIKLLTSYPNAASQSNMVTSWLALGLSRAGEPS
FT                   FDPGEKVELLFADLAAILGELQSGAVIMQSMHVAALYAAESWLRIQASEGLK"
FT   CDS_pept        453522..453977
FT                   /transl_table=11
FT                   /locus_tag="RL0414"
FT                   /product="putative carbon monooxide dehydrogenase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05905"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM97"
FT                   /protein_id="CAK05905.1"
FT                   /translation="MDFSGEERIAAPRDVVWTALNDPEIMRGCIPGCQSIERLSLSAFE
FT                   ATIKVKVSLLSATFHGLLTLSNVDAPKSYTLSAEGKGGLAGFARGSADIVLEEWGVETI
FT                   LRYRSKAELGGRLAQFGARLLDSTSQKLAEGFFSDFNAAVVAKMAAG"
FT   CDS_pept        454015..454449
FT                   /transl_table=11
FT                   /locus_tag="RL0415"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05906"
FT                   /db_xref="GOA:Q1MM96"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM96"
FT                   /protein_id="CAK05906.1"
FT                   /translation="MTWTIRPPRAEDQEMLAEIYLSVRRETFVWVDPGKFYREDFAAHT
FT                   NGETVFVCAHENGSVAGFLSLWPEDDFIHMLYISPEFQGQGAGTALLHALPEWPQHRYR
FT                   LKCLVKNRRAKAFYLAHGFHVTGNGTSPEGDYEELSFFPA"
FT   CDS_pept        complement(454488..454820)
FT                   /transl_table=11
FT                   /locus_tag="RL0416"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05907"
FT                   /db_xref="GOA:Q1MM95"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM95"
FT                   /protein_id="CAK05907.1"
FT                   /translation="MAKKIVNLLILLPLGVILIVFCVANRQSVTLAFNPFRPEDQVLAV
FT                   SAPFFVFLVVALIAGMLIGAAATWFSQGKHRKRARTEAKEAIRWQSEADRHKNRAEEIA
FT                   GQLPAR"
FT   CDS_pept        complement(454973..455272)
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="RL0417"
FT                   /product="putative integration host factor beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RL0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05908"
FT                   /db_xref="GOA:Q1MM94"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MM94"
FT                   /protein_id="CAK05908.1"
FT                   /translation="MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVEL
FT                   RGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADEED"
FT   CDS_pept        complement(455302..456285)
FT                   /transl_table=11
FT                   /locus_tag="RL0418"
FT                   /product="putative peptidase"
FT                   /note="Codons 30 to 250 are similar to codons 30 to 270 of
FT                   Bacillus subtilis SppA putative signal peptide peptidase
FT                   (ec 3.4.21.-). UniProt:SPPA_BACSU (EMBL:AF008220) (335 aa)
FT                   fasta scores: E()=8.9e-19, 36.744% id in 215 aa, and to
FT                   entire protein of Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970) SppA proteinase IV (agr_c_588p).
FT                   UniProt:Q8UIG0 (EMBL:H97399) (317 aa) fasta scores:
FT                   E()=1.2e-73, 66.349% id in 315 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05909"
FT                   /db_xref="GOA:Q1MM93"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM93"
FT                   /protein_id="CAK05909.1"
FT                   /translation="MPKPVPALEVSMDSSIIADRRRLRRKLGFWRLIAVALIVALGFAF
FT                   YRFALGDAGTQRPHIAHVTISGLIVDDDELLERLKKVETSDQVKAAVISISSPGGTTYG
FT                   GEKIFKAIRAISAKKPVVSDVRTLAASAGYMIATAGDTIIAGDSSITGSIGVIFQYPQI
FT                   QPLLDKIGVSLQEIKSSPLKAEPSPFHEASEEAKTMIRNMVVDSYNWFVDLVADRRKLP
FT                   RDEVLKLADGTIYTGRQALKVKLVDAIGGEAEIRAYLTSRGVDSDLPMVDWDKKSNTPF
FT                   LLAGAVSRLITIFGYDDLMKTQDINGILPPKLLLDGLLSVWQVGHD"
FT   CDS_pept        456478..457143
FT                   /transl_table=11
FT                   /locus_tag="RL0419"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05910"
FT                   /db_xref="GOA:Q1MM92"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM92"
FT                   /protein_id="CAK05910.1"
FT                   /translation="MLDTLKNNGHAAYSGSGRNAYGDALFHSARVRRLKILLPVAALII
FT                   AASLTAVALVSIYLPENVKMEGAKIENGKVVMEKPAISGRNSDGINYSMLAERALQDIR
FT                   NPNLITLETIKAAVPMNDGLIARVVASTADYNRTTDNLHMTAPFTLVLSSGLNANFQSA
FT                   ELDIKGGNMRSDDPVTITKDNASIVAKTLQITDKGRVITFEGNVRMNVDPSTIHKQGT"
FT   CDS_pept        457159..457800
FT                   /transl_table=11
FT                   /locus_tag="RL0420"
FT                   /product="putative outer membrane OstA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05911"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM91"
FT                   /protein_id="CAK05911.1"
FT                   /translation="MTKDCRISTCKTGMAFIAGAFALILTASGAGAQQATATMPGMKLS
FT                   NDQPIQIESDKLEIRDQEHTALFTGNVKVVQGTTTMQSGKMTVYYKDKAAKPAADGAQP
FT                   AAQPDQSASLASGSADIDKILVTDKVFLSSGTQTATADDGNFDMASQTFILTADEGNKV
FT                   ILSDGPNVFTGCKLTVHMQTGQAELESCGGRVQIQLDPKSQPNAQQQKQN"
FT   CDS_pept        457817..458617
FT                   /transl_table=11
FT                   /locus_tag="RL0421"
FT                   /product="putative ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:RL0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05912"
FT                   /db_xref="GOA:Q1MM90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM90"
FT                   /protein_id="CAK05912.1"
FT                   /translation="MKLSSLSTMFGKPGPQAAGAADKSRYQGTLIARGLTKTYATRRVV
FT                   NGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDEGTIEIDGNDVTTMPMYRRSRL
FT                   GVGYLPQEASIFRGLTVEENIRAVLEVHVKDKAEREQKLNELLEEFHIQKLRKSAAVAL
FT                   SGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADIQNLVHHLTARGIGVLITDHNV
FT                   RETLGLIDRAYIIHAGEVLTHGRANDIVNNPEVRRLYLGDNFSL"
FT   CDS_pept        458791..460350
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="RL0422"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:RL0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05913"
FT                   /db_xref="GOA:Q1MM89"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM89"
FT                   /protein_id="CAK05913.1"
FT                   /translation="MALSANLFLRQTQSLVMTPQLMQSIQLLQMTHFELNQFIALEVEK
FT                   NPLLEFPSNDGEAGGERGEAEDGEYAHQPEDAGSDDGYDNRTEALSSDWYDNGGSASTS
FT                   RLNDELDANYTNVFPDDGAPQRLDAPELVSQWKSMPGSGEGADYDLDDFVAGQVSLRDH
FT                   LAQQIPFVLPDMADRLIAQNFVDQLDDCGYLQADIVEAGERLGTSLAQAERVLATLQSL
FT                   DPPGVFARSLAECLAIQLRQKDRYDPAMQALVENLELLARRDFATLKRLCGVDEEDLLD
FT                   MLGEIRQLNPKPGSGFEAGVSEAITPDVVVRHASDGGWLVELNPDTLPRVLVNQSYFSR
FT                   VTKNGEDHAFLSDCLQSANWLTRSLDQRAKTIMKVASEIVRQQDAFLLHGVDHLRPLNL
FT                   KTVAEAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSISAVAGGDSHSAEAVRHKIR
FT                   ALILQESPEAVLSDDDIVDMLKKGGVDLARRTVAKYREAMNIASSVQRRREKRALAKVA
FT                   GF"
FT   CDS_pept        460439..461404
FT                   /transl_table=11
FT                   /locus_tag="RL0423"
FT                   /product="putative transmembrane protein"
FT                   /note="Possible alternative start site at codon 18"
FT                   /db_xref="EnsemblGenomes-Gn:RL0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05914"
FT                   /db_xref="GOA:Q1MM88"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM88"
FT                   /protein_id="CAK05914.1"
FT                   /translation="MALQPFELSSTNIEMPTMTPQNSSLARELFLLLVLATLWGSSYSF
FT                   IKIGVETIPPITLIAARTLIAGGILLAVLHHRRVRLPRDRATWRRFFVQACLNSVVPFT
FT                   LIAWAEQSVDAGLAVILNSATPIFTFLLAVLITHHEQVTLRRLFGVMAGLAGICLVIGV
FT                   EALSGLGENLTAQLAIILATICYAGAAIFSKNFKGLDPAVPAAGSLISGAVILLPTSLV
FT                   VDRPWELDPSAASMLALLALSAFSTALAFVIYFRLVQTLGSVGTTAQAYLRVPIGVAIG
FT                   IVFLGERLSPTAWIGLICVISGVAAMTIPARRGATQARNA"
FT   CDS_pept        461697..462272
FT                   /transl_table=11
FT                   /locus_tag="RL0424"
FT                   /product="putative sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05915"
FT                   /db_xref="GOA:Q1MM87"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM87"
FT                   /protein_id="CAK05915.1"
FT                   /translation="MSVRVSGKHMEIGESFRQKIEDQIGMAITKYFDGGYSGQVTVEKA
FT                   SSRYSADCKLHLDSGVVLHAAGEATDPQLAFDAASQRIEKRLRRYKRKLKDHHAGSHLN
FT                   GFAEVSYTVMDSVPDHDDEIADDFAPAIVAESTKQLKTMSVATAVMALDMTDEPLLLFR
FT                   SPGKEHLNIVYRRHDGNIGWIDSASIKG"
FT   CDS_pept        462343..462807
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="RL0425"
FT                   /product="putative nitrogen regulatory IIA Ntr protein"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:RL0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05916"
FT                   /db_xref="GOA:Q1MM86"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM86"
FT                   /protein_id="CAK05916.1"
FT                   /translation="MALADLLHQDAIIPALRVNSKKQLLQELAARAARITGLSEREIFD
FT                   VILQRERLGSTGVGNGIAIPHGKLGNIHSIVGIFARLEQPVDFEALDDQPVDLVFLLLA
FT                   PEGAGADHLKALSRIARVLRDHDLVAKLRATESASAIYAFLNEEQTSNAA"
FT   CDS_pept        complement(462895..465303)
FT                   /transl_table=11
FT                   /gene="mcpX"
FT                   /locus_tag="RL0426"
FT                   /product="probable mcp type chemoreceptor, ortholog of S.
FT                   meliloti mcpX"
FT                   /note="Codons 345 to the C-terminus are similar to codons
FT                   200 to the C-terminus of Caulobacter crescentus McpA
FT                   chemoreceptor (methyl-accepting chemotaxis protein).
FT                   UniProt:MCPA_CAUCR (EMBL:AE005716) (657 aa) fasta scores:
FT                   E()=1.1e-59, 48.817% id in 465 aa, and to entire protein of
FT                   Agrobacterium tumefaciens (strain C58/ATCC 33970)
FT                   methyl-accepting chemotaxis protein. UniProt:Q8UIC4
FT                   (EMBL:AE009008) (793 aa) fasta scores: E()=1.8e-177,
FT                   68.678% id in 779 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05917"
FT                   /db_xref="GOA:Q1MM85"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM85"
FT                   /protein_id="CAK05917.1"
FT                   /translation="MMGRSLCCCAGECPFGASLPEDPMFIFRMKSLAAKLIVITGIAIA
FT                   LVLIVSNFFLIGQTRDRVQTLTMDQANLEAKSIANDIAANVGELASAARTMSGVIGRGH
FT                   EGKSLDRKGMINVLKANLEQNAFAFGSWFCEQLGAFDGKSTEIANNNDEGTNKNGAFTP
FT                   YWSKTKDGGIQYSTFDNDYTAAWWKLAADSGEGAITTPYMAEGTDVPTLLTSIAYPVMS
FT                   DGKMIGVGGVDISLKSLTDKLQALHPFGSGRVTLLSQAGNWIVAPIPELMTKEYDGEGA
FT                   DIVKSALSSKQPGLVRNLTYDGLDPFDRVVYPFAVPGVNATWVVLVDVPHTAINAPVRD
FT                   QTYMMIVNGLIVLGAVMLALYFAVRSFVQRPLDGLVASVKALSDGEYGEPVAAQDRSDE
FT                   VGSVAKALEGFRFTLADSRRLEDEAADQRQAAETERSRSESERQESVSLQRHIVSIVGA
FT                   GLSELSQGNLSHRITDEFPGEYGKLKQDFNAALASLEETINTMNLSVANIGSGTGEISN
FT                   SASDLAKRTEQQAASLEETAAALNELTAQVDSSAENARTAADNVNLACQDAEKSGEVVQ
FT                   KAIASMQGIEQSSTEVSRIIGVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVR
FT                   ELAQRSANAAKEIKTLINTSAVQVKEGVDLVGRAGGTLHKIAEQVMGINDLIRQISASA
FT                   SEQAVGLKEINQAMNQMDQVTQQNAAMVEEATAASVALNDEAQTLKALATRFNVSGSGN
FT                   AAALASVAQRMRAPSTSAPSHRAAAPAVRRAAAPSRGSAAVAQDSWEEF"
FT   CDS_pept        complement(465583..466482)
FT                   /transl_table=11
FT                   /gene="rbsK2"
FT                   /locus_tag="RL0427"
FT                   /product="putative ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:RL0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05918"
FT                   /db_xref="GOA:Q1MM84"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM84"
FT                   /protein_id="CAK05918.1"
FT                   /translation="MITVFGSINMDLIATTERLPKPGETVAGNGFATAAGGKGANQALA
FT                   ARRAGRYVHMAGAVGKDAFAAEALALLDDAGTDLSLIKHVDGPTGTALILVGGDGENMI
FT                   AVVPGANGQVTPADAETAIGRMNEGDILMLQLEVPVAAVERALSAARAKGVTSILNLAP
FT                   LIPDAPRLGRLADIVIANETEFERLAGQEGMDAQAREAALVRLHAETGQTLIVTLGADG
FT                   VIAIRDGAISRAQGLKIEPVDTVGAGDTFCGYFAASLDDGLDFVSALRRAAVAGSLACL
FT                   EAGAQPSIPLSEEVADRI"
FT   CDS_pept        complement(466677..467903)
FT                   /transl_table=11
FT                   /locus_tag="RL0428"
FT                   /product="putative DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05919"
FT                   /db_xref="GOA:Q1MM83"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM83"
FT                   /protein_id="CAK05919.1"
FT                   /translation="MTIHSESLALALASISPAMLALVGGALAALALLVIVLLLRGASLR
FT                   REQAEEASFRAQENEARMAELLKIQAEMQGRIAAMTEVFGARQSELNQTISQRLDGMSQ
FT                   RVSSTITEQTKSTHENLQRLQERLAVIDAAQNNIQTLAKDVVGLQAILSNKQTRGAFGQ
FT                   SRMETIVADGLPMGAYAFQQTLSNGSRPDCTIRMPNGAPPLVIDAKFPLEAWNAIRDAG
FT                   SPEAGKIAGQQFRRDMEVHIRDISEKYLIQGETQDTAFLFVPSESIFAEIHEHFEPVVQ
FT                   KAHRARVVIVSPSLLMLSIQVIQAVLKDQRMRAQAHLIQGEVAILMDDLSRLDERVRKL
FT                   QGHFAMAQKDIDMVVTSADKLTRRGARIEALEFEAAVGDAKPARDSEAAGKSVESRTGL
FT                   LKLRVVDEE"
FT   CDS_pept        468110..469606
FT                   /transl_table=11
FT                   /gene="mcpH"
FT                   /locus_tag="RL0429"
FT                   /product="probably MCP type chemoreceptor"
FT                   /note="Codons 170 to 610 are similar to codons 285 to the
FT                   C-terminus of Caulobacter crescentus McpA chemoreceptor
FT                   (methyl-accepting chemotaxis protein). UniProt:MCPA_CAUCR
FT                   (EMBL:AE005716) (657 aa) fasta scores: E()=3.4e-46, 51.064%
FT                   id in 329 aa, and to Caulobacter crescentus
FT                   methyl-accepting chemotaxis protein McpB. UniProt:Q9AB06
FT                   (EMBL:C87302) (537 aa) fasta scores: E()=6.6e-69, 46.586%
FT                   id in 498 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05920"
FT                   /db_xref="GOA:Q1MM82"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM82"
FT                   /protein_id="CAK05920.1"
FT                   /translation="MTAQQTDSALRQRLDFIELDEAARKSMRDLRPVISELIGGALDKF
FT                   YAKIAKTPAVAGFFADKNHVGHAKKRQQDHWANLAGGAFDESYVNGVTAVGRTHARIGL
FT                   EPRWYIGGYAIVMSELVKGIMEKQWPSIFARQQGKALAEKLSAVIKSGMLDMDYSISVY
FT                   LETLEAKRRALEEERAEAESDQAIALEQLRRGLEALSKGDLEATLPTDLPGNFRQMAED
FT                   YNRAVRALSQSFASVRETSGHIMSGADVISNATNDLALRTAQQAAGVEESSAALQQLSV
FT                   SVGQTAANAEKASAAVRETQEKAKNSGELVTSAVSAMAGIEKSSTGISKIIGVIDEIAF
FT                   QTNLLALNAGVEAARAGDAGKGFAVVAQEVRQLAQRTAEAAKEIKNLISQSSTQVNQGV
FT                   GIVSSTGEALNDMISRIDIINRFVADIAAAARDQATGVNEVSVAVRNMGAITQQNSDMV
FT                   EHSSAETRRLKDEVESLIELLRRFRARPEGHSASAARRAA"
FT   CDS_pept        469703..470218
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="RL0430"
FT                   /product="putative peptide deformylase (polypeptide
FT                   deformylase)"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:RL0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05921"
FT                   /db_xref="GOA:Q1MM81"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM81"
FT                   /protein_id="CAK05921.1"
FT                   /translation="MTIKPLIILPDPVLRQLSKPIERVDSDLQRLADDMLETMYDAPGI
FT                   GLAAIQIGVPRRMLVIDISREGEEKQPQVFINPEIVKSSDERSLYEEGCLSIPDYYAEV
FT                   ERPAVVSVKYLDRNGKEQTVEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFT
FT                   KAAKSKAL"
FT   CDS_pept        470284..470544
FT                   /transl_table=11
FT                   /locus_tag="RL0431"
FT                   /product="putative plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05922"
FT                   /db_xref="GOA:Q1MM80"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM80"
FT                   /protein_id="CAK05922.1"
FT                   /translation="MGDLLIRDVPDAMKRQLQESAQRNGRSLSEEAIEIMRRQIAVERS
FT                   GASAGQRLRSLMSEERLSEDEVEAIAASRHERDREPPRFDT"
FT   CDS_pept        470541..470960
FT                   /transl_table=11
FT                   /locus_tag="RL0432"
FT                   /product="putative plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05923"
FT                   /db_xref="GOA:Q1MM79"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM79"
FT                   /protein_id="CAK05923.1"
FT                   /translation="MIVLDTNVISEMQGRTHSDRILNWLDAYDVETLFLTTIAVAEMRY
FT                   GLELLDDGRRKTALVSDFNRIESEFAGRILGFALSAAHRYGLLAAERRKAGRPMETKDA
FT                   MIAAICLANGATLATRNTRDFEGLDLKLVNPFEDG"
FT   CDS_pept        470957..471916
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="RL0433"
FT                   /product="putative methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:RL0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05924"
FT                   /db_xref="GOA:Q1MM78"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM78"
FT                   /protein_id="CAK05924.1"
FT                   /translation="MILNWRDKMSLRIIFMGTPEFSVPTLRLLVDAGHRIVAVYTQPPR
FT                   PGGRRGLDLQKSPVHQAAELLGLPVFTPVNFKDPEERERFRGLNADVGVVVAYGLLLPE
FT                   AILNGTRDGCYNGHASLLPRWRGAAPIQRAIMAGDAKTGMMVMKMDKGLDTGAVALTRE
FT                   VEIGPNMTAGELHDRLMLVGAKAMAEAMVKLEMNDLPLTPQPEDGVLYAAKIDKAETRI
FT                   DFSRDAGDVHNHIRGLAPFPGAWFELEIGGKPERVKVLASEPAEGQGVAGQLLTDDLVV
FT                   ACGSGAVRLTRLQKAGGKPLAAADFLRGTPLAAGTRLT"
FT   CDS_pept        471916..472734
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="RL0434"
FT                   /product="putative tRNA pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RL0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05925"
FT                   /db_xref="GOA:Q1MM77"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM77"
FT                   /protein_id="CAK05925.1"
FT                   /translation="MPRFRMTVEYDGGPYVGWQRQENGPSVQGAIEAAVLSLTGETVSV
FT                   RGAGRTDSGVHAMGQVIHADLSKDWSPYQLQNALNAHLRIAGERVSVLDVEAAPEFFDA
FT                   RFSALRRHYLYRIVSRRAPLALEAGKAWWVPKVLDHEVMHAAAQRLVGRHDFSTFRAAH
FT                   CQANSPVRTLDRLDVTRRGELIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAA
FT                   LKARDRKACGPVAPPDGLYFMQVDYPDVIVDRRRPVTDNDDGADESDDLS"
FT   CDS_pept        complement(472741..473337)
FT                   /transl_table=11
FT                   /locus_tag="RL0435"
FT                   /product="putative transmembrane protein"
FT                   /note="This CDS overlaps 11 bp at the N-terminus with
FT                   RL0436"
FT                   /db_xref="EnsemblGenomes-Gn:RL0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05926"
FT                   /db_xref="GOA:Q1MM76"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM76"
FT                   /protein_id="CAK05926.1"
FT                   /translation="MPGFREVQYYLAGLWLLIRLDPRGFRYLDMSERGVNRSFWAMLWC
FT                   LPPMGISWLWWRQAFLRAMPPEADVDFPFYIRLGLVELANWFVPLVFAGFLLLAFRMGE
FT                   RFAPVVVSVNWLGVPLSYINGLLLALVFFLPGSVGLVSLLLLAFMLAQVFVLARILRMI
FT                   CHGHALMVGALTLVLLVPSMILSEYLQHFLGIYPA"
FT   CDS_pept        complement(473324..474517)
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="RL0436"
FT                   /product="putative succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="This CDS overlaps 11 bp at the C-terminus with
FT                   RL0435"
FT                   /db_xref="EnsemblGenomes-Gn:RL0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05927"
FT                   /db_xref="GOA:Q1MM75"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MM75"
FT                   /protein_id="CAK05927.1"
FT                   /translation="MTATDPVANLQTLIRCPSVTPAEGGALSALEAMLAPLGFTVDRVK
FT                   ASEEGTPDIENLYARLGTDGPHLMFAGHTDVVPVGDEAAWTHPPFAAEISKGELFGRGA
FT                   VDMKGGIACFVAAVARHIEKSGQPKGSISFLITGDEEGPAINGTIKLLQWAAERGERWD
FT                   ACLVGEPTNPDRLGDMIKIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQMTHALM
FT                   DPPFDGGTDDFQPSNLEVTTVDVGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRR
FT                   LDAAAGNGELRPGRDPVKYDIVWADRPSHVFLTRNNALIASLSSAVESVSGQSPKLSTT
FT                   GGTSDARFIKDYCPVVEFGLVGQTMHMVDERVAVADLETLTAIYETFIARWFANAGL"
FT   CDS_pept        complement(474619..475479)
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="RL0437"
FT                   /product="putative
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:RL0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05928"
FT                   /db_xref="GOA:Q1MM74"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MM74"
FT                   /protein_id="CAK05928.1"
FT                   /translation="MSATDLASLEKIIEAAFDNRDNVNTSTKGEVRDAVESALDLLDAG
FT                   KARVAERSSDGAWTVNQWLKKAVLLSFRLNDMDVVKGGSGNSTWWDKVPSKFENWGENH
FT                   FRAAGFRAVPNCVVRRSAYIAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHV
FT                   HLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIV
FT                   DRATGEVTYGEVPPYSVVVAGSMPSGNATMGNGQPAPHLYCAVIVKRVDEKTRSKTGIN
FT                   ELLRD"
FT   CDS_pept        475674..476540
FT                   /transl_table=11
FT                   /locus_tag="RL0438"
FT                   /product="putative lysine decarboxylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05929"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM73"
FT                   /protein_id="CAK05929.1"
FT                   /translation="MAKGRNGGSRRKDGVWDPLKSSSTDRQRAEAVPKTPQTLSPAYRL
FT                   AYVDEDFLCREELRPIRLQLELLKTEMMLTERGIKSTVVMFGGARIPAPGQSAWAARND
FT                   IQRVNLEAASVYYDEARKFARLCSKYSATLNFHEYVIVTGGGPGVMEAGNRGAADEGAP
FT                   SIGLNIVLPHEQAPNAYVTPELSFNFHYFAIRKMHFMVRAKAIAVFPGGFGTLDEFFEC
FT                   LTLIQTGRMERLPLILFGEAFWRSIINFDALAEFGTIAPDDVKLISFVDTAEEAWKIVQ
FT                   NFYEHRE"
FT   CDS_pept        complement(476616..477257)
FT                   /transl_table=11
FT                   /locus_tag="RL0439"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Agrobacterium tumefaciens (strain C58/ATCC 33970)
FT                   hypothetical protein atu0377. UniProt:Q8UIC0 (EMBL:A97405)
FT                   (217 aa) fasta scores: E()=2.8e-22, 47.664% id in 214 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05930"
FT                   /db_xref="GOA:Q1MM72"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM72"
FT                   /protein_id="CAK05930.1"
FT                   /translation="MYRNKLILAALSSTLIFGAAAGAVFAAPGDGPRQHAGMGRPGPGA
FT                   AAFREITYVRMLKQFDTNKDGQVSKDEATAGLDKIFAAIDTNKDGSLTPGEIREYRKTQ
FT                   MQAMRDQRKQEAGESKDANAAPTAPETADNNDQGRPPRDGHDGRDGHRWMRHGGNIMRA
FT                   SIMMHRVDTDQNGQISKQEAEAAMGKLFTRMDRNKDGVISIDDMPDRPLL"
FT   CDS_pept        complement(477362..478087)
FT                   /transl_table=11
FT                   /locus_tag="RL0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Rhizobium meliloti (Sinorhizobium meliloti) hypothetical
FT                   protein smc01730. UniProt:Q92SG4 (EMBL:SME591783) (258 aa)
FT                   fasta scores: E()=3.7e-66, 74.359% id in 234 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05931"
FT                   /db_xref="GOA:Q1MM71"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM71"
FT                   /protein_id="CAK05931.1"
FT                   /translation="MTKIDRTPDKADFEHVTDWVFDLDNTLYPHHVNLFAQIDKNMTAY
FT                   VAALLQMEREEARKLQKQYYLDHGTTLQGLMIHHGIDPNDFLEKAHAIDYTALTPQPEL
FT                   GEAIKALPGRKFIFTNGSVRHAEMTAEALGILEHFDDIFDIVAADYVPKPAQATYDKFA
FT                   ALKRVETNKAAMFEDLPRNLTVPKALGMQTVLLVPRNLEETVVEWWEKTSGEEDHIDFV
FT                   TDDLAAFLRKIIGLGKITG"
FT   CDS_pept        478277..479806
FT                   /transl_table=11
FT                   /locus_tag="RL0441"
FT                   /product="putative vitamin B12 binding methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05932"
FT                   /db_xref="GOA:Q1MM70"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM70"
FT                   /protein_id="CAK05932.1"
FT                   /translation="MKIVLINPPHTAIGSRIPDDHLPPLGLLSVGGPLIDDGHIVGLID
FT                   AEFGPMTIAEIVSRVAASGPDLVLIGHSGSTSAHPTARAIAEAVKHSDRAIRIVYGGVF
FT                   PTYHWREVLAETEAFDILVRGEGEETMRRLAGTLTAGRPLATVPGIAYRNGDGEILATQ
FT                   PAQAFADLDAYRVGWELIDHRHYSYWGGKRAVVMQFSRGCPHLCNYCGQRGFWTRWRHR
FT                   SPELFAREIARLYREEGVELINLADENPTSSRKAWLAFLEAMIIENVPVQIVGSTRADD
FT                   IVRDADILHLYRKAGVVRWLIGMENTDEATLTLIKKGGAKATDREAIRLLRQHDILSMA
FT                   TWVVGFEEETLSHLLRGFRQLLSYDPDQIQALYVTPHRWTPFFRIARDRQVIETDIRKW
FT                   DYKHQVLKMRHLNPIVLVACVKLIEVAVQARPKALLRILFHRDREQRHSMRWYTQMGRR
FT                   VWFHEILEFLFRRRHLKDGPTLENFWGAPQDSEEESMLRPQRYVKSLDAAE"
FT   CDS_pept        479862..480935
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="RL0442"
FT                   /product="putative ADA regulator
FT                   (Methylated-DNA--protein-cysteine methyltransferase)"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:RL0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05933"
FT                   /db_xref="GOA:Q1MM69"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM69"
FT                   /protein_id="CAK05933.1"
FT                   /translation="MLFERPDDDTLYDALIARSADYEGQAYVCVKTTGIFCRLTCPARK
FT                   PKRENTLFFDTIAACMHSGFRPCQRCRPLEQPGREPIVDELLAALDREPQLRWTENELM
FT                   RRGHDPSTVRRAFKRGLGMTFHDIVRYIRLGEAARQLADGARVIDAQLDAGYDSASGFR
FT                   AAFQRLVGMAPALSQNRKLLFADWFDTPLGPMIAVADRTHLHLLEFHDRKALPTELEAL
FT                   QKRVRSSVAIGRTPAIDQIETEIRDYFEGRLTVFKTPLAHGGTPFEKHVWAKLMEIPAG
FT                   QTRAYGDLAREMERPEAVRAVGRANGANQLAIIVPCHRILGADGSLTGYGGGLWRKQWL
FT                   LRHEEKISTQAKMEETA"
FT   CDS_pept        480932..481702
FT                   /transl_table=11
FT                   /locus_tag="RL0443"
FT                   /product="putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05934"
FT                   /db_xref="GOA:Q1MM68"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM68"
FT                   /protein_id="CAK05934.1"
FT                   /translation="MNQSEKAKAFGALHRKGDPVVLYNIWDAGTAKAVGDAGAKALATG
FT                   SWSVAAAHGYADGEKLPMSVLVETAKSITAAVDLPLSVDFEGAYSTEPEGAAANVAKLV
FT                   EVGAIGINFEDQVVGGGGLYPAERQAARIRAIRAMAEGKGIPFFINARTDLFLAESDLS
FT                   KHAGLVDEAIERGKAYAAAGGSGFFVPGLIDPALIEKVCAASPLPVNIMMRTGAPDVKA
FT                   LAKLGVGRVSYGPGPYRSMMEKLKQEAAAIYSLL"
FT   CDS_pept        complement(481874..483022)
FT                   /transl_table=11
FT                   /gene="lldD3"
FT                   /locus_tag="RL0444"
FT                   /product="putative lactate dehydrogenase"
FT                   /EC_number="1.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:RL0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05935"
FT                   /db_xref="GOA:Q1MM67"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM67"
FT                   /protein_id="CAK05935.1"
FT                   /translation="MRLTDCYNFHDFRRMAKRRLPGPIFDYIDGGADDEVTYRRNTAAF
FT                   EACDLVPDVLRGVADVDMSVTVMGQKLAMPVYCSPTALQRLFHHQGERAVAAAAAKHGT
FT                   MFGVSSLGTISLEEARQISNGPQVYQFYFHKDRGLNREMMARAKNAGVQAMMLTVDSIT
FT                   GGNRERDKRTGFAIPFKLNLAGMTQFAVKPSWAIDWLTHERFRLPQLENHVKMDGGALS
FT                   ISRYFTEMLDPSMSWDDVAEMVREWGGPFCLKGIMSVEDAKRAAEIGCSGIVLSNHGGR
FT                   QLDGSRSAFDQLAEIVDAVGDRIDVMMDGGVQRGTHVLKALSLGAKAVGLGRYYLFPLA
FT                   AAGQPGVERALETMRTEIERGMKLMGCTSVSQLTRRNLRFRS"
FT   CDS_pept        complement(483090..483977)
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="RL0445"
FT                   /product="putative acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:RL0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05936"
FT                   /db_xref="GOA:Q1MM66"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MM66"
FT                   /protein_id="CAK05936.1"
FT                   /translation="MNETESEMQARLLAKALPFMQRYENKTIVVKYGGHAMGNPELGKA
FT                   FASDIALLKQSGVNPIVVHGGGPQIGAMLSKMGIESKFEGGLRVTDQKTVEIVEMVLAG
FT                   SINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKTVKDPDSNIERVLDLGFVGEVVEV
FT                   DRTLLDLLARSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALNATRLLFLTDVPGVL
FT                   DKNGQLIKELSVAEAHALIADGTISGGMIPKVETCIDAIKAGVQGVVILNGKTAHSVLL
FT                   EIFTEHGVGTLIVP"
FT   CDS_pept        484645..485376
FT                   /transl_table=11
FT                   /locus_tag="RL0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05937"
FT                   /db_xref="GOA:Q1MM65"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM65"
FT                   /protein_id="CAK05937.1"
FT                   /translation="MHGTMTSPDKSKGDRSRDEVLAGEYVLGVLSLQDRRVVEERMRHD
FT                   RPFAAIVSRWETNLSAFNDEYEGVAPNRETFKQIEARLFGDGQKPPSFSQGLWNSAVFW
FT                   RSLSFACIVVAASAVIFASGVVPEPQGPAPLVASLSGQNSTINLLASYELQSGRLKIVP
FT                   VAAGKPEEKSLELWLVPGSGMTRSLGVFQPGESGELVIPAELRSMIADGATLAVSLEPF
FT                   GGSPTGQATGPVIASGPLRRP"
FT   CDS_pept        485501..486055
FT                   /transl_table=11
FT                   /locus_tag="RL0447"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Agrobacterium tumefaciens (strain C58/ATCC 33970)
FT                   hypothetical protein atu0472. UniProt:Q8UI28 (EMBL:C97416)
FT                   (217 aa) fasta scores: E()=4.6e-50, 81.622% id in 185 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05938"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM64"
FT                   /protein_id="CAK05938.1"
FT                   /translation="MIKSVLRGFALATAMSAVAFAAAKNPTVGGAAMFDSKNIIENAVN
FT                   SKDHTTLVAAVKAAGLVGTLEGKGPFTVFAPTNEAFAALPKGTVDTLLKPENKATLTKV
FT                   LTCHVVAADAMAKTVAKMIKDDGGEHDIKTVGGCVLKAKESMGKITLTDENGGVSHVTI
FT                   ADVKQSNGVIHVVDKVLLPKM"
FT   CDS_pept        complement(486328..487407)
FT                   /transl_table=11
FT                   /locus_tag="RL0448"
FT                   /product="putative two-component sensor histidine kinase
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05939"
FT                   /db_xref="GOA:Q1MM63"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM63"
FT                   /protein_id="CAK05939.1"
FT                   /translation="MMTESNDQPLSPEGVGNLPHLAEALDDNRFRHFLDHVPFAVAVSE
FT                   LAGNEPLIYVNLEFERLTALEATEVQGKPWPEIELNSTAVSGEVPLTAAVTSAEEYIGA
FT                   FSLVAEPESTVVIDVWSNTIVDDDDTPLFRLVAFAARNEATAAESFSELLTEKDVLLRE
FT                   LQHRVKNNLQMITALIRMEARNAQQNEESERFARLAGRIEALALLYRSLSDEEKGATVD
FT                   LGTYVSQIAASVMAAHAVEGIRLDMKVDTWPVSVDVAMPAGLVINELLTNTLKHAFVGR
FT                   DGGEITLRCVVGDTGCRITVADNGVGLPQDVTWPQPGKLSAMIVQSLKQNARAEVEVSS
FT                   SPDTGMSVTLVFPRAEAAR"
FT   CDS_pept        complement(487541..487849)
FT                   /transl_table=11
FT                   /locus_tag="RL0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05940"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM62"
FT                   /protein_id="CAK05940.1"
FT                   /translation="MLAFTHIMEASMAETPQELQSINTAWQIAIQEILRMVIRDMYHGG
FT                   GEASFKTHIKRIEEAAVDSIYTDLRLRGTDEWTEVLVKERASNFVTTLLTSFTYDRT"
FT   CDS_pept        complement(487937..488161)
FT                   /transl_table=11
FT                   /locus_tag="RL0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05941"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM61"
FT                   /protein_id="CAK05941.1"
FT                   /translation="MTETYSKSRQRAEIAFGNVQTQFFAKNQAAEELQSDAQSQQAKTL
FT                   RLREARLAREHSNRSSATSALIAKRARAR"
FT   CDS_pept        complement(488295..488504)
FT                   /transl_table=11
FT                   /gene="cspA2"
FT                   /locus_tag="RL0451"
FT                   /product="putative cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05942"
FT                   /db_xref="GOA:Q1MM60"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM60"
FT                   /protein_id="CAK05942.1"
FT                   /translation="MTTGTVKWFNSTKGFGFIQPDNGGADAFVHISAVERAGMRDLVEG
FT                   QKIGFDLERDNKSGKMSACNLQNA"
FT   CDS_pept        complement(488772..489425)
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="RL0452"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05943"
FT                   /db_xref="GOA:Q1MM59"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MM59"
FT                   /protein_id="CAK05943.1"
FT                   /translation="MPETEKPLFGHPWIFIRGVPSLNFLPPEGPLEVAFAGRSNVGKSS
FT                   LINALVGQKGLARTSNTPGRTQELNYFVPDGYSGEGGDLPPTAIVDMPGYGYAQAPKEQ
FT                   VDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDDDVLDLLDKAAVSYQIVLTKTDKI
FT                   KAAGVPKLLAETAEKIRKRPAAYPGVLSTSSEKGDGLDELRQAIAETVGIARWK"
FT   CDS_pept        complement(489578..491374)
FT                   /transl_table=11
FT                   /gene="oxaA"
FT                   /locus_tag="RL0453"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05944"
FT                   /db_xref="GOA:Q1MM58"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MM58"
FT                   /protein_id="CAK05944.1"
FT                   /translation="MMENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQ
FT                   QTEQVQQPAAGGQTPAQTSGAAPSGQAAATATLEQALQKSPRVVIDTPALSGSINLAGA
FT                   RLDDLKLKGYHETVDDSSPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPE
FT                   GAKLTEKTPVTLSYTNDKGLTFTRTISVDERYMFTVADKIENTGQAPAALSSYGRVTRY
FT                   NKPTTPSVYVLHEGFIGVIGDDGLIETKYSAVEKEAVAPAKSTGGWLGITDKYWAATIV
FT                   PPQSAAYEAHFSYFADGQPRYQADYKDDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEA
FT                   SYSIPKFDRLIDWGWFYFITKPMFKLMDFFFRYFGNFGVAILCTTIVVKALFFPLASKQ
FT                   YASMANMKRMQPKMEELKAKFADDRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFS
FT                   LYKVIYITIEMRHAPFFGWIKDLSAPDPTTIVNLFGLLPFEGPTLLHLGVWPLIMGVTM
FT                   FVQMRMNPTPPDPTQAMIFNWMPLVFMFMLASFPAGLVIYWAWNNTLSVAQQGLIMKRH
FT                   GVKVELFDNLKGLFRRKEAPSK"
FT   CDS_pept        complement(491371..491760)
FT                   /transl_table=11
FT                   /locus_tag="RL0454"
FT                   /product="putative ribonuclease protein component"
FT                   /note="Similar to codons 140 to the C-terminus of Thermus
FT                   filiformis RnpA ribonuclease P protein component (ec
FT                   3.1.26.5) (rnasep protein) (rnase p protein) (protein c5).
FT                   UniProt:RNPA_THEFI (EMBL:AY256339) (240 aa) fasta scores:
FT                   E()=0.00012, 39.175% id in 97 aa, and to entire protein of
FT                   Rhizobium meliloti (Sinorhizobium meliloti) RnpA
FT                   ribonuclease P protein component (ec 3.1.26.5) (rnasep
FT                   protein) (rnase p protein) (protein c5). UniProt:RNPA_RHIME
FT                   (EMBL:SME591783) (128 aa) fasta scores: E()=2.8e-32,
FT                   70.968% id in 124 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05945"
FT                   /db_xref="GOA:Q1MM57"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MM57"
FT                   /protein_id="CAK05945.1"
FT                   /translation="MTISEKKHTVGRLKSRPQFLAVREGEKRRGGFFLLEVLDRKEPDS
FT                   QARVGFTVTKKHGNAVERNRMRRRLKEAVRLHAGFAMQPGHDYVVVARRDVLDASFQEL
FT                   AAELKSRVETRPKHRRSGDGRPRNV"
FT   CDS_pept        492347..494344
FT                   /transl_table=11
FT                   /gene="mcpT"
FT                   /locus_tag="RL0455"
FT                   /product="probable MCP type chemoreceptor, ortholog of S.
FT                   meliloti mcpT"
FT                   /db_xref="EnsemblGenomes-Gn:RL0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05946"
FT                   /db_xref="GOA:Q1MM56"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM56"
FT                   /protein_id="CAK05946.1"
FT                   /translation="MKIRGKINLLVCVMGAVALLIGATALSAMHEYSRNLTAYEHAASR
FT                   AYAGERLNRFVTAVVMESRGIYAAKTIKDTPNFAKGLMAGLDEIDKVISGWAPLVPESQ
FT                   KADFAKLVARAAEFRTFRTETARLGTEVGPEAAGQQGNNDANRANRKAFQAEIDAVVST
FT                   DKAALETVNAEIESFRSWVLMLVLSITGIGIAVGIGMGFYIGTSHLSRPIKRVTHAIKE
FT                   VADGNFEAEVPFAGRRDEIGEMAAAVAVFKANGLAVKRLNAQEAAMRAKSDDLQSSMSV
FT                   VVAAAAAGDFSHRIGKDYEDDNLNQFAGNINTLLSSVDAGIGETRRVIASLAEGDLTQT
FT                   MSGSFQGAFAELQRNVNNTFVTLQATMREVRETTEAMNGNTAELRNASDDLSKRTEQQA
FT                   AALEETSAALDEITAVVQNSTERAHEATIMVSEAKENAGRSGVVVGNAVEAMGRIEQAS
FT                   REISQIINVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSATAAKDI
FT                   KALITKSGNEVQVGVKLVQATGEALAEIGTRVIAINDHIHSIATAATEQSTGLKEVNTA
FT                   VNQMDQVTQQNAAMVEETSAATHRLSAEAGGLVRLIARFKLPDDAPTPVALVRNEPQRP
FT                   VASPARRAIAKVARAFGGNAAAAEQNWEEF"
FT   CDS_pept        494569..496083
FT                   /transl_table=11
FT                   /gene="regM"
FT                   /locus_tag="RL0456"
FT                   /product="Probable two component regulator sensor
FT                   kinase/regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05947"
FT                   /db_xref="GOA:Q1MM55"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM55"
FT                   /protein_id="CAK05947.1"
FT                   /translation="MRDQGDNPSAENPAAGEAVRAPCPSAGLFGGLSGKLLWLTVFFIM
FT                   LAEILIFFPSVASMRVRWLQDRLNTAAAAAIVIDGLQPVELPRALQKETLEATGTKAIV
FT                   LRKDGTSRLLATTDMPASVDESYDLTDVPPVTAIRDALDTLVFGGSRIIRVYGPVGETN
FT                   TGVEVVMKDRQLRRAMFVYSRNVLLLSVLISLFTATLIFFAINRILIGPIRRLTGSMQQ
FT                   FSSDPDNPAHIYIGDGGRDELAVAGRNLTSMQMELQKTLKQQKNLAALGLAVSKINHDM
FT                   RNILASAQLMSDRLVDVDDPMVKSFAPKLLRTIDRAVGYTTEVLSYGKASESAPRRRHI
FT                   RLLELTQDVKDMLAIDPQSGIEFAEQIGAELEVDADGEQLFRVIHNLCRNALQALTSPG
FT                   EGGPGSVRRITVSAQRVGSVVSITVDDTGPGMPLKARQNLFAAFRGSARSGGTGLGLTI
FT                   ARELVLAHGGTIALVEKPTVGTQFRIEIPDRPVSLEDYRSRTHVEK"
FT   CDS_pept        complement(496131..496283)
FT                   /transl_table=11
FT                   /locus_tag="RL0456A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0456A"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM54"
FT                   /protein_id="CAK05948.1"
FT                   /translation="MAHPKRFELLTPRFVVWCSIQLSYGCVQNAAVPLAWRSSKTSFGT
FT                   MQEHF"
FT   CDS_pept        496748..497095
FT                   /transl_table=11
FT                   /locus_tag="RL0456B"
FT                   /product="putative transposase related protein"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Rhizobium sp. (strain NGR234) transposase. UniProt:Q6W167
FT                   (104 aa) fasta scores: E()=3.4e-34, 80.000% id in 95 aa,
FT                   and similar to entire protein of Bradyrhizobium japonicum
FT                   id319 id319 (bsl1856 protein). UniProt:Q9AND3 (97 aa) fasta
FT                   scores: E()=2.3e-27, 70.968% id in 93 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0456B"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05949"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM53"
FT                   /protein_id="CAK05949.1"
FT                   /translation="MERFVLTDAQWAKMEPHCHGKPSDPGRSGSNNRRFIEAILWIVRT
FT                   GSPWRDLPTVFGNWNTIYKRYRDWVKADVFTRLFEVCSDEPDMEYAMVDATIVKVHRHG
FT                   QGSKGGLRARL"
FT   CDS_pept        497113..497499
FT                   /transl_table=11
FT                   /locus_tag="RL0457"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05950"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM52"
FT                   /protein_id="CAK05950.1"
FT                   /translation="MTTKILALTDALGNLVRFVLLPGHRFDTVGVAPLIDGIGFDGLIA
FT                   DKAFDSNQIVADLNERGAKVVISQHPRRKAPLPLDSEIYKWRHLIENFFCKLKEFKRIA
FT                   MRADKTDQSFSAIIHLAAAVINSR"
FT   CDS_pept        497590..499461
FT                   /transl_table=11
FT                   /locus_tag="RL0458"
FT                   /product="putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05951"
FT                   /db_xref="GOA:Q1MM51"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM51"
FT                   /protein_id="CAK05951.1"
FT                   /translation="MQRKLAAIMAADIVGYSRLMAEDESSTYAELRTVFDKLIDPTVAR
FT                   HGGTTFKTTGDGFLAMFPSVNEAVDAALAIQQGFDDGPFKLRIGINLGDVIEDNGDVYG
FT                   DGVNVAARLEAMTEPGQIFVSGAVVMAAERNRGDLFARVGRRRAKNIPELLEVYRVRRA
FT                   GSPWSIWRQMPHVLRGSAARWSYGIAAIALVLIGTQISPLPLAAMVSGIPAALSLDQTR
FT                   GDPRPSIAVMPFATMSGSGNQPYFADGLTEDVTTALARNPELQVIARDSTYAVRGQETD
FT                   VRKLAAKLGVDYVVEGSARREGDQLRVSAQLIDVGTGAHLWSRSFDKKVADVFTVQSEL
FT                   TTEIVAQLAPYIGRSEAAAAALRPTDSLQAYDLVLQARDRYRHGATDHNAILAARGLYQ
FT                   RALEMDPAYAAARAGLALTYIGEVAQRPGGQAAAPELDLGLSEARQAVRLDPNLGFGYQ
FT                   VISFGLALQADYSGGLQAAQRAVELNPNDPDSMIALAKAQVRFGDYPDAVANAERARRL
FT                   HPMAPEYYAYVHGQALYADGRREEAATVISECLVRAPRDANCLLIQAALQGGSGELEKA
FT                   QATMASLVEAHPAFSLEAERAYRRFGDEPLMEEFLQDLARAKAPETA"
FT   CDS_pept        500140..502071
FT                   /transl_table=11
FT                   /locus_tag="RL0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05952"
FT                   /db_xref="GOA:Q1MM50"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM50"
FT                   /protein_id="CAK05952.1"
FT                   /translation="MTFVLNTFGRLQLVDGQGSLVAFPEKGLLLLVYLLTTGEGSADRT
FT                   SLARFLWGDADRDVALSTLRKLISRIKARQTELGINILSSQGNMVSLDRESLSSDLLLS
FT                   ETDEAVASFSLLKHLVKLLNQPFLGPVHCHSREFQHWLAEREKSHIDLLANTLKAVSQR
FT                   AQSRTESELLRKAAIILFRTEPKDPDTLQLLIEIFKAEEEVESLRNHFEQRRISISRGI
FT                   AVRTASDGGDTKPVLPALAPSREKHATAVSLEPEDISIAIPRLVLLPPRNQSIHPQAGF
FT                   LAASLVEDITIGFCAFNSLQVIAPYSAVQIGHHMETQKAFFERHHVNYILDTRISNAGD
FT                   DVTLFAQLIFFDQNQIVWAERFSLDHRDLVKDRRTVSRRIALSISSEIERHEALREDLN
FT                   PAAYHRYLVGRRHLARLTLPNLRRARKEMKAALSVSPDFAPALSSMARTYSKEWLLTAR
FT                   GDIDLLKTAETLATQATETRPDFADGYREFGVAKLLQGAFDQSAEAMEVAESLAPHYAD
FT                   VIADYADTLVHCSLPAIALRKIERAIELNPLSPDTYFWTAAGANYALGEFEASLDYIGQ
FT                   MADASLADRLAAANWAMLGHQDKARTFVRRFREVNPDFDVDKWLSAVPSKEQWHKDLYR
FT                   EGLKKAGF"
FT   CDS_pept        502100..502318
FT                   /transl_table=11
FT                   /locus_tag="RL0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05953"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM49"
FT                   /protein_id="CAK05953.1"
FT                   /translation="MARVVVISVEGDDALWVADLDAGTVVPLPSPKSGGLKAVTDLRAT
FT                   GSIVTKGVNLAVVVKSAEAALSGHYDG"
FT   CDS_pept        complement(502832..503353)
FT                   /transl_table=11
FT                   /locus_tag="RL0461"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05954"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM48"
FT                   /protein_id="CAK05954.1"
FT                   /translation="MRNAKFIRYAAFSAYVAFATFQAGQVLADSANDKFFDAALCKPPY
FT                   TMTSAMKIYDVVEALAKPDTSSLGAAIYKLPNQIGRDGFKSTEIFFASNAVGVLIEGER
FT                   ADDLAAKYGLKAETSDLLGTSTKGYSLELPADLQPEPGMAGPGKVSIIARQGNALPGKT
FT                   LLACEFVQEF"
FT   CDS_pept        503550..503732
FT                   /transl_table=11
FT                   /locus_tag="RL0462"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05955"
FT                   /db_xref="GOA:Q1MM47"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM47"
FT                   /protein_id="CAK05955.1"
FT                   /translation="MIAAYFDEIIMFCAGLWMTSVGFDYLPYPGKPASRPPLLRHFKWM
FT                   GPLLLAIAIVLAAAS"
FT   CDS_pept        503863..504159
FT                   /transl_table=11
FT                   /locus_tag="RL0463"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05956"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM46"
FT                   /protein_id="CAK05956.1"
FT                   /translation="MTEMLACPSGGLDKTESIIHRGSYILRCAACGETIVATSFMAMLD
FT                   SDHQCSAFIDPGPGKHPSPETLVARGPFRQIATAISAAASDGTLIRLISEAKV"
FT   CDS_pept        complement(504186..505664)
FT                   /transl_table=11
FT                   /locus_tag="RL0464"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Codons 28 to 118 are similar to the N-terminus to
FT                   codon 90 of Agrobacterium tumefaciens (strain C58/ATCC
FT                   33970) hypothetical protein atu4248. UniProt:Q8U851
FT                   (EMBL:AE009353) (93 aa) fasta scores: E()=7.2e-12, 56.818%
FT                   id in 88 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05957"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM45"
FT                   /protein_id="CAK05957.1"
FT                   /translation="MTSPHWKRFAWFCICLILSHPAWSAGGVTIPGYAPATGVERSYRV
FT                   QKATETDMSFWFDKSGTPPVTARGAFRQAMTVLSRDEDGMRVRWSLSADLPEGMAGLAD
FT                   SYQMNLLYRNSLTAYGTATLELETDLNGNPRDVAGVDQIVAHMRAMVANGPGGVPAAPE
FT                   SGLYEIINTIEANPLQIVAAMVPEAQLLATGQSYKDETMDVGPASATSRDEDYGGVSVP
FT                   VISTWTLKSTDATAHTATLSLSEEADAAAFSQSQQPAIANLMTGFAERAKNLTADQLAS
FT                   LKRASKSRSVELMVSLDDGSTLEASEIVTVEAGGTRLRTYTHIQREDMPASLPLPAVLT
FT                   ARDLQTPDLHIEPLPSARAGPGIMDDLSTPPAPPTASQDTTVTTGDDAATAIAPVSLEV
FT                   KSAEVSLSPMSYDQGLNIVLTPESAATFRDFTQAVLGRQTQMLIKDKVVMEPWMREPIM
FT                   DGRIVLAGTDRKDLEALAEQLRVPGAKILVRLRP"
FT   CDS_pept        complement(505881..506372)
FT                   /transl_table=11
FT                   /locus_tag="RL0465"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05958"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM44"
FT                   /protein_id="CAK05958.1"
FT                   /translation="MIFYYPVPSARIAAMNLGGRSAMRISGMGEKSVVVCVRRLLVLIS
FT                   ILLGSTVQAFSCDQPIMISNWSFCAIANVTDEGGDADWKVVPAWTREKAISAYFGNDPR
FT                   LLANHGLCNAKFHRVVLCQPGWQTGNPDECSYLVCSGYYSSLVGKEERDAYSRDYPIAQ
FT                   "
FT   CDS_pept        complement(506443..506988)
FT                   /transl_table=11
FT                   /locus_tag="RL0466"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM43"
FT                   /protein_id="CAK05959.1"
FT                   /translation="MVTDKSQREPVGMRDTTARPAAANFYQPLIFELIDRIGHIFAGHA
FT                   VGHELRVGHDQLAVFQGSVGRVLDDDAEEGAAGVRTQGREGRRFQQLNGEPLPAKATVI
FT                   RRARRSSMLAHHRPRLSLTGSAFVARVEFRHQPLARVVGRYPPALRSLLRKLRSCSARR
FT                   PQLARAITSPLRKKLLSI"
FT   CDS_pept        complement(507261..507959)
FT                   /transl_table=11
FT                   /locus_tag="RL0467"
FT                   /product="putative O-methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05960"
FT                   /db_xref="GOA:Q1MM42"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM42"
FT                   /protein_id="CAK05960.1"
FT                   /translation="MASPWVNDALSHAQSAFSSKTDTNILEVGGGSRTHIPLKGARYTV
FT                   VDISKEQLEKNQDAAERILGDAQTIDYGDRHFDACVFWDVLEHLESPRSALLRAHDTLS
FT                   PGGLVFVKGPILNSAKGIFTDLTPWWTHVLFYRYVLRQKNAGKPGYAPFRVEHAAEASH
FT                   SEIAGTLKDLGMDVVFVGEYVSTQVHALKDRIPPLYWLYEAFGLVLRTVSAGKIGGRET
FT                   EFLIVAKCLR"
FT   CDS_pept        508158..508478
FT                   /transl_table=11
FT                   /locus_tag="RL0468"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05961"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM41"
FT                   /protein_id="CAK05961.1"
FT                   /translation="MTVGLFRALAVLAMMTALGGCIDHANDPVLLAVGVPVNPPVVAHG
FT                   LCMTDGNAMYDEARKQYQLRAQLTGYAQADELEAETIARAAAHRQYVACLSGQGYRTLY
FT                   AN"
FT   CDS_pept        508670..509041
FT                   /transl_table=11
FT                   /locus_tag="RL0469"
FT                   /product="putative exported surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05962"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM40"
FT                   /protein_id="CAK05962.1"
FT                   /translation="MKMLSLTPSTAALGALLALTSIIPVQAAPVQTARPPAVSDVKVVQ
FT                   YKPHAGSWHGYRGFRTERPGTRRHSDGYWYPLAAFGVEAGTTGSIVRPPVNRPAAPEMC
FT                   NPTFSGSIGPGSMPCDNGY"
FT   CDS_pept        509193..509501
FT                   /transl_table=11
FT                   /locus_tag="RL0470"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05963"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM39"
FT                   /protein_id="CAK05963.1"
FT                   /translation="MMTTTFKTGLMAAAFGAILGLSAFSATAAPLQSSATEQGAAERPV
FT                   ASQETKVEHDRRTTGSIGDRASETSGRMTPYMMNPKKPLKMDCKLGFNPGSGSSCNY"
FT   CDS_pept        509741..510412
FT                   /transl_table=11
FT                   /locus_tag="RL0471"
FT                   /product="putative phospholipid N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05964"
FT                   /db_xref="GOA:Q1MM38"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM38"
FT                   /protein_id="CAK05964.1"
FT                   /translation="MTAKAACSDFLHFFRSWVSNPLRVAAIAPSGDSLARIMTSEIAAL
FT                   DGPIIELGPGTGVFTRALLARGVSEADLTLIEYGPEFITSLQARFPTARVLQMDAAHLA
FT                   HADIFEGEPVGAVVSGLPLLSMSPRKIASILAGAFAYMRPGGAVYQFTYGPRCPVPRPI
FT                   LDRLGLKAVRIGGTVRNLPPASVYRISRRKPLELSRERFSYRSSAADVDDVAAFSNETG
FT                   G"
FT   CDS_pept        510432..511067
FT                   /transl_table=11
FT                   /locus_tag="RL0472"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05965"
FT                   /db_xref="GOA:Q1MM37"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM37"
FT                   /protein_id="CAK05965.1"
FT                   /translation="MAENKRTETTEGRRERKRRQTRERIEQAAMTLFLQRGFEATTIED
FT                   ITEAADVSKRSFFDYFPSKEEVVFAWQDAFADRLMAAVAARPAGESSVAAVEAAITATV
FT                   IASVDEPGLARGDLIHRTPALKARDQLKYAKLEQKLAEALLLRKAGDPLERPRMRVLAA
FT                   IVIGALRVGAELWQQRPPSASPQDFAREIFADLWKMLAEFGDEAKTRR"
FT   CDS_pept        511064..511351
FT                   /transl_table=11
FT                   /locus_tag="RL0473"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05966"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM36"
FT                   /protein_id="CAK05966.1"
FT                   /translation="MTRDRLSLRAHFSDIGSMSMFPLIPVIRPCYRNRAVLYLQASQRP
FT                   HSDDPRDRRIFTMPGIAFDQGRHSRSKASPKASAFVPRLLNRLRPFHRFQ"
FT   CDS_pept        511376..512272
FT                   /transl_table=11
FT                   /locus_tag="RL0474"
FT                   /product="putative aldo-keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05967"
FT                   /db_xref="GOA:Q1MM35"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM35"
FT                   /protein_id="CAK05967.1"
FT                   /translation="MSSHNAAQYNAAKSGTFKIGGDIEINRLGFGAMRVTGKGIWGEPS
FT                   DHAESIRTLKRLPELGVNFIDTADSYGPDVSEWLIKEALHPYGGKSVIATKGGLTRHGP
FT                   DIWLPVGRPEYLIQQAHKSLRNLGVEQIDLWQLHRIDQKVPAKEQFDAIKSLLDTGLIR
FT                   HAGLSEVSVADIEAASKHFKVATVQNRYNLVDRTSEDVLDYCAKHNIGFIPWYPLAAGD
FT                   LAKPGSLLDSIAKKHNAAPSQIALAWVLKRSPVMLPIPGTSKVKHLEENVAAVDITLSN
FT                   EEFSALDAEGSKVFKAA"
FT   CDS_pept        complement(512816..513202)
FT                   /transl_table=11
FT                   /locus_tag="RL0475"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05968"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM34"
FT                   /protein_id="CAK05968.1"
FT                   /translation="MMKLLGITCLSTLMLMPSLGSTETLGEADIRRDIIGKTVYLSTPL
FT                   GGELPLIFRSSGKVDGNGQAIGLGRYVKPSDTGQWWIDANRLCQKFQSWNKGKPMCFEL
FT                   ERAGANTIKWTWDNGKTGVARIGN"
FT   CDS_pept        513420..514676
FT                   /transl_table=11
FT                   /locus_tag="RL0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05969"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM33"
FT                   /protein_id="CAK05969.1"
FT                   /translation="MPAALTGLLIATMALAGCGGRPVGVMQAAGTAAPGTSKVDLLVAT
FT                   TRAADDNPAVLFSGERGTGLAVNAVDVSIPPEANRKVGQVQWPSRLPADPLRNFVTVSV
FT                   DPLEGERAGETWLKTHMPKSRRVLVFVHGFNNRYEDAVYRFAQIVHDSHADVAPVVFTW
FT                   PSRGSIFDYNYDKESTNYSRDALEELLTRTAANPAVSDITIMAHSMGTWLTVEALRQMA
FT                   IRNGHVAPKINNVILASPDLDVDVFGRQFASLGKERPQFTIFVSQDDRALALSRRISGN
FT                   VDRLGQIDPSAEPYRSKLEAAGITVLDLTKLKGGDRLNHGKFAESPEVVKLIGDRLIAG
FT                   QTITDSNVGLGEAVGAVAMGAAQTAGSAVSVAVSTPIAIFDPRTRRNYDAQVKRLGQSM
FT                   NNTVGSVGDSVGASLPESQ"
FT   CDS_pept        514840..516108
FT                   /transl_table=11
FT                   /locus_tag="RL0477"
FT                   /product="putative D-amino acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:RL0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05970"
FT                   /db_xref="GOA:Q1MM32"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM32"
FT                   /protein_id="CAK05970.1"
FT                   /translation="MRWVDGMADETKKSVAVVGAGVIGASIAFELQRRGFEVTLIDKGE
FT                   PGRGTSFGNMASIALDFAAGSGPSTWKKIPGWLLDPEGPVWLRPSYAARMLPWFLRFLA
FT                   AGRPSRLREIEDAGMSLSHRALGDFRGMLEAIGAPELMTEEGCLAIYETEAEFAADRGH
FT                   LAMMQRYGLEFEVLSNGAIQYYEPTLSPAIAKAVLLPDNKSIRDPYKLVVKLTDAAKAA
FT                   GTTFVSGTVRNIERRGDGTAVVLLEDGRRIEADSVVLAAGVHTRFLAEKLGEPIPLETE
FT                   RGYHTQIMKPGIEMRYSVIWPHRAFMVTPTAGGIRVGGNVELAGLDAAPDFRRPRVLVR
FT                   HAQRALPGLKVEETTEWMGHRPALPDTIPIISPSSKLPGVFYATGHGHLGLTFSATTAL
FT                   VIADMVTGLKPSLDMTPFRIDRY"
FT   CDS_pept        516118..516828
FT                   /transl_table=11
FT                   /locus_tag="RL0478"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05971"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM31"
FT                   /protein_id="CAK05971.1"
FT                   /translation="MSETTKPVALITGGGRGMGEAIARELSAQGYLLALMSPSESCEKL
FT                   AAELDGVASRGVAEKAEDLKAVFDLTMKTYGRIDAVVNLSGHPPKGDLLDISDENWTLG
FT                   SDMMILSLVRMARLVTPVMLKQGKGAFVNITTFAAYEPTLVFPVSCTYRAAAGAFTKLY
FT                   SDRYAADNIRMNCILPGYIDSLNHKPETAEKVPMKRIGHVEEIAKTAAFLLSDGAGYIT
FT                   GQNIRVDGGVTRHV"
FT   CDS_pept        516844..517881
FT                   /transl_table=11
FT                   /gene="prdF"
FT                   /locus_tag="RL0479"
FT                   /product="putative proline racemase"
FT                   /note="Similar, but extended at the N-terminus, to
FT                   Clostridium sticklandii PrdF proline racemase.
FT                   UniProt:Q9L4Q3 (EMBL:CST130879) (299 aa) fasta scores:
FT                   E()=8.5e-28, 34.629% id in 283 aa, and similar to entire
FT                   protein of Agrobacterium tumefaciens (strain C58/ATCC
FT                   33970) hypothetical protein atu0398 (agr_c_701p).
FT                   UniProt:Q8UIA0 (EMBL:AE007977) (345 aa) fasta scores:
FT                   E()=4.2e-117, 82.319% id in 345 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05972"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM30"
FT                   /protein_id="CAK05972.1"
FT                   /translation="MRWKRTIQLLDVHAEGEIGRVAIGGVPKIPGDTIAAQLHWLNTDP
FT                   KGDELRRFLCLEPRGAPIGSVNLLLPARHPEADAAFIILQPDQAHASSGSNSICVTTAL
FT                   LESGIVEMKEPETIVTLETAAGLVKATATCRDGRCEKVKLTMVPSFVHELDVAIDTPHW
FT                   GRIKADICYGGIFYALVDVGQIGLTIEKANAAGLVQAGMILKELINRDIKVVHPEIPAI
FT                   SGVAYVMFRDTEADGTVRTCTTMWPGRADRSPCGTGNSANLATLYARGKVKVGDTFTSK
FT                   SIIGSEFEVGLQAVTEVAGRPAVIPTITGRGFTFGLTQVALDPFDPHPNGFALTDVWGP
FT                   AAGEI"
FT   CDS_pept        complement(518170..518820)
FT                   /transl_table=11
FT                   /locus_tag="RL0480"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05973"
FT                   /db_xref="GOA:Q1MM29"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM29"
FT                   /protein_id="CAK05973.1"
FT                   /translation="MSNVDETPARSRGRPRAFDREAALAQATRLFWIKGFEATSIADLT
FT                   EAMGIGSPSLYAAFGSKEALYAEALRHYRDNNEALVWAGFFSAGTARDAVMSLLMDSAA
FT                   ALTGCVADIPRGCMVTLSSVGSEGHVELGELVRTARAITLERLKLRINQAISEGEIPAS
FT                   ADVHALARFVQTVQNGMSILARDGATRSELEAVAELAMLGWDTRTGAAKRRQG"
FT   CDS_pept        518920..519660
FT                   /transl_table=11
FT                   /locus_tag="RL0481"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:RL0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05974"
FT                   /db_xref="GOA:Q1MM28"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM28"
FT                   /protein_id="CAK05974.1"
FT                   /translation="MTELAGKRALVTGGSRGIGAAIALALADKGADVAITYERSADRAA
FT                   EVVRAIEGKGRKAIAIQADSADPAAVKRSVDEAAQALGGLDILVNNAAIALYGAIADVS
FT                   VEQIDALLDVNVRSPLLASQAAIPYLQAGGRVITIGSVGAERIVGDTGTVYFMTKSALH
FT                   SFTRGLARELGSRDITVNLVQPGSTDTDMNPANGDFADFQRALIPLGRYGEPEDVAAAV
FT                   AFLASPAAKHITGTVLTVDGGLNT"
FT   CDS_pept        complement(520064..520675)
FT                   /transl_table=11
FT                   /locus_tag="RL0482"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05975"
FT                   /db_xref="GOA:Q1MM27"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM27"
FT                   /protein_id="CAK05975.1"
FT                   /translation="MGRHREFDVEKALDAALCVFWRKGYEGSSYTDLTEAAGVERPALY
FT                   SAFGNKEALFRLALARYSERFLHYIPEALQLPTARQVAAHILVNAVDLNTRYPDHTGCL
FT                   GINGAVAGSDDAEPVRQALIDFRAAGQAQLRERFERAKTEGDLPETAKADALAAFVMAL
FT                   THGMAVQAKAGFSREMLEAVVEQALSTWPTGRSTLSETSS"
FT   CDS_pept        520836..521594
FT                   /transl_table=11
FT                   /locus_tag="RL0482A"
FT                   /product="putative short-chain
FT                   dehydrogenase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0482A"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05976"
FT                   /db_xref="GOA:Q1MM26"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM26"
FT                   /protein_id="CAK05976.1"
FT                   /translation="MSNILKGKVALVTGGSRGLGAATAEALADQGADVAISYVASAEKA
FT                   EAVVETLRARGVRALAIQSDQADMAAAKPLVEKVVAYFGKLDILVNNAAIAVQGKTVDD
FT                   PDLDTVNLDRQWQINVMGAVATTRAAAPVLPDGGRIIFIGSALGTHVPFTGAADYAGTK
FT                   AAIVGYAKGVARDLGGRNITVNVIQPGVMPTDMAAEVLGDGVPEALMNLHAIRRIATLE
FT                   EVSALIRHLAGPNGGYITGGVIDVAGGLAI"
FT   CDS_pept        521640..522617
FT                   /transl_table=11
FT                   /locus_tag="RL0484"
FT                   /product="putative short-chain oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05977"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM25"
FT                   /protein_id="CAK05977.1"
FT                   /translation="MTEKFGAKSTADEVLSGVDLRGKRFLITGVSSGIGLETARALVAH
FT                   GASVVGAVRDRAKAERATASVRDAASQGGGTLELTELDLASLQSIRACADRLLADGRRF
FT                   DSIIANAGVMATPFARTADGFELQFGTNHLGHFALVNRIASLLADNGRLVVLSSQAHRV
FT                   ADVDLDDPNFERQAYDPWVAYGRSKTATSLFAAEFDKRHRDRGIRAASVMPGNSLTDLP
FT                   RHLRQEDLQGLFETVGKARAEAGLPPAELKDIPQVAATSVWAAVVADKDEIGGHYLDDC
FT                   AVAPINDTPNPFADGVRSYALDADKAKRLWAKSEEWIGANTAAI"
FT   CDS_pept        complement(522669..524291)
FT                   /transl_table=11
FT                   /locus_tag="RL0485"
FT                   /product="putative transmembrane sensory box GGDEF/EAL
FT                   domain signalling protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05978"
FT                   /db_xref="GOA:Q1MM24"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM24"
FT                   /protein_id="CAK05978.1"
FT                   /translation="MIENMSGTMRFSKLAMTARHTTGACYMPRIQPTRPQVEIVAWLAV
FT                   FLLLFCLSWFFDWHEGLDAFIEKHHDYPLDHALLALNISGFLGLIYSALRIRDLSREVH
FT                   RRLQAEKNVDWIACHDTLTELPNRRFLDSVCAQAMSDQREETYAVFSIDLDGFKKVNDL
FT                   LGHDHGDAVLKTVAQRLSSLFPREHVFRLGGDEFVVLARRTGNPDLAALGNRIVSVIGK
FT                   PFAFNGVAVDLGASVGFALYPENGDDLSEVIRHSDCAMYVAKKQGRNLVKPFVPSMQDE
FT                   LAKRIRVEADLRAAIRKAEIVPYYQPLVDLKTNKIIGFEALARWKSASGEFIPPNEFIP
FT                   VAEEAGLIVELTDQLLRHACTDALSWPSELVLSFNLSPIQLSDRLLGLRILKILGDVGL
FT                   PAHRVELEVTESAIIQDAVTARIVLDDLVNAGVRIALDDFGTGYSSLSQLSNYRFDKIK
FT                   IDRSFVSSFETNDKQDKVIKAIIALGAGLGVTITAEGIEEESQLQRLQDLGCDIGQGYL
FT                   LGRPAPAAELATDHISTRILQRR"
FT   CDS_pept        complement(524665..525339)
FT                   /transl_table=11
FT                   /locus_tag="RL0486"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM23"
FT                   /protein_id="CAK05979.1"
FT                   /translation="MAPDMSAPPRRSTTGLRKFLDPEQQRDWMEGEAELIDAEERLESL
FT                   EQRFKYVARYEKLLRRPQAQDILEILRLYGQSCIPIPRKTERHYWSVSCLPSTSDKPLI
FT                   RVNASWMELFTLYADGEGLRARFLVHLSHFTTDHSPAQGDVDEPFLEDCVATPEDVGYF
FT                   FPRGEDIFGITVRGSASIRKFLAERRILRAIRTFNVTHMNRGRNAYQASHCYSLGDTML
FT                   AG"
FT   CDS_pept        complement(525574..526050)
FT                   /transl_table=11
FT                   /gene="fucU"
FT                   /locus_tag="RL0487"
FT                   /product="putative fucose uptake protein"
FT                   /note="This CDS overlaps 14 nt at the N-terminus with
FT                   RL0488"
FT                   /db_xref="EnsemblGenomes-Gn:RL0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05980"
FT                   /db_xref="GOA:Q1MM22"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM22"
FT                   /protein_id="CAK05980.1"
FT                   /translation="MLKGLDPLLSPELLLTLRAMGHGDEIAIVDGNYPGVEHARRLIRL
FT                   DGHHLIPVLNAVLSVLPIDDFVAEAIFRSTVKAERDKLDPVHEEMIDCCARHEPHRQVV
FT                   PLIGQDFYGRVKTAHAVIQTGEPRLYANIILRKGVIYPKEPGTHAAAGVDPFVY"
FT   CDS_pept        complement(526034..527281)
FT                   /transl_table=11
FT                   /locus_tag="RL0488"
FT                   /product="putative ROK family transcriptional regulator"
FT                   /note="This CDS overlaps 14 nt at the C-terminus with
FT                   RL0487"
FT                   /db_xref="EnsemblGenomes-Gn:RL0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05981"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM21"
FT                   /protein_id="CAK05981.1"
FT                   /translation="MSTLDGPEHTPVPPPILNPAGGANQVRVRAYNERLVLSLVRLYGA
FT                   LSKADIARRSGLSAQTVSVIMRVLEKEGLLSRGEPVRGRVGQPSIPMHINPDAVYSFGL
FT                   KMGRRSADLVLMDFVGRIRMQLHRTYAYPLPDEILAFVISGIRELEERLDDKQRCRIAG
FT                   LGIAAPFELWNWAEEVGAPAGAMEVWREIDLQADIASRVSHPVFMQNDATSACGAELVF
FT                   GVGPSYPDFVYFFIGSFIGGGIVLNSAIFSGRTGTAGAIGPLPVRGKNGETKQLLEIAS
FT                   IFVLENMLRERGIDPEPLWYSADDWVDFGEPMEAWIQDSAKALAQAIVAAASILDFSAA
FT                   VIDGGFPSWVRSRVVQATIDEAAKLDLQGVVMPEIIEGAVGAQARAIGGASLPIFARYL
FT                   TDQNVLFKEVDHAERT"
FT   CDS_pept        527510..528529
FT                   /transl_table=11
FT                   /locus_tag="RL0489"
FT                   /product="putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM20"
FT                   /protein_id="CAK05982.1"
FT                   /translation="MKKSVLAFGALALGVTFSAPVMAADVAACLITKTDTNPFFVKMKE
FT                   GATAKAKELGVSLKSYAGKVDGDSESQVAAIESCIADGAKGILIAASDTKGIVSSVKKA
FT                   RDAGLLVIALDTPLEPADAADATFATDNLLAGKLIGQWAKETMGDKAKDAKVGFLDLTP
FT                   SQPTVDVLRDQGFMMGFGIDPKDPNKIGDEDDARIVGHDVTNGNEEGGRKAMENLLQKD
FT                   PSINVIHTINEPAAVGAYQALKAVGMEKNVLIVSVDGGCPGVKSVKEGVIGATSQQYPL
FT                   MMAALGVEAIKKFADNGEKPKPTEGKSFYDTGVSLVTDKPVSGVKSIDTKEGTDKCWG"
FT   CDS_pept        528562..529749
FT                   /transl_table=11
FT                   /locus_tag="RL0490"
FT                   /product="putative sugar permease component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05983"
FT                   /db_xref="GOA:Q1MM19"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM19"
FT                   /protein_id="CAK05983.1"
FT                   /translation="MIPGRFRRTMCRRLTNRLIKDRMDIGDGPRASSARGCGGGTMTGT
FT                   QEFERVLDGSDKSVASFEHEKVSLIKRAQHFLHSTPAAVPLIVLVLAIVIFGLTIGGRF
FT                   FSSYTLTLILQQIAIVGILGAAQTLVILTAGIDLSIGVIMVISAVIMGNVAITYGIPTP
FT                   IAVIAGLVVGGLCGLLNGFLVAYMKLPPFIVTLGTWNIVMATNFIYSANETIRDTDVDE
FT                   KAPLLHLFAVSFKLGSAVLTLGVIAMVLLVLVLWYVLNHTAWGRHVYAVGDDPEAAKLS
FT                   GIQTKKVLLTVYAISGVIAGLAAWVSIGRNGSISPSSAVTDFNLQAITATVIGGISLFG
FT                   GRGSILGTLFGAMIVGVVSMGLNMLGADPQWKVLLTGVLIIAAVAIDQWIRKVSV"
FT   CDS_pept        529752..530549
FT                   /transl_table=11
FT                   /locus_tag="RL0491"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05984"
FT                   /db_xref="GOA:Q1MM18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM18"
FT                   /protein_id="CAK05984.1"
FT                   /translation="MASEPLLTAPLLTARGLVKRYGRVTALDNADFDLYPGEILAVIGD
FT                   NGAGKSSLIKAISGAVTPDEGVITLEGRQVQFRSPMEAREAGIETVYQNLALSPALSIA
FT                   DNMFLGREIRKPGVLGSMFRMLDRPAMEKLARNKLTELGLMTIQNINQAVETLSGGQRQ
FT                   GVAVARAAAFGSKVIIMDEPTAALGVKESRRVLELILDVRARGLPIVLISHNMPHVFEV
FT                   ADRIHIHRLGRRLTVIDPKEYTMSDAVAFMTGAKAVPTEPVAA"
FT   CDS_pept        530546..531178
FT                   /transl_table=11
FT                   /locus_tag="RL0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05985"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM17"
FT                   /protein_id="CAK05985.1"
FT                   /translation="MNARIDEIAGEVLDRAGHSRRFLVAIAGPPGAGKSTMADNLANAL
FT                   RAKGESVAVLPMDGFHMDNAILIERGLLARKGIPETFDVRGFLDIVRAVRPADQEVLVP
FT                   VFDRSRELAIASARPIAPGDRFIIIEGNYLLFTQGKWAELDGIFDYTIMLAPPIEVLEE
FT                   RLWDRWRGYNLTEEAANAKVYGNDLPNGRLILENRRPADVTLEIALA"
FT   CDS_pept        531251..532297
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="RL0493"
FT                   /product="putative dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:RL0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05986"
FT                   /db_xref="GOA:Q1MM16"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MM16"
FT                   /protein_id="CAK05986.1"
FT                   /translation="MQSITIRRPDDWHLHLRDGAMLEGVIADTSRTFARAIIMPNLVPP
FT                   VVTSADAKAYRERILKALPDSHRFQPLMTLYLTEHTSPDDVEEGKNSGLITAVKLYPAG
FT                   ATTNSHGGVRDMEKAMPVLERMAKIGLPLCVHGEVTTPEVDIFDREAVFIDTVLDPLRQ
FT                   RLPELKVTMEHVTTSDGVDYIKAARGNLAGSITTHHLIINRNAILVGGIRPHYYCLPVA
FT                   KRENHRLALRAAAVSGDPRFFLGTDSAPHVDPLKECACGCAGIYTSVNTMSCLAHVFEQ
FT                   EGALERLEAFVSLNGPAWYGLQPNEERITLSRQAEPVVFPARIETGAGPVTVFDPMFPL
FT                   HWQVVQQA"
FT   CDS_pept        532397..533656
FT                   /transl_table=11
FT                   /locus_tag="RL0494"
FT                   /product="putative transmembrane sensory box GGDEF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05987"
FT                   /db_xref="GOA:Q1MM15"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM15"
FT                   /protein_id="CAK05987.1"
FT                   /translation="MHKTFLSTDPMSCRHHPARLQSRRLKSMMLDYNSLLLALGVSAAC
FT                   LAVTLMGSWLVRRSETVLLTATVGLVLVVSGIFVYSAYVNTPEKWLGVANFVLFHAGFA
FT                   TIWGAGKQFLTGRVFLPAIAIRAFAAMVFSVVPMLSGYDGLAFIADNLAIALLLFATAR
FT                   QYWLARAEAPAPLLGITALYTLTAISFFLCAAVLISDGKLVLGHAPSNWAEDLSLAVCI
FT                   AGMTGIGALSLALHQWRLAARHRLDAITDPLTGLLNRRALFDQYGTRPMGTTTAVIVFD
FT                   IDHFKSVNDRFGHATGDRVLNVFAGELSAHCRTGDTAARLGGEEFVLVLKEIMPGRAEL
FT                   TAERIRRAFEAREIHIDDEVLTCTVSVGVAPGRSKSLDFDTMLSAADKALYVAKRAGRN
FT                   RVELASYLKAVPVEATRTAS"
FT   CDS_pept        534042..534383
FT                   /transl_table=11
FT                   /locus_tag="RL0495"
FT                   /product="putative glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05988"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM14"
FT                   /protein_id="CAK05988.1"
FT                   /translation="MPIFRIFSVEKAKEFYCGFLGFHLDWEHRFGENFPLYCQVSRDGM
FT                   ALHLSEHSGDASPGAKAFVRVANIRAYHAELSGKDYRYMKPGVEEAPWGLEMTVTDPFS
FT                   NRIAFCEQR"
FT   CDS_pept        534408..534707
FT                   /transl_table=11
FT                   /locus_tag="RL0496"
FT                   /product="putative GGDEF sensory box protein, pseudogene"
FT                   /note="Similar to codons 300 to 375 of Rhizobium loti
FT                   (Mesorhizobium loti) mlr0754 protein. UniProt:Q98M33
FT                   (EMBL:BA000012) (428 aa) fasta scores: E()=9.3e-07, 53.731%
FT                   id in 67 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05989"
FT                   /protein_id="CAK05989.1"
FT                   /translation="MASKSVNDRYGQAAGDRVLQVFADDLTARGRPGDTAARLGGEEFA
FT                   LVLTEIMPRRAELIRKAFEARRFFNLPGADFPQRHPDWCLGPKRRSAVRVQVLA"
FT   CDS_pept        complement(534613..535209)
FT                   /transl_table=11
FT                   /locus_tag="RL0497"
FT                   /product="putative transmembrane protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05990"
FT                   /db_xref="GOA:Q1MM13"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM13"
FT                   /protein_id="CAK05990.1"
FT                   /translation="MTGCDVKSGTLSMGSKEESVKWSLGKPGRILLTMLLLPAVLSIFV
FT                   QISGLNFLPSNEWISKAALPALAVGVVSAALPFWLTLKSRREIDGVRKGFGLLIAPIAG
FT                   YFFGKHLVIIAVPMLFAFIAGHLVELSFTVVDAHERGSKKCRSPVQVEGVPMLFDEICW
FT                   VPENVRRELGPGQRIAVSGRGTSRGVFVESLRRVD"
FT   CDS_pept        complement(535785..536267)
FT                   /transl_table=11
FT                   /locus_tag="RL0498"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05991"
FT                   /db_xref="GOA:Q1MM12"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM12"
FT                   /protein_id="CAK05991.1"
FT                   /translation="MQIILILSLVAAAIGSGLVAGIFFAFSTFIMTAFSRIPAEQGIAA
FT                   MNSINVTIVRSPFMGLFVPTAILCIVIAVLALIDWRGGASVLMLAGAALYIFASFLSTI
FT                   IFNVPMNDALAKVGGNGPEAVQLWTTYVRDWTWWNHVRTIASLLASVAFVRALMVV"
FT   CDS_pept        complement(536270..537094)
FT                   /transl_table=11
FT                   /locus_tag="RL0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05992"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM11"
FT                   /protein_id="CAK05992.1"
FT                   /translation="MQTSEIVLVGGSGKTGGRIIKRLEERGLTVRAASRSSARPFDWED
FT                   RSTWRGALDGASSAYVAFQPDLSVAWAAEAIEALARVAVECGLEHIVLLSGRGEEGAQR
FT                   SEAALKASGMNTTILRASWFCQNFSEGAFLEQILSGRLQLPAGEISEPFIDADDIADAA
FT                   VAALTDPRHRNKTYELTGPRALTFRQAVAEIAQATGRAIEYEQVSMADFSGGLADAGLP
FT                   RGLIELLEELFGQVLDGRNSNVMGGVAEILGRPATDFSEYARRTAATGLWSA"
FT   CDS_pept        537196..537852
FT                   /transl_table=11
FT                   /locus_tag="RL0500"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05993"
FT                   /db_xref="GOA:Q1MM10"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM10"
FT                   /protein_id="CAK05993.1"
FT                   /translation="MSEQPVATRRRQQESTGQLRRIPSQQRGRERFEKILAVAAELIES
FT                   HGSDGLKMSEIVEKAGLSFGALYQYFPDKTSIIRTLAERFNEEGRRCVEEELAKVTDAA
FT                   DLQGALANIVDEYYAFFRREPVMRDIWHATHTDKLLQQVDAEDMEFHAQAFLAVLVRLW
FT                   PDRDRKELLAIARLTMQLLAAAVRYAVSLDAEEGAQAIALFKKMQIVDIGRLLQQ"
FT   CDS_pept        537924..538613
FT                   /transl_table=11
FT                   /locus_tag="RL0501"
FT                   /product="putative orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05994"
FT                   /db_xref="GOA:Q1MM09"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MM09"
FT                   /protein_id="CAK05994.1"
FT                   /translation="MIQTTFPDRAVMAELLAKMLWEIKAVHFNAAQPYKLSSGMASPVY
FT                   IDCRKLLSFPRIRSTVMDFAASTLLRDAGFEQFDCIAGGETAGIPFAALLADRLSLPMI
FT                   YVRKQPKGHGRNAQIEGNMPEGSRVLVIEDLTTAGGSMFKFIDAIRAAGGIVDHGIALF
FT                   FYGIFGEERFADGKVRLHHIATWRNVLAVAKEQKLFDDKTLSEVEAFLDAPLAWSGRNG
FT                   GVSELSL"
FT   CDS_pept        538676..539602
FT                   /transl_table=11
FT                   /gene="frk"
FT                   /locus_tag="RL0502"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05995"
FT                   /db_xref="GOA:Q1MM08"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM08"
FT                   /protein_id="CAK05995.1"
FT                   /translation="MILCCGEALIDMLPRDTTLGEKGFAPYAGGAIFNTAIALGRLGIP
FT                   TAFFTGIADDMMGEILLETLKASNVDYSPCAITPRPSTIAFVKLVNGQATYAFYDEGTA
FT                   GRMITTADLPDLGDDCEALHFGAISLIPSPCGETYEALLDREAARRVISLDPNIRPGFI
FT                   KDKPSHMARIKRMAAKADIVKFSDEDLEWFGLQGDHDALAAHWLNHGAKLVVITKGAEG
FT                   ASGYTKERKVTVPSERVTVVDTVGAGDTFDAGILASLKMDNLLTKAQVASLDEKALRNA
FT                   LTLGAKAAAVTVSRAGANPPWAREIGL"
FT   CDS_pept        complement(539920..541326)
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="RL0503"
FT                   /product="putative trehalose-6-phosphate synthase,
FT                   glycosyltransferase"
FT                   /EC_number="2.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:RL0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05996"
FT                   /db_xref="GOA:Q1MM07"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM07"
FT                   /protein_id="CAK05996.1"
FT                   /translation="MSRLVVVSNRVPMPAKDGSAAAGGLAVALQAALQERGGIWMGWSG
FT                   ESSGDREPGPLSQLQKGNITYALTDLTDTDVEEYYRGFANRVLWPICHYRLDLAEYGRK
FT                   EMAGYFRVNRFFAHRLAPMIEPDDIIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPP
FT                   ADILVTMPVHEEIMRGLSHYDLVGFQTDYDLQNFAGYLRREGIGDDLGNGLFDSHGRIF
FT                   KAGAYPIGIETAGFAEFAERAANNIMVQKTRRSVEGRDMIIGVDRLDYSKGIIQRLEAF
FT                   ETFLTSNPAYQNKVTYLQVTPKSRSEVPEYEHMQKMVAEQAGRVNGAIGTVDWVPIRYV
FT                   NRSISRNVLAGIYRLATIGLVTPLRDGMNLVAKEYVAAQDPDRPGVLVLSRFAGAAREL
FT                   KGALLVNPYDVEGTANAIAKGLSMSLEERRDRWSMMMEHLLSHDVSLWCENFLGDLVLA
FT                   PELRPEHDPG"
FT   CDS_pept        complement(541877..543559)
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="RL0504"
FT                   /product="putative glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RL0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05997"
FT                   /db_xref="GOA:Q1MM06"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MM06"
FT                   /protein_id="CAK05997.1"
FT                   /translation="MRVRKRIVSATFPPPKEPPMNAIVEQLKSTADATKATDIRAAFAA
FT                   DSQRFSRFSVSLDDLLMDFSKTAVNDDILKLLVKLAEEGGVEKKREEMFSGKAINFTED
FT                   RAVLHTALRNRSNAPVLVDGKDVMPDVNAVLAAMGKFADDVRSGTLKGATGKAITDVVN
FT                   IGIGGSDLGPVMATLALAPFHDGPRAHFVSNIDGAHIADILKLVQPETTLFIVASKTFT
FT                   TVETMTNAQTARNFIAKALGEAAVQHHFAAVSTALDKVAAFGIDSARVFGFWDWVGGRY
FT                   SIWSAIGLPLMIAVGPENFGKFLDGAHAVDNHFRKAPITENLPILLGLIGFYHRNVLGY
FT                   PTRAILPYDQRLSRFPAYLQQLDMESNGKGVTIDGTPVEGNSGPVVWGEPGTNGQHAFY
FT                   QLIHQGTSIIPAEFMIAANAFEPELRHQHQLLISNVLAQSEALMKGRTFAEAKKQLTDK
FT                   GMDDKKADFIAPHRVFTGNRPSITFVYDKLTPYALGRLIALYEHRVFVEGVLFRINSFD
FT                   QWGVELGKELATGLLPVVEGKESAASHDSSTQGLVAALAKLAK"
FT   CDS_pept        complement(543654..545354)
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="RL0505"
FT                   /product="putative long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RL0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05998"
FT                   /db_xref="GOA:Q1MM05"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM05"
FT                   /protein_id="CAK05998.1"
FT                   /translation="MNSISVHPNGAKPDKPWLAAYPDIVPAEIPPLEYASLAELLEKSC
FT                   ARYADRTAFSSMGKGMRYRELESQTRKLAAWLQSTGLQKGDRVAVMMPNVLQNPIATYA
FT                   ILRAGLVVVNVNPLYTPRELEHQLKDSGAKAIFVLENFARTVEQVLNKTDLRHVVVTSL
FT                   GEMLGPKGLIVNFVVRKVKKLVPSWSIPQHKSFGQVLREGAGKELQPVTLTGGDIAFLQ
FT                   YTGGTTGVAKGAVLTHENLLANKLQLSLWLRSAFERKKEPEVLNFLCALPLYHIFALTV
FT                   NSLMGMSHGAHNILIANPRDIPGLVKEFEKSKVHIFPGLNTLFNALMNNADFAKLDFSS
FT                   LIMSLGGGMAVQRPVAERWLKMTGTAVTEGYGLSETSPVATANRFDSPEFTGTIGLPLP
FT                   STDLDIRDEEGNSLPSGQVGEICIRGPQVMAGYWQKPEETARVMTDDGYFRSGDMGFMD
FT                   ERGYTKIVDRKKDMILVSGFNVYPNEIEEVAAMHAGILEAAAIGVPDGHSGEAVKLFVV
FT                   RKDPNLTEAEVKAHCIANLTNYKLPRFIEFRTELPKSPVGKILRKDLRG"
FT   CDS_pept        545615..546007
FT                   /transl_table=11
FT                   /locus_tag="RL0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAK05999"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM04"
FT                   /protein_id="CAK05999.1"
FT                   /translation="MLNQDTDATRRDPNVKSTHSLIASDRVEGTRVYGADGKHIGSIER
FT                   LIIGKLDGRVAYAVLSFGGFLGIGHDHYPLPWEKLNYDTQLDGYRIDLTKEQIEGAPSY
FT                   SDDDDTWYNDNGRRVYDYYGVPPYWM"
FT   CDS_pept        complement(546057..548528)
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="RL0507"
FT                   /product="putative mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06000"
FT                   /db_xref="GOA:Q1MM03"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM03"
FT                   /protein_id="CAK06000.1"
FT                   /translation="MHQEPAMIEKTALNSGWTLSCNDTAGPGLPAAIPATVPGCVHLDL
FT                   LANRLIPDPYIDVNEITNDWIGKTDWTYRCSFEAIPDDARVQELVFDGLDTIAVISLNG
FT                   EEIGRTFNMHRSYRFDVSRLLKAGQNELTVTFRSAYAYGAEMEKHYGYRPNNYPGPGNL
FT                   MRKMACNFGWDWGPTLVTAGLWKPVRLESWDRARLAETRVSAILSGGDGLVKVHARLAR
FT                   HGDKTPLRLVAEIGGVSKTVAIAPDEDAVSFELALPSPQLWWPHHLGAQPLYPMTLRLF
FT                   DEASDDLLDSYQRELGFRSLRLDTAADDHGSAFTFIINDVPLFICGANWIPDDCFPPRL
FT                   TAERYAARIEEAKAANIHMLRVWGGGIFEADEFYETCDRAGMLVWQDFLFACAAYPEEE
FT                   PLGSEIEAEVRDNVVRLMPHASLVLWNGNNENIWGFDEWGWRPIIKAGESWGLGYYLDL
FT                   LPKLCAELDPDRPYYPGSPYSGSMEIEPNADGHGCKHIWDVWNDVGYEVYRNYIPRFCS
FT                   EFGWQAPAAWATIEESVHDAPLTPQSNGVFHHQKATEGNDKLIRGLSGHLPEPKTMDDW
FT                   HFATQLNQARAIRFGVEHMRSHRDICKGAVVWQFNDCWPVTSWAALDSAGRRKPLWYAL
FT                   KAAYDPRLLTIQPRGGGLSAVAVNERTLFWRAKISGKRMTLDGTVLAEFEFWRLLCDRF
FT                   EAKEFPLPEDIVTPGLPKDELIVVQMLDRRAFHYFVEDIELALPAPRLTVDVVGIDGGY
FT                   AVKVTAQNFLKDLCLMADRLDPHAVVDTMLVTLLPGESHVFAVKTARTIEAGDITVGTV
FT                   LRSANDLVVTH"
FT   CDS_pept        complement(548590..548985)
FT                   /transl_table=11
FT                   /locus_tag="RL0508"
FT                   /product="putative lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RL0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06001"
FT                   /db_xref="GOA:Q1MM02"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM02"
FT                   /protein_id="CAK06001.1"
FT                   /translation="MAKMIHSMIRVLDEARSVEFYERAFGLSVADRVDFETFTLIYMSN
FT                   AETGFELELTVNKGRTAPYDLGNAYGHLAVSVEEVAVERERLSKLGLKPGELVELNRDG
FT                   KLFGLFFFISDPDGYKIEVLQRHGRFL"
FT   CDS_pept        complement(549033..549782)
FT                   /transl_table=11
FT                   /gene="qatY2"
FT                   /locus_tag="RL0509"
FT                   /product="putative component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06002"
FT                   /db_xref="GOA:Q1MM01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM01"
FT                   /protein_id="CAK06002.1"
FT                   /translation="MKLVVANLFRVAALALLLILLFRTEWLSFMLVPLTSNNAPAVYTQ
FT                   NSLASLAAGHLQLVIGSIVCSAVLAVIGGIFVTRESGADFLPLSRAVANAGQTFPPVAV
FT                   LALAVPATGFGAMPTLIALFLYGLLPIFENTVAGLKQVSPQVLDAADGMGMNGTQRLFR
FT                   VELPLALPLILEGLKVATVINIGTATIGSTVAAKGLGEVIIAGLISDNTAFILQGGLIV
FT                   GLMAVLIYDAMGLVEGVITRRIGLRAA"
FT   CDS_pept        complement(549779..550723)
FT                   /transl_table=11
FT                   /gene="qatV2"
FT                   /locus_tag="RL0510"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06003"
FT                   /db_xref="GOA:Q1MM00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MM00"
FT                   /protein_id="CAK06003.1"
FT                   /translation="MTMIEIRNVTKRYGAATVVDNVSMSVEKGEITVIVGTSGSGKSTL
FT                   MRMINRLVPITEGEIFVGGQNVMDVPVTELRRKIGYAIQGHGLFPHRTVAQNIATVPQL
FT                   LDWDSARIAKRVEELLGLFNLDPATFADKYPHQLSGGQQQRVGVARALAAEPELLLMDE
FT                   PFGALDPVIRGKAQDDLLAIQKQFGTTVILVTHDMDEAFHLGNQIAVMSEGRLLQCSTP
FT                   EKILTEPADPFVQQLTGTSDRALKLMSLLPLKESMEPAKNGLAYALPQSLSLRDALAEM
FT                   IWQGVDEAAVQDAQKAPVGSISMTRLLELGRKA"
FT   CDS_pept        complement(550720..551886)
FT                   /transl_table=11
FT                   /gene="qatW2"
FT                   /locus_tag="RL0511"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06004"
FT                   /db_xref="GOA:Q1MLZ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLZ9"
FT                   /protein_id="CAK06004.1"
FT                   /translation="MAETLAVRRLDRLGVVLVAGGIAATALMPFIYVKANRIAAGKPML
FT                   LMQLLPQPSVIILTVLLLLTAFATLFLRHAIVRLAIATLCLAALIVAIGLVSAAATPTG
FT                   STVARMTPGGGFWVLFAVIGLVISDALVKIRLAPWMRIAALAAYTALLFISLSSGLLDS
FT                   LSIMKEFSTRAPQFETEAISHLLLAFGSLAIAIVLGLPLGILCFWVPKLRAIVLQCLSL
FT                   IQTIPSLALFGLLMLPLGYLATHVPLAAAIGIRGIGTAPALIALVLYSLLPIVANTVVG
FT                   LQGVDPSVRDAAAGMGLTRWQILTGIDMPLAFPVILTGIRIVLVQAIGMVTIAALIGGG
FT                   GFGIFIFQGLGQTAMDLVLLGAVPTVFFAFSSAVILDAVIESIRGSAA"
FT   CDS_pept        complement(551978..552886)
FT                   /transl_table=11
FT                   /gene="qatX2"
FT                   /locus_tag="RL0512"
FT                   /product="putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06005"
FT                   /db_xref="GOA:Q1MLZ8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLZ8"
FT                   /protein_id="CAK06005.1"
FT                   /translation="MLKKLALAVSLSAFAVGAAHAADIVVSSKIDTEGTLLGNVIALAL
FT                   EANGIKTQDRIALGATPVVRKAITAGEIDIYPEYTGNAGFFFNKADDAAWKNIDQGYEL
FT                   AKKLDYDANKIVWLTPSPANNTWALAVRSDVAGPNKLKSLTDFGKWVAGGGAAKLAASA
FT                   EFVNSAGALPAFQTTYGFQLKPDQMVVLSGGDTAATIKAAADQTNGVNTAMVYGTDGAI
FT                   EAAELTVLEDDKNVQQVYAPTPIIREEVLKANPKIEEVLSPIFKSLTADELRKLNAKIQ
FT                   VDGEPAKSVAEGYLKEKGFLK"
FT   CDS_pept        553408..554649
FT                   /transl_table=11
FT                   /locus_tag="RL0513"
FT                   /product="putative transcriptional regulator"
FT                   /note="Codons 100 to 355 are similar to N-terminus to codon
FT                   260 of Bordetella pertussis probable LysR-family
FT                   transcriptional regulator. UniProt:Q7VSJ2 (EMBL:BX640412)
FT                   (301 aa) fasta scores: E()=5.2e-09, 29.057% id in 265 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06006"
FT                   /db_xref="GOA:Q1MLZ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLZ7"
FT                   /protein_id="CAK06006.1"
FT                   /translation="MHLGALFIASHVLTSGSVRETARRFQLSPSTVSTAIHNLETELAM
FT                   TLTERASGELATLIASGRVLEGLEPIMAAIGELGQWAGHDGAGIDEAWASRIPVKIVTM
FT                   ERFLEVADQGSINRAARRLRLGQPQLSLQLANLEKFLSHRLFERQAQGSVLTEEGRRAY
FT                   QIFMAISQAWNDLKSSADERYRRTARSLRIGSIIPTGSESWVARCLGSLVSEWNVRRNN
FT                   NAISLVSMTADDLREALKSGRIDVAILDSVFGLESFRHRELLQTDMVVIAPPDSTETSV
FT                   ADLVASHAICMPSPRTGLGHAAMAFSYERAPNRRLRSQDITAADSLPVIVDLVANHGYV
FT                   SFLGRVSAMPIADKVRIVDLDEHLPMSYHVAFNHRKAAADACTVIIEVAARITSETVAR
FT                   TIRPTDAGARETAA"
FT   CDS_pept        554646..555371
FT                   /transl_table=11
FT                   /gene="cutC"
FT                   /locus_tag="RL0514"
FT                   /product="putative copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06007"
FT                   /db_xref="GOA:Q1MLZ6"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLZ6"
FT                   /protein_id="CAK06007.1"
FT                   /translation="MTILLEVCVDSAEGLAAAMEGGAGRIELCSALELGGLTPLPSLMR
FT                   IAARAPIPVYAMIRPHAGPFIFDGADEEAMMIDIDAVRAAGLAGVVIGANRPDGTLDMP
FT                   LIHRLKAHAAGLGSTLHRAFDLVPDADQALEQAVELGCERILTSGCALKATDGLETLKR
FT                   ISAKAAGRIAIMPGSGIRPANVGEILQATGAREIHGSCSSPVESADPRAVAFGFEAKST
FT                   NKTDVAVVRQMRRAIEAVS"
FT   CDS_pept        complement(555576..556595)
FT                   /transl_table=11
FT                   /locus_tag="RL0515"
FT                   /product="putative alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06008"
FT                   /db_xref="GOA:Q1MLZ5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLZ5"
FT                   /protein_id="CAK06008.1"
FT                   /translation="MKAVLCREPGVLDIVERPSPAAPAAGWVRLAVSHVGICGTDYHIF
FT                   EGKHPFLEYPRVMGHEISATVLEAGDGVTIAVGTPVIVNPYLSCAQCIACRQGKPNCCT
FT                   NIKVLGVHTDGAFCEEICVPAENLYAAKGVSLEAAATTEFLAIGAHAVRRSMTDAGARA
FT                   LVIGAGPIGLGAAIFSRIAGHEVTLLDTSTERLQMASERFGFTSGIVANEATAEAVREK
FT                   TNGDGFDVVFDATGYGPSMEKAFSFVAHGGALVLVSVVKDDIRFSDPEFHKREMMVIGS
FT                   RNATRVDFEHVADSIAKGLVPVDKLITHRTTLADAPRDLARWAHEKNGLIKAVISIGA"
FT   CDS_pept        complement(556659..557633)
FT                   /transl_table=11
FT                   /locus_tag="RL0516"
FT                   /product="putative component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06009"
FT                   /db_xref="GOA:Q1MLZ4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLZ4"
FT                   /protein_id="CAK06009.1"
FT                   /translation="MTATPTEIVAPPPRRKMNILFGLTLIGLLIFLWIVLGVVTPSFWT
FT                   PLNISNLLRQGAMTAILALGQTFVIITAGIDLSVGAIVGFCTVIIAWLLQAGVPVWGAI
FT                   ALTLLMGVAIGAFHGFGIVHMGLPPFIITLATLTSLRGIGLLITNGSTINITNEGFSNF
FT                   ARADLLSIPSLFWMVILVAVPSFIFLHLSRWGRYLFAVGSNAEAARLSGVNVKGMIYLA
FT                   YILSASFAAFVGVLLASRIAIGNATQADGWELQAIASSVIGGTSLFGAVGSVHGPLIGA
FT                   FILATINNGANLLNVNSFWQRIITGLLIIVIVFFDQLRRRRSN"
FT   CDS_pept        complement(557661..559214)
FT                   /transl_table=11
FT                   /locus_tag="RL0517"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06010"
FT                   /db_xref="GOA:Q1MLZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLZ3"
FT                   /protein_id="CAK06010.1"
FT                   /translation="MIGLEEVSHRHDDSATLKEANRIPAGSPILELKGLQKNYGHVQAL
FT                   KPATLTFLAGEIHAIVGENGAGKSTLIKLLTGVITRTAGEVLWCGQPVALATPNEAIAR
FT                   GINAVHQEVVLCRHLTVAANLFLGDEVNRFGLMRKKQMEKMAQAVLDDLGFGLPAGALL
FT                   SSLTIGQQQLVATARAAMRGTQFLIFDEPTAYLTRQESAQLFKLIRRLQGEGVTIVYIS
FT                   HRMEEVFELADRVSVLRDGTHVGTRLIGETNDAELIALMINRSIEQIYHKEEIAIGETI
FT                   LAVNGLSGPGFNDVSLSVKAGQIVGLYGLIGAGRSEFALGLYGRQPTTSGDVQWMGKRV
FT                   DIRNERTAMELGIALAPESRRDQGLCLNQSIGLNINLPVFGRLSHGPVINHTRESANAD
FT                   QQIRNLSIKTPSRRVPASSMSGGNQQKIVIGKWLSHGARLFIFDEPTVGVDVGTKAEIY
FT                   RLFAKLLKDGAGIILISSYLPEVYELADRLHVFRAGKIVASHDYHAATHEEVLSEAIGV
FT                   "
FT   CDS_pept        complement(559323..560312)
FT                   /transl_table=11
FT                   /locus_tag="RL0518"
FT                   /product="putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06011"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLZ2"
FT                   /protein_id="CAK06011.1"
FT                   /translation="MSIVKSLLSRRAFTALAGAAVIATAMPAPSFAADVTIPIIVKDTT
FT                   SFYWQIVLAGARKAGQDLGVNVPELGAQAESDVNGQISILENAVAGKPAAVIISPTEFK
FT                   ALGKPIDEAAKSVPIIGIDSGADSKAFKSFLTTDNVQGGRIAADGLAAAIKGMSGKEEG
FT                   EIVILTNLPGVGSLEQRREGFLDQVKTKYPGLKVIADKYGDGQATTGLNMMTDLITANP
FT                   NLVGVFASNLILAQGVGQAIAENKLGEKIKVIGFDSDDKTVGFLKDGAIAGLVVQDPYR
FT                   MGYDGVKTALAVSKGEKVEENVDTGANLVTKANMADPKIDALLNPKIK"
FT   CDS_pept        complement(560521..560967)
FT                   /transl_table=11
FT                   /gene="fucU2"
FT                   /locus_tag="RL0519"
FT                   /product="putative fucose operon protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06012"
FT                   /db_xref="GOA:Q1MLZ1"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLZ1"
FT                   /protein_id="CAK06012.1"
FT                   /translation="MLKGIHPLLGPDLLHALKTMGHGDDIVISDANFPSGSMGPPVIRA
FT                   DGVSATAMAEAILTHMPLDTFVPEAAWRMEVVGDPDAMPEVCTEFQQIVSKHAGDFRIV
FT                   PVERFAFYAMARKATYIVATTEFRLYGNLILKKGVVHPHEVDQA"
FT   CDS_pept        complement(560977..561996)
FT                   /transl_table=11
FT                   /locus_tag="RL0520"
FT                   /product="putative aldo-keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06013"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLZ0"
FT                   /protein_id="CAK06013.1"
FT                   /translation="MKTRRIGKTKLEVTEISFGAAALGGLYRACPREVAMDTLQAAWDS
FT                   GIRYFDVAPWYGLGLAERRVGDFLRDQPDGSYVLSTKVGRLLRPVPTGTVPDYSYVDPL
FT                   SFDADYDYSYDGIMRSVEFSYARLGLNRIDILYVHDLGVYTHGAAKNAVHQKQFLDSGV
FT                   KALEELKSSGAISAFGLGVNEVPVCLDVTRHSDLDCILLAGRYTLLDRSAVAELLPLCR
FT                   EKGTSLVVGGVFNSGILATGPVPGSHFDYMPADDDVLAKVGAMEAIANRHGVPLAAPAL
FT                   QFPLREAIVASVLIGTAKPSSLTRNMEIVEPRLADEIYAEFEPYTLVAPPLGAEAVRV"
FT   CDS_pept        complement(562147..563649)
FT                   /transl_table=11
FT                   /locus_tag="RL0521"
FT                   /product="putative altronate hydrolase/glucarate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06014"
FT                   /db_xref="GOA:Q1MLY9"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLY9"
FT                   /protein_id="CAK06014.1"
FT                   /translation="MDKLPWIILSAGDNVAVATAAIAPGSTVAGIQTREKIDPGHKVAI
FT                   ADIPLGSPVVKYGQAIGRTTAEVKAGDHVHSHNLHFENDRLAATANSAPETATADDVGR
FT                   TFMGYRRADGRAATRNYIGIIASVNCSTTVCRAIADEANRTILPHYEGIDGFVPIVHDQ
FT                   GCGMSSTGDGMNVLHRTLAGYTRHVNFGGVLMIGLGCEVNQLTLYGQSGAGASKRHFNI
FT                   QDAGGSRRAVERAMGMLREIAADVGKEKRVPMSIGEIIIGLQCGGSDGFSGITANPALG
FT                   VAADLLAAAGGTAILSETSEIYGAEHLLRSRAVSDEVAKKLDDKIAWWEDYVALHGASL
FT                   DNNPSPGNKRGGLTTILEKSLGAVAKGGRSPLTAVYGYAERVTAPGLVFMDTPGYDPVS
FT                   ATGQVAGGANMIAFTTGRGSCFGCRPAPSLKLSSNSALYASMEEDMDIDCGTIATGDAT
FT                   ISGKGREIFDLIVDTASGKKTKSELFGYGDNEFVPWHLGATL"
FT   CDS_pept        563876..564775
FT                   /transl_table=11
FT                   /locus_tag="RL0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06015"
FT                   /db_xref="GOA:Q1MLY8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLY8"
FT                   /protein_id="CAK06015.1"
FT                   /translation="MARQNTVFKEAYNRYAVALRTDTALPSEPEIAAQLGVSRSTARAI
FT                   LTRLSEEGIIRWNKRQKIVLRQPTDHDLFPSEETDSLHDIIERSFMQRILADDAAPGMQ
FT                   INELELAREIGTGTTSVREFLIRFSRFGLIEKRPNSHWTLKGFTREFALELADVREMFE
FT                   LHSAAEFGRLPRDNQSWADLAAMRDEHHAMLADINQRFKDFSVLDERFHLLIHRASKNR
FT                   FIADFYDAIAIVFHYHYQWNKTAARQRNERAIHEHLDYIAALESGDQAAIDAACRAHLH
FT                   SARQTLLQSLPQIATETA"
FT   CDS_pept        complement(564841..565311)
FT                   /transl_table=11
FT                   /locus_tag="RL0523"
FT                   /product="putative purine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:RL0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06016"
FT                   /db_xref="GOA:Q1MLY7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLY7"
FT                   /protein_id="CAK06016.1"
FT                   /translation="MENHEPFLREAIALSRSAVENGDEPFGSLLVKDGEVILRAENSVF
FT                   TGHDMTNHAEMNLVKLAAQHYDTAFLADCTLYTSTEPCAMCSGAIYWSGIGRMVFACSE
FT                   ARLGEIAGIGLNVPSRAVLQTGARIVTVVGPNLEDEAAAVHQEFWPKHLGKA"
FT   CDS_pept        565884..567884
FT                   /transl_table=11
FT                   /locus_tag="RL0524"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06017"
FT                   /db_xref="GOA:Q1MLY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLY6"
FT                   /protein_id="CAK06017.1"
FT                   /translation="MADAKLKPKSVDGTEPHGAGNSPQETASTVEVMPPPDAIEPDPEL
FT                   TPEEAEQARKRYLLKRFWISARRYWGRGGDKFAWPLSIGLLAMICMNVGFQYGINLWNR
FT                   GIFDAIERHDAGTVYFLSGVFVPLVLGTVAIVTIQVAVRMMIQRRWRSWLTTAVIARWL
FT                   ANGRYYQLNLIGGDHKNPEARISEDLRIATEAPVDFVAGVISAFLAASTFIVVLWTIGG
FT                   ALTLPIAGFTVTIPGFLVITAVLYAAITSTSMAVIGRYFVHVSEAKNQAEAEFRYTLTH
FT                   VRENGESIALLGGEEEERNDLDKTFTNVLKQWALLARQHMRTTVVSHGSMLIAPVVPVL
FT                   LCAPKFLEGSMTLGQVMQAASAFAIVQGAFGWLVDNYPRLADWNACARRIASLMMSLDG
FT                   LERAEQSDSLGRIKHGETEGEAMLSLNDLSVSLDDGTAVVTETRVEIEPGERVLVSGES
FT                   GSGKSTLVRAIAGLWPWGGGSVNFHADRRLFMLPQRPYIPSGTLRRAVAYPGAADSWPL
FT                   DEIKSALDKVGLDYLNDKIEEDAPWDQTLSGGEKQRLAFARLLLHQPDIIVLDEATAAL
FT                   DEKSQDKMMQMVIDELPEVTILSVAHRVELEVFHSRKITLERREGGAKLVSDIDLIKRK
FT                   RKRNLLSRVLEKRRSPPKGSTTSNEGGTVPE"
FT   CDS_pept        complement(567911..568369)
FT                   /transl_table=11
FT                   /locus_tag="RL0525"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06018"
FT                   /db_xref="GOA:Q1MLY5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLY5"
FT                   /protein_id="CAK06018.1"
FT                   /translation="MDEDVLSTPGHLISLAARGFARLSESRLKPLGFGVGQLPVLVALQ
FT                   NGKASTQRDLARFARVEQPPMAQMLARMERDGLIERTPDPADGRSSRIVLTKTAQECMP
FT                   KAIAALFQGNREALAGFTDAEAGQLADLLTRLIDNLDQIASAELSSGD"
FT   CDS_pept        568497..568874
FT                   /transl_table=11
FT                   /locus_tag="RL0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06019"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLY4"
FT                   /protein_id="CAK06019.1"
FT                   /translation="MSQNDVEMIKRIYASFNARDIDAVLAVLSDDVAWANGMDGGHVHG
FT                   REAVRDYWTRQWAVISPHVEPMAFEETPGGAVAVEVIQSVFDLDGRPLEGQTHGLKDKT
FT                   VTHIFRMEGDKIVRFDIRDAL"
FT   CDS_pept        568932..569315
FT                   /transl_table=11
FT                   /locus_tag="RL0527"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06020"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLY3"
FT                   /protein_id="CAK06020.1"
FT                   /translation="MTAPVATRHCQARFSAVGGLACAFNSHLAGGIGSEPARFQTPLVA
FT                   LDIVGAQLRQTELAFLKFPADQDEALLLGFAQCLQAGAFRGRLPSHAIGSVQQDHDLYN
FT                   VASPWPMHTAGLHRFSNPLVPHS"
FT   CDS_pept        569648..570046
FT                   /transl_table=11
FT                   /locus_tag="RL0528"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06021"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLY2"
FT                   /protein_id="CAK06021.1"
FT                   /translation="MWGIKNQGLSASAPRRLDIGGFQMVAPCGRRNATRQFFFGTQQSH
FT                   RNEDRGAPSGGVNKLLVRPCAALIAFDTGMGEDEIRRRAAIGGDCIQDGLPDPPGVFPY
FT                   ALRQRSGLILVEEAQDRVVEPVIINDLC"
FT   CDS_pept        complement(570199..571689)
FT                   /transl_table=11
FT                   /locus_tag="RL0529"
FT                   /product="putative transmembrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06022"
FT                   /db_xref="GOA:Q1MLY1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLY1"
FT                   /protein_id="CAK06022.1"
FT                   /translation="MSNAAQRSNRVLIVATIMLATFMVAIEATIVATAMPRIVGELGGF
FT                   SYYSWVFSAFLLAQSTTTVIYGKLSDIFGRKPVLIGGILIFLVGSLLCGLAWSMMSLVL
FT                   FRLLQGLGAGAIQPVTMTIIGDLFKLEERGRVQGAMATVWATSAVVGPLAGGIIVDNIS
FT                   WAWIFWINLPIGVISIIAFMVFLKEDVAHKQAKIDYLGSVLFSISIVALLVMLTETDAS
FT                   AWILLSLFAVFVVTGLLFLAQEKRAPEPIISIPLWSRRLIATSNTATLLAGMALIGLST
FT                   ILPLYVQGVLGRSPLVAGFTLTMLVVGWPLAVMLSSRFYKAFGIRRTLRVGSLMFPFGA
FT                   CFLLFLTPDSSPVVAGAGSFFMGFGMGLISLTSIVLVQDSVEWSMRGSATASIIFSRSL
FT                   GNTLGATVLGAILNAGINHYASGDAAAGLHEALNQPTGLSALAADPAIRSVFNAALHWS
FT                   FWGVVVVAVLTFFTTWLIPVGHGQKGEGAAVPSEAASH"
FT   CDS_pept        complement(571949..572329)
FT                   /transl_table=11
FT                   /locus_tag="RL0530"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06023"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLY0"
FT                   /protein_id="CAK06023.1"
FT                   /translation="MSGKFIAISLLSIGLAGPALAQTAGGADANGRLSVAPVIGGSGSS
FT                   GGGSAGAGSAGTGSVGTGSTGTGSVGTDPGTTGSTTGNGGVNLNSGRSTINPGGVNPNL
FT                   QQTPGCTSGSADTGSLGEACPQ"
FT   CDS_pept        complement(572448..572849)
FT                   /transl_table=11
FT                   /locus_tag="RL0531"
FT                   /product="putative transmembrane protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06024"
FT                   /db_xref="GOA:Q1MLX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLX9"
FT                   /protein_id="CAK06024.1"
FT                   /translation="MAQQKGYCPKRTTSLSAAEGSIVNALKEGRMEDTDSQSPPVEHDT
FT                   AHASRIRTIDPSEAVTGVAIVLGILGGAIGVVSTLVLADASSVGSWIAYCLIAALAGGS
FT                   AGIVVGGMFGAIFAVTRGITVPAHSDRQG"
FT   CDS_pept        complement(572953..575220)
FT                   /transl_table=11
FT                   /gene="fixI"
FT                   /locus_tag="RL0532"
FT                   /product="putative nitrogen fixation cation ATP-ase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06025"
FT                   /db_xref="GOA:Q1MLX8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLX8"
FT                   /protein_id="CAK06025.1"
FT                   /translation="MTCCASIASSLHEPGPRRPGVDEVALASRDLGNGLRQITLSVPDM
FT                   RCGACMALLESTLGKHPEVHMARANLTAKRVTIHWQAENGSPPDFAALIGKIGYTAVLP
FT                   AEGRDQPDGEISGLLRALAVAGFCSMNIMVLSVSVWAGADPATRQTLHLMSAALALPAV
FT                   IYSGATFYRSAWRALAHGRANMDVPVSIGVLLSFGLSVYDTFAEGRQAYFEASTSLIFI
FT                   LLVGRTLDHLMRRRARSAAASLADMMPKGANVIRADGRIEYVPLSDIVSGTRTLIAAGD
FT                   RIPADGTILSGMSELDRSLLTGESRCETVGPGGQVRAGDLNVGHPLTVEATAAPGDSTL
FT                   AELHRMLEAVEDCRSQYRILADRAARLYAPVIHGLSVLTFLSWFAVTQDIHLALTISIS
FT                   VLIIACPCALGLAVPMVQVVAARRLFTRGIVARDGSALERLAEIDTVVFDKTGTLTQYE
FT                   PRLLTGNWTGPLEFSLAASLSRFSSHPMSRAIADYASRREWEALALDDVREIPGNGLEA
FT                   SFRGEVYRLGRAAWAASGDADDRTGAASTVVLTRQGEILASFVFGEKVRAGSAMAVQFL
FT                   KNRGIAVEMLTGDVPEAALAVAREVGIDSVRAAALPKDKAEAIDALRSLGRKVMMIGDG
FT                   INDAVALKAAHVSMAPASGSDIGRSAADFILLNGNMDGIKVALTTAGRAAVLIRQNFAL
FT                   AIVYNACSIPLALLGYANPLIAAIAMSTSSILVVANAMRLEIDRTPPEREMRRINKLAG
FT                   VG"
FT   CDS_pept        complement(575234..576058)
FT                   /transl_table=11
FT                   /locus_tag="RL0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06026"
FT                   /db_xref="GOA:Q1MLX7"
FT                   /db_xref="InterPro:IPR018692"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLX7"
FT                   /protein_id="CAK06026.1"
FT                   /translation="MREEDQMPQDDTSGRYRSEVSGIQETMNPKWQRHLPLGAPLGWLG
FT                   KGWQDLIRQPWPSLAYGFVVFLLALAATVMLFRLERDYLLFPALAGILIVAPLFAAGLY
FT                   VKSRSLANGERISLRQMLFVRPRAGGQVFFTGMLLCMVMLLWMRAAVIIYALFFGVNPF
FT                   PGLDGVARLLVTTPSGWGMLIVGLCIGALFAGFAFAIGVFSIPMLLDERIDAFTAMGVS
FT                   VVMVWNNMGPSMVWGAIVLALFLASLLTGLVGLIVVFPLLGHATWHAYKAMR"
FT   CDS_pept        complement(576250..577128)
FT                   /transl_table=11
FT                   /gene="fixP3"
FT                   /locus_tag="RL0534"
FT                   /product="putative membrane-anchored cbb3 cytochrome
FT                   oxidase subunit"
FT                   /note="This CDS overlaps 7 bp at the N-terminus with
FT                   RL0533A"
FT                   /db_xref="EnsemblGenomes-Gn:RL0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06027"
FT                   /db_xref="GOA:Q1MLX6"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLX6"
FT                   /protein_id="CAK06027.1"
FT                   /translation="MAIEEVDPVTGRKTTGHIWNGIKELDTPVPRGVLLFLIITHLFAA
FT                   LWWILYPTWPLGNTYTRGLIGTGQKQAVERKIIEADASRALWIEKIETSSFDEIRADEK
FT                   LMEKVASSGHQLFGDNCAACHGRDGKGGRDFPDLTDDDWLWGGGPEKIVQTMTVGVNTT
FT                   HSQSRVSQMPAFGTDEMLNRKQVSDVAAYVYSLSNTSTESVDASQIAAGRQVFMASCVA
FT                   CHGEDAKGKQDVGAPNLTDGRWIYGGGIERIVQSIHGGRQGHMPTWEERLSPAEIKILA
FT                   LYVNKLGGGRQ"
FT   CDS_pept        complement(577119..577289)
FT                   /transl_table=11
FT                   /gene="fixQ3"
FT                   /locus_tag="RL0533A"
FT                   /product="putative cbb3 cytochrome oxidase subunit FixQ
FT                   protein"
FT                   /note="This CDS overlaps 7 bp at the C-terminus with
FT                   RL0533"
FT                   /db_xref="EnsemblGenomes-Gn:RL0533A"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06028"
FT                   /db_xref="GOA:Q1MLX5"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLX5"
FT                   /protein_id="CAK06028.1"
FT                   /translation="MDLTHETMLELSKVWGLFYLIVFSIGVIIYTFWPSNKARFDRAET
FT                   DIFDKDDTPWR"
FT   CDS_pept        complement(577308..578060)
FT                   /transl_table=11
FT                   /gene="fixO3"
FT                   /locus_tag="RL0535"
FT                   /product="putative FixO cytochrome-cbb3 oxidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RL0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06029"
FT                   /db_xref="GOA:Q1MLX4"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLX4"
FT                   /protein_id="CAK06029.1"
FT                   /translation="MSERLHGRLERTAVGFMLAIVVAGSVGGLVEIAPLFTIHETVEDA
FT                   PDMRVYTPLEAAGRNIYVREGCYACHSQMIRTLRDEVERYGPYSLAVESKYDHPMLWGS
FT                   KRTGPDLARIGGKYSDLWHVAHLINPREVVPESNMPSYQWLATTPLDLGDLRDQLAALR
FT                   TVGVPYTDDMVANASADAFGQANPDSEQSSGVTERYGQDTQVSAFDGVKTSVTEMDAMV
FT                   AYLQVLGRLTKAAYQNTAAPEQMPNPNN"
FT   CDS_pept        complement(578064..579707)
FT                   /transl_table=11
FT                   /gene="fixN3"
FT                   /locus_tag="RL0536"
FT                   /product="putative cytochrome cbb3 oxidase subunit"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RL0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06030"
FT                   /db_xref="GOA:Q1MLX3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLX3"
FT                   /protein_id="CAK06030.1"
FT                   /translation="MGQLTSAERGSAAAILIALMVVGVAMAAAGRFDPIGIHGAIVLVY
FT                   CGALFCYILTSAFSEEPDASRFSSYYDDPIKVGVALTLAWAVFGMFIGVWAAAQLAWPS
FT                   LNFDTAWSSFGRIRPAHTTGVIFGFGGNALIATSFHVVQRTSRARLADQLSPWFVIFGF
FT                   NLFCLIAVSGYFMGVTQSKEYAEAEWYADLWLVIVWIAYFVLFVRTLARRKEPHIYVAN
FT                   WYYLAFIIVVAILHIVNNLAVPVSFGHAKSYTVWSGVQDAMVQWWYGHNAVAFFLTSGF
FT                   LGMLYYYLPIRAERPIFSYRLSILSFWGITFFYMWAGSHHLHYTALPIWVQNLGMTFSV
FT                   MLLVPSWASAGNALLTLNGAWHRVRDDATLRFIMMAAFFYGLSTFEGSFMAIRPVNSLS
FT                   HYTDWTVGHVHAGALGWVAMITFGAFYTLVPSIWKRERMYSAALVEVHFWLALAGTLIY
FT                   VFAMWNSGIIQGLMWRTYSADNTLVYSFVDSLLAMYPYYIARAFGGLLFLLGAIVASFN
FT                   IWMTVRTAPAVGAVHDAPLTSGILENAPAE"
FT   CDS_pept        complement(580205..581164)
FT                   /transl_table=11
FT                   /locus_tag="RL0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06031"
FT                   /db_xref="GOA:Q1MLX2"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLX2"
FT                   /protein_id="CAK06031.1"
FT                   /translation="MALPPILRDRLRLPVIGSPLFIISHPALTLAQCKAGIVGAFPALN
FT                   ARPESQLDEWLAEITEELARHDAAHPERPAAPFAVNQIVHMSNKRLEHDLTLCVKYKVP
FT                   IVISSLGAVPEVNAAVHSYGGIVLHDIINNRHAHSAIRKGADGLIAVAAGAGGHAGTLS
FT                   PFALVQEIREWFDGPLLLAGAIATGGAILAAEAMGADMAYIGSPFIATEEARAADAYKQ
FT                   AIVAGAAGDIVYSNYFTGVHGNYLKPSIVAAGMDPDNLPLADASKMDFEQAVGGAKAWK
FT                   DIWGSGQGISAVKAVEPVANLVDRLEAEYRAARARLAL"
FT   CDS_pept        581450..582637
FT                   /transl_table=11
FT                   /locus_tag="RL0538"
FT                   /product="putative transmembrane protein"
FT                   /note="Codons 155 to the C-terminus are similar to codons
FT                   45 to the C-terminus of Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970) agr_c_731p. UniProt:Q8U5M0 (EMBL:AE007979)
FT                   (277 aa) fasta scores: E()=6.4e-25, 49.383% id in 243 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06032"
FT                   /db_xref="GOA:Q1MLX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLX1"
FT                   /protein_id="CAK06032.1"
FT                   /translation="MSGLETAIRTALDNSDRDNPEVRARIYQSARQALEAGLRKQDITD
FT                   TEVVAHHRHRLESTIHAIEGEERDRLHPRQRPPEVPVPPVVEMPAPPVHQADVDQFDGP
FT                   AVSGETRAAEVVQRRGDESSLDDVHAGSTDHLAAAPVGEERLARGQRATNMDFRPERAA
FT                   GRRKPRKFFSRLLVWCVLLAFIGIGAWWAHTSGLLMTAAERDTSVANPPASTQPEDFTG
FT                   NDDSAGNAASHTDQPVTIDPQNSFSADWIPLFKPEDADKIQSGPRARTEKITENDGPAV
FT                   RLISESGAADGNISISVPPSVLQQLAGKSSTIALTLQSTTDEPTQITVECNFQTLGNCA
FT                   RHRFTVTREKSDALLQVKFDRSLAPNSPGTLTINSDLDGKARGINLFAIRILPGQ"
FT   CDS_pept        complement(582735..583616)
FT                   /transl_table=11
FT                   /locus_tag="RL0539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06033"
FT                   /db_xref="GOA:Q1MLX0"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLX0"
FT                   /protein_id="CAK06033.1"
FT                   /translation="MGETVESRAVELDIHGNKRIFDVDDPVLPVWVDEYALASGDFPYK
FT                   KKLKEEDYLAQLQKLQIELVKVQFWLQATGKRVMALFEGRDAAGKGGAISASSAHMNPR
FT                   LARVVALTKPTEREQGQWYFQRYVAQFPTSGEFVLFDRSWYNRAGVEPVMGFCTPQQYE
FT                   DFLKQAPQLEKIIAHEGIFFFKFYLDIGREMQIKRFHDRRHDPLKVWKLSSMDIAALTK
FT                   WGDYSDKRNRMLKETHTDFAPWTVIRANDKRRARLELIRHMLNKMDYDGKDKKVLGTVD
FT                   TEIIGSGPGFLK"
FT   CDS_pept        583856..585079
FT                   /transl_table=11
FT                   /locus_tag="RL0540"
FT                   /product="putative two-component sensor histidine kinase
FT                   transcriptional regulatory protein"
FT                   /note="Codons 140 to the C-terminus are similar to codons
FT                   308 to the C-terminus of Bacillus subtilis PhoR alkaline
FT                   phosphatase synthesis sensor protein (ec 2.7.3.-).
FT                   UniProt:PHOR_BACSU (EMBL:A27650) (579 aa) fasta scores:
FT                   E()=8.4e-29, 39.700% id in 267 aa, and to entire protein of
FT                   Agrobacterium tumefaciens (strain C58/ATCC 33970) PhoR two
FT                   component sensor kinase. UniProt:Q8UI80 (EMBL:H97409) (433
FT                   aa) fasta scores: E()=2.3e-93, 67.327% id in 404 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06034"
FT                   /db_xref="GOA:Q1MLW9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLW9"
FT                   /protein_id="CAK06034.1"
FT                   /translation="MARIRRERPVLLAAILSALAALAAGMNKWVVLGLLLVMILTALFN
FT                   EAPVIAADPAPPVEIEPEVLPSHLPEVSATLSGLDIPVMVLSDDASVLFQNRAAEKAFG
FT                   EVALGAHISARLRSPGVLDMVRETIATNAPNQIEHSERLPSERVYIVRSAPIEFAAGDG
FT                   PHERYFILSFRDISEVRRIDRMRSDFVANASHELRTPLASLRGFIETIQGPAKNDLKAQ
FT                   ARFLNIMLDQTTRMSRLVDDLLSLSRLELKSHIAPDEKVDLVPLLGHVRDALLPLARDV
FT                   GVDINLHLPDGKVEVLGDRDELVQVFENLMENACKYGQEGEIVDVWLKNGAGQPVEVSI
FT                   VDRGPGIPAEHVPRLTERFYRVSIEDSRSKKGTGLGLAIVKHILTRHRARLIVRSEVGK
FT                   GTDFTVRF"
FT   CDS_pept        585168..585569
FT                   /transl_table=11
FT                   /locus_tag="RL0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06035"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLW8"
FT                   /protein_id="CAK06035.1"
FT                   /translation="MRGPKPKTTARARSLRQSDNDAEDRLWNELRDRRLNGNKFVRQLP
FT                   IGPYFADFARRELRLVVEIDGSQHAESRRDGIRDVFMTGDGWSVVRFWNVDVLRALPSV
FT                   LDTILAICDGRLTARVEVADLRFFPAASD"
FT   CDS_pept        586041..587075
FT                   /transl_table=11
FT                   /locus_tag="RL0542"
FT                   /product="putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06036"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLW7"
FT                   /protein_id="CAK06036.1"
FT                   /translation="MNTFKLTVAALAATAAFAGAAVARDQIQVAGSSTVLPYAKIVAES
FT                   FGETFTNFKTPIVESGGSGAGLKEFCKGVGEDTIDIANSSRPINKNELEACKAAGVTDI
FT                   QEVKIGYDGIVFATDASNPDLAYVPADIYKALAAQVVVDGKLVANPYKKWSEVNPKLPA
FT                   VDIAAYIPGEKHGTREVFEQNVLAAGCKASGATDVIAKEIADKAAQGKACVAVRKDGVA
FT                   VDIDGDYPETLARIAANKTGLGVFGLSFYENNADKLKVATMSGIVPSTETISNGTYPVS
FT                   RPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYGLVAAPDAEREAIRKEVEA
FT                   GKAM"
FT   CDS_pept        587241..588722
FT                   /transl_table=11
FT                   /locus_tag="RL0543"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06037"
FT                   /db_xref="GOA:Q1MLW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLW6"
FT                   /protein_id="CAK06037.1"
FT                   /translation="MSTSIILLCLVVIGVAAYLVARNRATALAGGRSSSLHSRPAYYGA
FT                   YAAIWAVLPALIVLGLWLSISPGIIQSSVRSAFPDDIQAQVSVEQDLGYSTVATVARGL
FT                   TMLTSDETAAVGNDPAALQAKLLEKGVPLAGQPLPYMIDAARTLNAMSMTSRIAMTAIV
FT                   FALAVAGAFYALRSIAPRFRARNRVERVILWGLLLASSIAILTTIGIVLSMLSEAARFF
FT                   AAVPAMDFFFGTVWDPRFAGAGSSSFGQFGLIPLLLGTIYIGLVAMLVAVPVGLFAAIY
FT                   MAEYASMKVRSVAKPLLEVLAGIPTIVYGFFALVTVGPFLRDFSAQVSGLLSGNYSNFI
FT                   QAQSVLTAGIVMGIMLIPYVSSLSDDIITAVPRSLRDGSLGLGATRSETIKKVVLPAAL
FT                   PGIVGALLMTASRAVGETMIVVLAAGVAARIQINPFEPMTTVTVKIVNQLTGDLEFTSP
FT                   QTLVAFALGITLFCITLCLNIYALYIVRKYREQYE"
FT   CDS_pept        588719..590041
FT                   /transl_table=11
FT                   /locus_tag="RL0544"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06038"
FT                   /db_xref="GOA:Q1MLW5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLW5"
FT                   /protein_id="CAK06038.1"
FT                   /translation="MTDIVSPTSGVSVSKAPARRDIGIKRRYAAERRFQAYGIAAITFG
FT                   LVFLFILLWTVIGKGYTAFQQTAITLPIEFVEKTIDPNNKRATDPSVLIAANYPVLLRD
FT                   AIVKQLNVNASSRPDVRDATAMLSKSAPIQLRDMVMADPSIIGKTINVTVLADANVDSA
FT                   NKGQIDLSVDEKNRKVNDKQVGWMNELKASGALHKQFNTGLFVNGNSSRPEAAGLGVAL
FT                   IGSLYLMLIVLVLALPIGVAASIYLEEFAPKNKLTDLIEVNINNLAAVPSIVYGLLGLS
FT                   VFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPSIRAAALGLGASKMQMVF
FT                   HHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPTTPLDPSTALPVQVYMW
FT                   ANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW"
FT   CDS_pept        590057..590872
FT                   /transl_table=11
FT                   /locus_tag="RL0545"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06039"
FT                   /db_xref="GOA:Q1MLW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLW4"
FT                   /protein_id="CAK06039.1"
FT                   /translation="MNMLTEAAVEKALDHKMSNVPYKMIGKDVSVYYGEKRALFDVNLN
FT                   VRENTVTALIGPSGCGKSTFLRCLNRMNDTIDGCRVTGKITLDTDDVYDPDIDVVELRA
FT                   RVGMVFQKPNPFPKTIYENVSYGPRIHGLAKSKADLDQIVETSLQRAGLWNEVKDRVHE
FT                   SGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRENYTIVIV
FT                   THSMQQAARVSQRTAMFHLGNLVEENDTDKMFTNPDDPRTQDYIMGRFG"
FT   CDS_pept        590917..591630
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="RL0546"
FT                   /product="putative phosphate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06040"
FT                   /db_xref="GOA:Q1MLW3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLW3"
FT                   /protein_id="CAK06040.1"
FT                   /translation="MASTHIFSAYDDDLKFLSRRISEMGGLAEQMVGESVRALVNGDTA
FT                   LAQKVISDDVILDHAEREIGDKAIVTIARRQPMASDLREIMGSIRIAADLERVGDLGKN
FT                   TAKRVIAVQSTGVPRKLARGLEHLSELALVQLKEVLDVYTNRSADKANAIRERDNEIDA
FT                   MYTSLFRELLTYMMEDPRNITSCTHLLFCAKNIERIGDHATNIAETIFYMTTGAQPEGD
FT                   RPKDDSANTVGAVTE"
FT   CDS_pept        591764..592447
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="RL0547"
FT                   /product="putative phosphate regulon two-component
FT                   regulator transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06041"
FT                   /db_xref="GOA:Q1MLW2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLW2"
FT                   /protein_id="CAK06041.1"
FT                   /translation="MIPRVAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEMRLQER
FT                   TPDLLILDWMLPGVSGIELCRRLRMRPETERLPIIMLTARGEESERVRGLSTGADDYVV
FT                   KPFSTPELVARVKAMLRRARPEVLSTVLKCGDIELDRETHRVHRKTREVRLGPTEFRLL
FT                   EFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMQDVIRTVRGAG
FT                   YSMEA"
FT   CDS_pept        complement(592768..593301)
FT                   /transl_table=11
FT                   /locus_tag="RL0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06042"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLW1"
FT                   /protein_id="CAK06042.1"
FT                   /translation="MNWTDERVEKLKKLWAEGLSASQIAAQLGGVSRNAVIGKVHRLCL
FT                   PGRAKAGGTNTAARTPKRNTSAPRAPNYASRITTRTVTRQQGATMLKEEIEIETIEEME
FT                   YVPRGNVVVPISRRLGLTELTERTCKWPVGDPLKDDFHFCGCESPDNSPYCSYHQKLAY
FT                   QPVNERRRAAARAS"
FT   CDS_pept        593692..594921
FT                   /transl_table=11
FT                   /gene="gabT2"
FT                   /locus_tag="RL0549"
FT                   /product="putative acetylornithine
FT                   aminotransferase/succinylornithine transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06043"
FT                   /db_xref="GOA:Q1MLW0"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLW0"
FT                   /protein_id="CAK06043.1"
FT                   /translation="MPANFDGDRAMAEAAPLYDTYSRAPLRFERGEGVWLITESGERYL
FT                   DFGAGVAVTSVGHSNPHVVGALKEQADKVWHLSNIYEIPGQERLAKRLTDATFADKVFF
FT                   TNSGAEALECAIKTARRYQFSKGHPERFHIITFEGAFHGRTLATIAAGGQEKYLEGFGP
FT                   KAPGFDQVAFGDIEAVRAAITEATAAILIEPVQGEGGVRPATPEFMKALRQLCDDNGLL
FT                   LILDEVQTGVGRTGKLFAHEWSGITPDIMAVAKGIGGGFPLGACLATAEAASGMKAGTH
FT                   GSTYGGNPLAMAVGSAVLDIILADGFLQQVRDVALVFRQGLASLKDRYPDVIEDIRGEG
FT                   LLLGIKAAVPSAELLQAIRAAHLLGVPAGDNVIRLLPPLVVTAEEAREGLVRIERAAES
FT                   IRASKVKKTA"
FT   CDS_pept        594964..595878
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="RL0550"
FT                   /product="putative ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:RL0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06044"
FT                   /db_xref="GOA:Q1MLV9"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLV9"
FT                   /protein_id="CAK06044.1"
FT                   /translation="MSPKHFLDLSAVTSADLRTIMNDALARKQAFKAGTGDKPLAGKML
FT                   AMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIR
FT                   TTEHSRLLELAQHATVPVINALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNV
FT                   LHSLVEGAARFGYRMNMAVPLGSEPKDHYLNWARNEGAEIMLCHDADRAVAGVDCVVTD
FT                   TWVSMNQEHRARGHNVFQPYQVNAALMAKAGNDALFMHCLPAHRGEEVTDDVIDGPQSV
FT                   VFDEAENRLHAQKSILAWCLGAI"
FT   CDS_pept        595970..596962
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="RL0551"
FT                   /product="chaperonin, heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06045"
FT                   /db_xref="GOA:Q1MLV8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLV8"
FT                   /protein_id="CAK06045.1"
FT                   /translation="MAEAAAALGQFDFAGDDHVVPFQVEGLDVRGRAVQLGPMLDAILE
FT                   RHHYPAPVARLLAEVVVLTVLLGTSLKFDGKFTVQTKGDGPVDLLVADFSTPENVRAYA
FT                   RFDQALLNKAIESGETEPEQLLGKGILAFTIDQGKFSQPYQGIVPLDGTTLEDIAGVYF
FT                   RQSEQIPTRVRLAAAELFDRDDAGKPRHRWRAGGLVAQFLPEAPERMRQPDLHGGDGDT
FT                   GSRPHGEDDAWLEARSLVETIDADELTDPLVGTERLLFRLFHERGVRVYEPRAVFDRCS
FT                   CSRDKIKGVLKGFSAEEIEASQEDGEIAVTCEFCSTTYRFEPAELQPAE"
FT   CDS_pept        597136..597684
FT                   /transl_table=11
FT                   /locus_tag="RL0552"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLV7"
FT                   /protein_id="CAK06046.1"
FT                   /translation="MPPVSLADDETVPWKEVGGWSVAVDPTLDNGCFVLTSFDDDTIFR
FT                   LGFNFRKKDNPLYILLGNPNWKSLEKGKHYPVELSFDQSKRTADARGLDLDGLKSLWID
FT                   FEDPDLIEEFAGKLSFRASFGGKQIVALGLKDSASAADELLACQKAVNDAVAKHPAPPQ
FT                   SKDPFEAKPGTQASDPFDL"
FT   CDS_pept        complement(597820..598230)
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="RL0553"
FT                   /product="putative methioine biosynthesis related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06047"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLV6"
FT                   /protein_id="CAK06047.1"
FT                   /translation="MTKVQGMYRALTREIEVVVEPFYLEEQSDPEDDRYVWGYRIVISN
FT                   NSGIAVRLVNRYWNITDQNGQVDEVTGPGVVGEQPRLSPGDTYEYSSGCPLDTPSGLMF
FT                   GHYQMETDEGEMFDVDIPAFSLDSPGLLRVLN"
FT   CDS_pept        complement(598445..599629)
FT                   /transl_table=11
FT                   /gene="metZ"
FT                   /locus_tag="RL0554"
FT                   /product="putative O-succinylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06048"
FT                   /db_xref="GOA:Q1MLV5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLV5"
FT                   /protein_id="CAK06048.1"
FT                   /translation="MSKTWRPATQLVHGGTLRSQYGETSEAIYLTQGFVYETSEAAEAR
FT                   FKGETEGFIYARYGSPTNDMFEKRMCLLEGAEDARATASGMAAVTAAILCQLKSGDHIV
FT                   AARALFGSCRWVVETLAPKYGIDCTLIDGRDLANWEKAITPKTKVFFLESPTNPTLEVI
FT                   DIAGVAKLANQIGAKVVVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGGVVLS
FT                   DKEWIDENLHDYFRHTGPAMSPFNAWTLLKGIETLPLRVRQQTENAAKIADFLAEQGKV
FT                   AKVIYPGRKDHPQADIIAKQMTGGSTLVAFELKGGKDAAFALQNALEIIKISNNLGDSK
FT                   SLITHPATTTHKNLTDEARAELGISPGTVRLSAGIEDTDDLIEDFARALAKVSA"
FT   CDS_pept        599824..600918
FT                   /transl_table=11
FT                   /locus_tag="RL0555"
FT                   /product="putative deoxycytidine triphosphate deaminase"
FT                   /note="N-terminus to codon 190 is similar to entire protein
FT                   of Escherichia coli Dcd deoxycytidine triphosphate
FT                   deaminase (ec 3.5.4.13) (dCTP deaminase). UniProt:DCD_ECOLI
FT                   (EMBL:ECD844) (193 aa) fasta scores: E()=1.5e-05, 31.795%
FT                   id in 195 aa, and entire protein is similar to Rhizobium
FT                   meliloti (Sinorhizobium meliloti) putative deoxycytidine
FT                   triphosphate deaminase protein (ec 3.5.4.13).
FT                   UniProt:Q92S94 (EMBL:SME591784) (365 aa) fasta scores:
FT                   E()=8.5e-123, 85.950% id in 363 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06049"
FT                   /db_xref="GOA:Q1MLV4"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLV4"
FT                   /protein_id="CAK06049.1"
FT                   /translation="MMARETGILADRAISALFETGRLISERELDRDQIQPASLDLRLGG
FT                   KAFRVRASFMPGPSHLVSDKLDRLSLHVIDLSEGAVLETGCVYIVPLMESLALPADMSA
FT                   SANPKSSTGRLDIFTRVITDYAQEFDKIPSGYSGPLYLEISPRTFPIVVRRGSRLSQIR
FT                   FRVGQALLGEPELLKLHESETLVASKLPNVSGGGIALSIDLAGDKEGLIGYRGKHHTAV
FT                   VDVDKKAQHDIYDFWEPLHSRGRNELILDPDEFYILVSREAVHVPPDYAAEMTPFDPLV
FT                   GEFRVHYAGFFDPGFGHAPAGGRGSRAVLEVRSHEVPFILEDGQIVGRLVYEHMQEKPA
FT                   SLYGSGLGSNYQAQGLKLSKHFRI"
FT   CDS_pept        complement(601181..601690)
FT                   /transl_table=11
FT                   /locus_tag="RL0556"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06050"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLV3"
FT                   /protein_id="CAK06050.1"
FT                   /translation="MSMLQKMLLAVVLTGGIATAASAAGTNEPAGIETAKPMSSAEIYR
FT                   LYNQNTWMWKAGAGYFSAKARRFTAWSRENGSPSFGMGRWFITESGKLCFNADWHAKTG
FT                   TATAITCFSHRKKGGLIYQKREPDGEWYVFKSAPAQATDEFAKLRRGDYVSSQLGGIET
FT                   SVSKTR"
FT   CDS_pept        complement(602667..604574)
FT                   /transl_table=11
FT                   /locus_tag="RL0558"
FT                   /product="putative transmembrane cellulose synthase
FT                   catalytic subunit [UDP-forming]"
FT                   /EC_number="2.4.1.12"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Acetobacter xylinus BcsA cellulose synthase catalytic
FT                   subunit [UDP-forming] (ec 2.4.1.12). UniProt:BCA1_ACEXY
FT                   (EMBL:A43735) (754 aa) fasta scores: E()=2.1e-11, 24.907%
FT                   id in 538 aa, and to Rhizobium meliloti (Sinorhizobium
FT                   meliloti) putative cellulose synthase protein.
FT                   UniProt:Q92WA2 (EMBL:B95897) (621 aa) fasta scores:
FT                   E()=2.1e-204, 77.325% id in 613 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06051"
FT                   /db_xref="GOA:Q1MLV2"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLV2"
FT                   /protein_id="CAK06051.1"
FT                   /translation="MTELAITQATHAPEPSHEPLLVPVLTGHRRVEYLFLTAVWACAFA
FT                   YFWIWWLESRHHVDAFGTITVSLVLAWVTALPAYFIVVFYRAARPNGPLRLPAGSRVAM
FT                   VVTKAPAEPFSVVRETLLAMVAQEVEHDTWLADEDPSPETLNWCSEHGVFVSTRKGRSD
FT                   YHRTSWPRRTRCKEGNLAFFYDHYGYSRYDFVAQLDADHVPAPDYLFHMLRPFADPKVG
FT                   YVSAPSICDKNASESWSARGRLYAEASMHGSLQAGYNGGLAPMCIGSHYAVRTVALEQI
FT                   GGLGPELAEDHSTTLMMNAGGWRGVHALDAIAHGDGPRTFSDLVTQEFQWSRSLVMVLL
FT                   RYSPSLVGRLPARLKFQFLFSQLWYPLFAFFMLLMFALPIIALVRGQNFVTVTYPDFLA
FT                   HFAPLSIALVVMAYRWRASSSFRPYDAKILSWECMLFLFARWPWALAGTLAAVHDFVTG
FT                   SFVDFRVTPKGRSEVDLLPVRVLAPYALLALMAVLPALAIGDAGASKGGYFFTILNAAI
FT                   YCALLLVIVGRHSKENTVAAAPRFYRPAMATVLLALVALPGAATIMRGKDATEALAWGS
FT                   GRLQLFEERYAASGAGRGGTALRTIFFKPRWISDPEEIQLRTDAAHPDVRPSVEEIHNA
FT                   "
FT   CDS_pept        complement(604571..605557)
FT                   /transl_table=11
FT                   /locus_tag="RL0559"
FT                   /product="putative UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:RL0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06052"
FT                   /db_xref="GOA:Q1MLV1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLV1"
FT                   /protein_id="CAK06052.1"
FT                   /translation="MDAPRVLVTGGAGYIGSHTAKLLRSEGIEPVVYDNLTTGNRSSVR
FT                   WGPFVEGDVLDTSCLIEVIEKYAPDAVIHFAASAYVGESVENPAKYYNNNVCGALSLID
FT                   ACRQTGLQNVIFSSSCAVYGVPSVLPIDETLPKAPINPYGKTKLIFEHMLADYAAAYGL
FT                   RYVALRYFNACGADPDGELGEWHVPETHLIPRALLAAAGRIPHLEIFGDDYDTPDGTCI
FT                   RDYIHVADLARAHVQAFTHLAKGGANLAVNLGTGRGYSIRDVLRVIQETTGREVPVVIH
FT                   PRRPGDPPSLYADASLARETLCFQPRYSDLETIVRTAAPFFGLEARA"
FT   CDS_pept        complement(605557..606603)
FT                   /transl_table=11
FT                   /locus_tag="RL0560"
FT                   /product="putative epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06053"
FT                   /db_xref="GOA:Q1MLV0"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLV0"
FT                   /protein_id="CAK06053.1"
FT                   /translation="MNYLGRIRAHSVQASARDANCPSGIHRAPKRVLVTGGAGFLGSHL
FT                   CETLLAAGHQVICLDNFSTGMRRNIVHLKRVDRFNVVAHDIVHPLDLEVDEIYNLACPA
FT                   SPRHYQADPIHTTKTCVLGSLNLLELAARTGARILQASTSEVYGDPNVHPQVESYWGNV
FT                   NSFGPRSCYDEGKRCAETLFFDFHNTHGVEIKIIRIFNTYGPRMRPDDGRVVSNFIVQA
FT                   LTGQDITIYGDGSQTRSFCFVDDLIGGMVRMMASPSSLTGPVNLGNPGEFTIRELAEQV
FT                   IGLTGSRSQIIHRALPVDDPRQRRPDISLAMQELDWRPKIDLSSGLRQTIDYFDGLLAR
FT                   PARELEAV"
FT   CDS_pept        606958..608106
FT                   /transl_table=11
FT                   /locus_tag="RL0561"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06054"
FT                   /db_xref="GOA:Q1MLU9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLU9"
FT                   /protein_id="CAK06054.1"
FT                   /translation="MATGSESDDDPAAEQERPAHMERRRWPREPAMRKERLSHASPALE
FT                   PLRFSTQDLPPAEQFQAWRAHMAPLVDVHLPEGKSPEDGFLAEQTGWHLGDILIVQQRA
FT                   HAHRYVRDQAMLRSSPIDHWNVGLQRSGQAWTEVNRRVTETGAGEIFFMSLGSPYRGRM
FT                   TDTEALLVFLPYEMLARDASLLQSAGNTVLSGSHAELLTGYLTGLETNLGNLTIGEVPR
FT                   IIQTIGDMVVAGAASSTRTDTGQNQTNMGLMERAHRYIHVNLHSENLTPDVMCRALGIS
FT                   RTRLYQLFEASGGVLNYIRKRRLLQAYADLSNSADHRPISEIAEAAGFEVAANFTRAFI
FT                   HEFGLSPREIRRTVATQQRPAPAIRSARRYGKTIGDWLALTG"
FT   CDS_pept        complement(608186..608464)
FT                   /transl_table=11
FT                   /locus_tag="RL0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLU8"
FT                   /protein_id="CAK06055.1"
FT                   /translation="MKPAIIGLVGTLVLAGCNTVSYSGPGLEPIPGSITYSGQPRTKLT
FT                   KSPVGSAFPHDFIDQYGQQVEETYIIQPDRSLIIAHRRYKPIRFFGD"
FT   CDS_pept        608889..609269
FT                   /transl_table=11
FT                   /locus_tag="RL0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to codons 80 to the C-terminus of
FT                   Caulobacter crescentus hypothetical protein cc0298.
FT                   UniProt:Q9ABD1 (EMBL:AE005703) (197 aa) fasta scores:
FT                   E()=4.7e-10, 41.129% id in 124 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06056"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLU7"
FT                   /protein_id="CAK06056.1"
FT                   /translation="MRLNHLDFHVPDITATADFLIRHFGLKLKDMRGQNGLAILEDDTR
FT                   LEIVLSHAIAKFGTADQVEMGRKTYHIGFILPERADVDAVHAGLAAAGADLSGPPVAMR
FT                   GGWLFYCTAPGNILVESGWRPG"
FT   CDS_pept        complement(609477..611465)
FT                   /transl_table=11
FT                   /gene="mcpE"
FT                   /locus_tag="RL0564"
FT                   /product="probable MCP type chemoreceptor."
FT                   /db_xref="EnsemblGenomes-Gn:RL0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06057"
FT                   /db_xref="GOA:Q1MLU6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLU6"
FT                   /protein_id="CAK06057.1"
FT                   /translation="MLKHLKIRTKIISVVALLGLITMAGLIYVISEFRRADAAYSAFID
FT                   HEAQASMLSARASASAVASVLQVSLLADMKPDTAEFQKALAIPSKLPQARDRMKQALAL
FT                   VPSRKPAIDEIQAGIDEIEALANKIIEQSKAKDSAGAQANVALINAKLDALTPKMIANN
FT                   DAMMAMLNDGGDALSASVNGRIVFCFVLIGIAVLAAVGFSVVVAQKGIAGPMTQLRQRM
FT                   TRLAEGDTTSDVSGLDRGDEVGQMAKAVSVFRDNAIERARIEARAEADRDVSDSERRDR
FT                   EAQKAREASELDRAVTALGDGLRRLAAGDLASHIAEPFVAHLDALREDFNNSVEKLNET
FT                   LHTVGANARAIGAGANEIRSSADQLSQRTEQQSASVEETAAALEEITTTVRDAAKRAEE
FT                   ASQLVARTRLGAEKSGEVVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGV
FT                   EAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALISTSGSHVQTGVSLVGETGKALD
FT                   AIVHEVQEINQHVHAIAEASREQSIGLQEINTAVNTMDQGTQQNAAMVEESTAASHNLA
FT                   TEAAALNNLLGQFRLTGTGGFTTSAPIATTPRAAARPAARSPVRVAREGTARPAASPAR
FT                   ALGQKIANAFGAGSSTSPSQDPDWTEF"
FT   CDS_pept        612044..612919
FT                   /transl_table=11
FT                   /locus_tag="RL0565"
FT                   /product="putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06058"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLU5"
FT                   /protein_id="CAK06058.1"
FT                   /translation="MMQSKLASLTLKGFFTLGLFLGVLFSSFAASAQQAAPSLPLLFDA
FT                   RERLARPDLSSLVRLRFLTSVDFPPFNFTDQNGKLSGFDVDLAREICSELEISDKCQIQ
FT                   AIPFADLRDALAASQGDAVIAGLAVTPELRRQFLFSRPYLMLPARFVRNLGVPLDGKTA
FT                   AALSSHPVGVVRGTVHEAMLAAFFPTLKAEPFDTKDALLAALKDRKVDAAFADALQLSF
FT                   WVSSPASAKCCALFDGPYLSEHFLGEGMTIMLRQKDSVLTSAIDHALATLSRNGRLQEI
FT                   YLRYFPYGLY"
FT   CDS_pept        complement(612948..613361)
FT                   /transl_table=11
FT                   /locus_tag="RL0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06059"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLU4"
FT                   /protein_id="CAK06059.1"
FT                   /translation="MNKPLSAHDALIYVMVMASAVDSTMNDREMTRIGQLIGFLPVFRD
FT                   FDDDKLIAVARDCASLLAGPEGLDVVLETVRDTLPAKLYDTAYALAVEVASADLSVKAE
FT                   ELRLLSLLRDRLGLDKLTCAAIERSAIARFRKG"
FT   CDS_pept        complement(613464..614186)
FT                   /transl_table=11
FT                   /locus_tag="RL0567"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06060"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLU3"
FT                   /protein_id="CAK06060.1"
FT                   /translation="MRPAAFITGITGMAVVAGLLLAGEARLGGGTAGEEMASAEETATA
FT                   SADAAPEAGERATISDDRAEMIARSVEPTAPPSPGSGPVSGDGGAPKPTDAPQQAETPA
FT                   GQTASPAAKKPVELARPMVDNGGILSFGERRLQLAGIVPTPVDRICGPAGRQWPCGMMA
FT                   KTALRLLLRNRSVSCDLETVEWKETVTTACRLGTEDLGSWLAENGWAEPAAGSPLTAAA
FT                   EKARQAGKGLYGDDPRRN"
FT   CDS_pept        complement(614198..614875)
FT                   /transl_table=11
FT                   /locus_tag="RL0568"
FT                   /product="putative phage-related transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06061"
FT                   /db_xref="GOA:Q1MLU2"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLU2"
FT                   /protein_id="CAK06061.1"
FT                   /translation="MLSHNQIWEALDRLAERHELTPSGLARRAGLDPTSFNKSKRLSAD
FT                   GRLRWPSTESIAKVLDATGASMEQFLAFMRPDAGPSEQQARQQENAFQPQGGSIPLLGF
FT                   AQAGAGGFFDDGGFPAGQGWDVVEFPAAPSQKSGVYALEVQGESMMPLYRDGDVLIVEP
FT                   GAQVRRNDRVVVRTNEGEVMAKVLLRQSPRSIELLSLNPEHPNRTLELSDVDWIARIIW
FT                   ASQ"
FT   CDS_pept        complement(614997..615644)
FT                   /transl_table=11
FT                   /locus_tag="RL0569"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06062"
FT                   /db_xref="GOA:Q1MLU1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLU1"
FT                   /protein_id="CAK06062.1"
FT                   /translation="MQEHTIIIADDHPLFRDALRQAVIGMEGRQSIVEAGDFAAARRAA
FT                   GAHADADLMLLDLAMPGVSGFSGLMALRSEFASLPIVIVSATDDATTIRRALELGASGF
FT                   ISKSSGIEDIRRSIQTVLAGDIATPESYRDGQEQDPDVADLIHRLHTLTPQQSRVLTML
FT                   GEGLLNKQIAYELGVSEATIKAHVSAILLKLDVDSRTQAVIQLGKINMAMVA"
FT   CDS_pept        complement(615736..616134)
FT                   /transl_table=11
FT                   /locus_tag="RL0570"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLU0"
FT                   /protein_id="CAK06063.1"
FT                   /translation="MKAFVITLGVFLMPLAAAAVEPDASRFQLEKSGDHFVRLDRQTGA
FT                   MSICQDKEGALVCRMAADERAAYEDELDRLAKRVTALEQGGVIQRALPSDAEVDRSISI
FT                   MERMMKSFMGMVKEFQAEENTNPLPQKT"
FT   CDS_pept        616353..616772
FT                   /transl_table=11
FT                   /locus_tag="RL0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to codons 105 to the C-terminus of
FT                   Agrobacterium tumefaciens (strain C58/ATCC 33970)
FT                   hypothetical protein atu0485. UniProt:Q8UI15
FT                   (EMBL:AE009018) (244 aa) fasta scores: E()=4.3e-28, 61.429%
FT                   id in 140 aa, and similar, but extended at the N-terminus
FT                   to Rhizobium meliloti (Sinorhizobium meliloti) hypothetical
FT                   protein smc02246. UniProt:Q92S76 (EMBL:SME591784) (115 aa)
FT                   fasta scores: E()=3.8e-27, 66.957% id in 115 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06064"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLT9"
FT                   /protein_id="CAK06064.1"
FT                   /translation="MDIAASFRQSPRDQGTAYREAMMTLTPTLYKIVTETLWQQARQTG
FT                   TFHGAGIDLKDGFIHFSTADQVKQTAALHFAGQSGLLLIAVDGSGLSDKLVFEPSRGGD
FT                   LFPHLYADLPLAAVLWEALLPLDETGAHVFPELQP"
FT   CDS_pept        616769..617857
FT                   /transl_table=11
FT                   /locus_tag="RL0572"
FT                   /product="putative dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RL0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06065"
FT                   /db_xref="GOA:Q1MLT8"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLT8"
FT                   /protein_id="CAK06065.1"
FT                   /translation="MIDPFKRLARKGLFLFDPETAHGMSIAALKSGLVPACQLTPDPRL
FT                   RQTVAGLTFENPLGMAAGYDKNAEVPEALLKLGFGFTEIGTVTPKPQSGNPRPRIFRLV
FT                   EDEGVINRLGFNNEGHDAAFGRLAALRGGGMIGVNIGANKDSEDRIADYVAGIRRFYSV
FT                   ARYFTANISSPNTPGLRDLQGRESLAVLLSAVLAARDEMGAASGRKIPVFLKIAPDLTE
FT                   EGMDDIAAEALSHALDGLIVSNTTLSRDGLKDQRQAKETGGLSGVPLFEKSTAVLARMR
FT                   KRVGPDLPIIGVGGVSSAETALEKIRAGADLVQLYSCMVYEGPGLAGDVVRGLSKLLDR
FT                   EKAASIRELRDTRVDYWAARKV"
FT   CDS_pept        complement(617833..619179)
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="RL0573"
FT                   /product="putative transmembrane DNA-damage inducible
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06066"
FT                   /db_xref="GOA:Q1MLT7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLT7"
FT                   /protein_id="CAK06066.1"
FT                   /translation="MDTRSNHNALAFDVTHLMVLSIAIPMTLGFMTTPLLGLTNTAVVG
FT                   RMGNAEALAGLAIGAMLFDLILGSFNFLRASTTGLTAQAYGRHDQHEQQAVFSRAMISA
FT                   LGCGLALLCLSPLLMAAGLRLMGAEGAIAEATSTYFSIRMLAAPAALANYAILGFVLGR
FT                   GQGNIGLLLQAIINGINILLSIYLGLTLDWGVAGVAWGTMAGETVGALAGLFIVLSGFG
FT                   KASRPAWSEVFSRHRLAELFALNRDILIRTFVLIGAFTIMTRIGTSFGAVTLAANAVVM
FT                   NFFLLSGYYLDGLANAAEQIIGRAIGAHYRPAFDRGLKLTTLWSFGLAALGSAFFFLAG
FT                   PWLISVLTTSPEVRQAAETYLPWAAVTGPTGALAFLMDGVFIGATWSADMRNRMLISFA
FT                   GYLLMLAVFVPLFGNHGLWLAMNAFLLFRGFFLAMLVKRRADQTFRAAQ"
FT   CDS_pept        complement(619265..619762)
FT                   /transl_table=11
FT                   /locus_tag="RL0574"
FT                   /product="conserved hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06067"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLT6"
FT                   /protein_id="CAK06067.1"
FT                   /translation="MTSIDLSRRGLLRLSGLALAAGIAGCTTTPRMAGTPSDGEDETAS
FT                   VLPLVNQLRAKHGLPALAVDPAASTAALFQAKRMASAGKMAHLMGMTDSFGARVKASGV
FT                   RLPAAENIAAGQQSVDAVVTAWINSPHHLENMLGRYGGLGVAVAHNTSSRNLPYWAMVL
FT                   SS"
FT   CDS_pept        complement(619764..620081)
FT                   /transl_table=11
FT                   /locus_tag="RL0575"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06068"
FT                   /db_xref="GOA:Q1MLT5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLT5"
FT                   /protein_id="CAK06068.1"
FT                   /translation="MRAARRDLIPRANRRWLMSDQANRFLGDSIGRTLIKLIVVSLIVG
FT                   FVMTVFGLTPWSIIDGVRDFILEIWHRGFSALGRVGDYLILGATIVIPLFVILRLFSYR
FT                   R"
FT   CDS_pept        620232..621164
FT                   /transl_table=11
FT                   /locus_tag="RL0576"
FT                   /product="putative TPR repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06069"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLT4"
FT                   /protein_id="CAK06069.1"
FT                   /translation="MQPHQLSSGDVIADRRADYARMLEEGGEPEAAAELMEQALELVPA
FT                   WAAGWYRLATYLEKAGRGEAAIEAYRRTLTLDPDDIFGAALKLALLGDAATPDLPPSRY
FT                   VERLFDDYADRFESALVEKLDYSVPQKLAALIASTGRRYELAVDLGCGTGLLGPEIRAN
FT                   VGRLEGFDLSQNMLAKAAEKHVYDGLAQADLSLAPDLSGVFADAGRHRADLVTAADVLM
FT                   YLGNLESVFAIVGELAASGADIAFSVEDAGEGDGFHLAPSLRYAHSESYVRMLLARHGL
FT                   EILKTVKSVIRKDGGKPVSGILFLTRKPA"
FT   CDS_pept        621346..622011
FT                   /transl_table=11
FT                   /locus_tag="RL0577"
FT                   /product="putative transmembrane protein"
FT                   /note="Possible alternative start site at codon 11"
FT                   /db_xref="EnsemblGenomes-Gn:RL0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06070"
FT                   /db_xref="GOA:Q1MLT3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLT3"
FT                   /protein_id="CAK06070.1"
FT                   /translation="MNSSAVETGDMTQLINALGFWNTTATRHTPIEDVQGIFSGSLVAA
FT                   LGLYVLASAGLLTGSTAGVAFLLHYAFGVNFGLAFFLLNLPFFYLSWKRLGIAFTIKTF
FT                   IAIGLTSVLADVQSRFLSISSIHPAWAALLGGLLLGFGLLALYRHRASLGGVGILGIYL
FT                   QERFGIRAGLVQLVIDMCVLAAAFFVTTPPVVFYSVLGAVVLNLFVAINHRADRYIAL"
FT   CDS_pept        complement(622606..623007)
FT                   /transl_table=11
FT                   /locus_tag="RL0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06071"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLT2"
FT                   /protein_id="CAK06071.1"
FT                   /translation="MRGPKPKTTARARSLRQSDNDAEDRLWNELRDRRLNGNKFVRQLP
FT                   IGPYFADFACRELRLVIEIDGSQHAESRRDGIRDVFMTGDGWSVVRFWNVDVLTALPSV
FT                   LDTILAICDGRLVERVEVADLRFFPAARD"
FT   CDS_pept        complement(623079..623540)
FT                   /transl_table=11
FT                   /locus_tag="RL0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06072"
FT                   /db_xref="GOA:Q1MLT1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLT1"
FT                   /protein_id="CAK06072.1"
FT                   /translation="MQPRFNFAKAAPDAYKAVAALEQYVQSSGLERRFIHLIKLRASQI
FT                   NGCAYCVDMHVKEARHDGLSEQWINLMCVWRESPVYDARERALLGWVDSVTNIAKTGAP
FT                   DADYETLKAHFSEEEMTKITVAIGAINIWNRLAVGFRSQHPLDAAQKAA"
FT   CDS_pept        complement(623563..624063)
FT                   /transl_table=11
FT                   /locus_tag="RL0580"
FT                   /product="putative Rrf2 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06073"
FT                   /db_xref="GOA:Q1MLT0"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLT0"
FT                   /protein_id="CAK06073.1"
FT                   /translation="MKMGDGVEQAIHSVAMLSGLSEGGVLSAAALAEFHGVSTSYLLKH
FT                   LQALSGAGILDTVPGPKGGYRLAKAPKEISLLDIVLAVEGSAPAFRCAEIRQRGPNPVS
FT                   DRLFAQPCTINAAMLKAERVYRAELAKTSLADIGIELAAVDDGSIAARGCAFLEIHERK
FT                   TAR"
FT   CDS_pept        624197..624829
FT                   /transl_table=11
FT                   /locus_tag="RL0581"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06074"
FT                   /db_xref="GOA:Q1MLS9"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLS9"
FT                   /protein_id="CAK06074.1"
FT                   /translation="MASNAFAGLLNSSADRHSLFDDAQGIVAGSMLAVLGVTLLSGAGL
FT                   LAGGTAGLAFLAHYATGFSFGLCFFAVNLPFYYLAFRRLGAAFTIKTFAAIALTSVLSE
FT                   FVSGFISMAHVDPIAGALFGGLVIGAGMLALFRHRASLGGIGILALYIQDRFGWRAGFV
FT                   QLGFDGIILALSFFVASPFIIACSVLGAIVLNLTIAINHRKDRYIAM"
FT   CDS_pept        624981..627491
FT                   /transl_table=11
FT                   /locus_tag="RL0582"
FT                   /product="putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06075"
FT                   /db_xref="GOA:Q1MLS8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLS8"
FT                   /protein_id="CAK06075.1"
FT                   /translation="MDQIDSEARTLLPAAFTRWFAEKGWRPRAHQLELLARTDAGESTL
FT                   LIAPTGAGKTLAGFLPSLTDLTRRGRIPPGSAFTGIHTLYVSPLKALAIDIERNLTKPV
FT                   EEMGLPVTVENRTGDTPNAKRQRQKLNPPDILLTTPEQVALLLANREAERFFKDLKYVV
FT                   LDELHSLVTSKRGHMLSLGLARLRRLAPGLQTIGLSATVAEPMDLQKWLVGQEEGSEHH
FT                   AGLVVVEGGAKPDISILSTEERIPWSGHSARYAIPDVYNKLVEHRTTLLFVNTRSQAEM
FT                   LFQALWTINDDNLPIALHHGSLDVAQRRKVEAAMAENRLRAVVATSTLDLGIDWGDVDL
FT                   VIHVGAPKGASRLAQRIGRANHRMDEPSKAILVPANRFEVMECQAALDANYIGAQDTPP
FT                   VGRGALDVLAQHVLGMACAEPFDMLELYDEIISASPYADLSWETFERIVDFVATGGYAL
FT                   RTYERYARIRKTAEGRWRVSNPAVAQQYRLNLGTIVESPMLNIRMVKRGEGGRIGRGGA
FT                   TLGKVEEYFLEQMSPGDTFVFSGKVLRFEGIRENECLASQAFSLDPKIPSYNGGKFPLS
FT                   TYLAEQVRAMIADPDRWRRLPDQVRDWLSLQNDKSMLPKRDEFLIETFPRGSRGYMVAY
FT                   PFEGRLAHQTLGMLLTRRLERIGTKPLGFVATDYSLAIWGLEDMGLMIRNGRLSLSDLF
FT                   DEDMLGDDLEAWLDESFLLKRTFRNCAVIAGLIERRHPGKEKSGRQITVSADLIYDVLR
FT                   SHEPDHILLQATRQDAATGLLDIGRLGDMLRRIRGHITHRALDHISPLAVPVMLEIGRE
FT                   AVPGEAHDALLAEAADDLIAEALA"
FT   CDS_pept        627513..628241
FT                   /transl_table=11
FT                   /locus_tag="RL0583"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06076"
FT                   /db_xref="GOA:Q1MLS7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLS7"
FT                   /protein_id="CAK06076.1"
FT                   /translation="MMNRLALARDISGLAATSGVETAVHGIAAVCDPLGALYLPDAGLL
FT                   VVSDLHLEKGAAFARRGMMLPPYDTLATLTVLAAVISRYDPKLVISLGDNFHDRIGSKH
FT                   LPENFRALIVEMARGREWIWINGNHDPDGIVDLPGTSADEMHYAGLTFRHEPKNGLQIG
FT                   EIAGHLHPSATVRRREKSVRRPCFATDGARLLMPAFGLMSGGLDLGHQAMKGLFDKALL
FT                   VAHLLGRDRIYSVRYGNLWG"
FT   CDS_pept        complement(628274..628855)
FT                   /transl_table=11
FT                   /locus_tag="RL0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06077"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLS6"
FT                   /protein_id="CAK06077.1"
FT                   /translation="MRTRIVLTAVGLALLAGCATAPKQTRNICAVFDERDGLFSSWQSA
FT                   AERTEKKYGVPVPILMATMYTESGFQPYARPPRTKLFGFIPWTRPSTAYGYSQALDGTW
FT                   DHYQSQTGNWTARRANFADAIDFIGWYHYQNSVETGIPLNDAYNLYLAYYSGPTGYKRG
FT                   DWRSNGQLQQTAQKFARMAGTYQRQLQECD"
FT   CDS_pept        complement(628999..629556)
FT                   /transl_table=11
FT                   /locus_tag="RL0585"
FT                   /product="putative RibD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06078"
FT                   /db_xref="GOA:Q1MLS5"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLS5"
FT                   /protein_id="CAK06078.1"
FT                   /translation="MRKLIVWNLMTLDGYFEGTKPWDIDFHNFAWGPELQRYAEQFGRE
FT                   SDLLVFGRKTYEGMAAYWPTAEGEGEIKAYMNSIAKIAVSRTMSEPGWNNARVVSDPIP
FT                   ELTRLKQEDGKAILIFGSAELADSLLKAGLIDEIRVCLVPVILGGGNPLFKPAESQMPL
FT                   KLIESSTTEGGAMILRYEPVKA"
FT   CDS_pept        complement(629758..630561)
FT                   /transl_table=11
FT                   /locus_tag="RL0586"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06079"
FT                   /db_xref="GOA:Q1MLS4"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLS4"
FT                   /protein_id="CAK06079.1"
FT                   /translation="MIRLAAAVIALLCLLPASAGAQWLPGQATEAVREGLEIGTSTSEI
FT                   AITSDFHGADLTIFGALSNTDQLLLAIGQYDVVVVLEGPREDATVRRKERVFGIWVNTR
FT                   SMTFEAVPHSYSMSSSRMIDDLTTPLELTDQGIGIDHIPLTPVGFVGDGSNLGEFRDAF
FT                   RRLQQGGGLYDRNPSGVRFVSSNLFKASLRLPANIPNGVHTVRAYLFKSGLFVTEKSLP
FT                   LRVIKTGIEQTITDAAHEQPILYGFAAVLLAVITGWGASLIFRKD"
FT   CDS_pept        complement(630558..631481)
FT                   /transl_table=11
FT                   /locus_tag="RL0587"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06080"
FT                   /db_xref="GOA:Q1MLS3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLS3"
FT                   /protein_id="CAK06080.1"
FT                   /translation="MTIYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSISGAITHFRRGSLDVKLGTVLLVGGLAGATVGIWIFSLL
FT                   RAIGQLDLIISLMYVIFLGTVGGLMLLESVNAMRRAARNEPPAPRKPGHQHWVHKLPLK
FT                   VRFKKSKIFLSVIPIVALGFAIGILTSIMGVGGGFIMVPAMIYLLRIPTNVVVGTSLFQ
FT                   IIFVTAYTTIVQAATNFSVDIVLAFILMVAGVIGAQYGVRVGQKLRGEQLRALLGLLVL
FT                   AVGVRLAIALVVTPADVYSVVMGAGN"
FT   CDS_pept        complement(631794..635597)
FT                   /transl_table=11
FT                   /locus_tag="RL0588"
FT                   /product="putative peptidoglycan binding protein"
FT                   /note="Codons 190 to the C-terminus are similar to entire
FT                   protein of Caulobacter crescentus PodJ localization factor
FT                   PodJL (polar organelle development protein) [contains:
FT                   localization factor PodJS]. UniProt:PODJ_CAUCR
FT                   (EMBL:AE005877) (974 aa) fasta scores: E()=9.1e-13, 26.182%
FT                   id in 1100 aa, and to Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970) hypothetical protein atu0499.
FT                   UniProt:Q8UI01 (EMBL:AE009019) (1248 aa) fasta scores:
FT                   E()=3.3e-66, 51.722% id in 1307 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06081"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLS2"
FT                   /protein_id="CAK06081.1"
FT                   /translation="MNGSRSNPSRQSDRTSLDALNRTIEGLEARIEGLMGSGREQRPRT
FT                   ATAERDPYAASHAPRPAKAPPEPRPDPLAEIRQRQRALEAGRERPYAREQAPQLRESAP
FT                   RAAAPVLAPALRAGDDTMTEIAQALVNLRQDLKRDISEGVTREMNALRTELREIKTNAG
FT                   DGRFADDMRADMGRLAQSITQLTGRSAAPEATGLREDFEELRSLMDGLAREDSLRHMEN
FT                   RWDGFENRLAALDTEGLQEELVSLAYRLDDIKRHIGGMGESPAVRALEDKLISIATAME
FT                   HFGNMIQPHDRVMSEQFAAMDMRLDEISRAIAASGRTATANDPGLMQRLESRLAALADQ
FT                   IDLMSHDAASRVNPADELAMRLEALTGRVEELTKAEATSRLDERLEHLSYLLERTQETA
FT                   PQADLTGTLSDISRKIDALENGAVNDALAQRLDHLARRIDEMAYQQQAPAAVVDDSAFL
FT                   RLEGRLSDIAARLEESTSAAPTDPHALKNLEDQIAHLSALMSAPRESAVIPPELDQRMG
FT                   AIEDYMATSDEYIIEAARQAAEAVVEAYSRHGGPQGVMPAADMSALTALAEDLRHLEDL
FT                   SRDSEERTHKTFQALHETLVHIADRLDGMGDRGRPAAQMPIADVDFDVDPYALMVAEAD
FT                   MNRTPAAAPTAKASPVIRTAEVAAEAAAPAQATAPAQTNAMSGTSAIAIEAATRTTETA
FT                   ATSAGTRAPAKASLLANLGKRLLPAKKAESRTTERPMIDPAPSIDPTDVVPTDAANELL
FT                   EPGSGAPDVKKILERVRASQSAARGKPAGETDRADYIAAARRAAQAAAMEVDANPKQAA
FT                   GKAEKKGANADKAGKASDKTGKTSAFSRYRRPILLAVGAVLLAIMAFPLARTLTTGERA
FT                   PQPPAEVSALTGAENPAPALPDATPAQPDAAALGTTAPAADATPPVAEQAQPEATPPDA
FT                   GEHLTDVTPLDGEGAATLAPPGPSGAAQETSGFVPNAPAAAAPAPAITVPDTVQPKSLA
FT                   DAASGGDALALFEIGARYSDGRNGMTVDQKQAASWYQLAADKGFAPAEYRLGSMYEKGN
FT                   GVERDIAKAKGFYEQAANQGNASAMHNLAVLYASGALGQQDYATAASWFTKAANLGITD
FT                   SQFNLAILCARGNGVPADLEESYKWFAIAAKGGDKDAAQKRDEVAKAMKPDQLERARAK
FT                   ADLWKAEPVDHRTNAIDIPDEWAGTGAKTASVDMKKAIRNIQAILNNNGFDAGVPDGEM
FT                   GAKTVTAIKNFQKSVGQEPDGKVTDATVKALLERNKQGSKAI"
FT   CDS_pept        complement(635925..636290)
FT                   /transl_table=11
FT                   /locus_tag="RL0589"
FT                   /product="conserved hypothetical protien"
FT                   /db_xref="EnsemblGenomes-Gn:RL0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06082"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLS1"
FT                   /protein_id="CAK06082.1"
FT                   /translation="MPRLDHVTIETRDAPQMIAFLETVLGVSEGYRPPFATPGHWLYLD
FT                   ERPVIHLSLTSRNTDFPPGIFNHVAFSLYEFGPALERIKAGGYRYEYYDIPDTDLGQVF
FT                   VYGPEGVKIELQYPRPA"
FT   CDS_pept        complement(636506..637207)
FT                   /transl_table=11
FT                   /locus_tag="RL0590"
FT                   /product="putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06083"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLS0"
FT                   /protein_id="CAK06083.1"
FT                   /translation="MIDFPYESALIVGAGSGISASLARQLSAQGVKVGLAARNIEKLQG
FT                   LIEETGASAFTADVSQPASVAALFEAAAAAIGGPDVVIFNASARQRGPLAELDPAEVEK
FT                   AIATTAFGGFLVVQQAARRMIPRGRGAILMTGASASVKGFAQSAPFAMGKFALRGLAQS
FT                   AARELGPMGIHVAHFVIDGAVRSQIRPDRVDKPDGTLLPDAIAQTYIDVLRQHRSAWSL
FT                   EVEVRPWTESF"
FT   CDS_pept        637480..639276
FT                   /transl_table=11
FT                   /locus_tag="RL0591"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="Codons 88 to 460 are similar to codons 220 to the
FT                   C-terminus of Methylobacterium extorquens Ibd2
FT                   isobutyryl-CoA dehydrogenase. UniProt:Q8RM51
FT                   (EMBL:AY054980) (562 aa) fasta scores: E()=4.2e-15, 29.600%
FT                   id in 375 aa, and to entire protein of Rhizobium meliloti
FT                   (Sinorhizobium meliloti) putative acyl-CoA dehydrogenase
FT                   protein (ec 1.3.99.-). UniProt:Q92S86 (EMBL:SME591784) (598
FT                   aa) fasta scores: E()=8.8e-207, 83.779% id in 598 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06084"
FT                   /db_xref="GOA:Q1MLR9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLR9"
FT                   /protein_id="CAK06084.1"
FT                   /translation="MPVYKAPVNDTLFVLNDVLGLERYNNLPGFADATPDMIEAILGEA
FT                   GRVAEEALFPLNYSGDQEGCARHDDASVSTPKGFKEAYKAYREGGWIGLAVPEEFGGQG
FT                   LPYTLHTAVGEYTSAANMSLMMYPGLTQGAIAALLVHGSDEQKATYLPKMVDGTWSGTM
FT                   NLTEPHCGTDLGMLRTKAVPQADGSYKISGQKIFISAGEHDLTDNIIHLVLARIEGAPD
FT                   GTKGISLFIVPKFLVGKDGAPGARNAVSCGAIEHKMGIHANATCVMNYDEATGFLIGAE
FT                   NRGLNAMFVMMNEARLMVGLQGIAISEIAYQNAASYARDRIQGRSLSGPKAPDKKADPI
FT                   IVHPDIRRTLMTIRAFNEAGRAFLLWTALKSDIAHRAADEKERQTADDILGLVTPILKG
FT                   VMTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARIAMIYEGANGIQALDLVGRKLAL
FT                   NGGRAAMALFKEIGDFCEENRSNEKLSFFTKHLKKGLNDVQGATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGLVILGYMWAKMAKAAEDGLASGDAAREDYLKNKLVTARFFMERLMPET
FT                   ALRKARIEAGADTMMELAAEAF"
FT   CDS_pept        639418..640626
FT                   /transl_table=11
FT                   /locus_tag="RL0592"
FT                   /product="putative thiolase"
FT                   /product="probable beta-ketoadipyl coa thiolase (ec
FT                   2.3.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:RL0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06085"
FT                   /db_xref="GOA:Q1MLR8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLR8"
FT                   /protein_id="CAK06085.1"
FT                   /translation="MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGL
FT                   DTGTVDDIIMGCVDPVMDAGAVIPKAAAFEAGYSTKAPGMQISRFCASGLDAVNFGAGK
FT                   IAQGADDIVIAGGVESMSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSR
FT                   TDVDAYAVESQKRAAHAWEKGWFDKSVVPVKDQNGLTILAKDEHMRPGTDMQALASLNP
FT                   SFQMPGEMGGFEAVGIQAHPEIERINYVHHAGNSSGIVDGASVVLLGSKAGGESMGKRP
FT                   RARIKAFANIGSDPALMLTGPVDVTEKLLKRSGMSLADIDLFELNEAFAAVVLRYMQAF
FT                   DIDHHRINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVI
FT                   ERV"
FT   CDS_pept        640629..641012
FT                   /transl_table=11
FT                   /locus_tag="RL0593"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06086"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLR7"
FT                   /protein_id="CAK06086.1"
FT                   /translation="MGFNTGTIETEYAEVTEHWSPRVIADLNGQSVKLAKVQGQLAWHS
FT                   HRDEDELFLIWKGSLTIEYRDRPHVHLKAGDFHVVPRGVEHNPIAEEECWIVLFEPSQT
FT                   KHTGDVVTEKTKTLDAQRSHLPA"
FT   CDS_pept        641029..643242
FT                   /transl_table=11
FT                   /locus_tag="RL0594"
FT                   /product="putative fatty oxidation complex subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RL0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06087"
FT                   /db_xref="GOA:Q1MLR6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLR6"
FT                   /protein_id="CAK06087.1"
FT                   /translation="MTYTNFTLETDADGIALVTWDMPGKSMNVFTAEVMAELDAIIDAT
FT                   TADAAVKGVVFTSGKSSFSGGADLSMIKSMFSSYQEEKAKSPETAVQALFGLVGRMSGL
FT                   FRKLETSGKPWVSAINGTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGGT
FT                   QRVPRLANAQDALQMMTTGQSLTGSRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAP
FT                   WDEKGFKAPGGGIWTPASAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGL
FT                   KIEQRYFTEVLQTREAFSMIRSLFISMQELGKGARRPAGHAKTELKHIGVVGAGFMGAS
FT                   IAYVTAAAGIPVTLIDRDIEAATKGKTVSEGLVKDSVGKGRLTQDEAAALLSRITPSAD
FT                   YADLANADLVIEAVFEDREVKKAVIEAVEAVLPEGAVFASNTSTLPISGLARNSQRPAD
FT                   FIGIHFFSPVEKMMLTEVILGSDTGDRALAVALDYVAAIKKTPIVVNDTRGFFVNRCVL
FT                   RYMSESYDMLIEGVPPVMIENAAKMAGMPVGPLALNDEVAIDLSLKILKATVADLGEKA
FT                   IDPRHMELISRMVEKEGRFGRKNSKGFYDYPPKPAKKSLWPDLKTFYPQKQADEVDVNV
FT                   LKQRFLVTIALEAARTVEEGIVTDPREADVGSILGFGFAPYTGGALSYIDGMGAKAFAE
FT                   LAEKLAAAYGNHFKPTPLLKDMAAKGETFYGRFDPYAKLGKAA"
FT   CDS_pept        643507..643716
FT                   /transl_table=11
FT                   /gene="cspA1"
FT                   /locus_tag="RL0595"
FT                   /product="putative cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06088"
FT                   /db_xref="GOA:Q1MLR5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLR5"
FT                   /protein_id="CAK06088.1"
FT                   /translation="MSTGTVKWFNATKGFGFIQPDDGAADVFVHISAVERAGMRDLKDG
FT                   QKLSYELVRDNKSGKMSADRLQAA"
FT   CDS_pept        complement(643907..644410)
FT                   /transl_table=11
FT                   /locus_tag="RL0596"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06089"
FT                   /db_xref="GOA:Q1MLR4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLR4"
FT                   /protein_id="CAK06089.1"
FT                   /translation="MMDEIQNRQHVVKQNRPERTIEGDAFSAFAITALRLAGHLTAAGD
FT                   RLAKPAGQTSARWQVLAAARRGGMSVAQIARALGLARQGVQRLADVLESEGLIAYADNP
FT                   QHQRAKLVRLTEEGAARLGVIEVAQAGWADGLGAAFTSAELDAARSVMARVMEMLEGNE
FT                   AAGG"
FT   CDS_pept        644466..644870
FT                   /transl_table=11
FT                   /locus_tag="RL0597"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06090"
FT                   /db_xref="GOA:Q1MLR3"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLR3"
FT                   /protein_id="CAK06090.1"
FT                   /translation="MKKTYKGSCHCGKVHYEVDMDLEEGTGRCNCSICAKRRYWGANVK
FT                   PEDFRLMCDQAETSDYQFNTMSGHHRFCRTCGVPAYGDGYVEAIGGAYVSINIACLDDI
FT                   TPEELAALPVRYADGRHDAWWNEPAVTSYL"
FT   CDS_pept        644964..645407
FT                   /transl_table=11
FT                   /locus_tag="RL0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06091"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLR2"
FT                   /protein_id="CAK06091.1"
FT                   /translation="MKDEANARIEEEAIIAMLMMRAKALGEKNASDALSYEAEDSVEFS
FT                   LAPPLVYHGQDEAGLQAWFDTWEGPIGGEVRDARLTVGDDVAFWSGLMRMTGTKTDGAA
FT                   VDLWFRQTLGLVKQDGRWLVAHQHASVPFAMDGSGRALLDLKP"
FT   CDS_pept        complement(645417..646619)
FT                   /transl_table=11
FT                   /locus_tag="RL0599"
FT                   /product="putative transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06092"
FT                   /db_xref="GOA:Q1MLR1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLR1"
FT                   /protein_id="CAK06092.1"
FT                   /translation="MFAAAKSTENSPRPSIGFHALTLATFFGASAAPTPLYRIYQENFS
FT                   VSPVLITVIFAVYAFALLAALLTAGSISDHLGRKPVIFFALVLEIVAMALFVVASGPGW
FT                   LIAARIVQGLATGIAGASLGAALVDVDRAKGQIVNSIAPLCGMAVGAVGTSALIQYGPF
FT                   PMHLVYALLLLAFTLQAAAIWLTGETGGTRPGALGSLIPRVTVPKQVKRPLSLVTPINI
FT                   ANWTLAGFYLSLVPSLVATTTGSRAPLTGGAVVTALMVSGAIAVYLRRSKTASANLAFG
FT                   VSAKTLGILTVVAGVHLANVPLLLVGTIFTGVGFGTNFLGSIGTIMPLAKADERAGLLS
FT                   AFYVQSYLAFSLPAILAGFLAKSAGYALTTDIYATAILLLMGVGLMSIRADRRRVAESA
FT                   A"
FT   CDS_pept        646728..647315
FT                   /transl_table=11
FT                   /locus_tag="RL0600"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06093"
FT                   /db_xref="GOA:Q1MLR0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLR0"
FT                   /protein_id="CAK06093.1"
FT                   /translation="MSKGESRVAGMTAKENLRPGGRSARVQASVHKAVRELMAEMSRAD
FT                   VTIPLIAGKAGVTPSTIYRRWGDLQELLADVAVDRLRPDMQPIDAGSGKADLETWAEQY
FT                   AEEMSSGPGREMIRDVLAAQAGANACKCSEYTRQQIDVIAERARARGETFPDVERVMDQ
FT                   VVAPIMYRILFGDVPATKRVRDLVARVISTTD"
FT   CDS_pept        complement(647427..650948)
FT                   /transl_table=11
FT                   /locus_tag="RL0601"
FT                   /product="putative transmembrane two-component sensor
FT                   kinase/regulator hybrid"
FT                   /db_xref="EnsemblGenomes-Gn:RL0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06094"
FT                   /db_xref="GOA:Q1MLQ9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLQ9"
FT                   /protein_id="CAK06094.1"
FT                   /translation="MLPGWVIFASAFGYLLLLFAVASYGDRKNRGQGTLEGGPGTLGGW
FT                   PVVYALSLAIYCTSWTYFGSVGLAAQRGLEFAGIYIGPILVFTLGMPLLRRIIELAKAE
FT                   KLTSVADFVAARYGKNPTVATIVALISLIGAIPYIALQLKAISSTVSAMVNPSDYGIGS
FT                   GNLYFLDLPLAATLVLACFAIMFGTRHTDATEHQDGLILAVSMESVVKLVAFLTAGVCV
FT                   IWFLFDGPTDLWRKTVDNELVMSALSYHTPISRWITLIVLSAFAIILLPRQFHVTVVEN
FT                   RTPKQLKLAGFLFPTYLIAINLFVLPVAIGGLLTFGGTGNADFYMLSLPLAGQMPVISL
FT                   IIFIGGFSAATAMVIVDSVALSIMVSNDIIMPIFLRRKLAGRAGQRDNFAKTLLNIRRS
FT                   AIFAVLLFGYAYYRSTDSTAGLASIGLLSFAAIAQIAPALFGGLIWRRANARGAILGLT
FT                   SGFVIWIYLLFLPSLGGPDYSYVASAVLGFIFPGTTLFTAPDADPLVNATAMSLLVNSA
FT                   FFVVGSLTRNAKPLERIQAGIFVKRHSRSQFATRGWKTRISVGDLKAAISRYLGEERMQ
FT                   RSLTTYEQSSGRKLEDEQPADMALIHFSEQLLGSAIGSSSARLVLSLILQKIEDASSDT
FT                   AWLLDQASEALQYNQDMLQTALSQMDQGIAVFDSSNRLTIWNRRFRQLLDLPENAGQVG
FT                   FPLSEIVTTLSQRGDIAPGDLSQTVRHFLTLDKPFSLVLGGGERIIEVRSNAMPDKGIV
FT                   ATFTDITQRVSADKALKQANETLEQRVAERTAELTRVNRELGEARAAADEANIGKTRFF
FT                   AAAGHDILQPLNAARLYSSALVERMAQSDNAPIVRNIDSALESVETILGAVLDISRLDT
FT                   GAMRPRLASVALSDLLERIQTDFAPIAREKQLKLVVMPTSLRVRSDPNLLRRLVQNLVS
FT                   NAIKYTITGKVLVGARRRGNQVIIQVIDSGIGIPPSKFRTVFKEFARLDEGAKTASGLG
FT                   LGLSIVDRIARVLNHPVELQSTHGKGTEFRIAMPLDISRPAAAAAAVTPADRPGQPLSG
FT                   LKILCIDNEPKILEGMKLLISGWGCEVEALNCLAEVNAVDGEEGPPDIVIADYHLGDGT
FT                   GIAAILHLRRRFGADIPALLITADRTPEVRSEAERHGIAVQHKPVRPAALRAYITQISG
FT                   IKRAAAE"
FT   CDS_pept        651171..651608
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="RL0602"
FT                   /product="putative transmembrane mechanosensitive ion
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:RL0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06095"
FT                   /db_xref="GOA:Q1MLQ8"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLQ8"
FT                   /protein_id="CAK06095.1"
FT                   /translation="MLNEFKAFIARGNVMDLAVGVIIGGAFGGIVKSLVDDLIMPIVGA
FT                   IFGGFDFSNYFLPLSAAVNAQSLAAAREQGAVFAYGSFLTVLINFLILAWIIFLMVKGV
FT                   NTMRAQIERQEKAAPEELPPPPADVQLLTEIRDLLARRPTA"
FT   CDS_pept        651731..652897
FT                   /transl_table=11
FT                   /locus_tag="RL0603"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06096"
FT                   /db_xref="GOA:Q1MLQ7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLQ7"
FT                   /protein_id="CAK06096.1"
FT                   /translation="MSIVSSISPRALAAPESGIVELVNYARGREGLLPLWVGEGDLPTP
FT                   DFISRAAMDALAAGETFYTWQRGIPELRQALSDYYDRHFGIRLPVEHFYVTGSGMQAIQ
FT                   IAVQALTSPGDELVYLSPSWPNIAAALEISGARSVGVELQFAGGKWAVDLNRIEAAITP
FT                   KTKGIFINTPSNPTGWTATKQDLGDILALARKHDLWIMADEIYARYSFAGGRAPSFLDV
FT                   MDEGDKIIFVNSFSKNWSMTGWRVGWIVAPPEMGQVLENLIQYSTSGVAQFMQKGAVAA
FT                   LDQGDDFVAANIAKAARSRDILCDALVATNRVETLKPDGAIYAFLKIDGVTESRRAALD
FT                   IVDKTGVGLAPGTAFGQGGELFLRACFLRDPTQVAVAAERLCDYILKL"
FT   CDS_pept        653236..654309
FT                   /transl_table=11
FT                   /locus_tag="RL0604"
FT                   /product="putative UDP-glucose 4-epimerase (UDP-galactose
FT                   4-epimerase) (Galactowaldenase)"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:RL0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06097"
FT                   /db_xref="GOA:Q1MLQ6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLQ6"
FT                   /protein_id="CAK06097.1"
FT                   /translation="MPLLVKTKAGMRDMAVLVTGGAGYIGSHMVWALLDAGEDVVVLDR
FT                   LSTGFRWAVAPAARFYLGDVADPDILKKVFIENDIEAIIHFAGSAVVPVSVADPLSYYD
FT                   NNSGKTRALLSASVKAGIRNFVFSSTAAVYGQQKTDLPVKETAPLNPENPYGQSKLMTE
FT                   FMLRDAAAAYDFNYVALRYFNVAGADPHHRAGQSTSGATHLIKVACEAALGTRDSVNVY
FT                   GIDYPTHDGTGVRDYIHVSDLTDAHLKALQHLRRGKGSLVANCGYGSGYSVLDVLNMVT
FT                   RLHGHSFKIHMAPRRAGDSASVVADASLARQVLDWKPRYDSLETIVQSSLDWELFLSNK
FT                   NVDDLHSIHRALAAASF"
FT   CDS_pept        654416..656377
FT                   /transl_table=11
FT                   /locus_tag="RL0605"
FT                   /product="putative GGDEF sensory box family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06098"
FT                   /db_xref="GOA:Q1MLQ5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLQ5"
FT                   /protein_id="CAK06098.1"
FT                   /translation="MKNFLASLQLQKDNPTLLLAQFRALSSQIPILYVLLIINALAVAI
FT                   THLKSAPLWLSLYIPVALSVVCVFRLCWWEIRGKENVTAERAYRLMKLTISGAGILAVA
FT                   FGGWAIALYQYGDASQQGQIAYFLVVTGISCIFCLMHLPMAAALTTVITFSAMVATFLF
FT                   SGNPVFVATAVSGLFLILPFLRVINSYFQNFVGLVQLTEELKQKQAEAEELNLVNSRNA
FT                   LHDQLTGLANRRSFFLSLEKRLQKDPSSPPVLGILDLDGFKPVNDVFGHAAGDLVLKET
FT                   ARRFVALVGEEGIVSRLGGDEFGIIFPCSMTRQAIADLGQALCAVVRDPFEIPDGSVRV
FT                   FGSCGIVYPDIGEYTAEDLYEKADFALYQVKSKRSSGVEFFSAEHEKILTQRHLIELEL
FT                   QANDFAKELKLDYQPIVELRSGRVVAYEALARWDSARFGRISPDAFIPAAERTAVIGRM
FT                   TRILFAKALEALAIIPRHLRLSFNLSARDICDHETSMALLAMITRSGIDPRRIEFEITE
FT                   TALLSDFDTADQVITMLRAAGISIALDDFGTGYSSLSHIHRLGFDKLKIDKSFVMNFDR
FT                   DARCMNITRSVANLCQNLGIASVAEGVESEEIAEGLKAIGVRLAQGYHFSRPLPLELAI
FT                   DYAARCEAEASARNSLSA"
FT   CDS_pept        656461..657525
FT                   /transl_table=11
FT                   /locus_tag="RL0606"
FT                   /product="putative enoyl-coenzyme A hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06099"
FT                   /db_xref="GOA:Q1MLQ4"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLQ4"
FT                   /protein_id="CAK06099.1"
FT                   /translation="MQDGERQDEVIIERRGTAGVIRLNRPRALNSLTLPMIRTITGALH
FT                   AFARDSEVASVVMMGEGERGFCAGGDIRALHESARAGDGLAASFWREEFRLNHLIASYP
FT                   KPYVALMDGITMGGGVGLSSHGRHRIVTERTRLAMPETGIGYVPDVGATWLLPRGPGEA
FT                   GTWLGLTGLDIGAADAIHARLADLQIASSLLGETIDALSDLPRASSSGDVDAVLQALSE
FT                   PQGESRLKQNAATIDRAFRFDSVEEILAALAEEEGEFAAETCRVMLTRSPTSLKLALRL
FT                   LRAGRRSASLAECLGRELGACLQMLDNPDFFEGIRAAVIDKDRNPQWSPASVEAVGAST
FT                   VEQFLKPAEPPLSL"
FT   CDS_pept        complement(657537..659594)
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="RL0607"
FT                   /product="putative uvrD ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06100"
FT                   /db_xref="GOA:Q1MLQ3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLQ3"
FT                   /protein_id="CAK06100.1"
FT                   /translation="MYLEKLNPQQRMAVEHGTLIDGSHIAGPLLVIAGAGSGKTNTLAH
FT                   RVAHLIVKGADPRRILLMTFSRRAAAEMARRVERICRDVLGSNAGVMADALSWSGTFHG
FT                   IGARLLRDYAEQIGLDPGFTIHDREDSADLMNLIRHDLGFSKTESRFPTKGTCLAIYSR
FT                   AVNSETALDLVLRDVFPWCATWEKQLRELFACYVEAKQSQNVLDYDDLLLYWAQMVGEA
FT                   MIAEDIGSRFDHVLVDEYQDTNRLQASILLALKPQGQGLTVVGDDAQSIYSFRAATVRN
FT                   ILDFPAAFSPAANIVTLDRNYRSTQPILAAANAVIDLASERFTKNLWTERQSADRPRLV
FT                   TVRDEAEQARYVADMVLDNREEGLTLKQQAVLFRASHHSGPLEVELTRRNIPFVKFGGL
FT                   KFLDSAHVKDMLAALRFAQNPRDRVAGFRLMQILPGVGPSTAQKTLDLMAEDASPISAL
FT                   AAMPAPPRSGEDWTMFVSMLQELKTGKAGWPAEIGLARQWYAPHLERLHEDAATRQADL
FT                   LQLEQIASGYASRERFLTELTLDPPDATSDQAGVPLLDEDYLILSTIHSAKGQEWTRVF
FT                   MLNVVDGCIPSDLAVGTTAEIEEERRLLYVAMTRARDGLDLVVPQRFFTYGQNSQGDRH
FT                   VYASRSRFIPATLLQFFEACSWPQGKSEAAQAQARQVRIDVGARMRGMWR"
FT   CDS_pept        complement(659702..659968)
FT                   /transl_table=11
FT                   /locus_tag="RL0608"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLQ2"
FT                   /protein_id="CAK06101.1"
FT                   /translation="MKALLPALFAGAMLAGCSSADTPALEPIPGSITYGGQPRTKLTKS
FT                   PVGSAVYNQFYNGTGQRVEETYILQPDRSLKLVRREIGPDFPD"
FT   CDS_pept        660147..660407
FT                   /transl_table=11
FT                   /locus_tag="RL0609"
FT                   /product="conserved hypothetical protein"
FT                   /note="Codons 18 to the C-terminus are similar to codons 55
FT                   to 125 of Yersinia pestis OsmY osmotically inducible
FT                   protein Y (hyperosmotically inducible periplasmic protein).
FT                   UniProt:Q8ZIQ9 (EMBL:AE013978) (204 aa) fasta scores:
FT                   E()=0.75, 35.385% id in 65 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06102"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLQ1"
FT                   /protein_id="CAK06102.1"
FT                   /translation="MLGFPAFTGHGEPGRQGHSDAATRASVESALHAAADFEAGEITVS
FT                   ISGSYVILEGFVRQRGDVERALQIAEGVVGRGYVRARLLRR"
FT   CDS_pept        660566..660829
FT                   /transl_table=11
FT                   /locus_tag="RL0610"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06103"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLQ0"
FT                   /protein_id="CAK06103.1"
FT                   /translation="MQLLPRLWATTLIVGCGVFAGSAHASLETGTNYSALPKDQIALNE
FT                   YTGAVACTPVEPHYLPSFIRATDGTIIGVGYVEIDNESGADC"
FT   CDS_pept        complement(661083..661325)
FT                   /transl_table=11
FT                   /locus_tag="RL0610A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0610A"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06104"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLP9"
FT                   /protein_id="CAK06104.1"
FT                   /translation="MATERWNSPVKVGFEGADARTVNGPFDALKCLADLWPSMRGLRYI
FT                   KARSACRAALDGRKSVEEARAEFLAAAEEAKLKLH"
FT   CDS_pept        662438..663730
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="RL0611"
FT                   /product="putative UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase (ec 2.5.1.7) (enoylpyruvate
FT                   transferase) (udp-n-acetylglucosamine enolpyruvyl
FT                   transferase) (ept)"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RL0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06105"
FT                   /db_xref="GOA:Q1MLP8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLP8"
FT                   /protein_id="CAK06105.1"
FT                   /translation="MDRIRIVGGNELNGIIPISGAKNAALPLMIASLLTSDTLTLENVP
FT                   HLADVELLMRILGNHGVDVAVNGRRERQEDSYSRTIHFTCRTIVDTTASYELVSKMRAS
FT                   FWVIGPLLAREGHCRVSLPGGCAIGTRPVDLFIEGLTALGATMEIDAGYINAKAPAGGL
FT                   IGARYTFPKVSVGATHVMMMAATLARGTTVIGNAAREPEVVDLANCLNAMGAKITGAGT
FT                   ATITIEGVTSLSGARHRVLPDRIETGTYAMAVAMAGGDVVLENTDVALLETAVETLRRA
FT                   GAEISSTNNGMRIKRNGAGIRPVDIVTDPFPGFPTDLQAQFMALMTRSSGVSHVTETIF
FT                   ENRFMHVQELARLGARISLSGQTAKIEGVQRLRGAPVMATDLRASVSLVIAGLAAEGET
FT                   TVSRVYHLDRGFERLEEKLTRCGAIVERISE"
FT   CDS_pept        663887..664270
FT                   /transl_table=11
FT                   /locus_tag="RL0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06106"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLP7"
FT                   /protein_id="CAK06106.1"
FT                   /translation="MSAHMQDSVFKVGDIDWSPRDAQFALAANRFVWEGAERKRKGFER
FT                   RRAALVFKRVLAVRSLGIDRGKRDEVLSLLALRFEQKGEGPEGTVELSLSGTASIALDV
FT                   ECIEVQLADIGGAWEASSKPRHR"
FT   CDS_pept        664326..665624
FT                   /transl_table=11
FT                   /gene="hisD1"
FT                   /locus_tag="RL0613"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RL0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06107"
FT                   /db_xref="GOA:Q1MLP6"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLP6"
FT                   /protein_id="CAK06107.1"
FT                   /translation="MAIWLDQASEGFEQHFAAFLTTKREVSEDVNIVVRAIIDDVRARG
FT                   DVALAEYSLKFDGIDYATVPMRVTAEEIDAAVEAVPSEVLGALKLAALRIESHHRRQLP
FT                   KDDIYEDDMGVGLGSRWTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVDRIVIAVPA
FT                   TGGAVNPAVLAAAKLVGVTEIYRVGGAQAIAALAYGTETIAPVAKITGPGNAYVAAAKR
FT                   HVFGTVGIDMIAGPSEVLVIADKDNNPDWIAADLLAQAEHDVSSQAILITDDAAFGKAV
FT                   EQAVERQLKTLNRAETAAASWRDFGAVILVADLKQAIPLANRIAAEHLELAVADPDRLL
FT                   DGIRNAGAIFIGAHTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPQ
FT                   QLRTLGPAAIALAVSEGLDAHARSVAIRLNLER"
FT   CDS_pept        665629..666102
FT                   /transl_table=11
FT                   /locus_tag="RL0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06108"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLP5"
FT                   /protein_id="CAK06108.1"
FT                   /translation="MAKGEFRLCDVVLDDTIGRSTPDVEHERAVAIFDLIEENRFEPLG
FT                   HAGGPYRLNISLVDSKLVFAITTEEGGGVATHILSLTPFRRIVKDYFMICESYYEAIRS
FT                   STPSRIEAIDMGRRGIHNEGSQTLKDRLAGKIEVDFDTARRLFTLVCVLYWRG"
FT   CDS_pept        666099..666584
FT                   /transl_table=11
FT                   /locus_tag="RL0615"
FT                   /product="putative arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:RL0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06109"
FT                   /db_xref="GOA:Q1MLP4"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLP4"
FT                   /protein_id="CAK06109.1"
FT                   /translation="MTAMELAVDVEEGKRQGAILFMCGMNAIRSPMAEAIARSILPANT
FT                   YIRSAGVRAGERDPFVDVVLDEIGLSLGRRQPQTLEELEDDYFDLIITLSPQAHHAALE
FT                   LTRSSAVDVVYWPTMDPTVAIGTREQILESYREVRDHLAGLIESRLLKRNGIAAQSA"
FT   CDS_pept        666708..666926
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="RL0616"
FT                   /product="putative translation initiation factor"
FT                   /db_xref="EnsemblGenomes-Gn:RL0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06110"
FT                   /db_xref="GOA:Q1MLP3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLP3"
FT                   /protein_id="CAK06110.1"
FT                   /translation="MPKEEVLEFPGIVTELLPNATFRVKLENEHEIIAHTAGRMRKNRI
FT                   RVLAGDKVLVEMTPYDLTKGRITYRFK"
FT   CDS_pept        666985..667605
FT                   /transl_table=11
FT                   /locus_tag="RL0617"
FT                   /product="putative Maf septum inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06111"
FT                   /db_xref="GOA:Q1MLP2"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLP2"
FT                   /protein_id="CAK06111.1"
FT                   /translation="MALKYKLILASGSPRRVDLLNQAGIEPSRLMPMDIDEAPKKSEHP
FT                   RSLARRLSAEKAEAALAAIKGDITWKGSYILSADTVVAVGRRILGKAEFADEALNSLHL
FT                   LSGRNHMVYTGVCLVTPDRKVRQKIVETKVRFKRLSGFEIENYLASGQWRGKAGAYGIQ
FT                   GLAGTFVQKMVGSYTNVVGLPLYETILLLTGEGFDVHSRWPEG"
FT   CDS_pept        667735..667947
FT                   /transl_table=11
FT                   /locus_tag="RL0618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06112"
FT                   /db_xref="GOA:Q1MLP1"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLP1"
FT                   /protein_id="CAK06112.1"
FT                   /translation="MPEDKKAAAKVEPLRKTRPCPECGKPSNREHYPFCSNRCREADLS
FT                   RWLTGAYAIPVADDETKAEYPDGEN"
FT   CDS_pept        668351..668596
FT                   /transl_table=11
FT                   /locus_tag="RL0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06113"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLP0"
FT                   /protein_id="CAK06113.1"
FT                   /translation="MKKIAYSKAATKALRKMQPKRAAAIVARVEAFANGESVDLKKLQG
FT                   SEFFRIRVGQDRVIIDDQTMQVLVIKAGPRGDIYNE"
FT   CDS_pept        668606..668953
FT                   /transl_table=11
FT                   /locus_tag="RL0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06114"
FT                   /db_xref="GOA:Q1MLN9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLN9"
FT                   /protein_id="CAK06114.1"
FT                   /translation="MGEIQKLTIDGKGYVLLSEDDYQDLVDISEARAAKARIGAGEETW
FT                   PEDVVKALIAGEDPVRVFRKHRGMSIKELAEKSGLSQPYLSEIETGKKEGSLDALRSIA
FT                   SALDVDLDDVA"
FT   CDS_pept        complement(669116..669397)
FT                   /transl_table=11
FT                   /locus_tag="RL0621"
FT                   /product="putative insertion element related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06115"
FT                   /db_xref="GOA:Q1MLN8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLN8"
FT                   /protein_id="CAK06115.1"
FT                   /translation="MMGKRKFDDDQITGILKEHQAGVTVADVCHKHGISEPTFYRWQSL
FT                   QVGNAGLHAKRLRALEEENQKLKKLLAESMLSAATLSEMLAKTSKGRH"
FT   CDS_pept        complement(669402..670862)
FT                   /transl_table=11
FT                   /gene="tobE"
FT                   /locus_tag="RL0622"
FT                   /product="putative HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06116"
FT                   /db_xref="GOA:Q1MLN7"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLN7"
FT                   /protein_id="CAK06116.1"
FT                   /translation="MALVQLDATPARFPNSSFPDSSGTGRRLAQRSTATAKQQTAYLPV
FT                   IESKQRGPAPPSPMPGLRGAVWTGNLLILVFIVGLGIWSVLAPLKSAAIASGVIEPESS
FT                   RKTIQHLEGGIVRRILVKNGDAVMGGQIVIELDDTKSRSERDSIQGQLWDAEGSRARLL
FT                   AEQTGGDRVAYPDDLRAAMDRYPSVSAILIGQQKIFEARRRVMQAEIQIANEKIAQVRQ
FT                   EIVGLGAQKAALADRATISSQELDQVTILSAKGLERRSRLLNLQREKADLDGQQGQVEA
FT                   QISRAYQVISGSQADLAKLESDRLSEVAQGMRDTESRIMQLRERLRAIDDQLSRTDIRA
FT                   PEDGTIMNLRVHTSGGVIGAGEPLVDLLPRTDRLVVSAHVRPEDIHLVRAGLEAQVHLL
FT                   PYNQRRVPLLKGRVEYVSADRLTDPQSGQPYFAATIRVTDERLAKMSDVELVAGMPTQT
FT                   LIETGQSSVALYAVRPLLDSFNRAFRED"
FT   CDS_pept        complement(670877..672592)
FT                   /transl_table=11
FT                   /gene="tobD"
FT                   /locus_tag="RL0623"
FT                   /product="putative ATP-binding component of Type I protein
FT                   secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:RL0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06117"
FT                   /db_xref="GOA:Q1MLN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLN6"
FT                   /protein_id="CAK06117.1"
FT                   /translation="MTTISIKPPRPQTQLVVALRACAGAFGLVFLYSCGYNLFLLAPSI
FT                   YLLQIYDRVLSSRSADTLLMLTMIIAIAVVVGSTLDIVRRAALSRIGSWLDHRLRPMVL
FT                   TASFEYAARADTGAAAECYRDLAALRQFLDSPASSLFFDVPWAPLFLLLLFLVHPLLGT
FT                   IGLLSAVALLLFAFMTELATREPLAHANLALSRSYLRFATALKNIEVIRAMGMQDGAAL
FT                   IVYRDAEMARRAQDIAMHRTEIILGFSKSIRTLAQILMMGSATWLVLANNGSPGIIFVA
FT                   SLLLGRGLAPIEGAIGAWRSLTFARNAFNRLNRMLISVASEHDARMVPRPEPNGLVLDN
FT                   VSYFKPFADRPILTDITLRLAPGDCIALIGPSGSGKSTLGRIIAGVVPATSGYALLGGV
FT                   DISALRLCGGTCHVGYLPQDIELFGGAIKDVIGRLDGGDPGKAIDAAKLVGLHEAIMRL
FT                   PQGYETDIGEGGNLLLRAQRQQLGLARAAYGNPSLIVLDDPNSSLDYDGERMLFTAIER
FT                   MKSRGMTVVIITHRMGILPVTNKIAIMRNGTVAAVGDSERIYETYLQPPSRTGT"
FT   CDS_pept        complement(672683..673258)
FT                   /transl_table=11
FT                   /locus_tag="RL0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06118"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLN5"
FT                   /protein_id="CAK06118.1"
FT                   /translation="MPIPQISDTIHLNNPDAGDANAGNGGDGHNDGNINYNPVAYVDPV
FT                   QTVYGATTDLHNGDHVWQKAGWDAGSGGDGGFAQAKNGFLAAVKNSGDGGAGGDSNSNG
FT                   SQGNSSGGDTATVNAATTATQYTQLVADQHATILAGVGGNGGNGNNALGGDISSALVHT
FT                   DPETTTVNNSLDHFINAFGHIDVDHLGS"
FT   CDS_pept        673651..674808
FT                   /transl_table=11
FT                   /locus_tag="RL0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Bradyrhizobium japonicum blr6968 protein. UniProt:Q89EV2
FT                   (480 aa) fasta scores: E()=3.3e-18, 39.364% id in 409 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06119"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLN4"
FT                   /protein_id="CAK06119.1"
FT                   /translation="MSEQIRLHRAACSVDVRSTRMETVMAETRPLLEDQPKTGADQYLA
FT                   SNVAAGHLALVPTWLPLDVASGPSHNSAGSGGDGISEGVISSNSLAVFMPSNAAIAGPH
FT                   SGADAFQGNDALINQHPTEMAGIGGNGGSGNVAIGGGDGANHAGTGGNGLFYGGLVSTE
FT                   VALFAPVNTAVAAGPGAEAHADQTNNALFLQGATQIGGMGGSGGDHNVTGHGPSMSPGT
FT                   ALTLTGDFYAGHGGDGYFVGSMVDVSIAIFSPINIAIGAAGGSAEAHQTNNVIFDQGTV
FT                   QIGGNGGGFNLSSDTIFTGNHALGGGGGGVGSSTGSMVDVNFAYFHPINIAVPAGGTAD
FT                   AQQTDHVLYDQQALQLAGIAGHGGDGNLTDTHSALVDDILSFMHS"
FT   CDS_pept        675201..675488
FT                   /transl_table=11
FT                   /locus_tag="RL0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06120"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLN3"
FT                   /protein_id="CAK06120.1"
FT                   /translation="MSFCCRICDCFELRYGNKAEPIGSSLYPMALSEVGLWQIGCLFSA
FT                   FVSFVDPLAVREFDEGWKVYGDKSNRQEFMKKLFNVLCKPSYLSLISYKL"
FT   CDS_pept        675586..676350
FT                   /transl_table=11
FT                   /locus_tag="RL0627"
FT                   /product="putative GerE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06121"
FT                   /db_xref="GOA:Q1MLN2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLN2"
FT                   /protein_id="CAK06121.1"
FT                   /translation="MQIFVGSTQVSDITGTRRRMGRNAPTVIIIEHSTLARTTVVKLLE
FT                   RELAGWNVIDLISTESLDSALGAEVRLIVLGLAGRSVESTSLRDDLAAIAARCPEAPVT
FT                   LLSGTDDAIIARQALKMGIRGFFSTSLPVDIALAGLRLVLAGGTFFPQLLGAGTNGSSE
FT                   HSPARSEAEKSLDDRTQYLAIADFTPREADVLAELQCGCSNKVIAGKLNLSGHTVKMHL
FT                   QHIMRKLQAQNRTEVVARLIQRAAGRPDVSPS"
FT   CDS_pept        complement(677034..677999)
FT                   /transl_table=11
FT                   /locus_tag="RL0628"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06122"
FT                   /db_xref="GOA:Q1MLN1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLN1"
FT                   /protein_id="CAK06122.1"
FT                   /translation="MTVPSATPVDTTPKSTKVIICIQKMILKRRRQMTENYFVYMPDNR
FT                   ISAAWGCTAVSTGYSVIAPHSSYPPSRHPDDHHFSWSRGRILQAYQVVLISAGNGKLEF
FT                   GNLRRQVRVTEGSIFLLFPGVWHRFAPDRRTGWTEHWIECRGTAFDFAVDAGLLHVERP
FT                   LNPASDEIDHVFASIHDLARQDPVLHQLVISTLGLQLLALLCRPDDLATGAGARLVDRA
FT                   RMILMERCGTSQSVEDLAAEMGVSYPYFRRLFREQTGMSAKQYQMNVRIQRARDFLVNT
FT                   DKSVKEIAGLLGFHSAFHFSSQFKNAVGCAPTEYRRTSEN"
FT   CDS_pept        678040..679263
FT                   /transl_table=11
FT                   /locus_tag="RL0629"
FT                   /product="putative component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06123"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLN0"
FT                   /protein_id="CAK06123.1"
FT                   /translation="MHQLSPLPGRVAAGRRINMKTHARLLVAATCLAASAAYADDFHGF
FT                   DPAKFDGNMLSAEALKAMAADASKVTPPKNGSKYSIGFANLQRDIAFGVLVEKGIQANA
FT                   DAAGVELVVADNRLDGPTALANAKSFAERKVDYVIEFQTDANFGQTVMDVFKQDGTKVT
FT                   AIDIPMPGASFFGVNNPKSGFMGGSYLATAAAKQFGADTVKSGYLVIGALPQSGVIPRM
FT                   RTEGQRAGFLALTKDFPADHIIEIDTKNTLQESYTQMNNVLGRIPPGAPILIIAINDQA
FT                   TMGMLQAVRAAGRVDQAIAVGNGADEAEALATDPKLVAATGSFPGSYGNYLIPIALSAL
FT                   AGKAVPEATFVTHQMVTKANICKFYKEFACAGEADGYTFPEAEFASYLSGLKKEDWLKG
FT                   YEAILPKQ"
FT   CDS_pept        679286..680845
FT                   /transl_table=11
FT                   /locus_tag="RL0630"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06124"
FT                   /db_xref="GOA:Q1MLM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLM9"
FT                   /protein_id="CAK06124.1"
FT                   /translation="MQTVSSTENRVARLQITNVTKSFSGVQVLKNVTCSADAGEVVALL
FT                   GANGAGKSTLMKILSGVYSCDAGQIQIDGAAVDITSARAAIASGIRLMPQELSVHPDLS
FT                   VAENIALGSMPQRKIAGISFVDRAAMQRQATTLLGRLKLGHVSASRRMGSLSLPEQRIV
FT                   EIARALAGQARILIMDEPTAALGEADAETLFGVIDALRADGVTIIYISHYLDEVFRLSD
FT                   RIVVLRDGEVRGQFQTSATSHDEVLRAMLGGDLGDLFPAKPQSLPDETILAVEGLSLPG
FT                   WLSDVSFSVHRGEVLGAFGLIGSGIEKVGRAIYGAEPKARVRSIRMGTAETALSNPRSS
FT                   IRSGIGFVAAERKRQGLIANLTVRTNTTLPYLTRFTRFGLVDDNRERAMSQHWIRTLRV
FT                   KTTGPEQEIRLLSGGNQQKVCLARWLLGDPKLLILEEPTRGVDLGARREIYEEIRRLAA
FT                   NGLGILLVSSDAEEVAGLADRAIVFEEGRAVAALGANASAAELMQAAESHSVSAANELE
FT                   KA"
FT   CDS_pept        680842..681846
FT                   /transl_table=11
FT                   /locus_tag="RL0631"
FT                   /product="ptative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06125"
FT                   /db_xref="GOA:Q1MLM8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLM8"
FT                   /protein_id="CAK06125.1"
FT                   /translation="MNKSNSIVASEPKTTSQRQSMTEILARPAAGIVVLLGFYVILLAA
FT                   FAMLSPFFLSVSNLANIGTNMAFIGLMAAAGTPLIIGGGLDLSVAAVAGLAGVIVALMH
FT                   SNGINIWVGCLTALVIGAGVGILNGVIVTKLRLNPLIVTLGTMSIFSGLSMVMTGGLSK
FT                   PLFVPAFNWLGSGRIFSVPFPVIVMLIVFAVLWLVLAKTPFGRFVYATGGNPEASSLLG
FT                   VPVERTQMILYVISGISGAAAGIILAAMLGAAAPNAASQHLLTIIAAIILGGTSLFGGR
FT                   GSVWGTLIAVLILGTLNNGLTLMNVSSFWQDVTRGVVLLLAVGLDQLRVRLQG"
FT   CDS_pept        681875..683302
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="RL0632"
FT                   /product="putative L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06126"
FT                   /db_xref="GOA:Q1MLM7"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLM7"
FT                   /protein_id="CAK06126.1"
FT                   /translation="MSDRPLKAGLFGIGLEAYWPQFDGLEARLRGYVHVVASKLERPGV
FT                   EVVNLGLVDTPEKAVDAGHLFRQADVDIIFLYITTYALSSTVLPVVRRAKVPVIILNLQ
FT                   PAGAIDYASFNALGNRTAMTGEWLAHCAACPVPEIANVFTRAGIRFHQVTGVLNDDPFV
FT                   DNEIEEWIEAARVAHVMSHNRLGVMGRYYNGMLDIYSDLTAQSTAFGTHIEVVEIDELA
FT                   RLRRDVGEAEVAACLDRIRTEFDVQPDCDPDELARAARTAVALRKLVDAKRLGSLAYYY
FT                   ESVSGHEYEDVITSVIVGCSMLTAEGIPVAGEYEIKNAQAMKIMDSFGTGGSFTEYYAM
FT                   DFDADVVLMGHDGPGHTKIAEGRTKIRPLEVYHGKVGSGVSVEMSVRNGPVTLLSVVEC
FT                   AGKVKLLCAEGQSVPGPILEIGNTNSRYQFPIGARAFVENWNAEGPAHHCAVGVGHIGS
FT                   SIEKLGKLLDVEFVRIC"
FT   CDS_pept        complement(683692..684087)
FT                   /transl_table=11
FT                   /locus_tag="RL0633"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06127"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLM6"
FT                   /protein_id="CAK06127.1"
FT                   /translation="MIDKVIRHSSFFIWMTEDKTVGILKLQRLLRIHDPQCLALVFGLE
FT                   RRLDDGFFLAHVHVLRCLKDNGQAESRFPSGHHDMKPVETNAPSIHGPPSRGPNCFYGL
FT                   TTRFGAATSMPLRPPNRRLFPRPKIRY"
FT   CDS_pept        complement(684193..684918)
FT                   /transl_table=11
FT                   /locus_tag="RL0634"
FT                   /product="Putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06128"
FT                   /db_xref="GOA:Q1MLM5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLM5"
FT                   /protein_id="CAK06128.1"
FT                   /translation="MEFKGKTVIVTGAGKGIGREIVRMLVERGAQVVALTRSAADVEAL
FT                   RGEFGCRAIQVDLADADATRKAAIAALPADFLINCAGTTELQPFLETTVEAFDRLVAVN
FT                   TRAPMIVAQEYARSLIKEGRPGAIVNVSSVASFVGIPDHAAYCASKGGLDGLTRVMAKE
FT                   LAPHGIRANGVHPTVTLTPMAVKAWSDPEKAAGMMKRIPVGRFAEPADIAEVVLFLLSD
FT                   QAAMVNGISMPVDGGYMIA"
FT   CDS_pept        complement(684930..685991)
FT                   /transl_table=11
FT                   /locus_tag="RL0635"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06129"
FT                   /db_xref="GOA:Q1MLM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLM4"
FT                   /protein_id="CAK06129.1"
FT                   /translation="MANVQVSDVTKKYGSLQVMHGVSVDIEDGEFVVLVGPSGCGKSTL
FT                   LRMIAGLETVSSGDIRIGGRVVTDAPPKERDIAMVFQSYALYPHKTVAENMGFPLKMAK
FT                   RPKAEINEKVGRAAEILDLTRYLDRYPKQLSGGQRQRVAMGRAIVRDPKVFLFDEPLSN
FT                   LDAKLRVTMRVEIKELHQRLKTTTVYVTHDQIEAMTMANKIVVMRDGRVEQIGKPLDLY
FT                   DFPVNLFVAGFIGSPSMNFLEGRIATRDGRKIVVTDQGITLPMADTNADEGRAVTYGIR
FT                   PEHITIGEEGVPVEVSVFEPTGSETLIFGRTGGVPIDALIRERIEVDPGRTMYFHIDPR
FT                   RAHIFDRETGQRL"
FT   CDS_pept        complement(686049..686255)
FT                   /transl_table=11
FT                   /locus_tag="RL0636"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06130"
FT                   /db_xref="GOA:Q1MLM3"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLM3"
FT                   /protein_id="CAK06130.1"
FT                   /translation="MTSQSGNNERKPGFLPIETNWFDRLFISIVIWVALSLFWMRFIEP
FT                   FGPSVWFAAAISAVLGAYVVWKG"
FT   CDS_pept        complement(686260..687096)
FT                   /transl_table=11
FT                   /locus_tag="RL0637"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06131"
FT                   /db_xref="GOA:Q1MLM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLM2"
FT                   /protein_id="CAK06131.1"
FT                   /translation="MKTRFPWLPVVLWTLISLATLFPIYWLFVISVKQPFDLFSTPDVI
FT                   LRSFFWKNYQDVLTNPTLRGYMLNSMIISSGNALLVTTLGFLACYALTRFDLAGKESIF
FT                   FWTITNRMAPPAVFLLPLFLLLTQVYKIGDFSLADSKLGMILVYCSFNLPFAIWTLRPT
FT                   VEGIPKELDEAAYMDGASPWTVLYDIIFPLARPGLAVTLILTWVFAWNEYLLAATLTNF
FT                   HARTLTTGLSEYVTTTGTAWGIMAAISMLTLVPALIVFSVVQRHIVAGLTFGAVKG"
FT   CDS_pept        complement(687101..687976)
FT                   /transl_table=11
FT                   /locus_tag="RL0638"
FT                   /product="putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RL0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06132"
FT                   /db_xref="GOA:Q1MLM1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLM1"
FT                   /protein_id="CAK06132.1"
FT                   /translation="MHSQKLGWLLLSPTIVILGLFGIFPFIYVLWVSFHSWNPFAANPG
FT                   MIFNWAENYRRLVFDPQFLASLGITLTFVFFAVVSELVLGYILAQALLKDFPGKAVFRT
FT                   IHTLPLIMAPIIVGSVWKLMTTPSIGIIPYLLRSWFGYDLNIGQSAVAAFTVTVIMDIW
FT                   HWTPLVTLSLIAALVSLPSDPFEQAQIDGAGKSQIFWHITLPLIRPALLATVFIRLMDA
FT                   LRTVDEVLMLTGGGPGSSTRYIGVHIFREVFPKTNYGYGSAISVIVLYLTIVVCWLLYV
FT                   GLIAPRVKRG"
FT   CDS_pept        complement(688074..689522)
FT                   /transl_table=11
FT                   /locus_tag="RL0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06133"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLM0"
FT                   /protein_id="CAK06133.1"
FT                   /translation="MGGLKMNYALKASALALTLSLATTASPAWADFWSDAGAKFKGVTL
FT                   HGVTESTPPSNYIRNVLAPEFEKKTGIKVDIETTSWDQMYDKAIKDMEAKTGIYDMVYI
FT                   EQDIIYSYLARDFLVDITKTLKDQPDLKAPTYDDANFTSFADYFKDSSGDLFGVPMEAF
FT                   LKAYLYRKDLFDDPKIKEAFKKETGKDLKPATTHAEYTEIADFFTKYGKDNGMELWGTT
FT                   AQAHTGHPASWYEFFESIAPTFGVYNWGIDAKNNYAATIEHGGAMNGDKAKAALKYWLH
FT                   LRDIAPPESTQSTWTETATTFAAGRVAQGLIYGENAAWIASDPAQSKVVGQVGFALPPL
FT                   EPGVLDDAKAGKGYIGYYDGGAFGVPVTSKNKEASLLFLEFIGQNEVQPDWAIAAPRIT
FT                   NTATFDDPKVKEMDVKLGGFYTMLKDDGKLFAGAPPYPFHAQVREATAPIFYDILTGKI
FT                   GPDEGLDQMAAKAEEELTSLGYRK"
FT   CDS_pept        689805..690689
FT                   /transl_table=11
FT                   /locus_tag="RL0640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06134"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLL9"
FT                   /protein_id="CAK06134.1"
FT                   /translation="MRRLGIHSFVWTGGQTQEGLETALNKTAEHGYRTIEFAYLRPEKF
FT                   NLDRLAKLAQSLDVEIGVTMGLSLDRDVSSEDTSAVSAGKQTLADAVRAVRDIGGNKLG
FT                   GILYSAHTKYNRQPTKKGWDNSVAAIAAIAEVARQANVDLVLEVVNRFETNLLNTAAQG
FT                   LKFIAETGSEHVRLHLDTFHMNIEEANPAAAIRLAGDKIGYFHIGESNRGYLGDGVINF
FT                   DLIFDALLDIDYKRDIVFESFSTTVVDEGLSLACAIWRDTWEDNDPLAAHAKRYIELKY
FT                   EEAKRRRATNARP"
FT   CDS_pept        690752..691966
FT                   /transl_table=11
FT                   /locus_tag="RL0641"
FT                   /product="putative ROK family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06135"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLL8"
FT                   /protein_id="CAK06135.1"
FT                   /translation="MNDTVSIGSSPRRIRQNNIVAALQTIYAHRSLSRADLARKLGMNR
FT                   SSSGEIVAELTEGGFVQESDESGKQRLEHSRAGRPGIMLELVPDAAFFVGIEIGVEHIS
FT                   AAVIDLSADVRACRKMAFDTMSSTVEKAVAEGVELIVSAMEKRMIGRCKGLGISAPAHI
FT                   RPDGIVTLAPIIGWREVSLKEIGQSAFPAAVPIAVENDANAFAIGDSYRHGVSGVTLFL
FT                   LMETGVGGGIMIDGKLFRGGHGLAGEIGHTLVPGSGGQKFEQLIGREVLIRQYREAIGR
FT                   KHVDLQEFLGDVHDRVPAAVNIAETWSRHLAYALLQACRLLDPDRIVLGGSVASLYPMV
FT                   AARVAVHMSEGQNIPFPTPEIVVDDDAEFGSAFGAACMLHQRFLSLESEEFGGEDGAPV
FT                   QSATS"
FT   CDS_pept        691997..692974
FT                   /transl_table=11
FT                   /locus_tag="RL0642"
FT                   /product="putative PfkB family sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06136"
FT                   /db_xref="GOA:Q1MLL7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLL7"
FT                   /protein_id="CAK06136.1"
FT                   /translation="MTSVLAPDQLGPTVCVGEILVEIVATTVGDGFLEAQPLVGPFASG
FT                   APAIFISQCGRLGGKAAMVGAVGDDDFGRVNTDRLKRDGVDVSTISIDPDYPTGSAFVR
FT                   YRKDGSRDFVYNIATSAAARFGWSQTVGDLINRSGHLHVMGSALSVPSARAVIDKAVGI
FT                   VKARGGTLSVDPNIRKELKLDKDTERRFSKLVAAADLLLPSGEELERAAGVEGKAEAIR
FT                   RLFEVGVKEIVLKRGAEGATYFGRDGDRIDAPAFVVQEVDPTGAGDCFGGAYLTCRRLG
FT                   MSPQQALTYGSAAGARNVTVLGPMEGAGTQQELDAFIASTERRP"
FT   CDS_pept        692971..694251
FT                   /transl_table=11
FT                   /gene="agaZ2"
FT                   /locus_tag="RL0643"
FT                   /product="putative tagatose 6-phosphate kinase"
FT                   /EC_number="2.7.1.144"
FT                   /db_xref="EnsemblGenomes-Gn:RL0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06137"
FT                   /db_xref="GOA:Q1MLL6"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLL6"
FT                   /protein_id="CAK06137.1"
FT                   /translation="MMQVHLNELARLRIEGRPRGVTSVCSAHPIVLRAALRHGRQQAST
FT                   VLIEATCNQVNHLGGYTGMTPSDFASLVRKIAIEEGCPEKLIVLGGDHLGPNPWRDRPA
FT                   EEAMAEAEKMVAAYVETGFRKIHLDASMGCKGEPVALDDETTAHRAARLAAVAEASAKR
FT                   AGGAMPVYVIGTEVPPPGGADHTLTTIDPTAAAAALTTIEVHRRIFAEAGLGQAFERAI
FT                   GLVVQPGVEFGNQNVILYDRNKIDALKSVLTDEPQFVFEAHSTDYQGTRPLTALVEDGF
FT                   PILKVGPELTFVLREALYALDAIASDLLPDYGQRPLYAAMEALMLDQPGNWSRHYHGTD
FT                   AEMRWLRHYSLSDRIRYYWASAEVQEAVRRLCGALRGQTVPLPLLWQHMPAAQDFADAP
FT                   LDPEQVLIWRVTKSLSDYHAACGVGKN"
FT   CDS_pept        694282..695007
FT                   /transl_table=11
FT                   /gene="rbtD"
FT                   /locus_tag="RL0644"
FT                   /product="putative ribitol 2-dehydrogenase"
FT                   /EC_number="1.1.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:RL0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06138"
FT                   /db_xref="GOA:Q1MLL5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLL5"
FT                   /protein_id="CAK06138.1"
FT                   /translation="MTELNGKIAAVTGAASGIGLASTEAMLAAGATVVLVDRDEKALET
FT                   VCARLGERAIPLVLNLLDPHQCAGLLEGILSKTGKLDILHANAGTYIGGDLMETDLDTI
FT                   DRMLNLNVNVVIKNVRNVIPHMIERGTGDIVVTSSVAGHSAIPWEPVYSSSKWAMTCFV
FT                   QTMRRQLLKSGIRVGSVSPGPVISALLADWPEENLRKAKEAGALIEPKEVADAIIFMLT
FT                   RPRNVTIRDIVVLPSAFDI"
FT   CDS_pept        695019..695792
FT                   /transl_table=11
FT                   /locus_tag="RL0645"
FT                   /product="putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0645"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06139"
FT                   /db_xref="GOA:Q1MLL4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLL4"
FT                   /protein_id="CAK06139.1"
FT                   /translation="MSYQQKFRLDGERAVVTGGGRAIGLCCTEALAEAGAAVVVIERSE
FT                   ADAEQALALRNRGYDVEVRVGDVTDAARMDAIATELADGGRPATILVNNAGIGQSGIPA
FT                   QDLTDADWLRMMDVNLNGVFWCSRAFGRSMISMKRGAIVNLGSMSGTICNRPQPQTAYN
FT                   VSKAAVHHLTRSLAAEWAHHGIRVNAVAPTYIETPMVVAVEANRERIPLWLADTPMARM
FT                   GTPEEVASAVLFLASGAASLMTGAIVNVDAGFTCW"
FT   CDS_pept        695930..696754
FT                   /transl_table=11
FT                   /locus_tag="RL0646"
FT                   /product="putative aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06140"
FT                   /db_xref="GOA:Q1MLL3"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLL3"
FT                   /protein_id="CAK06140.1"
FT                   /translation="MKSARLNRLFGVSGNCFDVAIDHGMFNERTFLSGIENMKTAIEVI
FT                   ADAAPDAIQLPPGTAPLLQAIPGKHRPALVLRTDIANIYGNPLPSQLFSEMIDRAVEQG
FT                   VALDAACVVVNLLMLPDQPEVYRACVRNVNSLKRECEIYGMPLMVEPLVMQDNSKGAYM
FT                   VDGAIDKILPLVRQAAELGADIIKADPCDNVEEYHRVVEIAQGLPVLVRGGGRVSDQEI
FT                   LIRTKQLMEQGARGIVYGRNVIQHQNPAGMTRALMAIVHDKASVEQALLHIA"
FT   CDS_pept        696777..697931
FT                   /transl_table=11
FT                   /locus_tag="RL0647"
FT                   /product="putative GFO/IDH/MocA family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0647"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06141"
FT                   /db_xref="GOA:Q1MLL2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLL2"
FT                   /protein_id="CAK06141.1"
FT                   /translation="MTKIFRFGVIGCGLMGREFASAAARWLHLADVKARPEIVAVCDTN
FT                   ATLLDWFRDHVPTVRQFTADYKELLANPEVDAVYCAVPHVLHQQFYIDILKAGKHLLGE
FT                   KPFGMDAAQNREIMAVLAEHPERLVRCSSEMPFFPGAQKVIALAKSGEMGDILEVEAGF
FT                   LHSSDIDRQKPINWKRMADINGDYGCMGDLGMHVLHVPLRLGWRPTTLHAQLVKKVTER
FT                   PDGKGGMLPCTTWDNATISSRVRTGDQDFPMVLKTWRIAPGESNTWYIRVLGMKKSTFF
FT                   STKSPRQWQWMDYNGGAQAWSTEDLGYGSLFPAITGKIFEFGFADAIQQMWAAFVDELA
FT                   GGNANGFGCATPAEAQAHHAVLTAALKSGREDVVVPVAYDGASA"
FT   CDS_pept        697931..698602
FT                   /transl_table=11
FT                   /locus_tag="RL0648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0648"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06142"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLL1"
FT                   /protein_id="CAK06142.1"
FT                   /translation="MKRSEINAALLRATETLERWHWSLPAWGYWTAADFTSHPEASAYL
FT                   RAHQLGWDVTDFGSNRFAECGLVLFCLRNGIVDIRGERTYAEKLLFVGEGQVTPTHRHA
FT                   AKMEDIINRAGGDLVIEFAATDADGNVLTEDVTVPVDGLPHRLAAWEPLILQPGQSVTI
FT                   RTGLYHRFYGRKGGGPVLVGEVSQVNDDNSDNFFLEPIARFAAIEEDEPPLRPLWNEGV
FT                   S"
FT   CDS_pept        698602..699660
FT                   /transl_table=11
FT                   /locus_tag="RL0649"
FT                   /product="putative PfkB family sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0649"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06143"
FT                   /db_xref="GOA:Q1MLL0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLL0"
FT                   /protein_id="CAK06143.1"
FT                   /translation="MRAGEGVHDRDSRKQGGIVCAGNFIVDRVHTLSYWPEQGNLAHIL
FT                   HQDLGVGGGAANVVTDLASLGFPGKLAAAGCIGADQDGEIVKARLAVAGVDVGGLTALA
FT                   DRVTAHTHVMNVPGQNRTFFYHGGANDAVTDKLVSPATFAKAGYRLFYLGYLMLLPGLD
FT                   RIGPDGRSGASRLLEAARRAGLTTCVDFVSSEDPEFAAKVGVALPFCDFLIINEMEAGR
FT                   ATGVIVRDAEGDLIEAGLLEAGERLLAAGVAKGAIIHAPETCFWFAPGASPIITRSRPV
FT                   DPDDIVSTVGAGDAFCAAVLYGLHENWPVEHICAVAHAAAARCLEGATATDGIPDMSVL
FT                   LREVKETKPESA"
FT   CDS_pept        699796..700584
FT                   /transl_table=11
FT                   /locus_tag="RL0650"
FT                   /product="putative sorbitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0650"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06144"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLK9"
FT                   /protein_id="CAK06144.1"
FT                   /translation="MTHTETARLSGKVALVTGGASGIGKAVCERFAAEGARVVVADLDG
FT                   ERCARVAEAIGPQAWGVALDVTSQDSIEEAARFTIATASQIDILVNAAGIYDVESILEI
FT                   SRERTARVFQVNIEGLIFMTQAVARHMVERGEGGRIINFSSQAGRRGEGPAVAYCASKA
FT                   AVISITQSCALELIRYGINVNAIAPGVVDTPMWDVVDAKLGSREGLRPGDVKRRVAAAV
FT                   PAGRFGAPQEQAAMAAFLAGPDAAYIVAQCYNVDGGNVMS"
FT   CDS_pept        700641..701651
FT                   /transl_table=11
FT                   /locus_tag="RL0651"
FT                   /product="putative alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06145"
FT                   /db_xref="GOA:Q1MLK8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLK8"
FT                   /protein_id="CAK06145.1"
FT                   /translation="MRAVRLESIGSLTMRSVEKPVAGPGELLVRVSVAGICGSDRHMYK
FT                   GEYPTAIPVTLGHEFCGIVEAIGDTVTRFTGGELVTVDPNIACGTCRACTQARPNLCES
FT                   LTAIGVTRDGGFAEYVAVPQAQAFVLPADLDPVHGVFSEPLACCIHAIDKARIRPGDSV
FT                   AILGGGVIGLLMVQLARLAGAGEVVLITRQQSRRQTALRLGATHAFDPAASDTIASVRE
FT                   VTKGGADVVIECAGVSDTLQSGLKMARRGGSFVLFGVTPAGVEVPVLPFDLLVNEVDIR
FT                   PAYLNPFTHSRAAAMVASGALELDALVTKTIGLEEVADVVGNAPLPGEIKVIVRP"
FT   CDS_pept        complement(701648..702679)
FT                   /transl_table=11
FT                   /locus_tag="RL0652"
FT                   /product="putative LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06146"
FT                   /db_xref="GOA:Q1MLK7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLK7"
FT                   /protein_id="CAK06146.1"
FT                   /translation="MTTSIRHIAKLAGTSVSSVSRVLNNSGYASPELRERVEAAIRTLN
FT                   YTPSKGARMLRGAPSRMIGLMLPSIEVPFFGILAHAIEQELFQHGYQTLICSTAENMDH
FT                   EVRYISMLLAQRVDGVIVASAFGSIEHFGVLRDAGIPIIAIDRELSGIADDAVMADHEE
FT                   GGRLMARHLIDLGHRAIAIVGAPAHSQPIQLRLKGITAEMAKDGIAPAIVAMAEEHSFA
FT                   ETYRLARELLASRPEVTAIIGTTDVSAIAAIHAIQDRGFSVPGDYSIVGFDDLPEAAYV
FT                   FPRLTTVAQPIRDVGQQAARLLEALIEEHHTGDESRQGAIVKVPVTLIERDSTGAVRRA
FT                   RPS"
FT   CDS_pept        complement(702859..703719)
FT                   /transl_table=11
FT                   /locus_tag="RL0653"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06147"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLK6"
FT                   /protein_id="CAK06147.1"
FT                   /translation="MSAALLDFPPAGPSARDLMERALDPHILLGMPHLNGNGLSETWLM
FT                   KELGHRHWLMLACHLGLDNADFRTADGEEAYAAICATSLTDARFDVVQANDILTIHSRL
FT                   SAVSRTRTSTRHELSVHGRSVGVVELISTFVHRTIKDNNHSIARVTLRAPQGQRFQPSR
FT                   LAQNAADIRNGRLGTHFGFPVLANKALRTFRFDPSASQEFNGAGLFYFAEYQALADRAL
FT                   EDWFPRKGPVVRKDVFFLGNIEQNERVFFDLLDFSEEQKTVHGQLRRENGKVIAKIFGT
FT                   WKSLC"
FT   CDS_pept        complement(703722..704996)
FT                   /transl_table=11
FT                   /locus_tag="RL0654"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06148"
FT                   /db_xref="InterPro:IPR024000"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLK5"
FT                   /protein_id="CAK06148.1"
FT                   /translation="MPTPSLKSHYSAVVIGGGQAGLSASYYLKSHGIDHVVFEKKTVAH
FT                   KWKNERWDAFCLVTPNWQCQLPDHPYDGTDPHGFMVKDEILAYVDRFVKKVDAPIFEQT
FT                   GVTSLEKHGGLFRLETSAGAVTADAVVIATSLYADPAIPRAGERLPEDITQIHTAAYRN
FT                   ADQLPDGGVIVVGSGQSGCQIAEDLHLAGRKVHLVTGNAPRCARFYRGRDVVDWLSDIG
FT                   QYDITVEHGGMTKKKHDTNHYLTGRDGGRDIDLRKFALEGIALYGRMSGVAAGRMLFEP
FT                   NLKANLDGADRVYNGINALIDRHIAEKGIEAPAGSPYVPVWEPEAEIAELDLKAEGITS
FT                   VIWATGFSPDWSFVGLPIFDGNAYPVHRRGVTAVDGVYVLGLPWLWTWGSGRFLSVGRD
FT                   AEHVVGHLAARHSAQTSSLKQSVSA"
FT   CDS_pept        complement(705008..705295)
FT                   /transl_table=11
FT                   /locus_tag="RL0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06149"
FT                   /db_xref="InterPro:IPR023846"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLK4"
FT                   /protein_id="CAK06149.1"
FT                   /translation="MPEMRFVITWPDGQEESCYSPSLIIREFFTEGESYSVADFVDRSR
FT                   RALTIASDRVEAKFGFACSSANDQLARIESAAVAFLHDADARVHCKTFIL"
FT   CDS_pept        complement(705288..706457)
FT                   /transl_table=11
FT                   /locus_tag="RL0656"
FT                   /product="putative mannosyltransferase/glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06150"
FT                   /db_xref="GOA:Q1MLK3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR023986"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLK3"
FT                   /protein_id="CAK06150.1"
FT                   /translation="MSLKSHRTLRIAMLTHSTNPRGGVVHAMQLSEALTSLGHQVVLHA
FT                   PDAKGAGFFRQPSCGAACIAVPPAPADMTQMVEQRMADYVDYFRRTGTDGFDLFHAHDG
FT                   ISGNALATLKLEGLIPNFARTVHHIDQFADPRLIALQDRAIDAADIFFAVSHLWQDRLR
FT                   DERGIEATVVGNGVDTNRFSPAWSGEQVALRDRLQLGSGPIFLSVGGIEARKNTLGILE
FT                   AFRQVRAIRPDAQLVIAGGASLLDHGDYQEEFRSCLACLGRDAAAVHVTGAIADADMPS
FT                   LYRLADALVFPSLKEGFGLVVLEAMASGIPVVTSSIAPFTEYLGPGDAIWCDPHHPVSI
FT                   AEGMALALVAPIREQIIPRGLTVAARHGWQQTATAHLARYHTLLEPDHA"
FT   CDS_pept        complement(706454..707428)
FT                   /transl_table=11
FT                   /locus_tag="RL0657"
FT                   /product="conserved hypothetical AIR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06151"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011413"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR024030"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLK2"
FT                   /protein_id="CAK06151.1"
FT                   /translation="MVPIDIESLAAKVSASSGIAAKQDIGTIAARLGLQGQQIAVGDDC
FT                   AALPDGDGYLLFAIEGFMNEFVAADPWFAGWCGVMVNISDVVAMGGRPIAVVDAVWANG
FT                   EAGATPVLEGMRAASSAFGVPIVGGHTNIRSERGQLSVAILGRAKTLLTSFDAKPGDVL
FT                   VAAIDHRGRYREPFNNWEAATDAAPARLRGDLELLPEIAEAGLALSAKDISQGGIVGTA
FT                   IMLAECSHVGIDIDVTAIPLPAGVSLDRWLVTFPSFGYLLSVAPKDVADVVTRFTARGI
FT                   SAAVIGAVVVGAEVALVDGESRAVVRDHTETPLLQLGRQDVAA"
FT   CDS_pept        complement(707431..707973)
FT                   /transl_table=11
FT                   /locus_tag="RL0658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06152"
FT                   /db_xref="GOA:Q1MLK1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLK1"
FT                   /protein_id="CAK06152.1"
FT                   /translation="MMVEAFAPYRSSEFQVKFATSAWERSQAHALRRAVFCEEQQIFEG
FT                   DDRDAIDDHAIPIVALSMLGIAADQLVGTVRIHQAEPGLWWGSRLAVHRDFRKIGALGA
FT                   TLIKLAVSSANAIGCHTFLANVQVQNGLLFRRLHWDVIEEFEVYGKPHLRMKADLAYYP
FT                   PCATPEAGFTALSRKAA"
FT   CDS_pept        complement(707970..709088)
FT                   /transl_table=11
FT                   /locus_tag="RL0659"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06153"
FT                   /db_xref="GOA:Q1MLK0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016779"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLK0"
FT                   /protein_id="CAK06153.1"
FT                   /translation="MENTTRLPTEVLINELQSYGARLVDPKAGHESRRGGAGPSDHKAL
FT                   TIDGMTVMVPVHTAPAFESPYLVEKPDEMGRSRISRDGTVLGEVSFPLRPRFYERSTAD
FT                   GIPYSQIAVLHGKDVLATTVLQTCIRYQSRTKTCQFCAIGQSLAAGRTIAHKTPEQLAE
FT                   VAKAAVELDGVKHMVMTTGTPKGDDRGAAILADSARAIKAAVNIPIQAQCEPPEDDIWF
FT                   TRMKEAGVDALGMHLEAVTPEVRARIMPGKAQVSIAKYMASFSAAVGVFGRGQVSTYIL
FT                   AGLGDSREAILEICEKLVALGVYPFVVPFVPISGTPLESHPAPSPDFMHSILGPLSRML
FT                   VASGLKAVDIKAGCGKCGACSALSTYERMLTK"
FT   CDS_pept        complement(709015..710061)
FT                   /transl_table=11
FT                   /locus_tag="RL0660"
FT                   /product="putative nitrilase"
FT                   /product="nitrilase (ec 3.5.5.7)"
FT                   /EC_number="3.5.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:RL0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06154"
FT                   /db_xref="GOA:Q1MLJ9"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR023919"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLJ9"
FT                   /protein_id="CAK06154.1"
FT                   /translation="MEKKPSVRVAAAQIAPDLTSREKTLARVLDAIREAAAKGAELIVF
FT                   PETFVPWYPYFSFVLPPVLSGKEHVRLYEEAVTVPSAATDAVSAAAREHGIVVALGVNE
FT                   RDYGSLYNTQLLFDADGTLILKRRKITPTFHERMIWGQGDASGLKVVDSAVGRLGALAC
FT                   WEHYNPLARYALMAQHEDIHIAQFPGSMVGPIFADQMEVTIRHHALESGCFVVNATGWL
FT                   TDEQIASITSDAGLQKALRGGCMTAIISPEGKHVVPPLTEGEGILIADLDMSLIVKRKR
FT                   MMDSVGHYARPELLHLVMDGRATAPMVTTTQPSFPTAEARILSDGEYDTSADRGSDQRI
FT                   AVLRSPAR"
FT   CDS_pept        complement(710137..710619)
FT                   /transl_table=11
FT                   /locus_tag="RL0661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06155"
FT                   /db_xref="InterPro:IPR023847"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLJ8"
FT                   /protein_id="CAK06155.1"
FT                   /translation="MPAVTKPANQKGDFLVDYEDKVFEDVQAGEGEKALVTFHTVAFEG
FT                   SIGFVNLLQATRLKRKGFETSILLYGPGVTLGVQRGFPTLGAEAFPGHLNFNNQIVKFM
FT                   EEGGKVYACRFALQALYGHGEGALIPGITPISPLDVLDLILIHRRDGAFILDTWTL"
FT   CDS_pept        711314..711973
FT                   /transl_table=11
FT                   /locus_tag="RL0662"
FT                   /product="putative lipase"
FT                   /note="Similar to codons 45 to 245 of Burkholderia glumae
FT                   (Pseudomonas glumae) LipA lipase precursor (ec 3.1.1.3)
FT                   (triacylglycerol lipase). UniProt:LIP_BURGL (EMBL:A16323)
FT                   (358 aa) fasta scores: E()=0.019, 26.214% id in 206 aa, and
FT                   to Bradyrhizobium japonicum bll2323 protein. UniProt:Q89SS7
FT                   (EMBL:BA000040) (224 aa) fasta scores: E()=1.8e-30, 47.664%
FT                   id in 214 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06156"
FT                   /db_xref="GOA:Q1MLJ7"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLJ7"
FT                   /protein_id="CAK06156.1"
FT                   /translation="MNDTVLLFHGIARTKKSMAKLAGFLSGHGYRVVNVGYPSTKFSIS
FT                   DLSDLIDIIRPEIDAAAKDAGEGRVHFVGYSMGGLIIRAFLRRYRPANLGRVVMVGTPN
FT                   NGSQIADFLKNWPLYRKVYGPAGQQLVTDQAAMTELFGTVDYELGIIAGNRTIDPVSSL
FT                   IIGLRVPNDGKVSVESTRLDGAAAHIVIPANHTFLPVNKVMWSQTLSFLKDGRFTS"
FT   CDS_pept        712048..713193
FT                   /transl_table=11
FT                   /locus_tag="RL0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="N-terminus to codon 255 is similar to codons 90 to
FT                   335 of Rhizobium leguminosarum PlyA polysaccharidase.
FT                   UniProt:O05692 (EMBL:RLY12758) (540 aa) fasta scores:
FT                   E()=6.9e-12, 27.888% id in 251 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06157"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLJ6"
FT                   /protein_id="CAK06157.1"
FT                   /translation="MTAILRKKVHGASTRGQVIDGAPDVGVAYQVFSDTVIEDVIVKNS
FT                   PRGFKFHNGRNLTVRRCETENVNGDGIYLTKTTHVLLENNRIGAAPGEGADCCQFAYQN
FT                   SDDNISSDIVIRGNLFLQSPASASNKGALVCDRTRKYLVEYNFIGGKNFSFSSIGDDAV
FT                   VRSNIMRDGRMNDYSFGYGVGDKADHAGHHIYDNWIENTNRGVSLSGFSDQELAFRKDI
FT                   DIHDNVISQCDIAFFANRRWSGSFRRNIFLRCEQDIVLKGNGKTTAGDIDGNYRNDGSF
FT                   LNVTPPPLRFKPDGNASVASGEWTSEPDEIRIQWRNKGIDIPGANRPSITVEPGMELSC
FT                   VLLARKAQNWMLAIAETAYDDFTPRAWQEHKLPWRKRYLSI"
FT   CDS_pept        complement(713225..714313)
FT                   /transl_table=11
FT                   /locus_tag="RL0664"
FT                   /product="putative transmembrane acetyltransferase"
FT                   /product="rspf"
FT                   /note="Similar, but truncated at the N-terminus, to
FT                   Rhizobium leguminosarum (biovar trifolii) RspF.
FT                   UniProt:Q9X6N8 (EMBL:AF141932) (388 aa) fasta scores:
FT                   E()=6.1e-17, 29.714% id in 350 aa, and to Agrobacterium
FT                   tumefaciens (strain C58/ATCC 33970) rspf acetyltransferase.
FT                   UniProt:Q8UB89 (EMBL:A98342) (365 aa) fasta scores:
FT                   E()=2.6e-25, 34.309% id in 376 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06158"
FT                   /db_xref="GOA:Q1MLJ5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLJ5"
FT                   /protein_id="CAK06158.1"
FT                   /translation="MTSSNRRLVGLDGIRGLAAICVAVHHTEGFVGFDAAPAAYLAVDL
FT                   FFCLSGFVIGHAYERKLIQESSLSANDFAIKRLIRLYPLYLLGLLLGVLAYAGMSLSRN
FT                   QQMDPMLFATSLIASMFFLPAIGGTSLKAPNLFPFNGPSWSLFLEIVINLAYGYTARLL
FT                   SNGVLAVILLASWVWLAAQTLAHGSADLIPLDGALLSGFPRVLFSFSLGILMYRYRQRL
FT                   SPSGIGKAAAVTTIVVATALLVFQAPAALVGIKDLIVITALFPLAVLVLYTANFDGVLR
FT                   QPLLIAGEASYALYAIHVPLLGLLLGAWKAAGLGQPPAWAIFAIVLPLIVVLAIVVTRL
FT                   YDEPVRKALSAGKAMRLRWRRS"
FT   CDS_pept        complement(714318..715673)
FT                   /transl_table=11
FT                   /locus_tag="RL0665"
FT                   /product="putative transmembrane exopolysaccharide
FT                   production protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06159"
FT                   /db_xref="GOA:Q1MLJ4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLJ4"
FT                   /protein_id="CAK06159.1"
FT                   /translation="MSTSFDSYQPIGLQRHRPRARAQYRIRRETLVRILLSAIFYISLW
FT                   RATGMWYGLPADFQEGVGKDPMPMRLLLMSLVPLIGLYCLLEPRRVVELLRSASPLVGI
FT                   VCLCVFLSIAFSVSVTASLRALVAVALLTAGPLLYRARYGAVDTFESLAKFAIATAFIN
FT                   ILYTAAFPRFAVMRGSYAGMVKGAFYHKNMLGQFSAANFILLLPALPMWRLRYYDLLRW
FT                   AAMLLYLVLIVLAKSSTAIILLSIGVAVYYGMSWIQRFPGRIFRSFVVLLAFALLGFVV
FT                   SVALMGVAQAIAESFGKDLTLSGRTNVWEQLLPLIYERPLTGWGFALFRQPDIMEQYVR
FT                   LTWDAQSTHNTYIELALNIGIPATIIWTSFVVVRLVAKMTSSPLNQALAITKRKEVVII
FT                   LLILIGAFTEAGMMLAPFILWPHTVIALTSLGPEFLSRFRKPTQAGAQHASG"
FT   CDS_pept        complement(715717..716451)
FT                   /transl_table=11
FT                   /locus_tag="RL0666"
FT                   /product="putative exported lipase"
FT                   /db_xref="EnsemblGenomes-Gn:RL0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06160"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLJ3"
FT                   /protein_id="CAK06160.1"
FT                   /translation="MLRLFANLLIVLACNFFLIVGNAGPSFAQECPDPTKAMNASAQQK
FT                   QASKRLNRALPSYRARSARYNLALVGDSLVELWQPWIKDSFPTRPVMNLAVAGDTTQNA
FT                   LYRLEGLDLPDFHPADVVVLIGTNNLGAKTAPCAVAAGVVAVVSKVRALWPGAHIYALS
FT                   IPPRGKRYAFYEDVRIPANQLVASSLAEMPGVTFVQMNDDMLRCGKPSDKDCSNYKPDH
FT                   LHFNEGAYKLITSFLAAAGLQL"
FT   CDS_pept        complement(716884..717117)
FT                   /transl_table=11
FT                   /locus_tag="RL0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06161"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLJ2"
FT                   /protein_id="CAK06161.1"
FT                   /translation="MADITYQVVPHDNGWAYKLGDTLSETYATADEAIVHARDAASRQK
FT                   IGDGDALLAYPAPDGRGWAFQELETDKSGSRL"
FT   CDS_pept        complement(717164..717424)
FT                   /transl_table=11
FT                   /locus_tag="RL0668"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06162"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLJ1"
FT                   /protein_id="CAK06162.1"
FT                   /translation="MPDVRSMDNQGRRMDARDRLIVALYAQLKAERETRETLEWAIRNG
FT                   AVSQEVLEAIAADPVPVVTSEDIASLEKIIALDERRKANRN"
FT   CDS_pept        717569..717997
FT                   /transl_table=11
FT                   /locus_tag="RL0669"
FT                   /product="putative stress-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06163"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLJ0"
FT                   /protein_id="CAK06163.1"
FT                   /translation="MADLKARPRPTGATAVVGRTGFPHVTSATKGEIDIVTAPSQPGFN
FT                   PLDLLYSSLSACLVLSARIAASQMGVLDKISEITAEVTGEKATEGLSRVAKFNIAFSIK
FT                   GDIDEETRQKIAHAAEDEICTVSNTIRGNPEFATTISG"
FT   CDS_pept        718052..719536
FT                   /transl_table=11
FT                   /locus_tag="RL0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06164"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLI9"
FT                   /protein_id="CAK06164.1"
FT                   /translation="MPRFYARASKAMIPATMQPKPLPTSEQPVVAIIGGGVSGAGVAYH
FT                   LARADCGERPAIMVFEPRAELGRGLAYDTADPAHRINVPAAKMSLQPDDLGEFLAWIEV
FT                   RDAVAGDPEARQPDGSLFPRRRLFGDYVASLLKPLLEDGSVRHCRAAATAVERRAGRWS
FT                   ILDDRGGVTEADIVAIATSHPPPTAPGRLASRLAAHPRFVADTTKPGALDVIRPHDRVL
FT                   VIGNGLTAADVIASLAERGHDGPVTAISRRGLRSRGHPPVPQELFGDFVSDAAHSAVSL
FT                   LRGIRAAIGAAKEEGISWHGVIDQVRAQGYDLWQALPVAERRRLVRHLRPYWDVHRFRI
FT                   APQVEAVLDAAVAAGRLDIVAGSVADARIEGELILCTLQPRHQRQPLEGRYDAVVVTTG
FT                   PAHGGILQTQPWLAALAASGHLTLDPTGLGLACTERSEAIGPSGKADPSLLISGPLARG
FT                   TFGELMGLPQVTEHAFFVAGEIAEKLRTSATNKHPA"
FT   CDS_pept        719752..720657
FT                   /transl_table=11
FT                   /locus_tag="RL0671"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar, but extended at the N-terminus, to
FT                   Oligotropha carboxidovorans (Pseudomonas carboxydovorans)
FT                   CoxK. UniProt:Q9KX21 (EMBL:OCA82447) (296 aa) fasta scores:
FT                   E()=1.1e-44, 45.763% id in 295 aa, and similar, but
FT                   extended at the N-terminus, to Rhizobium meliloti
FT                   (Sinorhizobium meliloti) hypothetical transmembrane
FT                   protein. UniProt:Q92MV5 (EMBL:SME591790) (281 aa) fasta
FT                   scores: E()=8.8e-75, 71.326% id in 279 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06165"
FT                   /db_xref="GOA:Q1MLI8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLI8"
FT                   /protein_id="CAK06165.1"
FT                   /translation="MSQAAPTLSEASPSNRFALAALLLGGAAIGGSPIFVRLSEVGPMA
FT                   TAFWRVALALIPIVIVSLMKKERGPKPQSLSDYAMLVLPGVMLALDLAAWHLSLTMTSV
FT                   ANATLLANLAPVFVTLIAFVFFSARISRVFVIGLAVALSGVVILKGGPAAIGNGDLRGD
FT                   GIAMIAAFFYACYILAIGRLRSRFDTIRIMLWSTACAAVCIFPIGLIYEGHMLPATVYG
FT                   WSIVFGLAFISHAGGQVAITYALAYLPPAFSSLTLLLQPVVAAILAWALLNEAIGTMQA
FT                   LGGAVVLAGIMIARTSRVQV"
FT   CDS_pept        complement(720670..722226)
FT                   /transl_table=11
FT                   /locus_tag="RL0672"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06166"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLI7"
FT                   /protein_id="CAK06166.1"
FT                   /translation="MVSGIHHITAVTRKVQANVDFYAGFLGMRLVKQTAGYEDATQLHL
FT                   FYGDAAGTPGSLLTFLTWEDGAPGRAGYGQISEISLSINPTSIGYWLTRAMSFGLSSEG
FT                   PADEFGEPVLRLKDPDNIILKLAGAKKLASPAAWDGASIPVEHAVQRLRGATMLTEKPA
FT                   ESRTFLETHFGYRFQASRGTIDRLVSQSGDIIDVRDARGFWSGAPGTGTVDHVAFRAAD
FT                   EETLLSVRKALEATDASPTNMHDRKYFRSLYAREPGGTLVELATDKPGMTVDEEQAALG
FT                   GKLFAPPEAITNLHDLKVMLPQFSMPGQPRVNYRELPFVHRFYTPPDPDGSVFVLLHGS
FT                   GGNETTLMPLLNKVAPRATLLGVRGRATEEGFPRWYKRITPFSFDQNDIKTEAEAFAAF
FT                   IEGAVKSYGLDPQKVVYVGYSNGANLLNSLLYLHPNLVHKAVLLRSMPVLSDYPHADLK
FT                   GTDLLVISGKTDAYGKYASELEERLKSSGATVDSDVIAGGHDLGDADVPIIQKWLLQEN
FT                   R"
FT   CDS_pept        complement(722311..723906)
FT                   /transl_table=11
FT                   /locus_tag="RL0673"
FT                   /product="putative two-component regulator sensory
FT                   histidine kinase transcriptional regulatory protein"
FT                   /note="Codons 115 to 260 are similar to codons 500 to 750
FT                   of Anabaena sp. (strain PCC 7120) alpha cyanobacterial
FT                   phytochrome A (ec 2.7.3.-). UniProt:PHYA_ANASP
FT                   (EMBL:AB028873) (765 aa) fasta scores: E()=1.6e-20, 34.274%
FT                   id in 248 aa, and codons 128 to 360 are similar to codons
FT                   1215 to the C-temrinus of Methanosarcina acetivorans
FT                   sensory transduction histidine kinase. UniProt:Q8TRB0
FT                   (EMBL:AE010795) (1456 aa) fasta scores: E()=7.1e-22,
FT                   36.481% id in 233 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06167"
FT                   /db_xref="GOA:Q1MLI6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLI6"
FT                   /protein_id="CAK06167.1"
FT                   /translation="MAEHCSILIIDDNIDDLEVYRRILGRVSSTAYTVVEAETGEEGRA
FT                   LNGRKRPDCILLDYSLPGRDGLGVLADILEDDPAANVIMLTGQGNETVAVEVMKSGARD
FT                   YLTKDSLSPETLHRCIQNAIMHGMLEAKLEQKRQSLEIFTRAMAHDLKEPLRTIKSFSR
FT                   ILHGSAALPAEDRELLDYVLSAADHMEDLIVKVSGFTKLEASGGLELRPVSLSDVLNQV
FT                   EDNLRQQTESRGAVIIRGALPEVMGDATLLTQLLQNLVSNAVRYCEQKVPEISITGEAL
FT                   ADTCRLTVRDNGPGIDPEHRELIFQPFKRLVGRGIEGTGLGLAICRRIAQMHGGSIWCE
FT                   AENGPGATFILEVPLAEARPAPSAASAVPHSARSAEQPGEGSGRLAEVLLVEDSPADIQ
FT                   LLKIKLMRRDKVNFNLHVATNGREAMRLLEERAGIADVPQIDLMLLDINMPIMDGFEVL
FT                   RALSVDVRLKRIPVCILSTSSDETDMQRARNLGARAYMVKPPTLQQLEEALEDVEHLEL
FT                   LQRGDSLALCAEQN"
FT   CDS_pept        complement(723911..724336)
FT                   /transl_table=11
FT                   /locus_tag="RL0674"
FT                   /product="putative response regulator transcriptional
FT                   regulatory protein"
FT                   /note="This CDS overlaps 11 nt at the N-terminus with
FT                   RL0675"
FT                   /db_xref="EnsemblGenomes-Gn:RL0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06168"
FT                   /db_xref="GOA:Q1MLI5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLI5"
FT                   /protein_id="CAK06168.1"
FT                   /translation="MQQRDTQPILIVEDSEDDFEATMRAFKRTNLRNSIRWAASGQEAL
FT                   DMLAEMVPKPGLILLDLNMPGLDGRKTLEAIKSNAGWRKIPVVILTTSDDERDIEGCYA
FT                   LGANTYVQKPVDLDGLFAAIQRLKEYWFEIAILPLED"
FT   CDS_pept        complement(724323..726629)
FT                   /transl_table=11
FT                   /locus_tag="RL0675"
FT                   /product="putative two component sensor histidine kinase
FT                   transcriptional regulatory protein"
FT                   /note="Similar, but extended 265 residues at the N-terminus
FT                   to Rhizobium meliloti (Sinorhizobium meliloti) FixL sensor
FT                   protein (ec 2.7.3.-). UniProt:FIXL_RHIME (EMBL:AE007255)
FT                   (505 aa) fasta scores: E()=3.8e-27, 29.709% id in 515 aa,
FT                   and codons 515 to the C-terminus are similar to codons 515
FT                   to the C-terminus of Anabaena sp. (strain PCC 7120) BphB
FT                   cyanobacterial phytochrome B (ec 2.7.3.-).
FT                   UniProt:PHYB_ANASP (EMBL:AB034952) (751 aa) fasta scores:
FT                   E()=1.4e-37, 50.417% id in 240 aa. This CDS overlaps 11 bp
FT                   at the C-terminus with RL0674"
FT                   /db_xref="EnsemblGenomes-Gn:RL0675"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06169"
FT                   /db_xref="GOA:Q1MLI4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLI4"
FT                   /protein_id="CAK06169.1"
FT                   /translation="MNLAVLRHHHTAVPLKFDIPHRRSFRKKRGTALPCLLSIPRFRKR
FT                   LPRKPKEDTRVQDQGNVDLQDQPRRHYRGFAIAVGCLMFLLGVTALAGWLLQAEIVISL
FT                   VPGFPSMAFNTALCFVLSGVGLAASTLAARRFRATAAITAGLAAAIAAARLVEIVMIGR
FT                   SFHNVDVLISRFLVSPDFIAEIGGGMGPNTALVFLIANLSLLLSLQVERSRSQVVQELT
FT                   SYVVITLGMIALAGYVTDAEQGYRWGPYAAMALHTAVGMVIFGSGLLARSWWMQPANRA
FT                   QIPLWIPAAVCFTGLLVDLYTPLGVANGILYVPLVLTALWFGNRNAPLFFAFACTVLLM
FT                   LGFFAVKHDESGFWQEIANRTITAATLWLIALFVFYFMRNTHHLESERVRFGALVRGTP
FT                   DAVVVIDERGTIKNFNPAAESMFGYSPQETIGKNIKMLMPEPYHSEHDGYLAHYRQTGE
FT                   ERIIGTTRMVSGRRKNGIVFPIDVSISAVVTGHTKTFVGIVRDISERVRQEERMKTTLS
FT                   QLEAYTAELERSNHDLDEFAYIASHDLKEPLRGLHNHSRFLLEDYEDKLDADGVRRLNR
FT                   LVRLSQRMEKLVNELLYFSRLGRQQLAVKRTDIGLIVKDVVATMELLLEERHAKVIIDG
FT                   RLPEVVCDAPRLTEVFRNLITNAVKYNDKPAPLVSIGYLDRFVGKDGTVARNVFFVKDN
FT                   GKGIPQEFHEDIFRIFKRLEKSQDSDDGTGAGLTFVRKIIARHNGDIWLESEVGTGTTF
FT                   YFTLGKKREGQNAAA"
FT   CDS_pept        726658..727035
FT                   /transl_table=11
FT                   /locus_tag="RL0676"
FT                   /product="putative two-component response regulator
FT                   transcriptional regulatory protein"
FT                   /note="Similar to codons 640 to 735 of Pseudomonas
FT                   fluorescens WspE. UniProt:Q842G9 (EMBL:AY074937) (755 aa)
FT                   fasta scores: E()=0.00012, 36.634% id in 101 aa, and codons
FT                   35 to the C-terminus are similar to codons 28 to 120 of
FT                   Anabaena sp. (strain PCC 7120) two-component response
FT                   regulator. UniProt:Q8YW80 (EMBL:BA000019) (231 aa) fasta
FT                   scores: E()=0.00011, 32.609% id in 92 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0676"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06170"
FT                   /db_xref="GOA:Q1MLI3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLI3"
FT                   /protein_id="CAK06170.1"
FT                   /translation="MTTLFYVDDSKDDLFYVDYMSKKQQLDVDLFCFSTAEMALEALET
FT                   RAAEGKTSPDLLVADLYMPLDSGIVLITRLRLDDRFKAMRLAICSGSDAAEDRARSLDA
FT                   GADVYLEKPLDLAAIILNLEM"
FT   CDS_pept        727516..728220
FT                   /transl_table=11
FT                   /locus_tag="RL0677"
FT                   /product="putative GerE family transcriptional regulator"
FT                   /note="Codons 125 to the C-terminus is similar to codons
FT                   135 to the C-terminus of Escherichia coli SdiA regulatory
FT                   protein. UniProt:SDIA_ECOLI (EMBL:A64955) (240 aa) fasta
FT                   scores: E()=4.7e-08, 38.739% id in 111 aa, and to Rhizobium
FT                   meliloti (Sinorhizobium meliloti) putative transcription
FT                   regulator protein. UniProt:Q92RN3 (EMBL:SME591785) (277 aa)
FT                   fasta scores: E()=1.3e-12, 27.391% id in 230 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0677"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06171"
FT                   /db_xref="GOA:Q1MLI2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLI2"
FT                   /protein_id="CAK06171.1"
FT                   /translation="MNNAPAIPFHAGPELSRAINRTDFFRLLKSAAQHYNFDNFALARI
FT                   SEASAPFGERDIVITNVAERRVGLFITTLKEALGTVRAKTAQFLATPVHGRSAQPEDYP
FT                   SDLVFNEFLSGVFLFIPLFTPEGRRYCLVLCGERQEPDQSEIADMLLDAMRIFDKLYEE
FT                   ILTPEMSGRLTQRESEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVH
FT                   MVAIALRNGLVS"
FT   CDS_pept        728251..728688
FT                   /transl_table=11
FT                   /locus_tag="RL0678"
FT                   /product="putative two-component response regulator
FT                   transcriptional regulatory protein"
FT                   /note="N-terminus is similar to the N-terminus of
FT                   Corynebacterium diphtheriae putative two component system
FT                   response regulator protein. UniProt:Q6NFF5 (EMBL:BX248359)
FT                   (236 aa) fasta scores: E()=0.045, 38.372% id in 86 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0678"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06172"
FT                   /db_xref="GOA:Q1MLI1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLI1"
FT                   /protein_id="CAK06172.1"
FT                   /translation="MITETSRRNAVKVLFVDDEFIEFRALKKKIADLSEPAVEVEYSQS
FT                   IGDALEKIRAARFDLILLDNRLLPNADFRDTVPELRGIGYTGPIGVVSTDISGGYFQEF
FT                   PDYGVDFRIGKDEIDAQTLQHIIREYVTYDVPDFWKDDYSI"
FT   CDS_pept        complement(728791..729507)
FT                   /transl_table=11
FT                   /locus_tag="RL0679"
FT                   /product="putative two component regulator histidine
FT                   kinase/response regulator transcriptional regulatory
FT                   protein"
FT                   /note="Similar to codons 525 to 750 of Anabaena sp. (strain
FT                   PCC 7120) alpha cyanobacterial phytochrome a (ec 2.7.3.-).
FT                   UniProt:PHYA_ANASP (EMBL:AB028873) (765 aa) fasta scores:
FT                   E()=1.5e-14, 27.928% id in 222 aa, and to codons 195 to the
FT                   C-terminus of Deinococcus radiodurans sensor histidine
FT                   kinase/response regulator. UniProt:Q9RZT4 (EMBL:C75621)
FT                   (416 aa) fasta scores: E()=9e-17, 33.486% id in 218 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0679"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06173"
FT                   /db_xref="GOA:Q1MLI0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLI0"
FT                   /protein_id="CAK06173.1"
FT                   /translation="MSSDPTRPPETNSASDSEERIKRFLATASHDLQSPLRHIAMYAEL
FT                   LLDDLEETLDGEQLQSLRMIMEKAQTAQRLTKALMSLAGGTPQVTPEEVDLQALAENVW
FT                   GELTDETAVGEAALESDGLPSIRTDPALFGLALRHLLTNALMYRGEAAPHVAIAAEREG
FT                   TDWFIRISDNGMGIDPAYRERIFEPFWKLPKPGTVQGAGLGLTTAREFLAALGGDISLE
FT                   HSDESGSRFIIRLPIT"
FT   CDS_pept        complement(729689..732250)
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="RL0680"
FT                   /product="putative transmembrane export SecD/F family
FT                   protein"
FT                   /note="Codons 35 to 520 are similar to codons 60 to the
FT                   C-terminus of Rhodobacter capsulatus (Rhodopseudomonas
FT                   capsulata) secd protein-export membrane protein secd.
FT                   UniProt:SECD_RHOCA (EMBL:RCU69979) (554 aa) fasta scores:
FT                   E()=1.3e-64, 44.960% id in 496 aa, and to entire protein of
FT                   Brucella suis protein-export membrane protein, SecD/SecF
FT                   family. UniProt:Q8FZZ6 (EMBL:AE014291) (845 aa) fasta
FT                   scores: E()=1.4e-193, 62.455% id in 839 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0680"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06174"
FT                   /db_xref="GOA:Q1MLH9"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLH9"
FT                   /protein_id="CAK06174.1"
FT                   /translation="MRTSRWLVATYTVIIVLGLLIALPNVLPQSVLQRVPAWLPHEQVS
FT                   LGLDLRGGSHLVLEVDEADLTKERLQSLLQDARRVLREKGIQPKAVVRSQNQIVVTLAD
FT                   AAQSDAAVTELKTLANPISTGLSAGQADLDVTANGATITVGFSRAGIAANVDNAVQQSL
FT                   EVIRQRVDQVGVSEPTIQRIGANRVLVQLPGAQDPSRLRELLGSTAKMSFHMLSPNNAP
FT                   GPGVTMLKDDEGRSYPVLDRVEISGDRLSDARVSFDPNTREPIVSFRFDSAGATRFAEI
FT                   TRQNVGNPFAIVLDDKVLSAPVIREPITGGSGQISGSFSADSATTLAAMLRAGALPAKL
FT                   TVIEERTVGADLGADAIRMGIYSGIVGFVLVAAFIFVLYGTWGFLANIALLIHTILTFS
FT                   ALTLVGATLTLPGIAGVVLGIGLAVDANVLINERIREETRKGKSAFAAIDTGFRRAYST
FT                   IIDGNMTALIAAAILFFFGSGPVRGFAVTMALGLIISMFTSVAFVRVAMIEITRRRKLK
FT                   VLNIRPLIPFSPYDKHIEFMKARFFGVTVSALLSIASVVLFIHPGLNYGVDFRGGIQMA
FT                   VKTQGAADLAKFREGLDSLGLGEITLQSFGDKSSILVRAQRQEGGEEAQTAAVTKLKAE
FT                   VTKIDPTATVEGTDVIGPKVSGELAWAGILSVVIASFAMLIYIWVRFEWPFAVGAIVTL
FT                   VLDVTKAIGFFAITGLDFNLTAIAAILTLVGYSVNDKVVVYDRMRENMRLYKSMPLREI
FT                   IDKSINETLARSLYTNATAFLALVPMAIWGGSAVSSFAIPMVFGILVAGASSIFIAAPI
FT                   LLFLGDWRRRHAKAAAATDEAVEIIPPGTGSPAQVRELISR"
FT   CDS_pept        complement(732334..732753)
FT                   /transl_table=11
FT                   /locus_tag="RL0681"
FT                   /product="putative transmembrane protein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:RL0681"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06175"
FT                   /db_xref="GOA:Q1MLH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLH8"
FT                   /protein_id="CAK06175.1"
FT                   /translation="MSRYGSDIAGTEKMELDQRRLTSRIAASLLVAVLAYLGLLFGGNL
FT                   VISPAAAANTLSSSDRDSQPPQLTARDAVRGLLATERKLAPKQAAHDAGPLALAVVPAV
FT                   DFSGWTMAAPFPAFEALLHAAVSRTHQPRAPPVAA"
FT   CDS_pept        complement(732769..734592)
FT                   /transl_table=11
FT                   /locus_tag="RL0682"
FT                   /product="putative transmembrane ion efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0682"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06176"
FT                   /db_xref="GOA:Q1MLH7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLH7"
FT                   /protein_id="CAK06176.1"
FT                   /translation="MMPHDTPLISTIVGGLVLAFIFGAFAHRLRMPPLVGYLIAGVLVG
FT                   PHTPGYVADQNLAPELAEIGVILLMFGVGLHFSLKDLLSVRGIAVPGAIVQIAFATLLG
FT                   WGLGAFMGWSTGGSLVFGLALSVASTVVLLKALQERRLVETERGRIAVGWLIVEDLAMV
FT                   LALVLIPAAASIGGEGHAPVEPLSAGLSRLFGLDLGIGGMIAMTLVKVALFVALMLVFG
FT                   RKLIPWTMHRIAHTGSRELFRLGVLAIALGVAFGAAKLFGVSLALGAFFAGMVLAESEL
FT                   SHRAAQESLPLRDAFAVLFFVSVGMLFDPNILIDKPLPILATIFIIVIGKSVAALLIVL
FT                   AFKKPLGTALTISASLGQIGEFSFILAALGVELGLLPEEGRDLILAGAIISIILNPLLF
FT                   FLCDRMRPLLDGAKREDVVADPAPAADAIAAQEEMPPEDDEVHPTTLSGHAILVGYGRV
FT                   GSIVGQNLKSSATPFLVIEDSDKRIGELKAQGIETLSGNAVMRETLDLANLSGARSIAI
FT                   AIPNAFEACRIIEQARSVNPSILIVARAHSDAEVDELTHYGADTVIMGEREIALGMVDR
FT                   LAQVHHESVPYEDGHEPDTIMLTDDPPPERE"
FT   CDS_pept        734624..734923
FT                   /transl_table=11
FT                   /locus_tag="RL0683"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0683"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06177"
FT                   /db_xref="GOA:Q1MLH6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLH6"
FT                   /protein_id="CAK06177.1"
FT                   /translation="MTYMVYIDQYGQLEIMGQGARETILTPALCRAARGLLDWTQTDLA
FT                   EKAAVSRSTIRDYEGRHHDIHRATEAQLRLAFEEGGVKFVEIEGTGTGLCLPTA"
FT   CDS_pept        complement(735005..736426)
FT                   /transl_table=11
FT                   /locus_tag="RL0684"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0684"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06178"
FT                   /db_xref="GOA:Q1MLH5"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLH5"
FT                   /protein_id="CAK06178.1"
FT                   /translation="MSPRSGLLIVLGFTLWRVVMLNFDATDFFVDEAQYWFWSQNLDLG
FT                   YYSKPPMIAWVIRAMTELSGSNAIYWIRLLGPLIHMAAALVLMKTAKRFVGPEIEGWTG
FT                   ATYITLPGVALSSVFFSTDVILLFFIAIALLAYFGLTQRRSVGLALVMGLGVGLAFLTK
FT                   YAVLFVVPGGAIALLLIPAARIAVRDVIIAVAVAAVVALPNLWWNLQHDNTTVRHTQDI
FT                   AHWSELGINLRRGLEFFAAQFGVVGPIIFFAMLWAVYRMIRGRSDDREKMLVWLSMPVV
FT                   LLITLQATVAKAYANWAVTAYVAGTILAVWLLYLKWPKGLRLSLTINGIASLLFPLATI
FT                   FPHQLLLPNGDALMKRYLGRAEVSREAAALATQAGTDIIVTDNRDMVADLFYTLRDASY
FT                   RIYARAPAGLPESYYEQEFALPADITGKVLFLTDGAFTCATETPEVLKNWQPTEGNYKG
FT                   KTLSIYKVSATCLAP"
FT   CDS_pept        737039..738685
FT                   /transl_table=11
FT                   /gene="hemAT"
FT                   /locus_tag="RL0685"
FT                   /product="Chemoreceptor, MCP family. No methylation
FT                   domains, homolog of HemAT"
FT                   /db_xref="EnsemblGenomes-Gn:RL0685"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06179"
FT                   /db_xref="GOA:Q1MLH4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLH4"
FT                   /protein_id="CAK06179.1"
FT                   /translation="MRQDMPSDQARGAQAGSLRDRLRFAGLDADQCELVRRNRPALEAH
FT                   LKAGLRDLFHRFQTFPDASRNFESERQVERLHDLQSSHWDVLTDARFDSLYAERVKVLS
FT                   DTESKMGLDPRWHVAGHGVMLEHVVSGLAEEIAGRPLLPSAKRRAREISDLMTAIIRIV
FT                   MVDVEIAVSLRFNALRAAQSRALADQRADNEAEITRIFGDVIESLSARDLTRRAPVDGD
FT                   GAYGGIAVALNGALDGLQAEFTTITERTVKAEAATGSLAGLSRQFAGTASGQADRLQLS
FT                   AAALAGIAGSVRDGAADSRAAEQAAATTRAAVEESGEVVGRAISAMADIEQSAEKIGQI
FT                   IGAIDEIAFQTNLLALNAGIEAARAGDSGRGFAVVAQEVRALAQRSAEAAREIKTLVTT
FT                   TKAQVDAGVQMVGRTQDSIGSIVRQVTDINAAISGIATRTGEHAASLDSVTSDVKGLGS
FT                   EVADSAGLAERSAEGADHLHTVILELGQTIREFRIARENATAGRPAPVRATPPRALEGT
FT                   TRPAPVADEYENDDFGLPQAFASVGGGRNVY"
FT   CDS_pept        738749..739045
FT                   /transl_table=11
FT                   /gene="cheX1"
FT                   /locus_tag="RL0686"
FT                   /product="putative chemotaxis related CheX protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0686"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06180"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLH3"
FT                   /protein_id="CAK06180.1"
FT                   /translation="MAAKKSGKTLDLTAVLDLNEASALRDKLLSLRGSGLSIDASGVER
FT                   IGALCAQVLMSAEKTWEQDKQPFTFSKVSDAFQKTMQLVGVNIDHLLAKEIRQ"
FT   CDS_pept        739042..739407
FT                   /transl_table=11
FT                   /gene="cheY1"
FT                   /locus_tag="RL0687"
FT                   /product="CheY protein, probably minor role in
FT                   reorientation"
FT                   /db_xref="EnsemblGenomes-Gn:RL0687"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06181"
FT                   /db_xref="GOA:Q1MLH2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLH2"
FT                   /protein_id="CAK06181.1"
FT                   /translation="MKKKVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGIEGLEVLEES
FT                   NPDVIVTDINMPRLDGFGFIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIV
FT                   KPFDPAKLIDAIERVTA"
FT   CDS_pept        739425..741710
FT                   /transl_table=11
FT                   /gene="cheA1"
FT                   /locus_tag="RL0688"
FT                   /product="CheA sensor kinase. Major chemotaxis regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RL0688"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06182"
FT                   /db_xref="GOA:Q1MLH1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLH1"
FT                   /protein_id="CAK06182.1"
FT                   /translation="MDMNEIKEIFFQECEEQLAELESGLLKMNDGDRDPETVNAVFRAV
FT                   HSIKGGAGAFGLDDLVAFAHVFETTLDCVRSNKLEPNQDVLKVMLKSADVLADLTNAAR
FT                   DGGSVDESRSRGLVKELEALANGELPSPSASAEAPAPKTAAKAAPAAPAPTTKPTDDSG
FT                   FQPVPFSFDDFGGDDDAGGMPTYEVIFKPRYELYSKGNDATLLLRDLSRLGEMTIYCNT
FT                   DDLPGLEELDPEGAYFFWNVTIKTDKGEDAIRTVFEFAEWDCELTVKPVEEARADATSN
FT                   DELPMVPVPFDLSILDETGAMEEISASDARAEETAAAVAAAETASNVTQIVAARVEKKE
FT                   SAAAAAAAASAAAQNNAAGAGQTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDTTG
FT                   TSSINMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSIRLITEGE
FT                   NTEVDKTVIDKLAEPLTHMIRNAVDHGIETPEKRAAAGKNTEGTVRLTAKHRSGRILIE
FT                   LADDGAGINREKVRQKAIDNDLIPADSNLSDEEIDNLIFLPGFSTADKISDISGRGVGM
FT                   DVVKRSIQALGGRINITSKPGHGSVFTMSLPLTLAVLDGMVVTVAGQTLVVPLTAIVET
FT                   LQPEAAAIHSFGANHRLISIRNSFCPLVDVGRILNFRATQANPVEGVALLVESEGGGQR
FT                   ALMVDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAVVGASRGQSLKA
FT                   EMSLAAVG"
FT   CDS_pept        741715..742182
FT                   /transl_table=11
FT                   /gene="cheW1"
FT                   /locus_tag="RL0689"
FT                   /product="CheW"
FT                   /db_xref="EnsemblGenomes-Gn:RL0689"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06183"
FT                   /db_xref="GOA:Q1MLH0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLH0"
FT                   /protein_id="CAK06183.1"
FT                   /translation="MSYTVKNLNEGDRELIAFRIGDQEFCVNIMSVREIRGWTPATAMP
FT                   HSPGYMLGVINLRGAVLPIIDLAARLGMKPADPTARHVIIVAQVRRKVVGLLVDAVSDI
FT                   LTVTDETIQPTPEISSELERQFARGVLAIEKRMICLIELESLFPETESEAA"
FT   CDS_pept        742179..743087
FT                   /transl_table=11
FT                   /gene="cheR1"
FT                   /locus_tag="RL0690"
FT                   /product="CheR"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:RL0690"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06184"
FT                   /db_xref="GOA:Q1MLG9"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLG9"
FT                   /protein_id="CAK06184.1"
FT                   /translation="MSVMGAKDQRQGSDEVLASGEYPLTRRDLTEIAAMIYSDAGIFLN
FT                   ETKASLVYSRLSKHIRNLGLSGFREYCDLVASPAGAAPRREMLSHLTTNFTRFFRENHH
FT                   FDHLRDHVLPELLQRAKSGGRVRIWSAASSDGQEPYSIALTVLSLMPNVADYDFKILAT
FT                   DIDPKILAIARAGAYDENALETVSPAMRKQWFSEVEIQGRRKFQVDDRVKRLITYNELN
FT                   LMAQWPFKGKFDVIFCRNVVIYFDEPTQMKIWQRFAGLLPEGGHLYIGHSERVSGEAKH
FT                   VFDNIGITTYRYTAKGLGRKA"
FT   CDS_pept        743084..744127
FT                   /transl_table=11
FT                   /gene="cheB1"
FT                   /locus_tag="RL0691"
FT                   /product="CheB methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:RL0691"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06185"
FT                   /db_xref="GOA:Q1MLG8"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLG8"
FT                   /protein_id="CAK06185.1"
FT                   /translation="MSAPARVLVVDDSATMRGLITAVLSSDPEVNVIGQAGDALEAREA
FT                   IKRLNPDVLTLDIEMPNMNGLDFLEKIMTLRPMPVIMVSTMTHRGAEATLAALEIGAFD
FT                   CVGKPAPGELRPFGDLAEKVKAAARTQRQYSQPVVAVAPPPSVADFRVGRKIVAIGSST
FT                   GGVEALIAVLQKFPANCPPTVITQHMPPTFTKSFAERLNRLCAPVVQEATDGARLEIGK
FT                   IYLAPGGERHLQVSGASAPCCRLIDRAPVNGHRPSVDVLFDSVAELAGRNAVGVILTGM
FT                   GRDGAAGLLKMRHAGARTLGQNEKTCVVYGMPRVAHELGAVEQQLPLSAIGEEILKMTA
FT                   ARKEGTE"
FT   CDS_pept        744128..744517
FT                   /transl_table=11
FT                   /gene="cheY2"
FT                   /locus_tag="RL0692"
FT                   /product="CheY2-probable major role in interaction with
FT                   flagellar motor"
FT                   /db_xref="EnsemblGenomes-Gn:RL0692"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06186"
FT                   /db_xref="GOA:Q1MLG7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLG7"
FT                   /protein_id="CAK06186.1"
FT                   /translation="MSLAEKIKVLIVDDQVTSRLLLSDALTQLGFKQITSAGDGEQGMK
FT                   IMAEQPHHLVISDFNMPKMDGIGFLQAVRTNPNTKKAAFIILTAQGDRALVQKAAQLGA
FT                   NNVLAKPFTIEKMKAAIEAVFGALK"
FT   CDS_pept        744514..745068
FT                   /transl_table=11
FT                   /gene="cheD1"
FT                   /locus_tag="RL0693"
FT                   /product="putative chemotaxis related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0693"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06187"
FT                   /db_xref="GOA:Q1MLG6"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1MLG6"
FT                   /protein_id="CAK06187.1"
FT                   /translation="MITEGAARRVHIIQGEYKVLNDPNAVLSTILGSCVAACLRDPVAG
FT                   VGGMNHFLLPGSATSPTSGGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAKTIS
FT                   TFSNVGEQNAAFAVQFLRDEGIPVVGSSTGGEHGRKLEYWPVSGRARQYPLTGAETQRT
FT                   VALEQRPAAPQKPVETSIEFF"
FT   CDS_pept        745085..745474
FT                   /transl_table=11
FT                   /locus_tag="RL0694"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0694"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLG5"
FT                   /protein_id="CAK06188.1"
FT                   /translation="MTFTQMMEPPAPVEALSDILMRIVSELHDVAYLIERIEPQLLEIG
FT                   GAEILNSPDAMKVMQGIDLAVQKSRGLAEFIDTITGEIPHGWAVDVATALSLVKLAEMQ
FT                   KALGGATRHGHSQPLSKAAGDFDFF"
FT   CDS_pept        745789..747474
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="RL0695"
FT                   /product="putative flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0695"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06189"
FT                   /db_xref="GOA:Q1MLG4"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLG4"
FT                   /protein_id="CAK06189.1"
FT                   /translation="MNLLNQLVQIFKNFGSLGRTRLMILGGVGALSIAIILAAALFVNK
FT                   PAQETLYVGLDSPDLNQISMALAEANINFQVGTDGSSISVPAGMTGKARLMLAERGLPN
FT                   SANAGYELFDNVGSLGLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNF
FT                   RKAEQKPTASVMIRASATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEA
FT                   SNSSLNRSLNIVQNVQQEVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPE
FT                   SKVERSVRSTKEAQQSQQKQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNY
FT                   EINSKTTATTRSSYKVEKLSIAVVVNKGRIAKMVGEPADQAKVDAYLAEMQKIVASAAG
FT                   IDAKRGDVVTVTAMDFLENQLLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMG
FT                   LRPLVRSINGTSAAFGDATPEAAGLELPDFAPASGAPGGALMDGFGSDFGFDSTEDLLS
FT                   LGDDDGNFNRRVKEGPERKLSRMVEINEERAAKILRKWAIDEAA"
FT   CDS_pept        747835..748623
FT                   /transl_table=11
FT                   /gene="visN"
FT                   /locus_tag="RL0696"
FT                   /product="regulator of flagellar and motility genes, also
FT                   regulates rem"
FT                   /note="Similar to entire protein of Rhizobium meliloti
FT                   (Sinorhizobium meliloti) orf12. UniProt:O54240
FT                   (EMBL:SMAJ4445) (245 aa) fasta scores: E()=3.7e-52, 64.414%
FT                   id in 222 aa, and C-terminus from codon 195 is similar to
FT                   C-terminus from codon 175 of Aeromonas salmonicida
FT                   transcriptional activator protein ahyr/asar.
FT                   UniProt:AHYR_AERHY (EMBL:ASU65741) (260 aa) fasta scores:
FT                   E()=2.9e-06, 51.515% id in 66 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0696"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06190"
FT                   /db_xref="GOA:Q1MLG3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLG3"
FT                   /protein_id="CAK06190.1"
FT                   /translation="MHRVRSFLSRRTLPMDMNVIQASKGERHMANFASAVVPDLLPRDE
FT                   LLQRLHGVASTGRLQSGLRALTDYVGASHYLLARCDLLQESGLDFIVSSDWPFDLVRDI
FT                   ANDLVRGYARSTELEKCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNVGRSRLSLMFL
FT                   FGEGFILSPERLRDVGLLAGYVASFLRCGGTKVDRDFELTDRELECLFWIAEGKTSDEI
FT                   AMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV"
FT   CDS_pept        748632..749378
FT                   /transl_table=11
FT                   /gene="visR"
FT                   /locus_tag="RL0697"
FT                   /product="regulator of flagellar and motility genes, also
FT                   regulates rem"
FT                   /note="Similar to Agrobacterium tumefaciens (strain
FT                   C58/ATCC 33970) agrr transcriptional regulator, luxr
FT                   family. UniProt:Q8UHY3 (EMBL:C97423) (251 aa) fasta scores:
FT                   E()=4.1e-50, 61.135% id in 229 aa, and to Vibrio fischeri
FT                   luxr transcriptional activator protein luxr.
FT                   UniProt:LUXR_VIBFI (EMBL:B33538) (250 aa) fasta scores:
FT                   E()=1.8e-05, 29.412% id in 170 aa"
FT                   /db_xref="EnsemblGenomes-Gn:RL0697"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06191"
FT                   /db_xref="GOA:Q1MLG2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLG2"
FT                   /protein_id="CAK06191.1"
FT                   /translation="MGYPAGRTMSSAEQLRTVRVNRISSRSDLFPRLIAMQKLAEAQGF
FT                   AIFRVSGSGLPAKQRLVCELENWGSSNAGFGKAFTDAYGDILLDHIDKSLLPLSWAGGY
FT                   DRAAPGPADFSPFMTRLQDGILPFSGLAFPVRLGAVGNGFILFTGDEIDPSSDTIVELH
FT                   GRCCHIMMDLLSLDERRTAAAEALSEREIACLQLAGDGRISEEIADKLGLSVHTVNAYL
FT                   GSATIKLDSVNRIQAIAKAIRLGYIS"
FT   CDS_pept        complement(749461..749904)
FT                   /transl_table=11
FT                   /locus_tag="RL0698"
FT                   /product="putative flagellin related gene"
FT                   /product="hypothetical protein atu0565/agr_c_992"
FT                   /db_xref="EnsemblGenomes-Gn:RL0698"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06192"
FT                   /db_xref="InterPro:IPR017024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLG1"
FT                   /protein_id="CAK06192.1"
FT                   /translation="MKKCPHSTQREKILADAISPVATELRLLDASDLISLLRFEYYGNL
FT                   SDLVASAAELFFHPGTVNFGLGGNYTLEWGGNPEVVLDLEIKPRGVTVYAQLTLAEDHA
FT                   GIEISHIAFQDPSADPDENTIFLKKSLREARYSVNQPPQALTG"
FT   CDS_pept        complement(749910..751007)
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="RL0699"
FT                   /product="putative flagellar biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0699"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06193"
FT                   /db_xref="GOA:Q1MLG0"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLG0"
FT                   /protein_id="CAK06193.1"
FT                   /translation="MTEGRDLADDDKDSKTEAPTAKKQSDAAEKGNVPSSRELSIFATI
FT                   LATFIYLVFFLPESVGRMTEMLRDIFEQPDQWKIETGPDVLALFVRIGWASAALVAPAF
FT                   ILFMVFGVASSVFQNLPTPVLERIRPQASRISPIKGWSRLFSVPGLVEFGKSLFKVVVV
FT                   GVILFFVLRSEYFGSIDAMFSDPQTILVRMMAAMRKIIIVMLIATAIVAIADLFWTRHH
FT                   WFTELKMTRHEVKEENKQAQGDPFVKSRQRSLMRDRARRRMIANVDRATLVIANPTHYA
FT                   VALRYAREENDAPVVLAKGQDLIALKIREIAEKNGIPVFEDPPLARSMFAQVSIDSVIP
FT                   SVFYKAVAELIHRVYAADAKNKRVR"
FT   CDS_pept        complement(751223..752260)
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="RL0700"
FT                   /product="putative flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:RL0700"
FT                   /db_xref="EnsemblGenomes-Tr:CAK06194"
FT                   /db_xref="GOA:Q1MLF9"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:Q1MLF9"
FT                   /protein_id="CAK06194.1"
FT                   /translation="MDFDDFGGALAGKPLTQAEKAAAVLLAMGKGVAGRLLKYFTQAEL
FT                   QTIISSAQSLRAIPPDELLLLVSEFEDLFTEGAGLMDNAKAIEAILEEGLTPDEVDSLL
FT                   GRRTAFQAYETSIWDRLSEAEPTFVAQFLLREHPQTVAYILSMMPSSFGAKVLLQLPDN
FT                   RRADIMNRTVNMKAVSPKAAQIIENQVMTLLAEVEAERNAAGSTKVADLMNELDKPQVD
FT                   TLLSSLESISRESVNKVRPKIFLFEDLMYMPQRSRVMLLNDISTDVLTVALRGSPPEIR
FT                   ESVLSAISPRQRRMIESDLQSGMGGVNPREIAIARRAVAQEAIRLANSGQIELKEKEGD
FT                   ASAAA"
FT   CDS_pept        complement(752292..752879)
FT                   /transl_table=11
FT                   /gene="fliN"
FT