(data stored in ACNUC7421 zone)

EMBL: AM260479

ID   AM260479; SV 1; circular; genomic DNA; STD; PRO; 4052032 BP.
XX
AC   AM260479;
XX
PR   Project:PRJNA13603;
XX
DT   30-AUG-2006 (Rel. 89, Created)
DT   07-MAR-2015 (Rel. 124, Last updated, Version 4)
XX
DE   Ralstonia eutropha H16 chromosome 1
XX
KW   complete genome.
XX
OS   Cupriavidus necator H16
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Cupriavidus.
XX
RN   [1]
RP   1-4052032
RA   Fricke W.F.;
RT   ;
RL   Submitted (06-APR-2006) to the INSDC.
RL   Fricke W.F., Institute for Microbiology and Genetics, Goettingen Genomics
RL   Laboratory, Grisebachstr. 8, Goettingen 37077, GERMANY.
XX
RN   [2]
RX   DOI; 10.1038/nbt1244.
RX   PUBMED; 16964242.
RA   Pohlmann A., Fricke W.F., Reinecke F., Kusian B., Liesegang H., Cramm R.,
RA   Eitinger T., Ewering C., Potter M., Schwartz E., Strittmatter A., Voss I.,
RA   Gottschalk G., Steinbuechel A., Friedrich B., Bowien B.;
RT   "Genome sequence of the bioplastic-producing "Knallgas" bacterium Ralstonia
RT   eutropha H16";
RL   Nat. Biotechnol. 24(10):1257-1262(2006).
XX
DR   MD5; 10bcd8e240a70b952b1d205544d27977.
DR   BioSample; SAMEA3283071.
DR   EnsemblGenomes-Gn; EBG00001193277.
DR   EnsemblGenomes-Gn; EBG00001193278.
DR   EnsemblGenomes-Gn; EBG00001193279.
DR   EnsemblGenomes-Gn; EBG00001193280.
DR   EnsemblGenomes-Gn; EBG00001193281.
DR   EnsemblGenomes-Gn; EBG00001193282.
DR   EnsemblGenomes-Gn; EBG00001193283.
DR   EnsemblGenomes-Gn; EBG00001193284.
DR   EnsemblGenomes-Gn; EBG00001193285.
DR   EnsemblGenomes-Gn; EBG00001193286.
DR   EnsemblGenomes-Gn; EBG00001193287.
DR   EnsemblGenomes-Gn; EBG00001193288.
DR   EnsemblGenomes-Gn; EBG00001193289.
DR   EnsemblGenomes-Gn; EBG00001193290.
DR   EnsemblGenomes-Gn; EBG00001193291.
DR   EnsemblGenomes-Gn; EBG00001193292.
DR   EnsemblGenomes-Gn; EBG00001193293.
DR   EnsemblGenomes-Gn; EBG00001193294.
DR   EnsemblGenomes-Gn; EBG00001193295.
DR   EnsemblGenomes-Gn; EBG00001193296.
DR   EnsemblGenomes-Gn; EBG00001193297.
DR   EnsemblGenomes-Gn; EBG00001193298.
DR   EnsemblGenomes-Gn; EBG00001193299.
DR   EnsemblGenomes-Gn; EBG00001193300.
DR   EnsemblGenomes-Gn; EBG00001193301.
DR   EnsemblGenomes-Gn; EBG00001193302.
DR   EnsemblGenomes-Gn; EBG00001193303.
DR   EnsemblGenomes-Gn; EBG00001193304.
DR   EnsemblGenomes-Gn; EBG00001193305.
DR   EnsemblGenomes-Gn; EBG00001193306.
DR   EnsemblGenomes-Gn; EBG00001193307.
DR   EnsemblGenomes-Gn; EBG00001193308.
DR   EnsemblGenomes-Gn; EBG00001193309.
DR   EnsemblGenomes-Gn; EBG00001193310.
DR   EnsemblGenomes-Gn; EBG00001193311.
DR   EnsemblGenomes-Gn; EBG00001193312.
DR   EnsemblGenomes-Gn; EBG00001193313.
DR   EnsemblGenomes-Gn; EBG00001193314.
DR   EnsemblGenomes-Gn; EBG00001193315.
DR   EnsemblGenomes-Gn; EBG00001193316.
DR   EnsemblGenomes-Gn; EBG00001193317.
DR   EnsemblGenomes-Gn; EBG00001193318.
DR   EnsemblGenomes-Gn; EBG00001193319.
DR   EnsemblGenomes-Gn; EBG00001193320.
DR   EnsemblGenomes-Gn; EBG00001193321.
DR   EnsemblGenomes-Gn; EBG00001193322.
DR   EnsemblGenomes-Gn; EBG00001193323.
DR   EnsemblGenomes-Gn; EBG00001193324.
DR   EnsemblGenomes-Gn; EBG00001193325.
DR   EnsemblGenomes-Gn; EBG00001193326.
DR   EnsemblGenomes-Gn; EBG00001193327.
DR   EnsemblGenomes-Gn; EBG00001193328.
DR   EnsemblGenomes-Gn; EBG00001193329.
DR   EnsemblGenomes-Gn; EBG00001193330.
DR   EnsemblGenomes-Gn; EBG00001193331.
DR   EnsemblGenomes-Gn; EBG00001193332.
DR   EnsemblGenomes-Gn; EBG00001193333.
DR   EnsemblGenomes-Gn; EBG00001193334.
DR   EnsemblGenomes-Gn; EBG00001193335.
DR   EnsemblGenomes-Gn; EBG00001193336.
DR   EnsemblGenomes-Gn; EBG00001193337.
DR   EnsemblGenomes-Gn; EBG00001193338.
DR   EnsemblGenomes-Gn; EBG00001193339.
DR   EnsemblGenomes-Gn; EBG00001193340.
DR   EnsemblGenomes-Gn; EBG00001193341.
DR   EnsemblGenomes-Gn; EBG00001193342.
DR   EnsemblGenomes-Gn; EBG00001193343.
DR   EnsemblGenomes-Gn; EBG00001193344.
DR   EnsemblGenomes-Gn; EBG00001193345.
DR   EnsemblGenomes-Gn; EBG00001193346.
DR   EnsemblGenomes-Gn; EBG00001193347.
DR   EnsemblGenomes-Gn; EBG00001193348.
DR   EnsemblGenomes-Gn; EBG00001193349.
DR   EnsemblGenomes-Gn; EBG00001193350.
DR   EnsemblGenomes-Gn; EBG00001193351.
DR   EnsemblGenomes-Gn; EBG00001193352.
DR   EnsemblGenomes-Gn; H16_A0268.
DR   EnsemblGenomes-Gn; H16_A0373.
DR   EnsemblGenomes-Gn; H16_A0539.
DR   EnsemblGenomes-Gn; H16_A0765.
DR   EnsemblGenomes-Gn; H16_A0945.
DR   EnsemblGenomes-Gn; H16_A0957.
DR   EnsemblGenomes-Gn; H16_A0998.
DR   EnsemblGenomes-Gn; H16_A1049.
DR   EnsemblGenomes-Gn; H16_A1226.
DR   EnsemblGenomes-Gn; H16_A1338.
DR   EnsemblGenomes-Gn; H16_A1347.
DR   EnsemblGenomes-Gn; H16_A1361.
DR   EnsemblGenomes-Gn; H16_A1364.
DR   EnsemblGenomes-Gn; H16_A1405.
DR   EnsemblGenomes-Gn; H16_A1478.
DR   EnsemblGenomes-Gn; H16_A1486.
DR   EnsemblGenomes-Gn; H16_A1498.
DR   EnsemblGenomes-Gn; H16_A1659.
DR   EnsemblGenomes-Gn; H16_A1660.
DR   EnsemblGenomes-Gn; H16_A1661.
DR   EnsemblGenomes-Gn; H16_A2077.
DR   EnsemblGenomes-Gn; H16_A2126.
DR   EnsemblGenomes-Gn; H16_A2127.
DR   EnsemblGenomes-Gn; H16_A2286.
DR   EnsemblGenomes-Gn; H16_A2350.
DR   EnsemblGenomes-Gn; H16_A2400.
DR   EnsemblGenomes-Gn; H16_A2401.
DR   EnsemblGenomes-Gn; H16_A2402.
DR   EnsemblGenomes-Gn; H16_A2427.
DR   EnsemblGenomes-Gn; H16_A2429.
DR   EnsemblGenomes-Gn; H16_A2468.
DR   EnsemblGenomes-Gn; H16_A2523.
DR   EnsemblGenomes-Gn; H16_A2539.
DR   EnsemblGenomes-Gn; H16_A2543.
DR   EnsemblGenomes-Gn; H16_A2544.
DR   EnsemblGenomes-Gn; H16_A2545.
DR   EnsemblGenomes-Gn; H16_A2593.
DR   EnsemblGenomes-Gn; H16_A2679.
DR   EnsemblGenomes-Gn; H16_A2824.
DR   EnsemblGenomes-Gn; H16_A2869.
DR   EnsemblGenomes-Gn; H16_A3006.
DR   EnsemblGenomes-Gn; H16_A3254.
DR   EnsemblGenomes-Gn; H16_A3302.
DR   EnsemblGenomes-Gn; H16_A3303.
DR   EnsemblGenomes-Gn; H16_A3304.
DR   EnsemblGenomes-Gn; H16_A3305.
DR   EnsemblGenomes-Gn; H16_A3306.
DR   EnsemblGenomes-Gn; H16_A3393.
DR   EnsemblGenomes-Gn; H16_A3504.
DR   EnsemblGenomes-Gn; H16_A3506.
DR   EnsemblGenomes-Gn; H16_A3507.
DR   EnsemblGenomes-Gn; H16_A3508.
DR   EnsemblGenomes-Gn; H16_A3509.
DR   EnsemblGenomes-Gn; H16_A3510.
DR   EnsemblGenomes-Gn; H16_A3511.
DR   EnsemblGenomes-Gn; H16_A3512.
DR   EnsemblGenomes-Gn; H16_A3513.
DR   EnsemblGenomes-Gn; H16_A3562.
DR   EnsemblGenomes-Gn; H16_A3613.
DR   EnsemblGenomes-Gn; H16_A3693.
DR   EnsemblGenomes-Tr; EBT00001771547.
DR   EnsemblGenomes-Tr; EBT00001771548.
DR   EnsemblGenomes-Tr; EBT00001771549.
DR   EnsemblGenomes-Tr; EBT00001771550.
DR   EnsemblGenomes-Tr; EBT00001771551.
DR   EnsemblGenomes-Tr; EBT00001771552.
DR   EnsemblGenomes-Tr; EBT00001771553.
DR   EnsemblGenomes-Tr; EBT00001771554.
DR   EnsemblGenomes-Tr; EBT00001771555.
DR   EnsemblGenomes-Tr; EBT00001771556.
DR   EnsemblGenomes-Tr; EBT00001771557.
DR   EnsemblGenomes-Tr; EBT00001771558.
DR   EnsemblGenomes-Tr; EBT00001771559.
DR   EnsemblGenomes-Tr; EBT00001771560.
DR   EnsemblGenomes-Tr; EBT00001771561.
DR   EnsemblGenomes-Tr; EBT00001771562.
DR   EnsemblGenomes-Tr; EBT00001771563.
DR   EnsemblGenomes-Tr; EBT00001771564.
DR   EnsemblGenomes-Tr; EBT00001771565.
DR   EnsemblGenomes-Tr; EBT00001771566.
DR   EnsemblGenomes-Tr; EBT00001771567.
DR   EnsemblGenomes-Tr; EBT00001771568.
DR   EnsemblGenomes-Tr; EBT00001771569.
DR   EnsemblGenomes-Tr; EBT00001771570.
DR   EnsemblGenomes-Tr; EBT00001771571.
DR   EnsemblGenomes-Tr; EBT00001771572.
DR   EnsemblGenomes-Tr; EBT00001771573.
DR   EnsemblGenomes-Tr; EBT00001771574.
DR   EnsemblGenomes-Tr; EBT00001771575.
DR   EnsemblGenomes-Tr; EBT00001771576.
DR   EnsemblGenomes-Tr; EBT00001771577.
DR   EnsemblGenomes-Tr; EBT00001771578.
DR   EnsemblGenomes-Tr; EBT00001771579.
DR   EnsemblGenomes-Tr; EBT00001771580.
DR   EnsemblGenomes-Tr; EBT00001771581.
DR   EnsemblGenomes-Tr; EBT00001771582.
DR   EnsemblGenomes-Tr; EBT00001771583.
DR   EnsemblGenomes-Tr; EBT00001771584.
DR   EnsemblGenomes-Tr; EBT00001771585.
DR   EnsemblGenomes-Tr; EBT00001771586.
DR   EnsemblGenomes-Tr; EBT00001771587.
DR   EnsemblGenomes-Tr; EBT00001771588.
DR   EnsemblGenomes-Tr; EBT00001771589.
DR   EnsemblGenomes-Tr; EBT00001771590.
DR   EnsemblGenomes-Tr; EBT00001771591.
DR   EnsemblGenomes-Tr; EBT00001771592.
DR   EnsemblGenomes-Tr; EBT00001771593.
DR   EnsemblGenomes-Tr; EBT00001771594.
DR   EnsemblGenomes-Tr; EBT00001771595.
DR   EnsemblGenomes-Tr; EBT00001771596.
DR   EnsemblGenomes-Tr; EBT00001771597.
DR   EnsemblGenomes-Tr; EBT00001771598.
DR   EnsemblGenomes-Tr; EBT00001771599.
DR   EnsemblGenomes-Tr; EBT00001771600.
DR   EnsemblGenomes-Tr; EBT00001771601.
DR   EnsemblGenomes-Tr; EBT00001771602.
DR   EnsemblGenomes-Tr; EBT00001771603.
DR   EnsemblGenomes-Tr; EBT00001771604.
DR   EnsemblGenomes-Tr; EBT00001771605.
DR   EnsemblGenomes-Tr; EBT00001771606.
DR   EnsemblGenomes-Tr; EBT00001771607.
DR   EnsemblGenomes-Tr; EBT00001771608.
DR   EnsemblGenomes-Tr; EBT00001771609.
DR   EnsemblGenomes-Tr; EBT00001771610.
DR   EnsemblGenomes-Tr; EBT00001771611.
DR   EnsemblGenomes-Tr; EBT00001771612.
DR   EnsemblGenomes-Tr; EBT00001771613.
DR   EnsemblGenomes-Tr; EBT00001771614.
DR   EnsemblGenomes-Tr; EBT00001771615.
DR   EnsemblGenomes-Tr; EBT00001771616.
DR   EnsemblGenomes-Tr; EBT00001771617.
DR   EnsemblGenomes-Tr; EBT00001771618.
DR   EnsemblGenomes-Tr; EBT00001771619.
DR   EnsemblGenomes-Tr; EBT00001771620.
DR   EnsemblGenomes-Tr; EBT00001771621.
DR   EnsemblGenomes-Tr; EBT00001771622.
DR   EnsemblGenomes-Tr; H16_A0268-1.
DR   EnsemblGenomes-Tr; H16_A0373-1.
DR   EnsemblGenomes-Tr; H16_A0539-1.
DR   EnsemblGenomes-Tr; H16_A0765-1.
DR   EnsemblGenomes-Tr; H16_A0945-1.
DR   EnsemblGenomes-Tr; H16_A0957-1.
DR   EnsemblGenomes-Tr; H16_A0998-1.
DR   EnsemblGenomes-Tr; H16_A1049-1.
DR   EnsemblGenomes-Tr; H16_A1226-1.
DR   EnsemblGenomes-Tr; H16_A1338-1.
DR   EnsemblGenomes-Tr; H16_A1347-1.
DR   EnsemblGenomes-Tr; H16_A1361-1.
DR   EnsemblGenomes-Tr; H16_A1364-1.
DR   EnsemblGenomes-Tr; H16_A1405-1.
DR   EnsemblGenomes-Tr; H16_A1478-1.
DR   EnsemblGenomes-Tr; H16_A1486-1.
DR   EnsemblGenomes-Tr; H16_A1498-1.
DR   EnsemblGenomes-Tr; H16_A1659-1.
DR   EnsemblGenomes-Tr; H16_A1660-1.
DR   EnsemblGenomes-Tr; H16_A1661-1.
DR   EnsemblGenomes-Tr; H16_A2077-1.
DR   EnsemblGenomes-Tr; H16_A2126-1.
DR   EnsemblGenomes-Tr; H16_A2127-1.
DR   EnsemblGenomes-Tr; H16_A2286-1.
DR   EnsemblGenomes-Tr; H16_A2350-1.
DR   EnsemblGenomes-Tr; H16_A2400-1.
DR   EnsemblGenomes-Tr; H16_A2401-1.
DR   EnsemblGenomes-Tr; H16_A2402-1.
DR   EnsemblGenomes-Tr; H16_A2427-1.
DR   EnsemblGenomes-Tr; H16_A2429-1.
DR   EnsemblGenomes-Tr; H16_A2468-1.
DR   EnsemblGenomes-Tr; H16_A2523-1.
DR   EnsemblGenomes-Tr; H16_A2539-1.
DR   EnsemblGenomes-Tr; H16_A2543-1.
DR   EnsemblGenomes-Tr; H16_A2544-1.
DR   EnsemblGenomes-Tr; H16_A2545-1.
DR   EnsemblGenomes-Tr; H16_A2593-1.
DR   EnsemblGenomes-Tr; H16_A2679-1.
DR   EnsemblGenomes-Tr; H16_A2824-1.
DR   EnsemblGenomes-Tr; H16_A2869-1.
DR   EnsemblGenomes-Tr; H16_A3006-1.
DR   EnsemblGenomes-Tr; H16_A3254-1.
DR   EnsemblGenomes-Tr; H16_A3302-1.
DR   EnsemblGenomes-Tr; H16_A3303-1.
DR   EnsemblGenomes-Tr; H16_A3304-1.
DR   EnsemblGenomes-Tr; H16_A3305-1.
DR   EnsemblGenomes-Tr; H16_A3306-1.
DR   EnsemblGenomes-Tr; H16_A3393-1.
DR   EnsemblGenomes-Tr; H16_A3504-1.
DR   EnsemblGenomes-Tr; H16_A3506-1.
DR   EnsemblGenomes-Tr; H16_A3507-1.
DR   EnsemblGenomes-Tr; H16_A3508-1.
DR   EnsemblGenomes-Tr; H16_A3509-1.
DR   EnsemblGenomes-Tr; H16_A3510-1.
DR   EnsemblGenomes-Tr; H16_A3511-1.
DR   EnsemblGenomes-Tr; H16_A3512-1.
DR   EnsemblGenomes-Tr; H16_A3513-1.
DR   EnsemblGenomes-Tr; H16_A3562-1.
DR   EnsemblGenomes-Tr; H16_A3613-1.
DR   EnsemblGenomes-Tr; H16_A3693-1.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2670826; 19338657.
DR   EuropePMC; PMC2747907; 19648235.
DR   EuropePMC; PMC4034039; 24904560.
DR   EuropePMC; PMC4230905; 25401070.
DR   EuropePMC; PMC4777769; 26941158.
DR   EuropePMC; PMC5696724; 29201140.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; AM260479.
DR   SILVA-SSU; AM260479.
DR   StrainInfo; 122962; 0.
XX
CC   URL -- http://www.g2l.bio.uni-goettingen.de
CC   Contacts: Heiko Liesegang (hlieseg@gwdg.de)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4052032
FT                   /organism="Cupriavidus necator H16"
FT                   /chromosome="1"
FT                   /strain="H16"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:381666"
FT   misc_binding    complement(398..408)
FT                   /bound_moiety="DnaA"
FT                   /note="DnaA binding site"
FT   CDS_pept        689..2455
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="H16_A0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /function="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91153"
FT                   /db_xref="GOA:Q0KFR8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFR8"
FT                   /inference="protein motif:PFAM:PF00308"
FT                   /protein_id="CAJ91153.1"
FT                   /translation="MQDFWQAAAAQLERELTPQQFKTWIKPLAPVAFDEETHALRIAAP
FT                   NRFKLDWVKSQFSGRITALACEYWEAQVSVQFVLDPAASGRAAAYMQPAQPGMGPGGMD
FT                   GHAAPGTGMGGYPGAQPMGGQAMGQPPFAMPGQQPGYGYGEPVSAAGYGMGQPPYGNPG
FT                   NPGNPAGMPSAAPVPAGARGQPHPGQHGHQPHGADMGEIDVVQMDPAEASARSYRAPPQ
FT                   QPQQQPHQQMGGATPMPGHQPSDTVHERSRLNPILTFDNFVTGKANQLARAAAIQVANN
FT                   PGKSYNPLYLYGGVGLGKTHLIHAIGNFMLLENPRARIRYIHAEQYVSDVVKAYQRKAF
FT                   DEFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEISGI
FT                   DDRLISRFDSGLTVAIEPPELEMRVAILMKKAAAENVNVPEEVAFFVAKHLRSNVRELE
FT                   GALRKILAFSNFHGKDITIEVTREALKDLLTVQNRQISVENIQKTCADFYNIKVADMYS
FT                   KKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLN
FT                   HELHVLEQTLKG"
FT   CDS_pept        2823..3938
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="H16_A0002"
FT                   /product="DNA polymerase III beta subunit"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="2.7.7.7"
FT                   /note="POL3Bc"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91154"
FT                   /db_xref="GOA:Q0KFR7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFR7"
FT                   /protein_id="CAJ91154.1"
FT                   /translation="MQLVKTSRDNLLRPLQIVSGIVERRHTLPILANLLIRKSGSNVSF
FT                   LSTDIEIQITTHAECGVGSDSVATTVAARKLLDILRAMPDGDVALSLNDKRMTVQSGKS
FT                   RFALQTLAAEEFPTVAEASEFNASVSLPQKTFKHLLAMVHFAMAQQDIRYYLNGMLLVV
FT                   EGKKVMAVATDGHRLAYCGVELETEAVGVGARQEVIIPRKTILELQRLLEDNDDPVQVQ
FT                   LAANQVKFTFANIELISKLVEGKFPDFQRVIPKGYKNAFAIDRVRLQQALQRTAILTTD
FT                   KFKGVRCILDTHMLKISSTNADQEEAQEELELDYSGDALDIGFNVTYLLDVLANLKSEQ
FT                   VQVSLGDSNSSALITVPEDDNFKYVVMPMRI"
FT   CDS_pept        4168..6693
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="H16_A0003"
FT                   /product="DNA gyrase subunit B"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91155"
FT                   /db_xref="GOA:Q0KFR6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFR6"
FT                   /inference="protein motif:COGS:COG0187"
FT                   /inference="protein motif:SMART:smart00433"
FT                   /inference="protein motif:PFAM:PF00204"
FT                   /protein_id="CAJ91155.1"
FT                   /translation="MTEQQNPQQENTYGASSIQILEGLEAVRKRPGMYIGDTSDGTGLH
FT                   HLVFEVLDNSIDEALAGYCTEIQVTIHSDNSISIVDNGRGIPPLVKFDDKHEPKRSAAE
FT                   IAMTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSKWLRLTVRRDGQVHLIEFAKGDVQ
FT                   NRIVETVTGPDGQPVEVSPMKIIGATDKRGTEVHFLADEEIFTNVEFHYEILSKRIREL
FT                   SFLNNGVHIKLVDQRTGKEEDFAFSGGVKGFVEYINRSKSVLHPNIFYANTEKDGIAVE
FT                   VAMQWNDGYNEQVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIEENEVAKKAKVETTG
FT                   DDMREGLSCVLSVKVPEPKFSSQTKDKLVSSEVRLPVEELVGKALNDFLLETPGDAKII
FT                   CGKIVDAARAREAARKAREMTRRKGLMDGMGLPGKLADCQEKDPALSELFLVEGDSAGG
FT                   SAKQGRDRKFQAILPLKGKILNVERARFDKMLSSQEVLTLITALGTGIGKDDYNLDKLR
FT                   YHRIIIMTDADVDGSHIRTLLLTFFYRQMPDIIERGYVYIAQPPLYKIKHGKEERYIKD
FT                   DVELNAYLLKLAMEKAVLVRPDGSEINGDALTELARQYQLTEGVISRLSRVVDTDALRA
FT                   IADGVPLDLDSAAAAEASAVALKAKLAEMHAKTLIGAAVNDDGTADVYAQFDEKTDKHR
FT                   LMIARRHHGNVRLSHLDADFVHGADYAALSNAAKTFQGLTPEGTKVQRGEGEKLRDQTV
FT                   NDFHGAMQWLLAEAERGVSRQRYKGLGEMNPEQLFETTLDVTQRRLLKVQIEDAIAADQ
FT                   IFTTLMGDEVEPRRNFIESNALVARNIDV"
FT   CDS_pept        6960..9467
FT                   /transl_table=11
FT                   /gene="h16_A0004"
FT                   /locus_tag="H16_A0004"
FT                   /product="Type I restriction-modification system
FT                   methylation subunit"
FT                   /function="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91156"
FT                   /db_xref="GOA:Q0KFR5"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFR5"
FT                   /inference="protein motif:PFAM:Methylase_M"
FT                   /inference="protein motif:PFAM:N6_Mtase"
FT                   /protein_id="CAJ91156.1"
FT                   /translation="MPLTLPQLERHLFKAADILRGKMDASEFKEYIFGMLFLKRCSDVF
FT                   DQRREEVIAERMNAGESRANAEKSAELERWYKGAEYFWVPPRSRYKFLLDEAHQNVGDS
FT                   LNKALSGIETANTKLYDVLEHIDFTRKVGQSKIPDIKLRQLITHFGIYRLRNEDFEFPD
FT                   LLGAAYEYLIGEFADSAGKKGGEFYTPRSVVRMMVRLIQPTLAHDIYDPCCGSGGMLIA
FT                   AKEYIDEHGEDGRKANLFGQEFNGTVWSIAKMNMLLHGISTANLQNEDTLAEPQHVEGG
FT                   ELMHFDRVLTNPPFSINWGNTEKNADGTPAWSPKFPERFRYGQVPLGAKKADLMFLQHM
FT                   LAVTRDGGMVATVMPHGVLFRGGEEKAIRAGIVEDDLLEAVLGVAPNLFYGTGIPACIL
FT                   VLRQRVQNGANRVSGKPAERRGKVLFINADREFFEGRAQNHLLPEHIEKIVTTFNEFKQ
FT                   VEGFSAIVDNATLKANDYNLNIRRYADNTPPPEPHDVRAHLVGGVPKAEVQAKSTLFAA
FT                   HGLNPMDLFVERDAKYVDFKPELAKRRDLKPSIERNAGLVAKEAAIRAAFEQWWHQHSA
FT                   RITLLAGQMDNAASLVGLRNDLLASFSESLEAIGMLDPFQVRGIVAGFWYQTKYDFLTL
FT                   MARGAKGVADAWRTSIVTALEDKANKESPLDHKLVKFLMSDFVDAINELEAKRAELDSQ
FT                   IKAADPKSGKDAEGDEGDAAESSEDEPADDNAVDETQLKAWKKELATAKKALKAKKDSF
FT                   AAHLNREVDGLSPEQAAELLLTILHNDMRAIVERYIAAQRKAIVVAFENWWDKYRVTLT
FT                   EIEGKRDSAAQALQVFLKGLRYV"
FT   CDS_pept        9460..10728
FT                   /transl_table=11
FT                   /gene="h16_A0005"
FT                   /locus_tag="H16_A0005"
FT                   /product="Type I restriction-modification system
FT                   specificity subunit"
FT                   /function="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91157"
FT                   /db_xref="GOA:Q0KFR4"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFR4"
FT                   /inference="protein motif:PFAM:Methylase_S"
FT                   /protein_id="CAJ91157.1"
FT                   /translation="MSNFVALGDHITVQKGKAPLVTGYVGKGAEPYLSPEYLRGRAPAD
FT                   LAKAGPDAVRAAEGETILLWDGSNAGEFFRSKVGLVASTMTKISPSSVFRPAYFFHVAK
FT                   QAERFLKAQTNGTGIPHVDRELLEGIKVFCPGSTEQQLLAEILDTLDTAIYETEAIIAK
FT                   LKAVKQGLLHDLLTRGIDANGELRPPQAEAPHLYESSPLGWIPNEWGLAPTATRCHLIT
FT                   KGTTPAANEMWQGGAGIRFLRVDNLSFDGQLDLDASTFRVSLATHKGFLARSRCLEGDV
FT                   LTNIVGPPLGKLGLVTKEIGEVNINQAIALFRPTEQLLPKFLLIWLSSSISQSWLRNRA
FT                   KQTSGQVNLTLALCQELPLPRMTINEQQAIVDRVDAAQEQIWCEEELIRKMRLEKSGLM
FT                   DDLLTGRVRVKPQLAETKQAGSA"
FT   CDS_pept        10728..14048
FT                   /transl_table=11
FT                   /gene="h16_A0006"
FT                   /locus_tag="H16_A0006"
FT                   /product="Type I restriction-modification system
FT                   restriction subunit"
FT                   /function="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91158"
FT                   /db_xref="GOA:Q0KFR3"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFR3"
FT                   /inference="protein motif:PFAM:HSDR_N"
FT                   /protein_id="CAJ91158.1"
FT                   /translation="MGWELEDVEKPFVAQLQTQGWTHIEGSLENPTSTCRTSFTEVIQE
FT                   PVLREALRALNPGPDGQPWVDDARLSEAMAAITRLGTRRLMEANERATELLIKGLTVEG
FT                   LPGWDGGRGQTIRYIDWDIPANNRFTVVNQYRVDCPPGFNSAKAFIVPDLVLLVNGIPL
FT                   VIVECKSPSIPEPLAEAVDQLRRYSNQRKAAFEVDDNEGNEVLFATNQLLIASCVDEAR
FT                   VGCIGAGFEHYAQWKTVVGPDGSGSEAEVAQALGESKLNEQERLIAGLLAPAHLLDVVK
FT                   NFLLFMQVGGQTIKSVCRYQQYRAVNRAIARLRTGQTRLQHGEHDQRGGIIWHTQGSGK
FT                   SLTMVFLVRKMRAEAQLRRFKVIVVTDRKDLQSQLSVTATLTGEVVEVADSTAGIKALV
FT                   RRKGPGLIFATIQKYRDPDTAGDSPLAAEDLPELEQPRATYKTGEKFEVLNEDESILVL
FT                   VDEAHRTQAGDLHANLLAGLPNCARIGFTGTPIIMGEKKRTHEIFGEFIDRYTIKEAEA
FT                   DGATVPVLYEGRTANGAIKDGASLDELFEDLFRQHTPEELEVIKQKYATKGHIFDAPAL
FT                   IADKARDIIRHYVTNILPNGYKAQVVAYSRLAAIRYFGALRRARDELLLEAQALSPEDK
FT                   ALDDEALCQRSPKMQAVVQAWRYQGILARIEFAPIISGSNNDDPAWKNWTDAAAHDQLI
FT                   KRFKKPLFHAKPEKTDPLAFLVVKSMLLTGFDAPIEGVMYLDRPIREAELLQAIARVNR
FT                   TGFGKRCGIVVDYYGVAQHLKEALAAYADEDVEGALASLKDEVPVLRDRHLRVADLFRQ
FT                   RGIESLDDTEACVEALGSEKLRAEFAVKLKAFLASLDTVLPRPEGLPYSGDAKRLAYIY
FT                   ARARNRYKDTPVLGKDVGAKVRKLIDDHVISLGVDPKVPPIQLTDAEFDTHLARTVNDR
FT                   AKASEMEHAIRSHIRKHTDEDPVLYRKLSERLNDILKTLGEKWNEVIAQLQEIIDELRT
FT                   GKASSDNTPGDLPEHCAPFLRTVLDVVCAGQTPTSAELLRLKDVTVELVDLLVQELKEN
FT                   PKIWSANKIPDQENLRDGVLFEHLMRLRPPLLDADRAGVLADKLIDQARASHDKLMQV"
FT   CDS_pept        14053..14766
FT                   /transl_table=11
FT                   /gene="h16_A0007"
FT                   /locus_tag="H16_A0007"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /function="General function prediction only"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91159"
FT                   /db_xref="GOA:Q0KFR2"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFR2"
FT                   /inference="protein motif:COGS:COG1451"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="CAJ91159.1"
FT                   /translation="MPSPVKLPSLQIGDLRFTLQRSARRRTMQITVERSGDLMLCAPPE
FT                   VDEAALRAFVLEKRFWIYTKLAEKDRLQRQVPRKEFVGGEGFLYLGRSHRLKVVDEQNV
FT                   PLKLNGGRFCLRRDALPAAREHFIRWYGERAKAWLSGRVADYQSRMEVTPAGVKVQDLG
FT                   YRWGSCGKGDWLYFHWKAILLPARIAEYVVVHEIAHLHEPHHTPAFWLRVERAMPDYAQ
FT                   RKAWLAEHGIDVEGI"
FT   CDS_pept        14773..17151
FT                   /transl_table=11
FT                   /gene="h16_A0008"
FT                   /locus_tag="H16_A0008"
FT                   /product="5-Methylcytosine-specific restriction enzyme B"
FT                   /function="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91160"
FT                   /db_xref="GOA:Q0KFR1"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFR1"
FT                   /protein_id="CAJ91160.1"
FT                   /translation="MADYFTSDYFKLLNKWKGQKRDESNPEQNRAYEDLKKAYEVTEAW
FT                   ADKVKAELFPVGRVEIRKRPTNQGNNFASYNWAKIYPSSEAPKELAYTVGIGADDGFVV
FT                   KIDTVGLDELDATRKAYLALRGAYNNTSPFIATLPASDGLGKSLDQLVAWSVEAIRNFK
FT                   LRYDEVVVKLNLGKKLSDEDLLKHFDGKPVFRTFRASWSAQDKALFCRLARVVHAAGLD
FT                   WWHMGKGVQVRFGRKNPGSERAVGVLGVIRGTRIRKISWTRELGEVPKLHREPLTERLV
FT                   ANIEAALSAERDSLDDWLVLDTERPGLWPDELRDDPVEPEEDSDEEEPADNDEVRQPIN
FT                   RIYYGPPGTGKTYELSKLLKREYEQAMTAVSNAEWREQLIATRIATLTWWEGAAAALYE
FT                   LGGKAKVGQLYEHPFIQAIAAAKGRKQNVRQTLWGTLQHHTVEDSHTVNTKMRLAPAVF
FT                   DKTTDSVWQFAGDWKEAVADVIETVKAYQIGAPASGKVQRYSFVTFHQSYGYEEFVEGL
FT                   RPVLNGDAEAGEIQYEIRAGVFKELCRRARSAPDQRFAMVIDEINRGNISKIFGELITL
FT                   IEPDKREGADNAVSVTLPSGDGFSVPSNVDIIGTMNTADRSLALLDTALRRRFEFVPVM
FT                   PDARDESGAPLAGLRVTLGEQVIDVPRMLDAINQRVEALYDRDHCIGHAYFTTLAKFPD
FT                   GDERLVALQQVFSTRILPLLEEYFFEDWQKIRLVLADNQKPAAAQFVAESQDHEDDLAR
FT                   LFGSDHGLDSYGSKRRYALQEAAFSNLDAYIGIYQTLST"
FT   CDS_pept        17160..18512
FT                   /transl_table=11
FT                   /gene="h16_A0009"
FT                   /locus_tag="H16_A0009"
FT                   /product="5-Methylcytosine-specific restriction enzyme C"
FT                   /function="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91161"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFR0"
FT                   /protein_id="CAJ91161.1"
FT                   /translation="MQVNGITIFEFETLIAATAGVAGTEGLHAVPDAVYGWLEDQCLRA
FT                   AEQGEAAWLRLAQRRGRRVVQVTSFVGVIRAPDGFQIEVLPKVGKAIGGGAVEARKLLI
FT                   EMLCCLQGFRHVKTDSANISAARMPLLEVFVAEFLRAVDHIVKRGLRSDYSSRQDNLYA
FT                   LRGKLLIAPHLQQNLYRADRFFTDHDEFTIDRPENRLLHAALRRVLELSASQLNQLARE
FT                   LAFVFAEVPVSAQPQIDFQRVRLDRGMGYYADALAWARLILDEESPLTGAGAHCAPSML
FT                   FPMEAVFEAFVAKHLAKQLARPLILKSQARSHHLVRHREQNWFRLKPDLLIRNADRDLL
FT                   VLDTKWKLLDGMKANGTDKYGLSQSDFYQLQAYGQSYLSGRGDVVLIYPKTASFERPVP
FT                   VFEFPKVEGLRLWVLPFCLKSRRLLVPDGAPFITVFPDRDPVEAAKSSAVG"
FT   CDS_pept        18786..19367
FT                   /transl_table=11
FT                   /gene="h16_A0010"
FT                   /locus_tag="H16_A0010"
FT                   /product="putative phage-related protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFQ9"
FT                   /protein_id="CAJ91162.1"
FT                   /translation="MTNKTRDRDVRAAVFRKVLAEHVADPNVLVVEELGLQHGLCRVDI
FT                   AVVNGFLHGYELKSDADTLERLPAQVEAYSKAMDRATLVVGEHHLGSAESILPPWWGIK
FT                   VASVGKRGAVSIETHRAVGANPSVSAFHVAHLLWRPEVTKILEERGVEKRRLRGNRREL
FT                   YEIAAALVPLSELRQLVRESLKTRTTWRHP"
FT   CDS_pept        complement(19324..20559)
FT                   /transl_table=11
FT                   /gene="h16_A0011"
FT                   /locus_tag="H16_A0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91163"
FT                   /db_xref="InterPro:IPR025683"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFQ8"
FT                   /protein_id="CAJ91163.1"
FT                   /translation="MFSGTTPIDPAQTSFRLPTKAVFTKNTKSAHLCCFWRGQMPLDTN
FT                   ERFNHIHYVPILKWRQGEYQALWRLSDAAKQWITPLLEIPTEPWDFETETPAKSLDEHL
FT                   ERFGNRLKSKWDTRRCFIDSCYIDGVAQMSTGQHHLEFLFEQARNEGASPIPVTGLGRH
FT                   PDYDAAVHNIVAQDQRGACVRLSAEDFSASILNDLQNLFARLNVGPPDSHLVIDMAEDI
FT                   SGSPVAQGLAWKALLQQTPWLNDWKSVTVAATAFPSALPAAQFRPHGLTPRTEWNAYNA
FT                   LLTNLGGLRIPTFGDYSVSHPQTELLDPRVLDPNAKIKYTVDGEWLVHTGAQVKKHGRG
FT                   QFQGLCQELIANPSAAFPGPTYSWGDAYIHGCASGTETTGGTSTWPSVGNNRHITKVIR
FT                   DVATLFGSSTIP"
FT   CDS_pept        complement(20763..21236)
FT                   /transl_table=11
FT                   /gene="h16_A0012"
FT                   /locus_tag="H16_A0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91164"
FT                   /db_xref="GOA:Q0KFQ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFQ7"
FT                   /protein_id="CAJ91164.1"
FT                   /translation="MGACFFLALINTYILKLALRKSFESSRISEQLLRWISVAAKSMEG
FT                   LDKDDRGPIRDSISTELTRRLKKYHSKRMLSESLFSISAVIVYASIYLIFINHSNLSKI
FT                   EFSYLELIVGSVSTLLCFFCHRNSIRYALSRVVPLQVCLTAMTGELAFSIDAD"
FT   CDS_pept        complement(21451..22293)
FT                   /transl_table=11
FT                   /gene="h16_A0013"
FT                   /locus_tag="H16_A0013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFQ6"
FT                   /protein_id="CAJ91165.1"
FT                   /translation="MRDNNHVSLRVLGRSMISIQAAADRAYLDIKYGNIWKHARLPIAF
FT                   YDDADFIVGDPEKGSYIIKFLSEQGEAIVKRLRQAIADPYRSAIEGGEQEIFSIKRQIE
FT                   ARKNQVDNVILVPQTFDEFLQAPDELATRAYGDKSINKNIDHMLSPVRKDPDAILKISL
FT                   KPNYRERTETFTFTQKEAIAFKKVVSQRQLGNPVIYHGRLRALDRGHNQKANFKGKFIN
FT                   AANDRDLALFIQSEQDYSDLVPYMDRENLTIVACPIVEYDSFDPVAGDIQFVKILTDG"
FT   CDS_pept        complement(22436..23551)
FT                   /transl_table=11
FT                   /gene="h16_A0014"
FT                   /locus_tag="H16_A0014"
FT                   /product="predicted restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91166"
FT                   /db_xref="GOA:Q0KFQ5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR021961"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFQ5"
FT                   /protein_id="CAJ91166.1"
FT                   /translation="MQSLSVVMENYLATKSALSGKARNANTPDQISISKTLPQFFIDIL
FT                   ERLERRGAFKVEGSYGQGNIAGVPWIGVFNLEITTSAQNGYYIVLLFSEDMKSCYLSLN
FT                   QGVTTLKNAYGVEVALHKLRGAAELALEAFVPAAGTVKGPIDLKASRALGKGYERGAIE
FT                   SFRYDFSALPTPDSLELDFRSLLGHYDTLANKVGPSLQALVPVNETQFQKAVLEKATAT
FT                   TKKDCPPFVEPPGGVPVLPKRGNGGSWKYPRDPLVAAEAVKSAEYRCELFPEHQTFKSS
FT                   SKNVPYVEAHHLIPLSRQADFQFSLDITANIIALCPTCHQRLHHGHASERRSPLRRLLS
FT                   QRKDRLQEKQIFIEEEILLHIYSNDILDNED"
FT   CDS_pept        24045..24374
FT                   /transl_table=11
FT                   /gene="h16_A0015"
FT                   /locus_tag="H16_A0015"
FT                   /product="conserved hypothetical protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91167"
FT                   /db_xref="InterPro:IPR009957"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFQ4"
FT                   /inference="protein motif:PFAM:PF07363"
FT                   /protein_id="CAJ91167.1"
FT                   /translation="MQSTTPAPQEPTLAQKQAQLAENLAKIDRAQARRQAKAAPPPPST
FT                   AITLEDHILEATDDILRVSAGLQSFLTLLELQSDTIPQGIGLHALLLPLKQQLVDTADR
FT                   LQALV"
FT   CDS_pept        complement(24477..25538)
FT                   /transl_table=11
FT                   /gene="h16_A0016"
FT                   /locus_tag="H16_A0016"
FT                   /product="putative signal transduction protein"
FT                   /note="DUF2"
FT                   /note="DUF1"
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91168"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFQ3"
FT                   /protein_id="CAJ91168.1"
FT                   /translation="MARLAGDEFTVILPAVGDAGVAGGIAEAILERIAAPYRLAGELVV
FT                   VSASIGVATWPKDADNAEDLLVCADQAMFAAKEEGRNRWKVFTQALLQAERERLRITQD
FT                   LRTALASGQFALHYQPIVNLRTGKVCKAEALIRWDHPVRGPIHPADFIAVAEESGLIID
FT                   IGRWVLTEALDQLARWQVLLGKGFQISVNKSPVEFCAPASGPESWSSMIERRNVPVGSL
FT                   VIEITEGSLMEQNADVMDQLSRFQAAGIEIALDDFGTGYSSLSYLRRLDIDYIKIDQSF
FT                   IRSLTRGPDDVALCHAIISMAHALRIRVIAEGIETESQRDILLAAGCDYGQGHFFCPPV
FT                   EASAFEAYVSAVT"
FT   CDS_pept        complement(26086..27024)
FT                   /transl_table=11
FT                   /gene="h16_A0017"
FT                   /locus_tag="H16_A0017"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91169"
FT                   /db_xref="GOA:Q0KFQ2"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFQ2"
FT                   /inference="protein motif:CDD:cd01919"
FT                   /inference="protein motif:CDD:cd00223"
FT                   /protein_id="CAJ91169.1"
FT                   /translation="MQLKQLYFELYPEIQNHPERSRMLLQALQALAATGAIMLPARASW
FT                   EKVGQPALPMWIKLVRTHNEAPKEDFSKIPWVPELGFWPELTSAQLAAAKCINEFLLQR
FT                   RGNLQRIPIKERSLEIFGDEKRLDAMRQGNTLFSGRLSLDTLGAFTVPLPLPYRPAPVS
FT                   GKPLLVVENHNSYWSFGEWNQRALRYSAVVYGAGEAFRSTGAALRQVLHEVKGTDVLYL
FT                   GDLDPKGIGIPLDFNRSSASDEPKVAPAMEWYEWLLSHGFRRKKAVCTNAHPQSAIDWL
FT                   GETLGEELAELWRGECWIPQEALGFEQLSAL"
FT   CDS_pept        complement(27081..31499)
FT                   /transl_table=11
FT                   /gene="h16_A0018"
FT                   /locus_tag="H16_A0018"
FT                   /product="chromosome segregation ATPase"
FT                   /function="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91170"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFQ1"
FT                   /inference="protein motif:COGS:COG1196"
FT                   /protein_id="CAJ91170.1"
FT                   /translation="MQKISRIYLGNCGYLMAWYDGLLFDLTDPETHQPTDTIINLENGG
FT                   GKTSLLSLIFSCFDTGQDRFLKHLQSKNNHFSQYFSQDGLPGFILVEWEMPSRTAGGEP
FT                   YRLVVGQVVSIKAGNDVPESDRMFFSFEATSGLMLEMIPAPKLGTAPVTSLAEFSRWVH
FT                   EEQRKHPDVYVTRKQADWQRHLREERLIDLEMLQMQVNFSVQEGGFDTGFLNFSSEAAF
FT                   LQKFFHLTLDAQRAAAVRDAVAAACDKLRRKPHYQAKLTELTKFRAVLRSFEETAHAYR
FT                   LSLADQMSVLVNGARLALALHERANTRRSKQQAELTFERDQRAVAATAASDVLGYSSQA
FT                   ASMASLIHVRAVRAALERTKQAALSLTDLQNDIKYVRAARVLAEVDAADKRLQTLEAQA
FT                   DLAKEGLQPFRDQLETEGALLRTALFKHEQALRETQRKIEKESIDRNDTVTGHRTALAE
FT                   DEKRRRTAVNEQAKLTELEKAWEREHTRMVTSGLLSDAGEVTQVAVARWGETEQQMRRE
FT                   EAAHKIAQSQHEQQQGHWSSEEVRLGSEAGRFEGEIQSTADFIGEGTAERERLSQLPAI
FT                   LLAVESDTASPDSPALPSVLERVAAASASEISLSDVRLAELHATMQAIHETGVAGSSPD
FT                   VARVVARLREAGVRSARPFNEYLADALPDAERARGLVLSDPARFLGVSVAQSEMEKARG
FT                   IEWHGQKLTRPVVVSPLALESAAAAPTRLVVPAASDAAYNRAAAETLAGTLSETIRLEE
FT                   NRRAGYYQRQTDALAAMQALQTYVLRFGEGKLAAANLRRNELQSQLRSTLERKEKAREK
FT                   AAAEAAEAKISNEAAVKCDRLALEACSHLQVLQRFMAEYEANREERLLRLDELEVILED
FT                   LEVRRLATEDEIQRLEDITREQSKVAIKAENSADNLAGERSRIEFYDKTLAADEHLKAN
FT                   PRDLEMLRGTYSDALTVYKAKAQDQLGVLEVQMQEARRRRDEKKQEYTRDYPGVTRTHV
FT                   APFEGQDHCAMLVGLEAKRTLVNKEHLDAVSAKGAAEHASEDWHKNNRDVPPATPDIEA
FT                   LDAAALDARKDEAVRMSEEAGARQKNASDVADRARGTAMRLGEAAGQDDRLAELLKSTM
FT                   KLEATPNPELLALEIASLTGQPPVLLEQLGELVLEEDASDQVTRAVKNHGAKSGLCDRA
FT                   RDNARTVFDAVKLAAGDPELQKVEPELAIAMLANEFTAACSDAARLLEGLEDRIHTTQD
FT                   NLDKMQADFDACVEEMLALSRIALGLLNSAIDKRVPATAPYVAGKAVLKMRANFAAINV
FT                   ESRRQALTHYLDSLIQANVPPGKGSDLVAEAVLRMYGGRPLGLQVLRMVIDESQQYVPV
FT                   EKISNSGGEGVVMALFLYVVITQLRAETQAKLHKLAGGPLILDNPFAKATSPTMWKAQR
FT                   LLAQSMGVQLVFATAIQDYNALAEFSAFVRLRRAGQNSKTGRWHLESVRYRLNEEMANP
FT                   ELAAPSTIEAA"
FT   CDS_pept        complement(31501..32241)
FT                   /transl_table=11
FT                   /gene="h16_A0019"
FT                   /locus_tag="H16_A0019"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFQ0"
FT                   /protein_id="CAJ91171.1"
FT                   /translation="MSDIQIGVRQAARLVYKALHTTLSPVNDQEYRQLLAQYRANPAFA
FT                   AQVQDVATGMELIILDVSERGLIIVPASRESRFAIRMTDIRTGLDAAQKASLLLAHVAI
FT                   AAVFFPTTDGLDDDNYTPPPALVSTCRDTLHALARRLRESSNPPADIPPELAPGWESVS
FT                   AMPLVLPAGQRASVNSLVGIVKLALGHMQTHGLVRLDREADDDASVTYTATHRLRVQLR
FT                   EIALRRLFDIAQEAARMPATTTET"
FT   CDS_pept        complement(32238..33803)
FT                   /transl_table=11
FT                   /gene="h16_A0020"
FT                   /locus_tag="H16_A0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91172"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFP9"
FT                   /inference="protein motif:COGS:COG1367"
FT                   /protein_id="CAJ91172.1"
FT                   /translation="MSVTPPRDTLAMHSQSTSSNEFAPLESDILEQMSEQGGATVPDAI
FT                   EMGALAPSSGLIDLSRQQRNLLLLRPLFQLELNKQRIGEDGTLFEGIDTHYLLLSSLDR
FT                   MMEGTTVSTGCTSDEVLTHIADTVMAMKPSLSAVQSGKVADTVLAALDNKANGYKEFSF
FT                   EYFHATHKSTRSIRFRLVAYEPDIEDVYRYKPTAEGYLVYLGMLDLSPEDAQELMEKML
FT                   ELLVQRGRFDAALEIARRARTLSIEYRQLIRDRLYQAYRAPGTVNWKRDISAGLDRARE
FT                   HVRQRQAEDQRMEESVLLALRQAEEPKARANLALLLKTLQGASMLRSQLVGDISRANDR
FT                   FLEAQRTLFRARRATGLPDLETRLLPQFIELPVNILAEQAENALSAMYSPALPRVYDLN
FT                   SLFSLLLEQRVEDGDPGEDDGEITPFVPPPLQFDEAVIRQVTDWLTERFSLGQSWRLDE
FT                   LLDQAEDMGFDRTIRRCLVLMLFRAYSHSETEFKNMRADALDEFIADVARGTNLRFTPK
FT                   ERHS"
FT   CDS_pept        complement(34342..34863)
FT                   /transl_table=11
FT                   /gene="h16_A0021"
FT                   /locus_tag="H16_A0021"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91173"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFP8"
FT                   /protein_id="CAJ91173.1"
FT                   /translation="MKRILVLFFGLALVPPAFAQVPSQVFDSCVLMESYKAAKYQELGG
FT                   DATVIDDEIPGYSVLSYQHKGIAYGYASSASSQPDFLVVGSQRVSILKAQRVGKANPER
FT                   IDPAQAVYGIVRYKARAYYCVASNFEGLGRSGSFQNIRAAYIAPLNASSKALKMSGLYY
FT                   SVRDIRNIPR"
FT   CDS_pept        complement(34860..35474)
FT                   /transl_table=11
FT                   /gene="h16_A0022"
FT                   /locus_tag="H16_A0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="HhH2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91174"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFP7"
FT                   /inference="protein motif:COGS:COG3773"
FT                   /protein_id="CAJ91174.1"
FT                   /translation="MTEKLDSETRLLAAMAYGESSTADVFEEMAALANVMVRQSRARGY
FT                   STIAAFTAKEASFSYVVADGNKRYAKLMTAKDEEIENSPSMSDAVKAAKNALNGGEDYS
FT                   NGAYFWDGADIRSNYKNHFKVAKGIRFTDPSHNIYGIKESTKLVKKIKTTKIKVNGKIE
FT                   TRKEELWRYDHIYQSTAAYGGTIFWKQNPDYIRYTHAKEYL"
FT   CDS_pept        complement(35471..36031)
FT                   /transl_table=11
FT                   /gene="h16_A0023"
FT                   /locus_tag="H16_A0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91175"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFP6"
FT                   /inference="protein motif:COGS:COG4104"
FT                   /protein_id="CAJ91175.1"
FT                   /translation="MMPDTRYALRNGDKTSTDGVLNGTARNSLDHGVALAVEGDYATCP
FT                   ACKAGGPVMNDCYPAFDIGGKQVLVSGARVYCKCQTKPVVLPSQISFTIEVNKSGTAYL
FT                   SAGSNGDSSLEPLSNSQDIVEQYFEITDEDGQPVEGYRYDLFANGEQLARNRRMISGRT
FT                   ISFEGSHDIHIVMWLDKTGQERA"
FT   CDS_pept        36695..37024
FT                   /transl_table=11
FT                   /gene="h16_A0024"
FT                   /locus_tag="H16_A0024"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91176"
FT                   /db_xref="GOA:Q0KFP5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFP5"
FT                   /protein_id="CAJ91176.1"
FT                   /translation="MWRVGETDKNRSYVLWLGSAAVAITLFSLIGGYRLDFEGRVAAKR
FT                   VALYQEWEGMLDPAAKVVGYVEPRTECRLFQVGAKSIPNFRVRCGSLIGWTAEGYSFDP
FT                   PITTR"
FT   CDS_pept        complement(37110..39752)
FT                   /transl_table=11
FT                   /gene="h16_A0025"
FT                   /locus_tag="H16_A0025"
FT                   /product="predicted signal transduction protein containing
FT                   PAS, GGDEF and EAL domains"
FT                   /function="Signal transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91177"
FT                   /db_xref="GOA:Q0KFP4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFP4"
FT                   /inference="protein motif:CDD:cd01948"
FT                   /inference="protein motif:CDD:cd01949"
FT                   /inference="protein motif:CDD:cd00130"
FT                   /protein_id="CAJ91177.1"
FT                   /translation="MPERSTTRYGKALQRLHQFFSPLNLAAAAWLIATWAFAAFQLVSE
FT                   RDRLLHDAAERTQAQAQAFGAYSKSSILRLSEFLLDLRASWLVGQPGFIDMVRERQNLV
FT                   VDLSFQVSVIDKHGLLIYSSIAPPTPGQKVDLSEREHFRVHQNAGGRDMLFISDPVKGK
FT                   VSRKWSIQFTRPILRAGSFDGVIVVSVSPEQFASFAQSFTNRDGEVASVVKTSGQVIAR
FT                   VPAMEGTLARAVSNRPYLASGSPQSGSYRAVSGSEGVERVFGYYRLPEFGLNFVVGESV
FT                   GLVLAPYEVYRRVALAGAMASTLLLGLLYYSLRRSMGERRRHMEEMKLASLVYSSSSEA
FT                   MVVTSLDGTIIDVNPAFAAATGYTAKEVKGRPGHIVSGAGNAAGLVERLRTTVASKGRW
FT                   SGEFSIRRKDGSEFPAYLTVDTYLAHAYGERRRVALIHDMTEKRQAEEVIRHQANFDAL
FT                   TDLPNRRLFFDRLRQEIERSRGTQDVLALLFIDLDRFKEVNDTLGHDQGDLLLLEAARR
FT                   IAASVRASDTVARLAGDEFTVILPAVGDAGVAGGIAQAILERIAAPYRLAGELVVVSAS
FT                   IGVATWPKDADNAEDLLVCADQAMFAAKEEGRNRWKVFTQALLQAERERLRITQDLRTA
FT                   LASGQFALHYQPIVDLRTGKVCKAEALIRWDHPVRGPIHPADFIAVAEESGLIIDIGRW
FT                   VLTEALDQLARWQVLLGKGFQISVNKSPVEFSAPAIGPESWSSMIERRNVPVGSLVIEI
FT                   TEGSLMEQNADVMDQLSRFQAAGIEIALDDFGTGYSSLSYLRRLDIDYIKIDQSFIRSL
FT                   TRGPDDVALCHAIISMAHALRIRVIAEGVETESQRDILVAAGCDYGQGHFFCPPVEASA
FT                   FEAFVSAVT"
FT   CDS_pept        complement(40214..40975)
FT                   /transl_table=11
FT                   /gene="h16_A0026"
FT                   /locus_tag="H16_A0026"
FT                   /product="hypothetical integral membrane protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91178"
FT                   /db_xref="GOA:Q0KFP3"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFP3"
FT                   /inference="protein motif:PFAM:DUF218"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="CAJ91178.1"
FT                   /translation="MGLALCGALLLSDAIALMTMGLFNFGIVLPGCIGASFLLLAWQWP
FT                   RVAHWRAASHRRQQLWQAAWIAFALWLATVAIFFYNIHRSTEAAIPGSSPVKAIVILGS
FT                   GTPNCVASPTLVARLDQGLKQAQRWPQAKVAVSGGQDFGLRCREADIMAEYLIDRGVAA
FT                   DRVVREGRSTSTEENLLFSRRLLEEQGIAATDPIVVVTSDFHVRRAVRIARKAGFGEVA
FT                   GVGAGTPLYLRYNAWLREYFAAISGWVLMEY"
FT   CDS_pept        41654..42160
FT                   /transl_table=11
FT                   /gene="h16_A0027"
FT                   /locus_tag="H16_A0027"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91179"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFP2"
FT                   /protein_id="CAJ91179.1"
FT                   /translation="MTDSPKLTSEERLLAAIAYGESSTRDQYEEMAALASVMVRQMKAR
FT                   GYSSIDAFTSKDKNFSFVRTDGNARYAKLMKSTEKDAHLMPSLLDLAETPAEARHALLL
FT                   RAWQAAQCGDPPVVCSMAARTGARHGRRQPSGGMPDGHRPRRRACPVALPRSPRFRAYG
FT                   LATVA"
FT   CDS_pept        42132..42650
FT                   /transl_table=11
FT                   /gene="h16_A0028"
FT                   /locus_tag="H16_A0028"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91180"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFP1"
FT                   /protein_id="CAJ91180.1"
FT                   /translation="MHMAWLLWPEQLHALFGPCEVWGFAWTGDWYALDRPPSQAQPDSA
FT                   DPRPWWPDASQWATVKQTTDIEQVLVRMAGKAKPSIAQAPNVDRLLRFAADELRVSSDL
FT                   DRKHYATYAAAFGQPFENHTKLQALWPAVASGEMTLRQALAQLSSHDWQLMKIMAETAR
FT                   KTASASHYG"
FT   CDS_pept        42643..45204
FT                   /transl_table=11
FT                   /gene="h16_A0029"
FT                   /locus_tag="H16_A0029"
FT                   /product="hypothetical membrane anchored protein"
FT                   /note="3 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91181"
FT                   /db_xref="GOA:Q0KFP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFP0"
FT                   /protein_id="CAJ91181.1"
FT                   /translation="MDNATSAVDRFTPSVKGCSFCDHPPGLAVLPVRYAVVGPEGKQGA
FT                   PALAGNFKIVDAPAQLGGGAQYTLRAMRPGFLYVFHEALQHWDCYLVLNGGHLWKIIPE
FT                   RPAPPKTPTEFFCSVGIGHGYTSMYFTIPNLKDATTVWYAYSHVQWTQAQLNDNKNQPD
FT                   LRKKHMQSLDVKAWMGGHNAPHAARMTELGKQVASFAMPPKDQDEAFKYLSAPPRVKAD
FT                   DHLDLIGSPAGAILSEAMERVSPGDAMLLAFNDPLGIAEDLGKLTNPKLHPKANNSVIW
FT                   DKATDLFLNTLEKNIRANAEAQHTKEAEAALAEAERTATTPEGFPAYELMSALFNGKAT
FT                   AERWKREDAAREATRLERLKAASDAAWKPYEDELTPGKRHQNLAPRLKMLNENVLAPIA
FT                   ASLAQWLVSPQLAAYMQYRHDKLELPHGYVYNESLTRCLENALDTVECRRVIKRWFDDA
FT                   NPVRHDNLLARALMLDHKPIIDTVADPTDQGYGAIFGILKSGIDNMDVTAKGLTLPEAL
FT                   AKMSLVPRLTWILADEVIPALANKVGSASARLALYGMSLSSGVRLVSRTASVMQIRATV
FT                   LSDLEAVNPALYKQLGRTQRREEAAAWARRASSKLAQSARLVWFRTEDLGSNAELSVLK
FT                   LRTENDVPGVRQVKAVLGSRFVNVGAVACILQGLALYHATQSFRAAGEFDEVEKGTKLV
FT                   GGLVAMAGTVAEQAGVALEKAPTHPLVQRIMRSPSKAEWAETGKKLAVKGRWIGFAGAV
FT                   VGVGWDAYHGADEGRKGNYFVSGLYFTSAGSGLATAILPLASEEFLAFLVGVPSWPFLV
FT                   VLFAVNVGILLLDDPATLKWIKRCRFSKAPASEHYSSGGIV"
FT   CDS_pept        45247..46362
FT                   /transl_table=11
FT                   /gene="h16_A0030"
FT                   /locus_tag="H16_A0030"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="2 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91182"
FT                   /db_xref="GOA:Q0KFN9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFN9"
FT                   /protein_id="CAJ91182.1"
FT                   /translation="MKFPTKDERTPFYFRQTGKPLGKWELEHRLSIRRPVSEQVVEYGN
FT                   VYRIDSTCLEITDESQMRIQNVGMLWIICSFATIFMLLGTVFFASAPFRETAEVMARKG
FT                   NWAGVILGTTVGIIGTGFFGLLAFDPMRRNMFTLKRRPIRLNRKTRRIYAIRTKDPGGI
FT                   WEVPWSEDEFFCVGHRRMGGLSRAYDMYDIRHYQLDAEGNVVRAFVLGQFALTLEEIYA
FT                   QWEYYRRYMQDGPANLPEPYRFWPPRETFWEGYKICRGGKFSGAFWAMIDFIFSPFALL
FT                   DAFARWLVLATCGDPVWPPEIEAACKPTPNDPYARPYADDYIGVPSGPDAKPSREDLER
FT                   MWAQEPQRRREGALTRAEAEDLIRRQTEVTV"
FT   CDS_pept        complement(46589..47911)
FT                   /transl_table=11
FT                   /gene="h16_A0031"
FT                   /locus_tag="H16_A0031"
FT                   /product="MFS transporter, ACS family"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /note="11 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91183"
FT                   /db_xref="GOA:Q0KFN8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFN8"
FT                   /inference="protein motif:TCDB:2.A.1.14"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /inference="protein motif:COGS:COG2814"
FT                   /protein_id="CAJ91183.1"
FT                   /translation="METTHMQTVPASGAPPLATPTDRPLTALLFRKLMPLLVLSYVISF
FT                   LDRTNIALAKTHIAVDLNISAAAYGLGAGLFFLSYALLEIPSNLIMHRVGARFWITRIM
FT                   VTWGLLSAAMAFVQGETSFYIMRVLLGAAEAGLFPGVMLYLTYWFGREDRARAVGYFLL
FT                   GVCIANIVSGPLGGALLGMDGMWGFKGWQWMFVLEGLPAVFLAAVVWKKLPDGPDSAPW
FT                   LTPVQAQEVRSRLAAEAADASAGKGGHSFLGAMRDPQVWLAIFIYFCHQISIYTVIFFL
FT                   PGIIGTYGKLTPVEIGLLNSLPWIAAAIGAAWLPRHANTPRRGRRLLCLGLVVMAGGLL
FT                   IAAFAGPVMALVGFSLTALMFFVVQSIVFLFPSSRLKGVALAGGLALINTCGLVGGFIG
FT                   PSVMGIIEQATGSTRNGLVIMAGLLLVACAVAPFLRQGQER"
FT   CDS_pept        complement(48020..48952)
FT                   /transl_table=11
FT                   /gene="h16_A0032"
FT                   /locus_tag="H16_A0032"
FT                   /product="Prokaryotic protein of unknown function,predicted
FT                   cytosolic protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91184"
FT                   /db_xref="GOA:Q0KFN7"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFN7"
FT                   /protein_id="CAJ91184.1"
FT                   /translation="MAKRAKAIITCAPTGAIHTPSMSPHLPVSADEIATAAIDAARAGA
FT                   AILHLHARDPKDGHPSQDPELFRPFLARISAETDAVINITTGGSPHMTVEERMLPATTF
FT                   KPELASLNMGSMNFGLFPMLDRFKEFQHDWEREHLENSRNLIFKNTYQDIENILRIGNA
FT                   NGTRFEFECYDISHLYNLRHFLDRGLVSGPVFIQSVFGILGGIGPDPEDLMHMHRTARR
FT                   LFGDQFRWSILGAGRGQLPLATIGAAMGASVRVGLEDSLWIGPGQLAASSAEQVTRIRT
FT                   VLEALNIDVATPDEARDILDLKGAAGTAF"
FT   CDS_pept        complement(49037..49819)
FT                   /transl_table=11
FT                   /gene="h16_A0033"
FT                   /locus_tag="H16_A0033"
FT                   /product="short chain dehydrogenase"
FT                   /function="General function prediction only"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91185"
FT                   /db_xref="GOA:Q0KFN6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFN6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="CAJ91185.1"
FT                   /translation="MWKDESLAGKRVLVTAGADGIGLEITRAFVEAGARVAVCDVAGGS
FT                   LERVCAELPGVVAVRADVSKESDVEALFQAVDGAFGGLDVLVNNAGVAGPTGGVETLSL
FT                   ADWERTLAVNITGQFLCARAAVPRLRQGRSPSIVNLSSAAGHLGMPGRSAYSASKWAVV
FT                   GFTKSLALELGADGIRVNTVLPGAVDGPRIRAVIAAKAESLGKPLEEVTRNYTSQAALC
FT                   RMVTMRDIANMVRFLCSDQAANVHGQEMVVDGLTQALS"
FT   CDS_pept        49916..50698
FT                   /transl_table=11
FT                   /gene="h16_A0034"
FT                   /locus_tag="H16_A0034"
FT                   /product="transcriptional regulator, GntR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91186"
FT                   /db_xref="GOA:Q0KFN5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFN5"
FT                   /inference="protein motif:COGS:COG1802"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="CAJ91186.1"
FT                   /translation="MLRGMTLNDLVTPLVRQTLSRDVYTQLRDLLISGQMMPGEQISLR
FT                   NIAAALGVSVMPVREAVHRLVAEQALELTPNRALRVPRMSVSQFEEITKIRIELEGLAT
FT                   ATAAERITDEELKQVQALHRRFADEMSKRSPDGADVIAANQAFHFAVYAAARMPILLQM
FT                   IESQWLRIGPILNHDLRSGSRRVEERVAVKHHDNLIEALRRHDSAAACAALRGDIESAA
FT                   AYIVSAGVLVNTDRTEDAAVTLVPLKRAAKAGRAGMKG"
FT   CDS_pept        complement(50803..51357)
FT                   /transl_table=11
FT                   /gene="h16_A0035"
FT                   /locus_tag="H16_A0035"
FT                   /product="transcriptional regulator, IclR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91187"
FT                   /db_xref="GOA:Q0KFN4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFN4"
FT                   /inference="protein motif:COGS:COG1414"
FT                   /inference="protein motif:SMART:smart00346"
FT                   /protein_id="CAJ91187.1"
FT                   /translation="MDLPHPTVLRFLLTLEEEGYVAREANQWRLTTRVFEIGFAAMESL
FT                   GVTEAVQEHLQQLADVYSGTANLGEINPEGVIIVGRAMAPAERRRLVVMNLRVGSVLPP
FT                   GSALAMALALPVGEWSELEYPESNQMSIAVPLPAVGSRQLSLGISTSMGEATPARIREE
FT                   MVPALQRAAGTVSRMIGLAPA"
FT   CDS_pept        51548..52525
FT                   /transl_table=11
FT                   /gene="h16_A0036"
FT                   /locus_tag="H16_A0036"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91188"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFN3"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /protein_id="CAJ91188.1"
FT                   /translation="MKRPILSAALACAAAIMPGPAAWASDAWPSKPIKWVVPYPPGGST
FT                   DMLARIVGQKLGERLGQPVVVENKAGAGGNVGTDYVTKQPADGYTIVMGNIGPIAINPS
FT                   LYPDLPYKPGKDLAPVTMLMAVPNLLVVNTALPVQSVKDLIQYGKRQATPLTYATPGAG
FT                   TSLHLAGELFASTAGVRMTHVPYKGSAPGLNDTVAGHVPVMFDNMPSALQLVKSGKLRA
FT                   LAITGAQRSPLLPDVPTMAEAGLRGYEIAGWFGVLVPAATPKPIVARLDSELEAVLKMP
FT                   DVRKKIDEMGGVISGAGPEAFGVFIDAETQKWRALVRSAHITVQ"
FT   sig_peptide     51548..51622
FT                   /gene="h16_A0036"
FT                   /locus_tag="H16_A0036"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        52570..53445
FT                   /transl_table=11
FT                   /gene="h16_A0037"
FT                   /locus_tag="H16_A0037"
FT                   /product="Alpha-ketoglutarate-dependent taurine
FT                   dioxygenase"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /EC_number="1.14.11.17"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91189"
FT                   /db_xref="GOA:Q0KFN2"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFN2"
FT                   /inference="protein motif:COGS:COG2175"
FT                   /inference="protein motif:PFAM:PF02668"
FT                   /inference="protein motif:CDD:cd00250"
FT                   /protein_id="CAJ91189.1"
FT                   /translation="MSQYRFIDVQPIAGALGAEISGVDLSQPVPDETFAEIRSALHNHQ
FT                   VIFFRDQQLTPDQHKAFSARFGDLLEVPFVRALEGHAEILPVMKGKAEQTKRNFGGAWH
FT                   TDMSYAEIPPLGSALYARVIPPYGGDTMWASMYHAYDALSDGLKLVLDKLRAVHSPVRS
FT                   YGARGAVVNNGDPAHKMDVRTDDRANSEVLHPVVRVHPATGRKALYVNSTYTMRFEGMT
FT                   EEESAPLLQYLYAHAARPEFTCRFRWTRGALAVWDNRCTQHLAMNDYDGFDRELHRTTI
FT                   AGDRPVGVAA"
FT   CDS_pept        53508..54359
FT                   /transl_table=11
FT                   /gene="h16_A0038"
FT                   /locus_tag="H16_A0038"
FT                   /product="Alpha-ketoglutarate-dependent taurine
FT                   dioxygenase"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /EC_number="1.14.11.17"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91190"
FT                   /db_xref="GOA:Q0KFN1"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFN1"
FT                   /inference="protein motif:COGS:COG2175"
FT                   /inference="protein motif:PFAM:PF02668"
FT                   /protein_id="CAJ91190.1"
FT                   /translation="MAMQVLPQDAPCGALVLGLDLKQALTDAQVAEIRRHWLEHKVLAF
FT                   TDQDLAIEDIERFASTIGPLGSDPYFTAIPGHPHVAQVRRDANERTPIFAESWHSDWSF
FT                   LAQPPAATVLYGNVIPPVGGDTLFADQYAAWDALPAELKSLVDGRQGVHSARRGYSRQG
FT                   AYGEKDKGRSMAIRYSDSAMATQLHPIARKHPETGRTALFVSVGYTIGIDGMSDEEAAP
FT                   ILRALFEHQARPEFVYRHRWSQGMLVVWDNRCVNHAATGGYDGYDRLLHRITVEERGDR
FT                   VG"
FT   CDS_pept        complement(54625..55209)
FT                   /transl_table=11
FT                   /gene="h16_A0039"
FT                   /locus_tag="H16_A0039"
FT                   /product="N-Acetyltransferase (GNAT) family"
FT                   /function="General function prediction only"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91191"
FT                   /db_xref="GOA:Q0KFN0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFN0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="CAJ91191.1"
FT                   /translation="MTRPMPDRPHQEDLTIRPATQADAAAISAVHALCWHQAYGELLPK
FT                   DMLANVTAESRLPARYRILADPSVACFVATSEAEVVGFSDCGPCREAEQECRGEVYALY
FT                   VLEAFHDKRVGLRLLSCCASALLRRGSSSMRLWSLEENARARRFYERAGGRLLDRRVST
FT                   RGSVVLTEVEYHWDLIGMKRLAALKWHLLCK"
FT   CDS_pept        complement(55253..55651)
FT                   /transl_table=11
FT                   /gene="h16_A0040"
FT                   /locus_tag="H16_A0040"
FT                   /product="predicted membrane protein"
FT                   /function="Function unknown"
FT                   /note="4 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91192"
FT                   /db_xref="GOA:Q0KFM9"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFM9"
FT                   /inference="protein motif:COGS:COG3766"
FT                   /inference="protein motif:PFAM:PF03994"
FT                   /protein_id="CAJ91192.1"
FT                   /translation="MVNAMHPALAYLIYIVTSFAMLGLFLLVYTRVTPHREFQLIREGN
FT                   VAAALSLGGAVLGFSLTLSSSIQHNATFGMFLLWAFGAFAVQVLAYLVVARALGGVGEA
FT                   ISSDNRGVGAVMGVISLAVGVVNAACLT"
FT   CDS_pept        complement(55714..56439)
FT                   /transl_table=11
FT                   /gene="h16_A0041"
FT                   /locus_tag="H16_A0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="predicted by FrameD"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91193"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFM8"
FT                   /protein_id="CAJ91193.1"
FT                   /translation="MAKKNNNGRKPSKYDSPYQPKSKGSPRSAWQPQPYAGEQKRSSPA
FT                   LWIIGACAVVAGVAALGSCSDDADDDPGVTVRRASYATLEDCEADWNTPNDCESVPVDD
FT                   PSTIYSSSLNASASDAATGGSGTSHGSSMYYARWYGPYYTSSGTVYHPNGTQTRRDMSA
FT                   GPLRPMNVYDSTGTRTQSFTNATPHAAMVEEATVRRSSLSGGRSMGLSMRAAAVSRAPV
FT                   VSRGGFTSRFGSSGRSGGG"
FT   CDS_pept        complement(56446..57621)
FT                   /transl_table=11
FT                   /gene="h16_A0042"
FT                   /locus_tag="H16_A0042"
FT                   /product="glutathionylspermidine synthase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="6.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91194"
FT                   /db_xref="GOA:Q0KFM7"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFM7"
FT                   /inference="protein motif:PFAM:PF03738"
FT                   /protein_id="CAJ91194.1"
FT                   /translation="MQRIPQTPRRNWPRELEKVGFHFHSLDEFNVPREVDDNTFFYWRE
FT                   DAAYAFSKQEVETLYAAAYDLNQRCLEAVQHVIDHDLFARLAIDKDFAQLIRTSWDRDE
FT                   PTLFGRFDMTLDQHGVPRMYEFNADTPTSLIESAVAQWYWKDTVQPQADQFNSLHDALV
FT                   ARWQWLRKHYRNASMLHLACMFDSQEDICNTEYLMDTALQAGWSVKLVDLQDIGTDGRG
FT                   NFYDADNVPMEVVFKLYPWEWMATSDYRDQLAHSPVRWVEPPWKAVLSNKAILPILWEL
FT                   FPGHPNLLEASFDPSHFAGQPHAKKPFLSREGESVTLATPDGGHVHNPGEYGAEGFIYQ
FT                   AYAPARRFDGRYTTLGVWIVDDVPSGLCVREESGPIAKNTSFFVPHYFMNE"
FT   CDS_pept        complement(57621..59015)
FT                   /transl_table=11
FT                   /gene="hss"
FT                   /locus_tag="H16_A0043"
FT                   /product="homospermidine synthase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="2.5.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91195"
FT                   /db_xref="GOA:Q0KFM6"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR023181"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFM6"
FT                   /inference="protein motif:PFAM:PF06408"
FT                   /protein_id="CAJ91195.1"
FT                   /translation="MIEQIVIVGFGCIGQAVLPLLERTWPRAAITVVDRVLDGTRRQLA
FT                   ARHGLDAIDATITAGNFEAMLGPLLRPGTFLLNLAPSVCSRDLIALAQAHGAFYVDAGI
FT                   EPWDYEADPQASHLSNYALRHEMLAFARGRETQPTALVAHGANPGLVSVLVKAALMELA
FT                   GNIGLNQPEPHDRAGWAALARALDLRVIQIAEYDSQQAPGYPRDGEFANTWSAEGFITE
FT                   CLQDAELGWGSHEPALPPDGYRHGYGSGAAIALDRPGHRTRVRSWSPVHGPFDAYLITH
FT                   NESISIAEYLTDQSAGQPLHRPTVYYAYRPTSATQTSMQWLDERAAPRVRGERILRDEI
FT                   QCGEDELGVLLMSGRHGAVWYGSRLSTQRARSLAPYNTATSLQVASSLIAGMQWMLANP
FT                   ARGVVESDALDFRPVLADAAHWWAPLSVQFSDWLPRPGATSLAFTDFLLDDAMTQPDPS
FT                   PLTMAC"
FT   CDS_pept        complement(59202..60152)
FT                   /transl_table=11
FT                   /gene="speB"
FT                   /locus_tag="H16_A0044"
FT                   /product="Agmatinase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91196"
FT                   /db_xref="GOA:Q0KFM5"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFM5"
FT                   /inference="protein motif:COGS:COG0010"
FT                   /inference="protein motif:PFAM:PF00491"
FT                   /protein_id="CAJ91196.1"
FT                   /translation="MTMALTQNLWQGRVDDGERGDTTRLFRIVHVLEAADVTPLDGAPV
FT                   LLGFNCDAGVLRNQGRPGAAHGPDAIRQALANVPAHGLPALYDAGNVSCDDGDLESAQL
FT                   ALAGTVRDVLARGGLPLVLGGGHEVAWGTWQGLRAHLDAQDDGGRVLIINIDAHFDLRT
FT                   SRPASSGTPFDQIANACAERGQPFDYVCLGVSRLSNTPALFSRADALGVCYVEDVDMQE
FT                   RHLESRLAELAARIDATDHLYLTIDLDALPAAVMPAVSAPAACGVPLTVVEEIAMLARH
FT                   SGKLRVADLAEYNPQYDRDHQGARVAARLAWRLFG"
FT   CDS_pept        complement(60149..60910)
FT                   /transl_table=11
FT                   /gene="hisP"
FT                   /locus_tag="H16_A0045"
FT                   /product="ABC-type transporter, ATPase component: PAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91197"
FT                   /db_xref="GOA:Q0KFM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFM4"
FT                   /inference="protein motif:TCDB:3.A.1.3"
FT                   /inference="protein motif:COGS:COG1126"
FT                   /inference="protein motif:COGS:COG4598"
FT                   /protein_id="CAJ91197.1"
FT                   /translation="MSDSAIIRIRNLGKSFGSHTVLRGIDFDVEPSQVVVVIGPSGSGK
FT                   STFLRCCNGLEQPEAGTIDIVGKRLVTDGQLIGEHELNQLRTEVGMVFQSFNLFPHLSV
FT                   LHNVTVGPRMLRGASREEAERKAMGLLEKVGLAHKAHAMPASLSGGQKQRVAIARALAM
FT                   EPRVMLFDEPTSALDPELVGEVLQVMKVLAAEGMTMVVVTHEMGFAREVADVVVVMDGG
FT                   GIIEAGPPSVIFSAPTQERTRGFLQAVLTRA"
FT   CDS_pept        complement(60907..61575)
FT                   /transl_table=11
FT                   /gene="hisM"
FT                   /locus_tag="H16_A0046"
FT                   /product="ABC-type transporter, permease component: PAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /note="4 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91198"
FT                   /db_xref="GOA:Q0KFM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFM3"
FT                   /inference="protein motif:TCDB:3.A.1.3"
FT                   /inference="protein motif:COGS:COG0765"
FT                   /protein_id="CAJ91198.1"
FT                   /translation="MELDFSPVFAGWHDIVHGAVITVEVTACALVLGCVMGLLVGIGRL
FT                   DPKRRVIYSICTAYVTFIRGTPLLVQLFLLFFGLPQFNILLPAFVCGVIGLGIYSGAYV
FT                   SEIVRGAIQSVDKGQMEAARSIGMSSGQAMRAVILPQAIVRMIPPLGNEFIALIKNSAL
FT                   VSLLTIADLMHEGQKIISVSYRSLEVYLAIALVYLILTSAAGLILRRAEQRLRMGGMVQ
FT                   "
FT   CDS_pept        complement(61594..62349)
FT                   /transl_table=11
FT                   /gene="hisJ"
FT                   /locus_tag="H16_A0047"
FT                   /product="ABC-type transporter, periplasmic component: PAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism / Signal
FT                   transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91199"
FT                   /db_xref="GOA:Q0KFM2"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFM2"
FT                   /inference="protein motif:TCDB:3.A.1.3"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /inference="protein motif:SMART:smart00062"
FT                   /inference="protein motif:CDD:cd00134"
FT                   /inference="protein motif:COGS:COG0834"
FT                   /protein_id="CAJ91199.1"
FT                   /translation="MNLRRKCLMAGLATLTALTLGTAAQAQDNAVLRVATDATFPPMEF
FT                   IENGKRTGFDVELVEAMAKTMGKRVEWTDIDFKGLIPGLVSRRFDMAVSGIYITPERRK
FT                   VVDFTEPYYVGGLVALVKSGNTTVHAPADLNGKKVSVQVGTKSVSFLRDTYPQVQRVEV
FT                   EKNQEMFNLVEIGRADAAVTGKPAAMQYVKTRGGLRMVEQQLTTEEYGMAVRKDTPELT
FT                   RALNAALAKVKADGTYARLTQKWFGTAAK"
FT   sig_peptide     complement(62269..62349)
FT                   /gene="hisJ"
FT                   /locus_tag="H16_A0047"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(62430..63224)
FT                   /transl_table=11
FT                   /gene="h16_A0048"
FT                   /locus_tag="H16_A0048"
FT                   /product="transcriptional regulator, IclR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91200"
FT                   /db_xref="GOA:Q0KFM1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFM1"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /inference="protein motif:SMART:smart00346"
FT                   /protein_id="CAJ91200.1"
FT                   /translation="MLNAVDNPTAVKPTTPTPAEPAQPAGGADRVLFVLAALAQHGAPI
FT                   TVRELVAKTGLPKSTLYRQLMMLKRWGFVLESDGEYAPGPISLQLALGFDMASHLAREA
FT                   LPDMQLLAQQSDESVGLVVAVKDHVVCLEMVESRQSLRCSFEKGRGVPLRAGASAKSLL
FT                   AFMRDEARERLVRAQCEPGEAERLLAELAAIRETGYAVSEGEVDPGVWGVSAPLFSRRS
FT                   KADALGSITLMVPATRRQGRESALIDMTVAAAMRISARLQSY"
FT   CDS_pept        complement(63359..64018)
FT                   /transl_table=11
FT                   /gene="h16_A0049"
FT                   /locus_tag="H16_A0049"
FT                   /product="Putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91201"
FT                   /db_xref="GOA:Q0KFM0"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFM0"
FT                   /inference="protein motif:PFAM:ICMT"
FT                   /protein_id="CAJ91201.1"
FT                   /translation="MRPTPGLAIATLAGTLAYLAIAIAGWGGIAPFFAHPARVALTLVL
FT                   FALSIAALFSGGNISSGMREDRGNRWVLAVFGVLGLLAAYLPPFTDRIGFWTLDGDTMR
FT                   WTGVALFAGGGVLRLWPVFVLGRRFSGLVAIQPGHTLVTTGIYGVIRHPSYLGFLVSSL
FT                   GWVLAFRSGVGVVLTLLMVPVLVARIRAEEALLRDQFGDEYASYCDRTWRMLPGIY"
FT   CDS_pept        64098..64487
FT                   /transl_table=11
FT                   /gene="h16_A0050"
FT                   /locus_tag="H16_A0050"
FT                   /product="predicted pyrophosphatase"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91202"
FT                   /db_xref="GOA:Q0KFL9"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFL9"
FT                   /protein_id="CAJ91202.1"
FT                   /translation="MIKSASCAGACRGAVNRFRHTIMPLIDIKNLQQAAQDFGKARNWG
FT                   KYHSPKNLAMALSVEVSELVEIFQWQTDAESRAIMSTDEREHVEQELADITIYLAQLVT
FT                   ALGVDLDAAIRAKMEMNARKYPLPE"
FT   CDS_pept        64760..65290
FT                   /transl_table=11
FT                   /gene="h16_A0051"
FT                   /locus_tag="H16_A0051"
FT                   /product="Hypothetical protein with NC domain"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91203"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFL8"
FT                   /inference="protein motif:PFAM:PF04970"
FT                   /protein_id="CAJ91203.1"
FT                   /translation="METVMASLGETTKTTAQATRSPHVLASRLAADAEPHLGAHLVTPR
FT                   HGYAHHGIYVGRGMVVHYAGYCHRQQRGPVEELSLAAFAAGHGITVLSTPMARYSAAES
FT                   VGRARSRLGEDCYRLLTNNCEHFCMWCLYGESRSEQVRHCLMHPFSGLRLAASILLCWC
FT                   KTAPAPAWDGATA"
FT   CDS_pept        complement(65293..66270)
FT                   /transl_table=11
FT                   /gene="h16_A0052"
FT                   /locus_tag="H16_A0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91204"
FT                   /db_xref="GOA:Q0KFL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFL7"
FT                   /protein_id="CAJ91204.1"
FT                   /translation="MPPASVGYRTVDCWRRSRIEVHRRPLQRRTIPTITGDRMTRLSGR
FT                   LAACIAFGLLLAASAQASDIACKTTLRPSRCDDPLAAGTSCLHSVPHAADLICDHAMLH
FT                   REHERIHADQQRRLRAGAIQGSDIAAWRERRDACTSVACLDRVFASWRRQPGKKPPRAA
FT                   APQPTPPAARAREVSRNKQAAVRVEASRPAVAPPSATPATQPAAEQLPAPPPSEPLAEA
FT                   GIHAPPVVIQRASGPTLQQASIRPTPAPQPRGWASLGTLAWLGMCGAGVACWSRRTRGE
FT                   WLPGVTRLRERTRDAPPIVLLVSGLLALNGVLLLCVLTASRPLS"
FT   CDS_pept        complement(66381..66884)
FT                   /transl_table=11
FT                   /gene="h16_A0053"
FT                   /locus_tag="H16_A0053"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91205"
FT                   /db_xref="GOA:Q0KFL6"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFL6"
FT                   /protein_id="CAJ91205.1"
FT                   /translation="MPDTAVALLLNAIVIGTGATLVMDAWAILRKRLLGVPALDYGLVG
FT                   RWLAWLPRGRLCHHPIAASPPVRGERGIGWIAHYLTGIVFAAILLGLWGLDWAHHPTLA
FT                   PALIVGIGSVAAPFLLMQPAMGAGIAASRTPRPNVARVHSLVTHAVFGLGLYVAGWVVS
FT                   LVAN"
FT   CDS_pept        complement(66877..67767)
FT                   /transl_table=11
FT                   /gene="h16_A0054"
FT                   /locus_tag="H16_A0054"
FT                   /product="SAM-dependent methyltransferase"
FT                   /function="General function prediction only"
FT                   /note="unknown EC_number=2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91206"
FT                   /db_xref="GOA:Q0KFL5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFL5"
FT                   /inference="protein motif:COGS:COG2226"
FT                   /inference="protein motif:PFAM:PF01209"
FT                   /protein_id="CAJ91206.1"
FT                   /translation="MGEQQQTSSNGGDQAALWNGPSGHAWVAEQAVLDDMLRPLEGRLV
FT                   DTVGKTSAQHVLDVGCGTGSTTIALARKLGAQGRCTGIDISEPMLAAARARAQHNGSTA
FT                   SFIRADAQDYAFAPASFDSIVSRLGVMFFSDPVRAFANLRRAATPDATLHCIAWRSASE
FT                   NPFMTTAERAAAPLLSNLPPRQPGAPGQFAFGDRQRVQAILEEGGWGGIDVEPIDFACT
FT                   LPEPALVDYLSRLGPVGLALREADASTRASVIETVRAAFEPYVHGATVRYTAACWMITA
FT                   RAAASSLTAGESAHA"
FT   CDS_pept        67842..68276
FT                   /transl_table=11
FT                   /gene="h16_A0055"
FT                   /locus_tag="H16_A0055"
FT                   /product="transcriptional regulator, SoxR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91207"
FT                   /db_xref="GOA:Q0KFL4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFL4"
FT                   /inference="protein motif:CDD:cd01108"
FT                   /inference="protein motif:CDD:cd01110"
FT                   /protein_id="CAJ91207.1"
FT                   /translation="MTSLDIAEVARQAGVPASTLRYYEEKGLIASIGRRGMRRVFDAGV
FT                   LERLALIALGRAAGFSLDDIARMFSPQGQPNIDRQVLAAKADELDRTIRKLTAMRDGLR
FT                   HAAVCPAPRHMECPTFQRILRAAASGAIGGRKHAHGLPMD"
FT   CDS_pept        complement(68388..70187)
FT                   /transl_table=11
FT                   /gene="tar1"
FT                   /locus_tag="H16_A0056"
FT                   /product="Methyl-accepting chemotaxis protein, contains
FT                   Cache domain"
FT                   /function="Cell motility and secretion / Signal
FT                   transduction mechanisms"
FT                   /note="2 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91208"
FT                   /db_xref="GOA:Q0KFL3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFL3"
FT                   /inference="protein motif:COGS:COG0840"
FT                   /inference="protein motif:PFAM:PF02743"
FT                   /protein_id="CAJ91208.1"
FT                   /translation="MFTTIRARIVALCVAIVIAALAINTALNQFVANRYNEDAIDSSLA
FT                   AVQSGHASAIADWVASHSQMIQSLQDAMLQPEPDAALRQIADAGGFTNVYVGYADKTAK
FT                   FSNPQGIPPGYDPTGRPWYQQAATAGKPVVTPPYVDAGTGKLVVAFAAPVVRDGGVKAV
FT                   VSGDVAMDSVIANVKAIHPTPASFGMLVARNGDIVAHTDDKLTLKPVTELAPALNADKL
FT                   AALAGAKTPLEVEVGGSAKLLGARAIPGTDWMVIVALDKAEATAGMRSVLIASVIAMVL
FT                   IAGMAAAVVWGVATMSLRGLSTVRDAMDAIGSGDGDLTQRLPADGNDEVAQIARAFNTF
FT                   ADKLCTIMRQIRDASESVRAASDEIAAGNTDLSRRTESAAASLQQTAASMEEITATVSQ
FT                   SASSAQHANESVTAASRVAADGGVVIGEVITTMGQIENASVRVSDIIGVIEGIAFQTNI
FT                   LALNAAVEAARAGDQGRGFAVVAGEVRALAQRSAQAAKEIKTLIESTVGGVSSGSGQVR
FT                   RAGDTMSEIVSNVSRVTGIISEITQAAMEQTRGIQEVNMAVSQLDQMVQQNAALVEQST
FT                   AAAAALQTQAGSLAGAVGQFRLG"
FT   CDS_pept        70719..71918
FT                   /transl_table=11
FT                   /gene="h16_A0057"
FT                   /locus_tag="H16_A0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91209"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFL2"
FT                   /protein_id="CAJ91209.1"
FT                   /translation="MSVLSLTSAPMRVLALSGALALAACGGGGDDGGGQGTLKVSMTDA
FT                   PACGFNNVFVTVNKVRVHSSASAETSAGGWVDIDVVPARKIDLLSLTNGVMTVLGQAAL
FT                   PAGNYQQVRLVLDANRGGGAGALANSVVPIGGTEQTLDTPSAVQSGIKINRPFTVAAGT
FT                   LTDLVLDFDACKSVVTRGNGTFGLKPVVTAIPMTVSGEVNGVVSGAPGARVYAERNGVV
FT                   VKSTVADANGNFKLSPIEQSSTAGPVDVVVVPGSANGKAAGIVRAVPVVVGTPTAISTA
FT                   AAPMSLPASTYRRVSGSVTPVSAEATLRALQLVNGGNFEIAATAAASDTGAYSMFATEP
FT                   ALPVAAPVIGTYQAALPIPLQPDGAAAGKYSVQATSATGAVQTQPADVSAADALVNFSF
FT                   "
FT   CDS_pept        72060..72965
FT                   /transl_table=11
FT                   /gene="h16_A0058"
FT                   /locus_tag="H16_A0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91210"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFL1"
FT                   /inference="protein motif:PFAM:DUF72"
FT                   /protein_id="CAJ91210.1"
FT                   /translation="MAARTAAKAASRTAATSEATPKARSRKAATSTEPVRVGIGGWNFA
FT                   PWRDNFYPAGLAQARELAYASRHLSAIEINSTYHGTQKRTSFAKWRDDTPDDFVFAVKA
FT                   SRFATNRRVLAESGESIERFIDSGIAELGRKLGPVVWQFAPTKQFDAEDFEAFLQLLPD
FT                   SVEGVKLRHVLEVRHDSFQSPDYLKLARKYKAATVFTDSPKFPSMADLTADFVYARLMA
FT                   SSAKLKAGYAPRDLDAWAARVRTWAQGHQPDDLPTVEDRKTAARKREVFVFFINGAKER
FT                   APAAAQALLERLDWTPPADD"
FT   CDS_pept        72999..74408
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="H16_A0059"
FT                   /product="ATP-dependent RNA helicase"
FT                   /function="DNA replication, recombination, and repair /
FT                   Transcription / Translation, ribosomal structure and bi"
FT                   /note="HELICc"
FT                   /note="DEXDc"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91211"
FT                   /db_xref="GOA:Q0KFL0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFL0"
FT                   /inference="protein motif:PFAM:DbpA"
FT                   /protein_id="CAJ91211.1"
FT                   /translation="MNSTPAQPQAGTAFSNLPLSPTMLATLAQLGYDEMTPIQAASLPI
FT                   TLAGQDLVAQAKTGSGKTAAFGLALLHRLDPRRFDVQAMVLCPTRELADQVTQEIRRLA
FT                   RAEENIKVLTLCGGSPMRPQVDSLIHGAHIVVGTPGRILDHIDRGSLDLSGINTLVLDE
FT                   ADRMLDMGFFDDIAYVASRCPKDRQTLLFSATYPPGIDKLSHRFLRNPQSVKLEATHDN
FT                   TTIRQRFYEVEEGERLNTVGRLLDHFRPVSTLAFCNTKARCRELVELLRAQGYQALALH
FT                   GELEQRERDQVLVQFANRSCSVLVATDVAARGLDIAQLEAVINVEITPDPEVHVHRIGR
FT                   TGRADQEGWAFSLVSMDEMGRVGNLEQHHGGEFEWQPLADLRPASNERLLPPMVTLQML
FT                   GGRKEKIRPGDILGALTGEAGFTKEQIGKINVLEMSTYIAVERSIGREAVKRLNAGKVK
FT                   GKKVKVRMLTE"
FT   CDS_pept        complement(74441..75556)
FT                   /transl_table=11
FT                   /gene="h16_A0060"
FT                   /locus_tag="H16_A0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91212"
FT                   /db_xref="InterPro:IPR021276"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFK9"
FT                   /protein_id="CAJ91212.1"
FT                   /translation="MAATEPTLAITRLFSRKDALNESRLEAAHEPASAAPGEVLLRLDR
FT                   FALTTNNITYAAFGKAMQYWDFFPTGQPQWGHMPVWGFADVVASGVDGIAPGERFYGYF
FT                   PIASHFRMQPGRVTARGFYDAAAHRAKLTSAYNQYTRVQNDAAYAPELEHYQMLYRPLF
FT                   ITSFMLADFLEDNRFFGARRLVVSSASSKTAYGTAFCLRDLDGIALTGLTSARNRAFVE
FT                   DLGCYGSTVTYDELASVPVDEPTLYVDFSGDESLRARVHAHFGDSLVYDCFVGSTQNTG
FT                   FLRDLHLPGPRPEFYFAPVQIRKRNADWGPQEVNRRFNAAQRRFIDHARDPAKRWLALV
FT                   EERGFEAAQARIARLAAGSGAPQEGYVVVVG"
FT   CDS_pept        75622..76335
FT                   /transl_table=11
FT                   /gene="h16_A0061"
FT                   /locus_tag="H16_A0061"
FT                   /product="transcriptional regulator, TetR/AcrR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91213"
FT                   /db_xref="GOA:Q0KFK8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFK8"
FT                   /inference="protein motif:COGS:COG1309"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="CAJ91213.1"
FT                   /translation="MPRIYRRANAAGFGNEAPAAGDLKRPATPRSKPLKRPSQQRAHFT
FT                   VNAIYDAFVRIWCRDGWDGVTTRAVALEAGFSVGTLYEYFPSKEALASGYVRHTVETML
FT                   ARIDAEVTQRADADWRTRVRRLVAIACGADDEATGIVFDADIIGLEPRIAEPKHHRRVF
FT                   EEFCEAWRRALCACPDLPTAPDAAKVQALVLAVWGARRYRLLLQGAALQPAQWVSEMQA
FT                   LCLAALDEKATDAQP"
FT   CDS_pept        76478..76918
FT                   /transl_table=11
FT                   /gene="h16_A0062"
FT                   /locus_tag="H16_A0062"
FT                   /product="Inosine-5'-monophosphate dehydrogenase"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91214"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFK7"
FT                   /protein_id="CAJ91214.1"
FT                   /translation="MKTARQVLESKPSQAIYSVPPTATVYTALQLMAEKGIGALLVIEH
FT                   GEILGILSERDYARKVILMQRTSRETLVRDIMTNAVIYVGASQTTDECMALMTRHRLRH
FT                   LPVMEGDELIGMLSIGDLVKDIISEQQFIIEQLEHYITGGGR"
FT   CDS_pept        complement(76990..78030)
FT                   /transl_table=11
FT                   /gene="h16_A0063"
FT                   /locus_tag="H16_A0063"
FT                   /product="conserved hypothetical protein"
FT                   /function="Inorganic ion transport and metabolism / General
FT                   function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91215"
FT                   /db_xref="GOA:Q0KFK6"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFK6"
FT                   /inference="protein motif:COGS:COG4638"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="CAJ91215.1"
FT                   /translation="MTETPRHEAGQAADAAGPELGQWHPVLAIEQADGDGPFAARLFGR
FT                   ALVLWRNADGWHAWDDRCPHRGAAFTLGAVHDGLLHCGYHGWRFASGGRCTRYPAHPEL
FT                   VPAPRACATTHAVREGYGLLWVRLGGDGTEAVPELPSFPEYHDAECRRVVCGPYDVATS
FT                   APRLVENFLDMAHFGYVHDGYLGDPAHTEVPPYEVEAIGDARKPDALRTIGCRAWQPRA
FT                   HASAAGGAMVEYEYRVVAPYAAILTKVPDLGDNHRGAIALFIGPRDEESSRVWFVMSLV
FT                   TDDDDASLREFQDTIFLQDKPIVESQQPRRLPLRTGVEVPQPADKLAGAYRRYLAAHGV
FT                   RFGTLG"
FT   CDS_pept        78279..79844
FT                   /transl_table=11
FT                   /gene="h16_A0064"
FT                   /locus_tag="H16_A0064"
FT                   /product="MFS transporter, DHA2 family"
FT                   /note="14 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91216"
FT                   /db_xref="GOA:Q0KFK5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFK5"
FT                   /inference="protein motif:TCDB:2.A.1.3"
FT                   /inference="protein motif:COGS:COG2814"
FT                   /inference="protein motif:PFAM:PF06609"
FT                   /protein_id="CAJ91216.1"
FT                   /translation="MSSPSFAASARDTTPALPAHDHRAVMRVIGGIVLCILLAALDQTV
FT                   VIPAVPAIANDLNGFSHLSWIVTAYLIVSTVTTPLYGKLSDSFGRRRLLMVAITLFIGA
FT                   SVACALAQTLGQLILFRALQGVGGGGLMSLAQAAIADVVAPRQRGRYQGYLATVWAVAS
FT                   IAGPLVGGWVSDHMSWRWLFWVNVPLGLLAMFMCYRGLAMLPPRGGRARVDWLGALLLA
FT                   VAIVAFLLAMSWGGDVYDWLSPELGALLLAAVAALVLLIWQERRAADPMLPPRLFANRA
FT                   YVMGVAASALAALDIFLCIFALPLHFQLVRGADASTSGLLVMPFLLATVAGNFIVAWLA
FT                   PRVGRMRGILSAGYIAGALGLIALALVTPAVPLAVVLAAMTLAGVGLGMTMVATLMSVQ
FT                   NALERRDTGAGTGALLVLRSLGSALGGALAGTLLTLEFRHALAASGVTQALDLGALRHG
FT                   SEAFAQLSPSVRAVLAGGVESGFHLLFAAGAAAAVLALLIVRRMPDLELRGSVTEHAAT
FT                   LAMD"
FT   CDS_pept        79927..80535
FT                   /transl_table=11
FT                   /gene="h16_A0065"
FT                   /locus_tag="H16_A0065"
FT                   /product="glutathione peroxidase"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91217"
FT                   /db_xref="GOA:Q0KFK4"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFK4"
FT                   /protein_id="CAJ91217.1"
FT                   /translation="MIRRPLLSSLAAALTLAAASTALLPAPVRAADKPAAAPAAGACPA
FT                   SLNFTFPRLQDDVPQNLCQYAGKVVLVVNTASYCGFTPQYEGLEALYAKYGARGLVVLG
FT                   FPSNDFSQEPGSQKEIADFCYNTYGVKFPMLGKSHVRGSDANPMYALLAKQTGTTPKWN
FT                   FYKYLIGRDGQVVASYGSRTRPDDKELVAKIESLLGAQR"
FT   CDS_pept        complement(80560..81186)
FT                   /transl_table=11
FT                   /gene="h16_A0066"
FT                   /locus_tag="H16_A0066"
FT                   /product="Glutathione S-transferase"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91218"
FT                   /db_xref="GOA:Q0KFK3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFK3"
FT                   /protein_id="CAJ91218.1"
FT                   /translation="MKLYYTPGVCSMAVHIALREAGLPVTLAKVDLLRHKLAEPENGTD
FT                   DYYTINPRGYVPLLQLDDGSRHTEAASLLQYIADLVPERALLPAAGTRERLEATGWITL
FT                   VSTELHKVFSPWLWHKETAQSTQDECKARLHRRFSELDQHLQTRHYLMGDTFTVADAYC
FT                   FTIVGWARILKLPLNDYPALQQYLSRVAARPAVQEAMRAEGLVRD"
FT   CDS_pept        complement(81320..82057)
FT                   /transl_table=11
FT                   /gene="h16_A0067"
FT                   /locus_tag="H16_A0067"
FT                   /product="hydantoin racemase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="5.1.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91219"
FT                   /db_xref="GOA:Q0KFK2"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFK2"
FT                   /inference="protein motif:PFAM:Asp_Glu_race"
FT                   /protein_id="CAJ91219.1"
FT                   /translation="MQLLIVNPNISESVTALIEAEARRTAASTTTLKMATAQFGVAYIE
FT                   TRFEALVGGYATACAAAEHAGQFDGLVVAAFGDPGLAGLKELFDVPVVGMTEAALASAC
FT                   LLGQRFSIIAISHRIQAWYRECVAANGLSSRLASVRSLQEPLRDIGSVQEDHAARLEQL
FT                   ALQAIEQDGADVIIVAGAPLAGLARSLQGRIAVPVVDGVSSAVRHCESLVALRAGSATQ
FT                   GSFARPPRKPNAGLPPALAKLLD"
FT   CDS_pept        complement(82131..83552)
FT                   /transl_table=11
FT                   /gene="h16_A0068"
FT                   /locus_tag="H16_A0068"
FT                   /product="D-Hydantoinase"
FT                   /function="Nucleotide transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91220"
FT                   /db_xref="GOA:Q0KFK1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFK1"
FT                   /inference="protein motif:PFAM:Amidohydro_1"
FT                   /protein_id="CAJ91220.1"
FT                   /translation="MSAHDSLDLVIRRADVVTASDRFRCDIGVRNGQIVALGHALPQGA
FT                   REIDADGLLALPGGVDGHCHLDQPMPDGLRMADDFFTGTRAAVCGGTTTVIPFAAQEKG
FT                   ASLKAAVADYHRRAEGRAVIDYAFHLIVADPTPAVLADELPALIRKGYSSFKVYMTYDD
FT                   LKLSDREMLSVLDVAKQNGALVMVHAENADCISWLTDKLVGEGRIAPRFHGLARPAAVE
FT                   REATHRAITFAELVDVPILIVHVSGKEAIEQIRWAQGRGLQILAETCPQYLYLTADDMA
FT                   LPGDDGYEGAKCVCSPPPRDPENQAAVWRALTNGVFSVFSSDHAPFRYDDPQGKQPGGE
FT                   RPSFEHIPNGVPGIETRLPLLFDGVARGKLSLHQFVELTSWRPARLYGLYPRKGTIAIG
FT                   ADADIVLWDPNQRVQIRNSALHHAVDYTPYEGIEVTGWPVHCFSRGEMLVRDGQYQEPQ
FT                   AGRGQFLPAGAPMLG"
FT   CDS_pept        complement(83557..84285)
FT                   /transl_table=11
FT                   /gene="h16_A0069"
FT                   /locus_tag="H16_A0069"
FT                   /product="maleate cis-trans isomerase"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /EC_number="5.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91221"
FT                   /db_xref="GOA:Q0KFK0"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFK0"
FT                   /inference="protein motif:PFAM:Asp_Glu_race"
FT                   /protein_id="CAJ91221.1"
FT                   /translation="MTKQIRLGMLTPSSNTALEPITSAMVAGLPNVSAHFSRFTVTEIS
FT                   LRDQALGQFNLDKILAAASLLADARVDVIAWNGTSSGWLGFDKDEALCRQITEATGIPA
FT                   TTSVLALNEILEKTGARNFGLATPYLDDVQQRIIANYERSGFHCVAESHLDLRVNYSFA
FT                   EVEEDTIREMVRGLAQHQPQAITTFCTNLRAAHLAEELEAETGIPLYDTISTVVWKSLR
FT                   LCGVDTRELRGWGRLFREVE"
FT   CDS_pept        complement(84375..85673)
FT                   /transl_table=11
FT                   /gene="h16_A0070"
FT                   /locus_tag="H16_A0070"
FT                   /product="MFS transporter, ACS family"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /note="12 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91222"
FT                   /db_xref="GOA:Q0KFJ9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFJ9"
FT                   /inference="protein motif:TCDB:2.A.1.14"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /inference="protein motif:COGS:COG2223"
FT                   /protein_id="CAJ91222.1"
FT                   /translation="MQTTSRATVVTEAKTSVRWKIFLMMLFLIAINYIDRASLSVAMPL
FT                   IAKEFDLSPTMQGLILSSFFWTYALMQVPGGMLADKYKPRIVIACATVFWGIAQAVAAF
FT                   TTNATALLLTRLGLGAAEAPIYPAGGKLNAIWMTQNERGRGATLLDGGAPLGAALGAII
FT                   ITWLIATLGSWRLAFIVAGVGTVLAGVLAWYYVRNSPREHRGVNELEARYIEEAQANEH
FT                   RAEPANLSGRSLDFFKYRSVWCMAIGWMCFNTVFYGLLTWMPNYLNKVHGFDIKQMGGA
FT                   SFIIFFSGFVGELIGGWIADKWKEAGGRPNVVMRTLFGIAAVVATVSIFSVAYVTDPIV
FT                   VVVLLSSTLFFLRWCGLFWCVPSMLGTRNKIGFLGGVMNLGGNIGGITVPIIVGMIVQF
FT                   TGSYFLALMFFAAAGVGLLLASTAIDYETKIPV"
FT   CDS_pept        85832..86590
FT                   /transl_table=11
FT                   /gene="h16_A0071"
FT                   /locus_tag="H16_A0071"
FT                   /product="transcriptional regulator, GntR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91223"
FT                   /db_xref="GOA:Q0KFJ8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFJ8"
FT                   /inference="protein motif:COGS:COG1802"
FT                   /inference="protein motif:SMART:smart00345"
FT                   /protein_id="CAJ91223.1"
FT                   /translation="MVHFPNLVTSVTQTLSQTTRLRTLGMSAEIAARLRTMIEEGELPP
FT                   GARIDERAFCETFDVSKTPLREALKVLVSEGLVLHRQYIGYRVAPLDLEELRATFETLH
FT                   GLEALAGELAAQRLGAAAMAKLERRHQAMIDAHAAGRRTDYFRINQEIHQLIIDGAANP
FT                   VLAGVYATLMSKVHRARGAANADTIRWQESHEEHEAIMAALREPGRPRLAQVLRAHSEN
FT                   TAREVLSVVAQTLAEAGATGAIGATLKKSA"
FT   CDS_pept        86616..87464
FT                   /transl_table=11
FT                   /gene="h16_A0072"
FT                   /locus_tag="H16_A0072"
FT                   /product="2-Keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91224"
FT                   /db_xref="GOA:Q0KFJ7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFJ7"
FT                   /inference="protein motif:COGS:COG0179"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="CAJ91224.1"
FT                   /translation="MKLVRVGNPGAERPGMIDAQGRVRDLSGVVADIGALQLAPAALAR
FT                   LAQVDPASLPVIEGARFGVPWSGVGKIVAIGLNYADHAAEAGMPLPAEPIVFLKANSSL
FT                   NGPNDVVMLPLGSEKTDWEVELGVVIGSTARNVSREAALNHVAGYCVVNDVSEREFQIE
FT                   RGGTWDKGKGCDTFCPAGPWLVTRDEVQDPQALGLWLEVNGERVQKGSTATMVFDVATV
FT                   VSYVSRFMTLLPGDLIATGTPPGVGMGFKPPRFLKAGDTMRLGVDGLGEQTQQVVPYGE
FT                   L"
FT   CDS_pept        87734..88981
FT                   /transl_table=11
FT                   /gene="h16_A0073"
FT                   /locus_tag="H16_A0073"
FT                   /product="putative peptidase, M20D subfamily"
FT                   /function="General function prediction only"
FT                   /EC_number="3.4.17.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91225"
FT                   /db_xref="GOA:Q0KFJ6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFJ6"
FT                   /inference="protein motif:MEROPS:M20.UPD"
FT                   /inference="protein motif:COGS:COG1473"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="CAJ91225.1"
FT                   /translation="MSEHAPEIESYLGTTLTASPTSPLKHRYCALADTLDSRAELEVIR
FT                   RNIHQHPELAFDEVRTSGLVASLLETWGYTVTRGVGGTGVVGTLRCGDSGHSVGIRADM
FT                   DALPIHERTALPYASVNAGRMHACGHDGHTAILLGAAKQLARTRNFDGTVHLIFQPAEE
FT                   IGAGGGAERMLADGLFERFPCDAIFGLHNHPGVEQGTFLFRSGPFMAACDTVTITIRGK
FT                   GGHAARPHQSVDPILVAGSLVMALQSVVARYVDPNETAVVTIGTLHAGHAPNVIPDNAR
FT                   MEISVRSFNPEVRASVENRIRQLATSHAEGYGAVAEVDYVRGYPVLVNSERETEFARQV
FT                   AEELVGAGKVVDQAARIAGSEDFAYFLQQRPGCFVRLGNGANQPLLHNAGYDFNDENLT
FT                   VGAAYWTRLVERYLAS"
FT   CDS_pept        complement(89000..89875)
FT                   /transl_table=11
FT                   /gene="h16_A0074"
FT                   /locus_tag="H16_A0074"
FT                   /product="transcriptional regulator, AraC-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91226"
FT                   /db_xref="GOA:Q0KFJ5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFJ5"
FT                   /inference="protein motif:SMART:smart00342"
FT                   /protein_id="CAJ91226.1"
FT                   /translation="MPRAPRPLSASGAARRRRDQHAPPAPTPEALALGDTYADPPPYVR
FT                   FDRSPLPVTAMAADYLPGHVTNPHQHPHAQLIHAVHGVMVVATTEGQWIVPPTRGMWMP
FT                   GGTTHWIRMVGRVQMRTAYIRPDAAPDLPQRCTVLGISALLRELILAAIDIPLPYAPGT
FT                   RGARLMRLLLDEVMLVPSLPLHLPRPADDSLRQICDAITGAPDTALTLADWGSRLGLDP
FT                   KTIQRRFARETGMTFGQWRQQARLLAALEKLAAGSKVVDVALDLGYDSPSAFATMFRRQ
FT                   FGVPPSAFFR"
FT   CDS_pept        90004..91236
FT                   /transl_table=11
FT                   /gene="h16_A0075"
FT                   /locus_tag="H16_A0075"
FT                   /product="MFS transporter, fosmidomycin resistance family"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /note="10 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91227"
FT                   /db_xref="GOA:Q0KFJ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFJ4"
FT                   /inference="protein motif:TCDB:2.A.1.35"
FT                   /inference="protein motif:COGS:COG2814"
FT                   /inference="protein motif:COGS:COG2223"
FT                   /protein_id="CAJ91227.1"
FT                   /translation="MSTTIDSAPAGATPSATSPQAERTGFRVLSAISFAHFLNDMIQSL
FT                   ILAIYPMLKGGFNLSFTQIGLLTMTYQVTASLLQPVVGLYTDKHPKPHSLAIAMAFTLA
FT                   GLLLLSVAPSYGVLLVAAALVGTGSSIFHPESSRVARMASGGQHGLAQSIFQVGGNGGS
FT                   AMGPLLAALIVHQQASLAWFSLAALVGIVVLWRIGGWYARQLAQGARKHKAAGAVASPV
FT                   PMRLVVRAMVVLMVLVFSKYFYMASLTSYYTFYLMERFGLARQDAQLHLFMFLAAVAAG
FT                   TILGGPIGDRIGRKRVIWASILGVAPFTLALPHVGLFWTTVLTFIIGFILASAFSAILV
FT                   FAQELIPGKVGMVSGLFFGFAFGMGGIGAAVLGGMADTHGIRAVYEYCAYLPLLGLLTI
FT                   FLPDLRERQRA"
FT   CDS_pept        complement(91240..91695)
FT                   /transl_table=11
FT                   /gene="h16_A0076"
FT                   /locus_tag="H16_A0076"
FT                   /product="transcriptional regulator, MarR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91228"
FT                   /db_xref="GOA:Q0KFJ3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFJ3"
FT                   /inference="protein motif:SMART:smart00347"
FT                   /inference="protein motif:COGS:COG1846"
FT                   /protein_id="CAJ91228.1"
FT                   /translation="MGVIGRLGRLNRHTSRAIEAALGETGLQPWEFDVLATLRRAGPPY
FT                   ALSPGALIGSLMITSGTMTNRLDHLERAGLVRRQPNPEDRRGLLVELTETGRERVDRAL
FT                   ELHVANEHRLLADLTATERAQLAALLRRWLRMFEPPPGGGGEGNEPA"
FT   CDS_pept        91898..92812
FT                   /transl_table=11
FT                   /gene="h16_A0077"
FT                   /locus_tag="H16_A0077"
FT                   /product="Predicted PecM protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91229"
FT                   /db_xref="GOA:Q0KFJ2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFJ2"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="CAJ91229.1"
FT                   /translation="MKASGSSSLAATGGVTLRDILLTGLAPAIWGSTYLVTSQWLPPGQ
FT                   PLLSGVIRALPAGLAMLAFGRQLPRGSWWWRAAVLGVLNIGFFQAMLFIAAYRLPGGVA
FT                   ATVGAIQPLIVVVLAWAWLGARPRPAAWLAGVGGLLGVALLVLGPAARLDAIGVAAAAA
FT                   GAVSMAVGTVLTRHWRPPVSPLVLTAWQLCAGGLFLLPFALVLEPLPGHFTLANWLGYA
FT                   WLSIVGAGFSYALWFRGVGRMPSSAVAALGLLSPVSATVLGFLVLGQALTAMQAAGALL
FT                   VLGSVWLGQRAAAPAAVTRTQLA"
FT   CDS_pept        92860..93159
FT                   /transl_table=11
FT                   /gene="h16_A0078"
FT                   /locus_tag="H16_A0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91230"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFJ1"
FT                   /protein_id="CAJ91230.1"
FT                   /translation="MAGMKSAVPPSPPSIHPASAPSATPACERCLALAADPRRREPPSC
FT                   LALRGTVPLVSQSAAGVPFSMLSFACRDCGTVWRLYDRANELFVSWVPERPLVR"
FT   CDS_pept        93318..94259
FT                   /transl_table=11
FT                   /gene="h16_A0079"
FT                   /locus_tag="H16_A0079"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91231"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFJ0"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="CAJ91231.1"
FT                   /translation="MTSGAAALPAAAADAYPSRPIRLIVAYPTGGISDTVARALGERLS
FT                   AQMGTSVVVENKAGAGGSIGIDAVAKAAPDGYTLGFAATSPLTLNPHVGRVNYDPQKDV
FT                   APVMSVMYSPVLVVATAGFSGKGFADVVGQASAKPGSVRWATSGLGTVGHVVLEQIKQK
FT                   SKADITLIPYKGAGQQMNDALGGQFEVMSTNASPVLTQHMQAGRLRALAVGAPRRLESL
FT                   PSVPTLAELGYPKANLTSTFGIFAPGKTPAAIINRLNAELNKALAEPEVHERLLKGGEV
FT                   PTGGTPAQFAKAIREESAENARIVRDAGIKAD"
FT   sig_peptide     93318..93398
FT                   /gene="h16_A0079"
FT                   /locus_tag="H16_A0079"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(94262..94942)
FT                   /transl_table=11
FT                   /gene="h16_A0080"
FT                   /locus_tag="H16_A0080"
FT                   /product="response regulator, OmpR-family"
FT                   /function="Signal transduction mechanisms / Transcription"
FT                   /note="REC (residues 8 to 116, 2e-12) with a typical
FT                   phosphorylation pocket (1/2 DD,D54,S/T82,K105)"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91232"
FT                   /db_xref="GOA:Q0KFI9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFI9"
FT                   /inference="protein motif:CDD:cd00156"
FT                   /inference="protein motif:COGS:COG0745"
FT                   /inference="protein motif:CDD:cd00383"
FT                   /protein_id="CAJ91232.1"
FT                   /translation="MNIAALQADPTLAVSIEQTLRLNGHQCTRYLSGRTMIGALRGRSF
FT                   DLLMLDCDTPGIPALEVLAWVRRTLGNEMPVMLTGTSNEEAFVAACFAQGADSYVPKPL
FT                   RTAELAARVLALLRRARPAVDECDLEHGVFRFATAERRVWVQGKPVLLAPKEFDLAVLL
FT                   FRNLGSLVLRQAMVDQVWRYHMDPASRTVDSHLSRVRTKLALWPHNGVRLSSVYGLGSR
FT                   LDAA"
FT   CDS_pept        95164..95901
FT                   /transl_table=11
FT                   /gene="h16_A0081"
FT                   /locus_tag="H16_A0081"
FT                   /product="response regulator, OmpR-family"
FT                   /function="Signal transduction mechanisms / Transcription"
FT                   /note="REC (residues 11 to 122, 5e-19) with a typical
FT                   phosphorylation pocket (DD,D54,S/T82,K105)"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91233"
FT                   /db_xref="GOA:Q0KFI8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFI8"
FT                   /inference="protein motif:CDD:cd00156"
FT                   /inference="protein motif:COGS:COG0745"
FT                   /inference="protein motif:CDD:cd00383"
FT                   /protein_id="CAJ91233.1"
FT                   /translation="MGKKMASRIASLEDAPADAALIRQVITGAGHDCVTFAESRRLLLA
FT                   LRDAGFDLLLLDWQMPDLSGREVLAWVRTHLDRRIPVMFLTCREAELDIVNALAAGADD
FT                   YMVKPVRPAELAARIDCLLRRAYPAQLAPLAPLRLGEYAFDCALRKVTCNGDPVSLTPK
FT                   EFDLAVLLFRNEGRIVTRDHITAAVWGREISPLSRTIDTHVSRVRSKLGLQAGHGLRLT
FT                   PVYTHGYRLERTDRPERTERAAA"
FT   CDS_pept        95898..96623
FT                   /transl_table=11
FT                   /gene="h16_A0082"
FT                   /locus_tag="H16_A0082"
FT                   /product="fragment of signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91234"
FT                   /db_xref="GOA:Q0KFI7"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFI7"
FT                   /inference="protein motif:COGS:COG2205"
FT                   /protein_id="CAJ91234.1"
FT                   /translation="MRASRLHQAGLAVAPWFGGRPVAQRRADVRNPAAVHDMLLHVLGH
FT                   DLRAPNASLLAWLELRRTRAQADAALLAQVGSHARRSLRQIDDLNRLLRETRHAYRMRR
FT                   IAMESLLDEALDRVWTLASEAGVRLERPAGRLPRLGGDQAMLAQTLEWLLTSAIDAAAR
FT                   ETALRITCRGHAGGLALWLAFDSADDESAARLAQPGPALLCAQRVVARHGGVLVPLQPM
FT                   GEATSQAGWYLWLRRRPRP"
FT   CDS_pept        complement(96675..97772)
FT                   /transl_table=11
FT                   /gene="h16_A0083"
FT                   /locus_tag="H16_A0083"
FT                   /product="outer membrane protein (porin)"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /note="OmpC Similar to Ralstonia solanacearum GI:17547810"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91235"
FT                   /db_xref="GOA:Q0KFI6"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFI6"
FT                   /protein_id="CAJ91235.1"
FT                   /translation="MKKSAIVLAAGSLLAGSAFAQSSVTLYGIVDQSIRFQTNSNANND
FT                   NLWELTNGAVTNSRWGLKGSEALGNNLKAIFQLEGGFDPDTGRSNQASATNPNGRLFGR
FT                   QAYVGLSGDFGTIKLGRQYTEGFNFFGDYDPLTIGNYTNNAWPFFLTQFRSDNVVSYGG
FT                   KFGGLDVGASYGFGEQPGSMTKNQYWGTRAAYSFGPFGIGGVYQEIRDINGNKQQMWGA
FT                   AGKYAFGPAKLFVGYVGGKDRTGVIDNGFLNNSAAAPAPAVVTAGAASNPRKDTLGYIG
FT                   LTYQATPALALTGVFYGDYVENKNGVNDNNGRRYTGVLLAEYSLSKRTQVYGTVDFNKV
FT                   SGGTTTEMPGRNNQTGAALGIRHIF"
FT   CDS_pept        complement(98139..98393)
FT                   /transl_table=11
FT                   /gene="h16_A0084"
FT                   /locus_tag="H16_A0084"
FT                   /product="cell division inhibitor MinE"
FT                   /function="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91236"
FT                   /db_xref="GOA:Q0KFI5"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFI5"
FT                   /inference="protein motif:PFAM:MinE"
FT                   /protein_id="CAJ91236.1"
FT                   /translation="MSILSFLLGEKKKSASVAKERLQIILAHERTGHSAPADYLPALQR
FT                   ELVAVISKYVKIGDQDLRVSLERQDNLEVLEVKIEIPQN"
FT   CDS_pept        complement(98415..99230)
FT                   /transl_table=11
FT                   /gene="h16_A0085"
FT                   /locus_tag="H16_A0085"
FT                   /product="cell division inhibitor MinD"
FT                   /function="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91237"
FT                   /db_xref="GOA:Q0KFI4"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFI4"
FT                   /inference="protein motif:PFAM:ArsA_ATPase"
FT                   /inference="protein motif:PFAM:ParA"
FT                   /protein_id="CAJ91237.1"
FT                   /translation="MAKIIVVTSGKGGVGKTTTSASFAAGLALRGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVVQGEANLRQALIKDKKCENLFILPASQTRDKDALTREGVEK
FT                   VINGLIEMDFEFIICDSPAGIESGALMAMYFADEALIVTNPEVSSVRDSDRILGILASK
FT                   TKRASEGGDPIKEHLLITRYNPKRVHGGEMLSLTDIQEILRIKLIGVVPESEAVLHASN
FT                   QGTPAIHLEGSDVADAYGDVVDRFLGKDKPMRFTDYQKPGLLSRIFGNK"
FT   CDS_pept        complement(99298..100110)
FT                   /transl_table=11
FT                   /gene="h16_A0086"
FT                   /locus_tag="H16_A0086"
FT                   /product="cell division inhibitor MinC"
FT                   /function="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91238"
FT                   /db_xref="GOA:Q0KFI3"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFI3"
FT                   /inference="protein motif:PFAM:MinC_N"
FT                   /inference="protein motif:PFAM:MinC_C"
FT                   /protein_id="CAJ91238.1"
FT                   /translation="MSQKKSPRFELRSGNVDALLLALQTADMAALRDDLLARFEATPDF
FT                   FSNDVIALDLRALEDDSEVALGTVIETLATLRARAIGVVARPGQREWAERFGLPLLDSQ
FT                   ARRGSGADRATDRAAEARAAAAAEQAAADQAAREESIRAAAQATTDAAVAAAIRQTQTM
FT                   LIDKPLRSGQQVYAQGDVVILDVVSYGAEVIAEGNIHIYAPLRGRALAGVKGNTGARIF
FT                   STCMEPELISIAGIYRTAEQTLPADVLGKTAQVRLADEKLILEALRLK"
FT   CDS_pept        100341..101312
FT                   /transl_table=11
FT                   /gene="corA1"
FT                   /locus_tag="H16_A0087"
FT                   /product="Putative Mg2+ and Co2+ transporter"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /note="2 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91239"
FT                   /db_xref="GOA:Q0KFI2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFI2"
FT                   /inference="protein motif:TCDB:1.A.35"
FT                   /inference="protein motif:COGS:COG0598"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="CAJ91239.1"
FT                   /translation="MGAIVNCVAYRQGKRLGTVGMDEIRTVLGVPGTFVWLGLHEPDLA
FT                   LLRQAQQAFGLHDLAVEDALDAHQRPKLEAYGDSVFVVLNTAQLVEDEVVVGETHLFVG
FT                   PNYVVSVRHGVSSTYAPVRERCEQDPHGLANGPGYVLYALMDFVVDHYLPIVTRLEDTF
FT                   EALEQGIFRDEFDRAAIERLYRIKRQVLRLRNAVSPVEDMCGQLIRLHEDLVPKELRAY
FT                   FRDIEDHASRLVRTLDVVREMLTTAVQVNLALVTVGQNEVVKRLAGWGAILAIPTVIFS
FT                   LYGMNFDFMPELKFHFAYPAVIGVTAVACGGLWRRLHRAGWI"
FT   CDS_pept        101467..102171
FT                   /transl_table=11
FT                   /gene="h16_A0088"
FT                   /locus_tag="H16_A0088"
FT                   /product="FOG: TPR repeat, SEL1 subfamily"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91240"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFI1"
FT                   /inference="protein motif:COGS:COG0790"
FT                   /protein_id="CAJ91240.1"
FT                   /translation="MSIARPPIAALLAGATAAWLLCMQAAASAPQPPAPAQVQTRDAVT
FT                   AYEAGNFDQALRGFADAARLGNRLAQFNYAMMLLRGEGTAARPQEALVWLKKAADNQMT
FT                   HAQYTWGDLYERGELVPKSLEEANRWYALAAQGGHVQAQMALATNYFTGRGVPRDYGQA
FT                   FMWYSRAASAGDGGAQYIVGSFYEHGEPGVVDRDLEQAKIWYARSAAHGDPGALAKLRS
FT                   LLEESVRGRAAR"
FT   sig_peptide     101467..101550
FT                   /gene="h16_A0088"
FT                   /locus_tag="H16_A0088"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(102276..103106)
FT                   /transl_table=11
FT                   /gene="h16_A0089"
FT                   /locus_tag="H16_A0089"
FT                   /product="transcriptional regulator, MerR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91241"
FT                   /db_xref="GOA:Q0KFI0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFI0"
FT                   /inference="protein motif:CDD:cd00592"
FT                   /inference="protein motif:SMART:smart00422"
FT                   /protein_id="CAJ91241.1"
FT                   /translation="MTLIRRRHPSSPTSQASDTTPPAPEYTIDELARVAGTTVRNVRSY
FT                   QDRGLIDPPQRRGRVGIYTQAHLGRLKLIHHLLARGYTLANITELLKAIVEGHDLRSIL
FT                   GLETAISSPWTNETPRHYSYLALARLFGRAISRPALAKAISLGLLEPDGLGYLARSPRA
FT                   LAAGAEIAQAGFALEDVLEIIAQSRGHFQAVSDHIVATVVRELDRFGIGKLPPPQDVPR
FT                   LVEILWRIRPLALVMAETEMMRALEISANKYLGDRVAAIIEHLHDEEDGSGGKP"
FT   CDS_pept        103205..104149
FT                   /transl_table=11
FT                   /gene="h16_A0090"
FT                   /locus_tag="H16_A0090"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91242"
FT                   /db_xref="GOA:Q0KFH9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFH9"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91242.1"
FT                   /translation="MHIRWLEDFVCLAQAGSLARAAELRNVTPPAFGRRMQALEVWAGA
FT                   PLIDRSAFPVRLTAEGRQFLEAAQSALRTLDETRVALRAAHRADASTVTIATGKTLARS
FT                   MVPAWLAGLREALRHDPAAAGFRTQLSTFPMHDALAMFAEGDADFLLCYSPPDLPVMLD
FT                   DARYQFHLAGVERLVCVSAADARGAPLHRLATGKAAAKPVPMIAYAETLTLGRMVNQEI
FT                   ARRKLAPRLDVIAVSDFAESVHEMVRQRMGLAWLPARLIADDLHAGRLVRAISGARSDD
FT                   GGDLALDIRLYRPRAPMRPLAEAFWQAAVQAPR"
FT   CDS_pept        104272..105240
FT                   /transl_table=11
FT                   /gene="h16_A0091"
FT                   /locus_tag="H16_A0091"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91243"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFH8"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /protein_id="CAJ91243.1"
FT                   /translation="MKTILRAAAAALCLAASAGAVASAWPAKPITLVVGYTAGGSVDLV
FT                   ARTIAPELGKRLGQSVVIENLGGAGGTIGAAKVVKAEADGYTLLMGSGSEVSIARLTNP
FT                   AVRYDGEKDLVPVTFVGTQPMVLVGKPGLAARNAAELIALAKAQPGKLSYASSGVGTPL
FT                   NLAGELIKQQGKVNITHVPYKGASAMATDLLGGQIDLAVMVLSSALPHIQAGRVQAYGV
FT                   TNAKRSPVAPNVPALAETPALKGVDMGVWFGLMGPARLPQAVVERLNTEMQAVLAMPDV
FT                   KKKLAEAGVEVAPANPAQFGSFIKRETGRYRTIVQTAGIHE"
FT   sig_peptide     104272..104340
FT                   /gene="h16_A0091"
FT                   /locus_tag="H16_A0091"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        105359..106333
FT                   /transl_table=11
FT                   /gene="h16_A0092"
FT                   /locus_tag="H16_A0092"
FT                   /product="predicted succinylglutamate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91244"
FT                   /db_xref="GOA:Q0KFH7"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFH7"
FT                   /inference="protein motif:PFAM:Aste_AspA"
FT                   /protein_id="CAJ91244.1"
FT                   /translation="MTQPTAPIDAYPVDVAFPDIRAYAAGNTGIPYLYTFDSGQPGPHV
FT                   MVNALTHGNEVCGAIGVKALLDHGLRPRRGRLTLAFANVDAYHSFDAARPDASRFVDQD
FT                   FNRVWTARVLDDASLDSSELRRARAMRPVIDTVDLLLDLHSMHEKSRPLIVSGPLDKGI
FT                   ALARALGAPADVIVDEGHPEGRRMRDYDGFGDAASPRNALLIECGQHWEPAAVTVAQDS
FT                   TARFLLHAGVIDASDLPAGWLQPLPATQRVVRVTEPVVATSMDFRFAGPYTGLETFTEA
FT                   GTVIGWRDGEPVVTPYPDCVLVMPSLRQLRPGVTVVRLGRLER"
FT   CDS_pept        complement(106422..106964)
FT                   /transl_table=11
FT                   /gene="h16_A0093"
FT                   /locus_tag="H16_A0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91245"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFH6"
FT                   /protein_id="CAJ91245.1"
FT                   /translation="MYKAMLAAGLGLLITGCSTYQAVTPVDRPDHTDPLVAFQVPAGGG
FT                   PLGNYGANGTLLCVVVNPVTGNDFVENFLSSLRRRNFEVKVLQAQTSIAACPVVALYTA
FT                   RSAWYWTAYLNSADITVFRNGDRVGKAIYNANRSAGGLNLSNFVQPSSKLDELVEQLFP
FT                   GMLPPPPPPAGTAAPAA"
FT   CDS_pept        complement(107104..107307)
FT                   /transl_table=11
FT                   /gene="h16_A0094"
FT                   /locus_tag="H16_A0094"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91246"
FT                   /db_xref="GOA:Q0KFH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFH5"
FT                   /protein_id="CAJ91246.1"
FT                   /translation="MQSVLSVLAILIMVATIVGVVSPAWLSQTLFGGRPVTRLQVAVIG
FT                   VCLAGLCLVLVGRLAQGGGAGG"
FT   CDS_pept        complement(107338..107907)
FT                   /transl_table=11
FT                   /gene="h16_A0095"
FT                   /locus_tag="H16_A0095"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91247"
FT                   /db_xref="GOA:Q0KFH4"
FT                   /db_xref="InterPro:IPR024422"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFH4"
FT                   /protein_id="CAJ91247.1"
FT                   /translation="MLNRTQQILVAIVAVAVLGMLWFAGNDRRDDVGDAAPEAQAEASA
FT                   VPASVVRGIPRDGTLDPISIDPERPADRLPQLQADTLLNDYRDNPKEADTRYLGQYLIV
FT                   EGVASGIRRERDQVFVDIRTNDPGVNVRALLLQRQICGPAGRVCEVEARATMVRRGQKV
FT                   ALECNGAGLADGAPLLRDCLLRGGAN"
FT   CDS_pept        complement(107949..109226)
FT                   /transl_table=11
FT                   /gene="h16_A0096"
FT                   /locus_tag="H16_A0096"
FT                   /product="Glycosyltransferase"
FT                   /function="Carbohydrate transport and metabolism / Signal
FT                   transduction mechanisms"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91248"
FT                   /db_xref="GOA:Q0KFH3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFH3"
FT                   /inference="protein motif:COGS:COG1819"
FT                   /protein_id="CAJ91248.1"
FT                   /translation="MRIFASHLSPAMRLILITFGTQGDCRPIVALGLGLRAAGHDVLML
FT                   GERSAATLAAEHGLAFAPMAGDIQQTLAPGGALHKLMTEGGNVAEATRAFARIAEDNTE
FT                   AWMAQLAEAARDADGIVFSGLTAYVALSVGEQLGKPVIGAGMFPISPTRAFPSALLPPF
FT                   RMPGWANRASHHVINFVLWRMFRSATNAARSRLFGASARKAMWADFPTLYAISPQLVPR
FT                   PHDWHDDWLVSGAWTMPPQPDWQPDAPLRDFLAAGEAPLYIGFGSMAGFDRHKVVTALV
FT                   QAADGRRALFYPGWSGIDVAALPSSFHVVGATPHDWLLPRVSAAIHHGGAGTTHAAAAA
FT                   GVPAIVLPFAGDQFFWAGRLAALGVAPRHVAGHKIDAPRLASMIAFAEQPATRERAARL
FT                   GRAMAAERGVDHAVAAIERFCGRQGA"
FT   CDS_pept        complement(109295..110251)
FT                   /transl_table=11
FT                   /gene="h16_A0097"
FT                   /locus_tag="H16_A0097"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91249"
FT                   /db_xref="GOA:Q0KFH2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFH2"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91249.1"
FT                   /translation="MAIDIRDLRCFLAVVSAGSISRAAEHMHLAQPALSLQIKQLEQEL
FT                   RVRLFDRTQRGVLPTAAGLRFVSHAKDILTRVDLACEDVRDFVAEPAGRVAIGLPQSMA
FT                   QILTLALVRETLARWQKIQLQIIELSTGYIPERLLSGHIDIGLTFQVDPGAGLLFEHLL
FT                   DEDLVLVGPPGALHGAPNASGSPGTVGQVAFAELADYAMLLPAGLHGLRALIDRHAKSH
FT                   HVSLRVLAEVNAIPQLIELAAAGVGFTILSYASVRRELRSGLLSAARIVEPGISRPVYL
FT                   CRSATTPLSMAASTVQALISDTVQALVADGRWPAHAS"
FT   CDS_pept        110432..111406
FT                   /transl_table=11
FT                   /gene="h16_A0098"
FT                   /locus_tag="H16_A0098"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91250"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFH1"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /protein_id="CAJ91250.1"
FT                   /translation="MTFSRRTLLLGTAAALLARHGFAQGWPSRPVRIVVPFAAGGPGDF
FT                   VARLAAKHLAQVLAQPVVVENKPGASGNLGAQFVLDTEADGHTLLLNTVGMQAVNPLMY
FT                   PAARFLPQRDFVAIGIAATVPNVLVVHPGKLGVSTMGDLVRLGKQRPGNLTFATYGPGS
FT                   SPHIYGALLQRLAGFSAIEVPYKGSAPASSDVMAGQVDFLFDSMTTCVSQIQGGKLKGL
FT                   AITSAERSPLLPAVPTMKEAGYGGLAMKYWLSLQASARTPPEIVSALRQALARALADPA
FT                   YQRALAARGAEPLLIAPAQVQAFVDRDAERWTAAARSIGIRAE"
FT   sig_peptide     110432..110503
FT                   /gene="h16_A0098"
FT                   /locus_tag="H16_A0098"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        111478..112656
FT                   /transl_table=11
FT                   /gene="h16_A0099"
FT                   /locus_tag="H16_A0099"
FT                   /product="bile acid-inducible operon protein F, predicted
FT                   acyl-CoA transferase/carnitine dehydratase"
FT                   /function="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91251"
FT                   /db_xref="GOA:Q0KFH0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFH0"
FT                   /inference="protein motif:PFAM:CoA_transf_3"
FT                   /protein_id="CAJ91251.1"
FT                   /translation="MLDLSKVLAGPLCGQYLGELGADVVKVEPIGVGDDTRAWLPQEQG
FT                   QSATFLSVNHNKRSIAVDLKTAEGQQLVQTLAAGADIVLQGFGGGTAARLGVDHDSLSA
FT                   RNPRLIYCEISGYGRTGPLGNEPGYDVMLQAFSGMISTMGDPAGKLARASFSPVDLGTG
FT                   MHAFSGILAALIEREKTGHGVYLEVSLLDTALGFMGYMAQNYWRTGRAPARMGTAHPAM
FT                   APYQAFDAADGPLMIGVGNDAQWRRFCTVAGLHDHVDDPAFATNAARVANFARTVDLVQ
FT                   RRIATQPVAFWLQALRAAGVACSPIHTLDQALAHPQLEARQLVVESEHPVLGTVRNMGL
FT                   PVRFRDGKRQAHRAPPLLGQHTEEILREAGFGPDMIRRYQADGIVAVAGSVT"
FT   CDS_pept        112713..113495
FT                   /transl_table=11
FT                   /gene="h16_A0100"
FT                   /locus_tag="H16_A0100"
FT                   /product="Enoyl-CoA hydratase/carnithine racemase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91252"
FT                   /db_xref="GOA:Q0KFG9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFG9"
FT                   /inference="protein motif:COGS:COG1024"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="CAJ91252.1"
FT                   /translation="MESMSSIRYAVRDQVAEIQLDSLPVNALNEAMIDDLIGALRRAAE
FT                   DDSVRAVILGSAIPRRFCAGLRLDAVQQSSPSQLYALVEKLYVGLCEAQFQLKKPSIAA
FT                   VEGAARGGGMTLAISCDMIVAAEDATFGYPEIDVGMIPAIHYTHLPRIVGRHRAFDLLF
FT                   TGRAFDADEAWRLGLVSRVVPQPDVMREARALAQSFCEKSPTIVRMGRAAFLRANDSDY
FT                   RRGVAGAVESFGNIAVTDDAKEGVAAFVEKRKPAWSPG"
FT   CDS_pept        113551..115905
FT                   /transl_table=11
FT                   /gene="h16_A0101"
FT                   /locus_tag="H16_A0101"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91253"
FT                   /db_xref="GOA:Q0KFG8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFG8"
FT                   /inference="protein motif:PFAM:Acyl-CoA_dh_N"
FT                   /inference="protein motif:PFAM:Acyl-CoA_dh_M"
FT                   /inference="protein motif:PFAM:Acyl-CoA_dh"
FT                   /protein_id="CAJ91253.1"
FT                   /translation="MPDHSRADRLEAFRQEVRSFLREVVPPDIRAASRAHCLVTREQAV
FT                   RWQRILHARGWAAPGWPREYGGPGWSLVEQAIFREELAASDAPRYDNLGIDTIGPTLIR
FT                   YGTPEQCRRFLPGMLSFDDFWAQGYSEPDAGSDLASLRTVARRDGDEWVVNGSKIWQTL
FT                   GQWANWALVLVRTDPSARRKQEGISVLLMDLRTPGVTVRPIRFINGAHFHVQMFFDDVR
FT                   VPAANLVGVEHAGWSIAKGLLVIERLFVARVGDCKAELASVAKLAGKWRPGPGAQIDDA
FT                   LLARRHAELDIRMRALEAAWWPAVRFAEQGGSPELEASLLKLDGNLLLQDLHTFKLDAL
FT                   GARTLPFDPRAIDGEPSPEPLSPGHAENFPLHYWRYRGITLAGGSSEIQRQIVAKAVFG
FT                   GLTEIDRPRQDQMDEQQAIMDGTLRRWLDKHYGFERRREAVAARDGFDPAAWAALAELG
FT                   LTGLLIPECDGGLGGTLSDLMPLLEALGEALVVEPMLWSAVLGTQVLLGAENAEGREPL
FT                   LAALASGQARCALAYREGQSRRDVHHPETVARRDGAHWRLHGVNRLVMGAAQAQHLFVT
FT                   ACLPEGGLALFDVPSQAAGVGLRAYQLHDGRSAADIRFDNVELPASALLCGADHATALL
FT                   DDALELATLALCAESIGAMRRSLALTVEYMRMRKQFGRTLSEQQVLQHRVADHYRGWHA
FT                   ARQLVREAVAGWSLVPPAERSRRVSAAKYMVGHASRVLALDALQLHGAIGMQDETPISH
FT                   YSKRLMANDALLGNASAHLGRFVDAGHRSQA"
FT   CDS_pept        115939..116934
FT                   /transl_table=11
FT                   /gene="h16_A0102"
FT                   /locus_tag="H16_A0102"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91254"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFG7"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /protein_id="CAJ91254.1"
FT                   /translation="MQALRSTRRLALALAAALGAMMAAPAVSAQTGAAWPARPVTIIVP
FT                   GAAGGTIDIPIRMLAQKLSLRLGQPVIVDNRPGSGGIIGTQAALRAPADGYTLLAGNVG
FT                   PQAINYSAYKTLPYKPDDLVGITDVISFPSVLVVNAQSPIRSAADLVAQMRAQAGKLSF
FT                   GSSGIGQTSHLTGELLKQRTGTDAIHVPYRGSTPATTALLAGETTFQFDNLTQALPHIR
FT                   AGKLRPLAVTSARRIPSLPEVPTMEETGVGNLLSTAWIGIFVKAGTPPEIAARLHEHLV
FT                   AVLRAPDVVTEISRMGGIPGGQAQERFAAFVTAERLRWSETIKTSQLSLD"
FT   sig_peptide     115939..116028
FT                   /gene="h16_A0102"
FT                   /locus_tag="H16_A0102"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(116951..118417)
FT                   /transl_table=11
FT                   /gene="h16_A0103"
FT                   /locus_tag="H16_A0103"
FT                   /product="Predicted GTPase"
FT                   /function="General function prediction only"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91255"
FT                   /db_xref="GOA:Q0KFG6"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFG6"
FT                   /inference="protein motif:PFAM:MMR_HSR1"
FT                   /protein_id="CAJ91255.1"
FT                   /translation="MPRQPHPICDNSAMTAPQVPIAAIATAPGRGGIGVVRVSGPDVGP
FT                   VMRSVCGQALKPRHATYLPFLDGHGKVIDHGLALYFPAPNSYTGEEVLELQGHGGPVVM
FT                   QMLLTRCLQAGDGIGLRLAEPGEFTRRAFLNDKLDLAQAEAVADLIEASTEAAARSAAR
FT                   SMEGEFSNAIRQLVDKVIHLRMLVEATLDFPEEEIDFLEQSDARGQLATIRTELSGVLA
FT                   QARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAIVTPIAGTTRDRVRETIQIDGI
FT                   PLHIIDTAGLREHAADEVERIGIERTWDAIRRADIVLHLVDATDYLRHGLSETDDAIDD
FT                   QLSGQLPPGSPIVRIVNKIDKAPAVGDVVFGGNRPHVVAANGPNPTEIWISARTGAGIE
FT                   LLRRELLRLVGWQSGNEGNFLARERHLTALRNAQSHLDIAAEQAEHQAQALDLFAEELR
FT                   LAQDCLNSITGEFTSDDLLGTIFTRFCIGK"
FT   CDS_pept        complement(118450..119403)
FT                   /transl_table=11
FT                   /gene="h16_A0104"
FT                   /locus_tag="H16_A0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91256"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFG5"
FT                   /inference="protein motif:COGS:COG5607"
FT                   /inference="protein motif:PFAM:PF05235"
FT                   /protein_id="CAJ91256.1"
FT                   /translation="MQREGAGLSTIHAPVTPRGSGPACRRLHWKHPRPECAPERMQPAM
FT                   IADTHPPPLRRKTRPAAAFAALTQASLARIEASLAQLLRRDEPEDLHALRVAVRHARAV
FT                   LWALGPSLPRQERDRWKHDLRMLARATSDVRDWDVFLAETIAPARKLEPDDTVLSAIAD
FT                   TARERRDTARQTMLAALAGYRDWPLPALHRDLAHLAQLAARARNGGGRLGPFARKRVRR
FT                   GRKRLRALAKAARRGDPRAVHEQRIAGKRLRYVIEAFEPVLPSRYTRDLHRKLVKGQAK
FT                   LGRLVDGIVARRLLADCLQAQAMPDEAPPRPLPGAS"
FT   CDS_pept        119446..119883
FT                   /transl_table=11
FT                   /gene="paaI2"
FT                   /locus_tag="H16_A0105"
FT                   /product="phenylacetic acid degradation protein"
FT                   /function="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91257"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFG4"
FT                   /inference="protein motif:COGS:COG2050"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="CAJ91257.1"
FT                   /translation="MTTEQERLLLRDTIEAGFRQAAFVNDVGITLADCGPGWCESTLAI
FT                   APRHLQHGGIVHAGVQATIADHTAGAAASTILEAGQHVVTAEFKINLLRAVRSERLRCR
FT                   ADVLKSGRSIIVVEADVFADVHGESVLVSRLNATMSVLDLA"
FT   CDS_pept        119915..120301
FT                   /transl_table=11
FT                   /gene="h16_A0106"
FT                   /locus_tag="H16_A0106"
FT                   /product="lactoylglutathione lyase or related lyase"
FT                   /function="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91258"
FT                   /db_xref="GOA:Q0KFG3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFG3"
FT                   /inference="protein motif:PFAM:Glyoxalase"
FT                   /protein_id="CAJ91258.1"
FT                   /translation="MIDHTGVSVSDYGKSRAFYQAALGAIGYVLDKEFPASVTGSTDVA
FT                   GFGPPGQPDFWIHRGTPNQPPLHVAFRVDSRETVDAFHRAALAAGGRDNGAPGIRAHYH
FT                   PNYYGAFVLDPDGHNIEAVCHKPA"
FT   CDS_pept        complement(120310..121080)
FT                   /transl_table=11
FT                   /gene="h16_A0107"
FT                   /locus_tag="H16_A0107"
FT                   /product="Trans-aconitate 6-methyltransferase"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91259"
FT                   /db_xref="GOA:Q0KFG2"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFG2"
FT                   /protein_id="CAJ91259.1"
FT                   /translation="MSWSAHQYVAFEDERTRPVRDLVAAIPNEIARSAVDIGCGPGNST
FT                   EVLLARYTGASVTGLDSSQDMVDAARKRLPAVQFRVADIGAWDEAGPYDVILANAVLQW
FT                   LPDHASLFPALVSRLAPGGTLAVQMPDNLEEPAHRLMRQVATESPWAEKLAGASKARAE
FT                   RAPAQWYYELLRPLCQRVDVWLTTYHHPLADGPAAVVEWFKGSGLRPFLQPLDEAERAA
FT                   YLARYQTEIAKAYPALPDGSVLLPFPRLFIVATR"
FT   CDS_pept        complement(121158..122615)
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="H16_A0108"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit B"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91260"
FT                   /db_xref="GOA:Q0KFG1"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFG1"
FT                   /inference="protein motif:COGS:COG0064"
FT                   /inference="protein motif:PFAM:PF02934"
FT                   /inference="protein motif:PFAM:PF02637"
FT                   /inference="protein motif:PFAM:PF01162"
FT                   /protein_id="CAJ91260.1"
FT                   /translation="MQWEVVIGLETHAQLSTASKIFSGTSTAFGAEANTQASPVDLALP
FT                   GVLPVLNKGAVERAIQFGLAIGATISPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGT
FT                   ITIQVEGRKGEFYEKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPD
FT                   MRSAAEAVAYAKALHSLVVWLGICDGNMQEGSFRCDANVSVRPLGQKEFGTRREIKNLN
FT                   SFRFLQQAIEYEVQWQIAEIEDGRKIQQATVLFDPETGETRAMRTKEDAHDYRYFPDPD
FT                   LMPLEIDASWVERVRGELPELPVAMQARFVSQYGLSAYDATTLTATKAFAAYYEAVVAD
FT                   AGAANAKPAANWLMGDVASQLNREGIAIDAAPVTPAQLARLLARIADGTVSNNTAKKDV
FT                   FPAMWAGEHGGDADAIIAAKGLKQMSDTGELEKIIDDVLAANARSVEEFRAGKEKAFNA
FT                   LVGQAMKATKGKANPAQVNELLKKKLG"
FT   CDS_pept        complement(122706..123737)
FT                   /transl_table=11
FT                   /gene="h16_A0109"
FT                   /locus_tag="H16_A0109"
FT                   /product="dienelactone hydrolase or related enzyme"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91261"
FT                   /db_xref="GOA:Q0KFG0"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFG0"
FT                   /inference="protein motif:PFAM:DLH"
FT                   /protein_id="CAJ91261.1"
FT                   /translation="MLRAAVALGLGAWLAGASAHTPELPAPALAQPAPLTPAGVLAPNA
FT                   VSRAAPGSAATAPVPAQRVQLRGDAATPALTAYWFLPREGATPRALPVVVALHGCGGLL
FT                   SARPARASAAGAAGTAQADVSGLLQQRYREYAHWLNERGYAVLMPDSFSARGRPHGICS
FT                   EPIDARGIDDRTRRADALAALRWVAQQPAVDTARIVLLGWSNGAQAVLATVDASRPWPA
FT                   GTPQVERAVAFYPGCRRAVQQHNFRLRAPMLLMIGGADDWTPATRCAMLQSAVLARQPG
FT                   ARFRLEIYPGAYHGFDGTSELHMRRDVPAGMRKTQGVTVGGDAVARVAALAQLDSWLAS
FT                   PDP"
FT   CDS_pept        complement(123815..124285)
FT                   /transl_table=11
FT                   /gene="h16_A0110"
FT                   /locus_tag="H16_A0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91262"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFF9"
FT                   /protein_id="CAJ91262.1"
FT                   /translation="MTARSSLTLRLMAAAALAAAVAGCIPLPGGLGRPAPIASRDIDLA
FT                   GDCRRTEEDGFREDAQLRVSDNSVQQLSWKLWVGKRGSCSFNLADFRQVQKKPHIELRA
FT                   NDGSGCKLMVWQDPRRVTLAHANCQQRCTPGVYEEAWPVMFEPGSGACARTR"
FT   CDS_pept        complement(124288..125793)
FT                   /transl_table=11
FT                   /gene="gatA1"
FT                   /locus_tag="H16_A0111"
FT                   /product="Glutamyl/Aspartyl-tRNA(Gln/Asp) amidotransferase
FT                   subunit A"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91263"
FT                   /db_xref="GOA:Q0KFF8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFF8"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="CAJ91263.1"
FT                   /translation="MPFSADSVTSLRQLADALAARSVSAEELAREYLARIEQAAALNAF
FT                   IHVDAERTLAQARAADERRARGEAAPLTGVPIAHKDVFVTRGWRATAGSKMLANYESPF
FT                   DATVVERMAAAGMVTLGKTNMDEFAMGSSNENSHFGPVRNPWDTSRVPGGSSGGSAAAV
FT                   AAGLAPAATGTDTGGSIRQPSSFSGITGIKPTYGRVSRYGMIAFASSLDQAGPMAHSAE
FT                   DCALLLNAMAGFDPRDSTSITPAQGGVDEDYTRLLGQPRAGATTERPLAGLRIGLPKEY
FT                   FGKGLSADVEQAVRAALAEYEKLGATLVEVTLPKTELSIPVYYVIAPAEASSNLSRFDG
FT                   VRYGHRAAEYRDLLDMYKKSRAEGFGAEVKRRIMVGTYVLSHGYYDAYYLQAQKIRRII
FT                   ADDFQRAFAQCDVIMGPVAPTVAWKLGEKTSDPVQMYLADIFTLSTSLAGLPGMSVPCG
FT                   FGEAGMPVGLQLIGNYFDEARLLQTAHAFQQATDWHLRRPGKA"
FT   CDS_pept        complement(125886..126185)
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="H16_A0112"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit C"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91264"
FT                   /db_xref="GOA:Q0KFF7"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFF7"
FT                   /inference="protein motif:PFAM:Glu-tRNAGln"
FT                   /protein_id="CAJ91264.1"
FT                   /translation="MALALSDVKRIAHLARIEISDDEAAQTLAQLNNFFSLVEQMQAVD
FT                   TSGIEPLAHPLSAVRDMVQRLREDVVTESDRRADYQRPAPATEDGLYLVPKVIE"
FT   CDS_pept        126775..127818
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="H16_A0113"
FT                   /product="rod shape-determining protein MreB"
FT                   /function="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91265"
FT                   /db_xref="GOA:Q0KFF6"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFF6"
FT                   /inference="protein motif:PFAM:HSP70"
FT                   /protein_id="CAJ91265.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRDKGIVLDEPSVVAIRQEG
FT                   GPNAKKTITAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMLKQFIKMVHDSKL
FT                   LRPSPRIIICVPCGSTQVERRAIRESALGAGASQVYLIEEPMSAAIGAGLPVSEPSGSM
FT                   VVDIGGGTTEVGIISLGGMVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVREMEVKGRNLSEGIPRAFTVSSNEILEALTDPLNQIVSAVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   CDS_pept        128015..128980
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="H16_A0114"
FT                   /product="rod shape-determining protein MreC"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91266"
FT                   /db_xref="GOA:Q0KFF5"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFF5"
FT                   /inference="protein motif:PFAM:MreC"
FT                   /protein_id="CAJ91266.1"
FT                   /translation="MDYSPPPLFKQGTSAVARLVLYVGIALALLVVDARFDALSVGRQV
FT                   AATVLMPVERLVLTPRDALRTMFDYAQSSAMLATENRELRQNAVQQAQASVRQAQLESE
FT                   NNQLRKLLGLAQQSATPVTAAEILYDARDPYTQRIVIDKGSQHGLRAGYPVIDERGVVG
FT                   QVTRVSPFQSEVTLLTDKDQAIPVQVVRNGLRSVAFGGARAGQLDLRFMAAAADLQQGD
FT                   LLVTSGLDGTYPPGLPVAKIVHIERKADTAFSRVYCEPVAGVRAHRLLLVVRYDAAIPA
FT                   RETVEAKPEAPVKGAKSAAARAAADSAAAAKAAPAKEAPR"
FT   CDS_pept        128977..129489
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="H16_A0115"
FT                   /product="rod shape-determining protein MreD"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91267"
FT                   /db_xref="GOA:Q0KFF4"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFF4"
FT                   /inference="protein motif:PFAM:MreD"
FT                   /protein_id="CAJ91267.1"
FT                   /translation="MTNPQYLLRPVNPAFIAFSFVLAFLFNLMPWGTTLWVPDMVALVL
FT                   VFWNIHQPRKVGMGVAFLLGLLMDVHDARLLGEHALAYTLLAYFAITIHRRVLWFTVYT
FT                   QALHVLPLLFVVHAVPVLIRLAMGAPLPGWQLLLAPAIEALLWPLATSLLLAPQRRSSD
FT                   VDETRPI"
FT   CDS_pept        129543..131849
FT                   /transl_table=11
FT                   /gene="ftsI2"
FT                   /locus_tag="H16_A0116"
FT                   /product="cell elongation specific D,D-transpeptidase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91268"
FT                   /db_xref="GOA:Q0KFF3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFF3"
FT                   /inference="protein motif:COGS:COG0768"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /inference="protein motif:PFAM:PF03717"
FT                   /protein_id="CAJ91268.1"
FT                   /translation="MTEIRNVELEIGRFRIRVAAAALFTVICFGLLFTRFLWLQWYKHD
FT                   QYSAKAEDNRISVAPIEPNRGIIMDRNGIVLARNYSAYTLEITPSKLGDTLDNTIEGLS
FT                   ALVDIQPRDRRRFKRLMEESRSFESLPIRSQLSDEEVARFSAQRFRFPGVDVRARLFRQ
FT                   YPLGESASHVIGYLGRISQRDQERIEAMDEANDADGAKYDPRKDADNYKGTNYIGKIGL
FT                   EQSYESELHGLTGFEEVEVSAGGRPIRTLSTSPATPGNNLILSLDIRLQQLAEALYGNR
FT                   RGALVAIEPSTGDILAFVSKPTYDPNLFVEGIDTNTWNELNNSPDKPLLNRPLRGTYPP
FT                   GSTYKPFMALAALTTGKRTAAWGMSDPGFFTLGNHTFRDDKPGGHGWVDMHSSIVHSCD
FT                   TYYYALARDMGVNGIHDFMKPLGFGQITGIDIEGESRGILPSTDWKRKAYRKPEQQKWY
FT                   DGETISLGIGQGYNSFTILQLAQATSVIVNDGKVMKPHLVKAVEDAVTRKRTLTVPKES
FT                   YTIPLKQADINVIKRAMVAVTHSGTAARVFAGAAYESAGKTGTAQTYSLAKGEKYNHHA
FT                   LDERKRDHSLYTAFAPADNPRIAIALIVENAGFGAAVAAPIARKVMDYYLTGKWPAELE
FT                   AIAPPEAERMAGRPPVATPSVFTTGQTASIASATVMSSGSAPASGAAASEVAAASGAHA
FT                   GASDAIAAALDPAAIAPASAVQTLDERMLQALGHSKPKVPPPASAPVVPAKAPAPKPRV
FT                   KPVAAKAASGADATR"
FT   CDS_pept        131861..133003
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="H16_A0117"
FT                   /product="rod shape-determining protein RodA"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91269"
FT                   /db_xref="GOA:Q0KFF2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFF2"
FT                   /inference="protein motif:PFAM:FTSW_RODA_SPOVE"
FT                   /protein_id="CAJ91269.1"
FT                   /translation="MDRRRVLSLIKTALTGFDKPLSLIVFLLFATGIVALYSAAIDMPG
FT                   RVEDQLRNILLSYVVMIVIAYLPTQTLMRVAVPIYTVGVALLIAVAMFGLIRKGARRWL
FT                   YVGMVIQPSEIMKISMPLMLAWYFQKREGVIKWFDFVVALGLLLIPVGLIAKQPDLGTA
FT                   LLVMAAGVYVIYFAGLSWRLILPLLGLLVVAITLLITFQNDMCAPGVNWPVLHDYQQHR
FT                   VCTLLDPTSDPLGKGFHTIQSIIAIGSGGVEGKGWLKGTQTHLEFIPEKHTDFIFAVYS
FT                   EEFGLIGNAVLLVLYLLLIFRGLFIAANAPTLFSRLLAGSITLIFFTYAFVNMGMVSGI
FT                   LPVVGVPLPLMSYGGTALVTLGAGIGILMSISRQKRLIQT"
FT   CDS_pept        133093..133779
FT                   /transl_table=11
FT                   /gene="h16_A0118"
FT                   /locus_tag="H16_A0118"
FT                   /product="Conserved protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91270"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFF1"
FT                   /inference="protein motif:PFAM:PF04340"
FT                   /protein_id="CAJ91270.1"
FT                   /translation="MNAQDVAAYLQSHPEFFEEHAELLAAVQLTSPHSHRAVSLQERQM
FT                   EILREKNKGLELRLADLVRHGHDNDRTQQRMHAWQLRLLAEADSHALPYAVQDGLQQVF
FT                   DVPAVALRLWDVAEQYVHMEVAQGASEDLRIFAEGLRAPYCGSNGGFEAAGLLERDDIT
FT                   SLAMVTLRVPVRAGDAEAGADVRGAAFGLLVLGSPDPRRFHEGMGTAYLSQIGEVAGAA
FT                   LHRLRD"
FT   CDS_pept        133805..134884
FT                   /transl_table=11
FT                   /gene="h16_A0119"
FT                   /locus_tag="H16_A0119"
FT                   /product="Site-specific recombinase XerC/Integrase"
FT                   /function="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91271"
FT                   /db_xref="GOA:Q0KFF0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFF0"
FT                   /inference="protein motif:PFAM:Phage_integrase"
FT                   /inference="protein motif:PFAM:Phage_integr_N"
FT                   /protein_id="CAJ91271.1"
FT                   /translation="MTARRPPRSVVADIAPASDGPPPAPEPLVTRYLDWLRGSRKLAEH
FT                   TLTSYSRDLRVLQGHAARYAPGVALLALQTHHIRNFAARLHGAGLVGTSIARTLSAWRG
FT                   FFQWAARHGHGVTVNPVDGVRAPRSGHALPKALSVEHAVALVAHPAGTDAQALRDQAVH
FT                   ELFYSSGLRLSELVQLDLRYADADGYRSSGWLDLAGAEVTVTGKGSRQRSVPVGSKAIE
FT                   ALRAWLAVRDTLLRPGALPEDAHALFLGPRGRRLSMRTVQLRLKQQALRAGVPADVHPH
FT                   MLRHSFATHVLQSSGDLRAVQEMLGHASISTTQVYTALDFQHLAKVYDKAHPRAGRARA
FT                   RPAADAAADPADSGEASED"
FT   CDS_pept        complement(134886..135842)
FT                   /transl_table=11
FT                   /gene="h16_A0120"
FT                   /locus_tag="H16_A0120"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91272"
FT                   /db_xref="GOA:Q0KFE9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFE9"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91272.1"
FT                   /translation="MAWKSAWEKDLPRGWHRELPRLPALTALRAFEAAARHESFSRAAT
FT                   ELFVTHGAVSHQIRALEDELGMPLFERHGKRVALTPSGRLYAERVRDALLQIADATRAL
FT                   QAGNRDKRLTISTMPSFAARWLTPRIGSFIERHPELDVELLSSNTLVNFAHEEVDIALR
FT                   MGSGDYPGLYVERLLDDVFFPVCSPGFNGGRLPERPQDMAGLPLLRGEGDPWKPWFEAA
FT                   GLDWPEPRKGLLLEDSSLLLQAASEGQGIALIRSSLAYNDLLAGRVVRLFDVSIPCPWL
FT                   LYFVCAPGSLNLPKVQAFRGWLLPEIERFREVLAQWE"
FT   CDS_pept        136091..136459
FT                   /transl_table=11
FT                   /gene="h16_A0121"
FT                   /locus_tag="H16_A0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91273"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFE8"
FT                   /protein_id="CAJ91273.1"
FT                   /translation="MKTVLTTTVFTLNPGEVTTLSVHAAQRLHVEEARGADVWLTREKD
FT                   SEDYWLRCGGSLLLRSGDEVVLSVDPRALHPVRLALIAEARRPALALADVPHLVYRSLR
FT                   RLVRGTEWTPNQDQVTAS"
FT   CDS_pept        136579..137385
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="H16_A0122"
FT                   /product="Lipoate-protein ligase B"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91274"
FT                   /db_xref="GOA:Q0KFE7"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFE7"
FT                   /inference="protein motif:COGS:COG0321"
FT                   /inference="protein motif:PFAM:PF03099"
FT                   /protein_id="CAJ91274.1"
FT                   /translation="MTEAGPAQAGPFRYTLAMHPIQVIERGREDYQPCFDAMRAFTAAR
FT                   TPETPDQVWLVEHPPVYTLGQAGDPAHLLAPDDRIPVVQIDRGGQITYHGPGQVVAYLL
FT                   LDLRRRRLMVRELVHGIEQAVLDTLAAYNLAAERKPGAPGIYLSDGPHQGAKIAALGLK
FT                   IRNGCSYHGVSLNVQMDLSPFLRINPCGYAGLETVDMASAGATFAAADANGAPLPVTAA
FT                   QQPEIALRLAAALCEVLAAHEARALAAEGTAAPAEAKQPGETALAS"
FT   CDS_pept        137426..138421
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="H16_A0123"
FT                   /product="lipoate synthase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91275"
FT                   /db_xref="GOA:Q0KFE6"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFE6"
FT                   /inference="protein motif:COGS:COG0320"
FT                   /protein_id="CAJ91275.1"
FT                   /translation="MSDALIATSSEAPQSPAEQYDPTRKQKSADKTARIPIKIVPAEKL
FT                   KKPDWIRVKAATGSSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDKC
FT                   TRRCPFCDVGHGRPDPLDVNEPGNLARTIAQLKLNYVVITSVDRDDLRDGGAQHYVDCI
FT                   SQTRELSPATRIEVLVPDFRGRLDKALDILQACPPDVMNHNMETVPRLYKQARPGADYE
FT                   HSLKLLQEFKRRNPNVPTKSGLMVGLGETDEEILEVMRDMRAHDIDMLTIGQYLAPSNH
FT                   HLPVLRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHQAGFA"
FT   CDS_pept        138663..139310
FT                   /transl_table=11
FT                   /gene="h16_A0124"
FT                   /locus_tag="H16_A0124"
FT                   /product="allophanate hydrolase subunit 1"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91276"
FT                   /db_xref="GOA:Q0KFE5"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFE5"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="CAJ91276.1"
FT                   /translation="MNCTVHRLAEQALLYSVAPPASLEVQRRIWAMAARAEDWRGVVDV
FT                   VPGMNNLTVIFDGSADVDALERNLKLAWASGEARNATGKLVEIPVRYGGEHGPDLGDVA
FT                   AHTGLTPREVVRRHAAGEYVVYFLGFQPGFAYMGGLAPELATPRRREPRVAVPAGSVGI
FT                   GGEQTGIYPAVLPGGWQLIGRTDAELFVADRDPPSLFAPGDTVRFVAEEIIA"
FT   CDS_pept        139307..140326
FT                   /transl_table=11
FT                   /gene="h16_A0125"
FT                   /locus_tag="H16_A0125"
FT                   /product="allophanate hydrolase subunit 2"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91277"
FT                   /db_xref="GOA:Q0KFE4"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFE4"
FT                   /inference="protein motif:PFAM:PF02626"
FT                   /protein_id="CAJ91277.1"
FT                   /translation="MIEIIRPGALASVQDLGRTGFRRFGVGRCGAMDMLAVEVGNRLLG
FT                   NAPGCAAIEFTLGRAALRFHADMRVALAGAECGANLDGVPVWSWHAFDVHKGETLTLPS
FT                   TRGGTRVYLCVAGGIEVEPVMGSRSTDLKSGFGGLGGRALQEGDRLTAGRPGLAAETDW
FT                   IGVQAPAWALPASIAGKATPVRMLPGPEYEDFDAASRAALWQADWTVTPNSNRMGLRLN
FT                   GPALARRAERSADLLSHGVVPGVMQVPPGGQPIALMADAQTTGGYPKIGVVIGADLWRL
FT                   AQVPLGAPVRFVQVTLAQAEAAQAELERYLRQIDQALRWQGDGMPIAARRRASTRVAA"
FT   CDS_pept        140382..141122
FT                   /transl_table=11
FT                   /gene="h16_A0126"
FT                   /locus_tag="H16_A0126"
FT                   /product="lactam utilization protein LamB"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91278"
FT                   /db_xref="GOA:Q0KFE3"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFE3"
FT                   /inference="protein motif:PFAM:LamB_YcsF"
FT                   /protein_id="CAJ91278.1"
FT                   /translation="MQIDLNADLGEGCANDEALLALISSANIACGWHAGDAATMVQTVK
FT                   WALERGVAIGAHPSYPDRENFGRTEMQRDPEHVYADVLYQIGALDAIVRAQGGELHHVK
FT                   PHGALYNQAVRDPALARAIVRAVRDFDADLVFFGLAGSQMIDIAREAGLRVKQEVFADR
FT                   GYNPDGTLVKRGSPGALHEDEEVALNQTLTMVREKRVRAIDGTWVPIQAETVCLHGDGA
FT                   HALAFARRIRERLGAEGIAVRAGD"
FT   CDS_pept        141223..141951
FT                   /transl_table=11
FT                   /gene="h16_A0127"
FT                   /locus_tag="H16_A0127"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="5 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91279"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFE2"
FT                   /inference="protein motif:PFAM:PF06149"
FT                   /protein_id="CAJ91279.1"
FT                   /translation="MEQAVNLWPLVGVGVIIVGFVLRFNPMLVVVLAALATGLAAPMPL
FT                   MQIFSAIGTAFVKARNLPLIILLPLAVIGLLERHGLREHAQAWIARIASATVGRLLIVY
FT                   LGVRELTAAIGLTSLGGHPQMVRPLLAPMAEGAAENRFGHLPEPVRQRVLAFCAATDNV
FT                   GLFFGEDIFVAFGAIALMHTFLLSSNIDVEPLHIAVWGIPTAICAFLIHAVRLKRLDRW
FT                   LERELGGKAAAAAVPAKSAE"
FT   CDS_pept        141962..142912
FT                   /transl_table=11
FT                   /gene="h16_A0128"
FT                   /locus_tag="H16_A0128"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="8 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91280"
FT                   /db_xref="GOA:Q0KFE1"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFE1"
FT                   /inference="protein motif:PFAM:PF06166"
FT                   /protein_id="CAJ91280.1"
FT                   /translation="MIISIEYLYWLAGLVLAITALMTFADREHPRRLSTGLFWLLYAIV
FT                   FLIGDRLPPAAVGIGAVVMALIAGFGGVGHGKHHSLPEEERRASARRLGNRLFIPALLI
FT                   PLVTVIGTMLFKDVKIAGVPLLDPKNVTFVSLGIGCLISLAVVCWLTRDTVAQGLRESR
FT                   RLTESLGWALVLPQMLAMLGLVFADAGVGKAVAHLSTAYINMDYKLVAVAVYCVGMALF
FT                   TVIMGNGFAAFPVMTGGVGVPILVGMFGGNPAVMAAIGMFSGYCGTLMTPMAANFNIVP
FT                   AALLELDDKNAVIRAQVPTALAILVANIALLYFLM"
FT   CDS_pept        142928..143578
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="H16_A0129"
FT                   /product="Pyroglutamyl-peptidase I"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91281"
FT                   /db_xref="GOA:Q0KFE0"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFE0"
FT                   /inference="protein motif:MEROPS:C15.001"
FT                   /inference="protein motif:COGS:COG2039"
FT                   /inference="protein motif:PFAM:PF01470"
FT                   /protein_id="CAJ91281.1"
FT                   /translation="MRTVLLTGFEPFENEPINPSWEAVRALDGERVGDAVIVARQLPCV
FT                   FGAAIDTIGELVDVLRPALVIAVGQAGGRAEMSVERVAINVDDARIADNAGAQPIDTAI
FT                   VAGGPAAYFATLPIKAMVRDMRAAGVPASVSQTAGTFVCNHVFYGLMHRLSQQPDGDVR
FT                   GGFIHIPYLPEQAARHPGQPSLAQETLVKGLRAAVATALSTRADVREQGGQLH"
FT   CDS_pept        complement(143591..144841)
FT                   /transl_table=11
FT                   /gene="h16_A0130"
FT                   /locus_tag="H16_A0130"
FT                   /product="predicted integral membrane protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91282"
FT                   /db_xref="GOA:Q0KFD9"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFD9"
FT                   /inference="protein motif:PFAM:VanZ"
FT                   /protein_id="CAJ91282.1"
FT                   /translation="MEPAPPPPSAPPPAAQPTPEATGPQHSPLARVGLICFTLLVVYAS
FT                   LYPFSGWVDNGVSPFAFLSAPKPRYITDFDLLTNVLGYFPFGALVVLSLHPRMSGGRAT
FT                   LVALVAGTLLAACMEAFQTWLPSRISSNIDLITNALGALLGGAVVAPFTRALIDDGRLT
FT                   RLRHAWFEPHASFAIILLLLWPFAQVFPQEHLFGMGGIVREWLTDPESWPMQALQMVFP
FT                   QLEAWQDHIGLRPEDMQSQQLLESLVTASSWVGTGLFASIAMRRSAPMLRILAGLLAAA
FT                   LLLKATAAELQFPSESAFVWLSEGGRFALLTSSLVLALLLYLPRWLRAVLAMVALIVLV
FT                   VLTNVLPSNPYAWISEQGWRMGRFIHFNSLAQWLGWLWPFLAFCYVIWRFEQVSLRRHA
FT                   RKKAAARREAAAAGTQE"
FT   CDS_pept        complement(144861..145550)
FT                   /transl_table=11
FT                   /gene="h16_A0131"
FT                   /locus_tag="H16_A0131"
FT                   /product="ABC-type transporter, auxiliary component"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91283"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFD8"
FT                   /inference="protein motif:TCDB:3.A.1"
FT                   /inference="protein motif:COGS:COG3218"
FT                   /protein_id="CAJ91283.1"
FT                   /translation="MPPLTRYRQPRDAAVNPATEMPRLLRSAISRLQAALLLAAAGLAL
FT                   SGCALTRGNDPTVTYDLGPPAATTPGNGNPAPARLPKLRVAQTDGPNWLDGNALFYRLQ
FT                   YAQAQRLQAYATQRWVMSPTRLFDERLREAVAARGTLSWFGDSSVPALKVDLIEFDQVF
FT                   DSATTSEGVVRLRATVFQHGMLGQQTFEARRPAASADGAGGVKALAEASDAVIAALLDW
FT                   IGTLQLK"
FT   CDS_pept        complement(145561..146502)
FT                   /transl_table=11
FT                   /gene="h16_A0132"
FT                   /locus_tag="H16_A0132"
FT                   /product="ABC-type transporter, periplasmic component"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91284"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFD7"
FT                   /inference="protein motif:TCDB:3.A.1"
FT                   /inference="protein motif:COGS:COG1463"
FT                   /protein_id="CAJ91284.1"
FT                   /translation="MMENKSHAFLAGVFTIGLAVLVLFAIFWFSTDHAVRVPYDLITRS
FT                   TVNGLQPQGDVKYRGLAVGKVESIKFDPQVPGQIIVRVNVNKDTPITRTTYGTLGFQGV
FT                   TGIAYVQLDDSATHDGTTASPPLPTSPKAVARIAMRPGFFEELEKRGDSLLTQVETMMA
FT                   SLNDMFQGANRAELMAAIRSVRKTAEDYSRLSDSLGPAANRLPKVTENLNATLESTRRL
FT                   TQELANPNGTVMRTVDSVGRDLQGAASSVQSAAGTFSEETLPQLNGLARDARQTARTFE
FT                   RAAGQFNESPSSVLFGAPAPAPGPGEPGFSAP"
FT   sig_peptide     complement(146401..146502)
FT                   /gene="h16_A0132"
FT                   /locus_tag="H16_A0132"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(146499..147353)
FT                   /transl_table=11
FT                   /gene="h16_A0133"
FT                   /locus_tag="H16_A0133"
FT                   /product="ABC-type transporter, ATPase component"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91285"
FT                   /db_xref="GOA:Q0KFD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFD6"
FT                   /inference="protein motif:TCDB:3.A.1"
FT                   /inference="protein motif:COGS:COG1127"
FT                   /protein_id="CAJ91285.1"
FT                   /translation="MSAAPATATQDGKVQKDRTPVIEVRNLVKRFGKAMVHDHVNLDVY
FT                   RDEVLSIVGGSGSGKTVLLRQIVGLERPTSGSIKVFGEDPTRLRPAQLQALRNRWGLQF
FT                   QRGALFSALSVIDNIALPLRELRALPDNLICQAALLKLQLVGLSARDADKMPSDLSGGM
FT                   IKRVALARALALEPELLFLDEPTAGLDPMASDDYVALIRELRRELGLTVVMITHDLDTL
FT                   VALSDRVAVLADHKVIAAAPIPEVVKVDHPFIREYFLGERAQRAMQALPPHAQPDAPPP
FT                   GEA"
FT   CDS_pept        complement(147350..148486)
FT                   /transl_table=11
FT                   /gene="h16_A0134"
FT                   /locus_tag="H16_A0134"
FT                   /product="putative uncharacterized transport protein"
FT                   /note="5 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91286"
FT                   /db_xref="GOA:Q0KFD5"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFD5"
FT                   /inference="protein motif:TCDB:9.B.11"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="CAJ91286.1"
FT                   /translation="MPLERQTTPDFHITRGDGTVSVALRGDWTALALAGCHQARQLRAQ
FT                   LHELAQAPDSAQWSLAGVERLDHIGGQLLWQAWNGALPQRLDASEGQRRVFERIAAVQN
FT                   EGWKKHMVDRFNPITLFGANVLSFGAQLRSGITMLGQLAFDLLRFAGVPQRGPWREISA
FT                   NIYNVGYKALGITALVGFLIGIVLSYLSANQLRTFGASTFIVNILGMAVIRELGPVLAA
FT                   ILIAGRSGSAITAQIGVMRVTEELDAMRVMGISHGFRLIMPRVIALAIAMPLLVAWTDV
FT                   MALAGGMLAARMQLGISATFFLRELPDAVPVANLWLGLGKGVVFGILIALTACHFGLRI
FT                   KPNTQSLGEGTTASVVTAITIVILADAVFAVLFKDVGL"
FT   CDS_pept        148616..149539
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="H16_A0135"
FT                   /product="Biotin-(acetyl-CoA carboxylase) ligase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91287"
FT                   /db_xref="GOA:Q0KFD4"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFD4"
FT                   /inference="protein motif:PFAM:BPL_LipA_LipB"
FT                   /inference="protein motif:PFAM:BPL_C"
FT                   /protein_id="CAJ91287.1"
FT                   /translation="MFSTIAIDPNPLPRMSAVPPTPSDPSAPSGANWRIDAGALRGMLS
FT                   PALSDWTLELVEETGSTNADLTAACRQAPWTDAARLRLAYRQTAGRGRQGRPWQGQAGM
FT                   TFSVALPLALAPAQLSGLSLAVGLALAEALGDVDARLGARIGLKWPNDLQIDGRKLAGI
FT                   LIESVPAGPQRVWAVIGIGLNLVRDAQMEAALGRELAGVAEAMPGFDAQRDAPRLLAAL
FT                   LERLAAMRIAFLAHGFGPMARRWSAADAYRDQPVRLLHEGKVIAEGMARGVDEAGHLLL
FT                   ETPAGLERIASGELSLRPAPGQGDTA"
FT   CDS_pept        149536..150378
FT                   /transl_table=11
FT                   /gene="h16_A0136"
FT                   /locus_tag="H16_A0136"
FT                   /product="transcriptional regulator, BAF-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91288"
FT                   /db_xref="GOA:Q0KFD3"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFD3"
FT                   /inference="protein motif:COGS:COG1521"
FT                   /inference="protein motif:PFAM:PF03309"
FT                   /protein_id="CAJ91288.1"
FT                   /translation="MSAPLLLIDIGNTRLKWAWCEAGAALPATSALPTPWQHGGAVTHA
FT                   DAGALQALAADLRALRGSGPMPSVWISNVAGPVIAAAVDVALADAFGGCAPVQWVRSAA
FT                   AHGNLANGYREPTQLGVDRWVGAIGAHRWLPHDTLLVVTAGTATTLDIVTAAADGSARF
FT                   EGGLILPGLALMLGTLARNTAQLPALDVDDAGTVAGAHLRWADNTHDAIAAGCLAAQAG
FT                   AIERTWRVLGERGPGPVRCLLSGGARGALAGALAVPFEMHDNLVLLGLHAMAMASAGD"
FT   CDS_pept        150420..151136
FT                   /transl_table=11
FT                   /gene="h16_A0137"
FT                   /locus_tag="H16_A0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91289"
FT                   /db_xref="GOA:Q0KFD2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFD2"
FT                   /protein_id="CAJ91289.1"
FT                   /translation="MTAPGQPARPRSPRIVPLLLLLANAVLLGAVLGVFGANPLAGWFE
FT                   TPREPQRLQQQVRGERMRVQAPASAPAAGAAPRSALPSATLAAACVEIGGFSAQAARRA
FT                   TEDLAAAALRVEAFARQEQVRWWVHLPAQPTREHAERKLAELRRRNVTEYSLVTAGTPE
FT                   APTYTVSLGLFRERERAEQYLDTLRGYGVRTAMLTEAARPLTRQWLRVRDADHAARARL
FT                   EAMRQRYGAEDVLACS"
FT   CDS_pept        complement(151152..151646)
FT                   /transl_table=11
FT                   /gene="hldC"
FT                   /locus_tag="H16_A0138"
FT                   /product="D-beta-D-heptose 1-phosphate adenylyltransferase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91290"
FT                   /db_xref="GOA:Q0KFD1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFD1"
FT                   /inference="protein motif:PFAM:CTP_transf_2"
FT                   /inference="protein motif:COGS:COG2870"
FT                   /protein_id="CAJ91290.1"
FT                   /translation="MSVPAFESKLTLPDTPAALAARIAALPRPLVFTNGVFDILHRGHA
FT                   TYLAQARALGASLVVGVNSDASVKMLGKGDDRPLNHESDRMALLAALESVDLVAMFREQ
FT                   TPVELIRLVRPDIYVKGGDYDIDTLEETRLVRSWGGQAYAIPFLHDRSTTKLLTRVRQG
FT                   S"
FT   CDS_pept        complement(152364..153227)
FT                   /transl_table=11
FT                   /gene="h16_A0139"
FT                   /locus_tag="H16_A0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91291"
FT                   /db_xref="GOA:Q0KFD0"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFD0"
FT                   /protein_id="CAJ91291.1"
FT                   /translation="MLYPELFKSLEAVRWHMDKDIPWDSFDASMLTDDQAKTIRMNAIT
FT                   EWSALPATEMFLRDNRHDSDFSAFMSIWFFEEQKHSLVLMEYLRRFRPDLVPTEEELHA
FT                   VRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKHIYRTLSQDEARHGGAYL
FT                   RYMKKYLAQFGDSARAAFAKIGVLMASARRTEKPLHPTNLHVNKALFPNDTVQSRLPDP
FT                   DWLEHWLDEQIRFDEGWEKKVIERILHNMSLLFERTFETVQDLNRYRKELNASLQGSGG
FT                   AQPAQA"
FT   CDS_pept        complement(153428..154693)
FT                   /transl_table=11
FT                   /gene="h16_A0140"
FT                   /locus_tag="H16_A0140"
FT                   /product="predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /function="General function prediction only"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91292"
FT                   /db_xref="GOA:Q0KFC9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFC9"
FT                   /inference="protein motif:PFAM:Patatin"
FT                   /protein_id="CAJ91292.1"
FT                   /translation="MHRESFPAPHPASQSGPNPAATALIMMGGGARAAYQAGVLSGLAR
FT                   IAARHGKGHGAMPFGIIAGTSAGAINGAGLAIQAGDFQAATQSLAALWHSIHADDVYRT
FT                   DVLRVGVSGARWLSTLALGWATQRRAPRALFDNTPLGSMLGELFEPERVQASLDSGALQ
FT                   AFAVTALSYSTGRHVTFYQSHHRIHPWHRSQRIAIPAPITVDHLLASASIPFLFPAMPL
FT                   ELDGHHEWFGDGTMRQMSPLSPAIHLGASRVLAIGAASRQRSGWYDTMPAGGYPSLAQV
FT                   GGQALASIFLDGLNADLERLLHINRLLARMPELAGDREGWRPVQVMTISPSEPIEAIAA
FT                   EHQKQLPRTVRALLAPLGGTEARGAAFASYLLFEPAFTQALMALGERDAEAQADELAAF
FT                   LFGVVPGTPPAALPVDERALSP"
FT   CDS_pept        complement(154731..155522)
FT                   /transl_table=11
FT                   /gene="h16_A0141"
FT                   /locus_tag="H16_A0141"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFC8"
FT                   /protein_id="CAJ91293.1"
FT                   /translation="MFGQIPDFTNGFDFMRRLWGSGSGMPAGMMPGLQAMTPPMDLDDL
FT                   DKRIADLKAVESWLQLNTNLLRTTIQGLEVQRATLVALQTFGNALSPEAMQSAMENVAR
FT                   AANTPSAAAPERDAGADADSGTQQEPPAAERPQAAASDTDSALPPNAALWWDLLQQQFN
FT                   QIASSAAAASIAPFGMGGVGGFGTAASPDAAAQAAAAKPKTDAPGKAASAGTGKPAARK
FT                   APAKKAPAKKAAKAKPARDAGNGEDNGKNGGNNGANGSSAA"
FT   CDS_pept        complement(155597..156430)
FT                   /transl_table=11
FT                   /gene="h16_A0142"
FT                   /locus_tag="H16_A0142"
FT                   /product="Enoyl-CoA hydratase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91294"
FT                   /db_xref="GOA:Q0KFC7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFC7"
FT                   /inference="protein motif:PFAM:ECH"
FT                   /protein_id="CAJ91294.1"
FT                   /translation="MTTPTADPTPLSPRYERYRALTLRRHGPILEIIMGAAQSANQKLA
FT                   TADANMHRELAEIWRDVSADPEVRVALIRGEGKGFSAGGDLALVEDMANDFETRTRVWH
FT                   EARDLVYNVINCDKPVVSAMHGPAVGAGLVAGLLADISIAARSARIVDGHTRLGVAAGD
FT                   HAAIVWPLLCGMAKAKYYLMLCESVSGEEAERIGLVSLAVEEDELVARAFEVANRLAAG
FT                   SQTAIRWTKYALNNWLRMAGPAFDTSLALEFMGFAGPDVHEGVASLRQKRPPQFR"
FT   CDS_pept        complement(156550..157530)
FT                   /transl_table=11
FT                   /gene="mhpD2"
FT                   /locus_tag="H16_A0143"
FT                   /product="2-Oxopent-4-enoate hydratase"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /EC_number="4.2.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91295"
FT                   /db_xref="GOA:Q0KFC6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFC6"
FT                   /inference="protein motif:PFAM:FAA_hydrolase"
FT                   /protein_id="CAJ91295.1"
FT                   /translation="MKLATLKDGSRDGQLVVVSRDLKQAHYATDIAGKLQTVLDDWNFY
FT                   APQLQDLYDALNAGRARHPFAFAPRDCMAPLPRAYQWADGSAYVNHVELVRKARGAEMP
FT                   AEFWTDPLMYQGGSDDFVGPQDDIVCASEAFGIDFEAEVAVITGDVRMGATPEQAGDAI
FT                   RLVMLANDVSLRNLIPAELGKGFGFFQSKPATAFSPVAVTPDELGEAWRERKVHLPMTV
FT                   HWNSKKVGQPDCGTDMVFDFGQLIAHICKTRNVRAGSIVGSGTISNVDRKKGYCCIAEK
FT                   RMLETIDEGKPVTEFMKFGDAVKIEMFDAQGHSVFGAIDQLVAAA"
FT   CDS_pept        complement(157613..158611)
FT                   /transl_table=11
FT                   /gene="h16_A0144"
FT                   /locus_tag="H16_A0144"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91296"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFC5"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /protein_id="CAJ91296.1"
FT                   /translation="MRPLGHFRPALAALTAGTLFAALFTASAPARADDWPSQPIRWVVP
FT                   YPAGGGTDVVARTVAQAITPGLGKQVVIDNRPGAATIVGADAVAHAKPDGYTVLTADTA
FT                   TLAANPSLYKKLPYNPDKDFVYIGQLARFPLVLVANPNFPARTLKEVVAYAQKNPGKVN
FT                   FASPGAGSPHHLAMELFMDQTRVKMTHVPYKGAAPAVQDLLAGQVDLMFLDLASGQQNV
FT                   QAGKLRALGVATPKRLTVLPGVPTVAEGGVAGFEAYAWQGMVAPAGTPKAVVTRLNAEL
FT                   VKALKTPEVQKKLEGVGVEAVYSTPEEFASYARAEGERWGKLIKAKGITVD"
FT   CDS_pept        158791..159624
FT                   /transl_table=11
FT                   /gene="h16_A0145"
FT                   /locus_tag="H16_A0145"
FT                   /product="transcriptional regulator, IclR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91297"
FT                   /db_xref="GOA:Q0KFC4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFC4"
FT                   /inference="protein motif:COGS:COG1414"
FT                   /inference="protein motif:SMART:smart00346"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="CAJ91297.1"
FT                   /translation="MSETEEEDTKLRSGIQSIEVGFRLLQALAVSPRAMMLRDLAAAAD
FT                   MNPAKAHRYLVSFMRLGAVAQDPVSGRYDLGPFALQLGLAGLNRLDPVKKARPILSQLR
FT                   DELDLTAGIAVWGNHGPTVVHWEESSHPVTVSLRLGDVMPMLNSATGRLYGAYLPRKQT
FT                   LPLIERELGARGNDGLPDMPRSLAEYDAICAEVRAHGAARTLGGVLPGINAFSMPVFNA
FT                   NGHLAMGLIVLGAQSIFDAEWGGTMDRRIRDIAQQLSSELGYLGAATPAGETGQS"
FT   CDS_pept        159737..160675
FT                   /transl_table=11
FT                   /gene="h16_A0146"
FT                   /locus_tag="H16_A0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91298"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFC3"
FT                   /protein_id="CAJ91298.1"
FT                   /translation="MPGPLIPVDVSNTPTLEAVLLPPPRPPAPPAPRPVPRPRPQPRAA
FT                   APAPGTRAAGSPRSPARHQPAGRDRDGVGQWRRGQRGQACRRCRAVRRAAGRRRWRGVR
FT                   PPPSATMHYASFVNGVQNPDGLIRWEQDGSRYRLAVETRVLWFRFAFQSGGAMAVQGLL
FT                   PERYEERRRNKTETSRFDAAAGTAVFASGTQAPFPPGAQDRFSVFLQLVGLVRGNPQRY
FT                   ATPGVTEAFLVADTRDVEPMQVQYVGEDEIDTGNGVIRAKHFVRLQRRANDRRRVELWL
FT                   AQSLGWMPVRLRQTEPDGTQIDLVYRGREGQ"
FT   CDS_pept        160727..161569
FT                   /transl_table=11
FT                   /gene="h16_A0147"
FT                   /locus_tag="H16_A0147"
FT                   /product="predicted hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily)"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91299"
FT                   /db_xref="GOA:Q0KFC2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFC2"
FT                   /inference="protein motif:PFAM:abhydrolase"
FT                   /inference="protein motif:PFAM:Ndr"
FT                   /protein_id="CAJ91299.1"
FT                   /translation="MTVATPPAETHRIHAEGADLHVRVDGADGPWVILAHALAADHTLW
FT                   DATAQHLARRYRVVRPDMRGHGASDAPLGPYTMTRLADDVVAVMDALQIPQAHFCGISV
FT                   GGMIGQTMGLRHPERLLSLALVATNSQTPMEAHPMWHNRIGQAEAHGMAGMADATLGRW
FT                   LTPAFHEAHRDQVSRIRDSLVATPVRGYVGVAGAIMAFDLAGALSRIHCPTLVVAGEQD
FT                   QGATVAMAQSIAAAIPGARLEVVPQAAHLVHVEQPERFHAALDAFLGNAACGGQCDVP"
FT   CDS_pept        161795..162052
FT                   /transl_table=11
FT                   /gene="h16_A0148"
FT                   /locus_tag="H16_A0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91300"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFC1"
FT                   /protein_id="CAJ91300.1"
FT                   /translation="MQMIYNSDNYCIVEFGADVDQAPLEFGGYEIVDKNLKREIFLGGH
FT                   LAESFRADVKRLIESEPSVEEVDDFLGKFDNVMMHPLVMH"
FT   CDS_pept        complement(162125..162643)
FT                   /transl_table=11
FT                   /gene="pspE1"
FT                   /locus_tag="H16_A0149"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91301"
FT                   /db_xref="GOA:Q0KFC0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFC0"
FT                   /inference="protein motif:CDD:cd01522"
FT                   /inference="protein motif:COGS:COG0607"
FT                   /protein_id="CAJ91301.1"
FT                   /translation="MYQGLAAARDDPRLPVRPAGAYTERRNRHRPGRFALPPSLPAMQH
FT                   LSPADAQDLLAQSPETLFIDCRSEMEYLFVGHPKGAHNVPWNDGPDWEVNPHFVQMVKK
FT                   LAGQASARPVLLICRSGNRSSAAARALEGAGFSNVQFVLHGFEGDLDAQRHRNTVNGWR
FT                   HDGLPWEQY"
FT   CDS_pept        162848..163807
FT                   /transl_table=11
FT                   /gene="bhmT"
FT                   /locus_tag="H16_A0150"
FT                   /product="Betainehomocysteine S-methyltransferase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="2.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91302"
FT                   /db_xref="GOA:Q0KFB9"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFB9"
FT                   /inference="protein motif:PFAM:S-methyl_trans"
FT                   /protein_id="CAJ91302.1"
FT                   /translation="MGTMIQRYKLTEADYRGARFAEHKVDVKGNNELLLLTRPQVISEI
FT                   HEQYLAAGADLIETNTFGATGVAQEDYKMADLAYEMNVEAARLARAACDKYSTPEKPRF
FT                   VAGAFGPTPKTASISPDVNDPGARNVTFEELRDSYYEQGKGLLEGGADVFLVETIFDTL
FT                   NAKAALFAIDQLFEDTGERLPVMISGTVTDASGRILSGQTVEAFWNSLRHARPITFGLN
FT                   CALGATLMRPYIAELAKICDAAVSCYPNAGLPNPMSDTGFDETPEVTSSLVEEFAASGL
FT                   VNLVGGCCGTTPEHIAAIAQRVANKTPRTWPGQYRDAA"
FT   CDS_pept        163825..166572
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="H16_A0151"
FT                   /product="methionine synthase, cobalamine dependent"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91303"
FT                   /db_xref="GOA:Q0KFB8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFB8"
FT                   /inference="protein motif:COGS:COG1410"
FT                   /inference="protein motif:CDD:cd00740"
FT                   /protein_id="CAJ91303.1"
FT                   /translation="MTDKQLPPRPMRLSGLEPFTIDDDTLFVNVGERTNVTGSKAFARM
FT                   ILNGQFDEALAVARQQVENGAQIIDINMDEAMLDSKAAMVRFLNLIASEPDIARVPIMI
FT                   DSSKWEVIEAGLQCVQGKPVVNSISLKEGEEQFRHHAALIRRYGAASVVMAFDEKGQAD
FT                   TFERKTEICKRSYDILVNDVGFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEATRWIKQ
FT                   NLPYAKVSGGVSNVSFSFRGNDTVREAIHTVFLYHAIGAGMDMGIVNAGQLGVYDQLDP
FT                   ELRERVEDVVLNRREDSTDRLLEIADRFKGGGAKKEENLAWRGTPEQPVPVGERLAHAL
FT                   VHGITTFIVEDTEEVRQQVEARGGRPIEVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSA
FT                   RVMKQAVAHLLPYIEEEKRLLAEAGGDVKARGKIVIATVKGDVHDIGKNIVSVVLQCNN
FT                   FEVVNMGVMVPCNEILARAKVEGADIVGLSGLITPSLEEMAYVASEMQRDDYFRVKKIP
FT                   LLIGGATTSRVHTAVKIAPNYEGPVVYVPDASRSVSVASSLLSDEGAAKYLDELKTDYD
FT                   RIRTQHANKKATPMVTLAQARANKTPIDWSSYVPPKPKFIGRRVFRNYDLAELANYIDW
FT                   GPFFQTWDLAGKFPDILNDEIVGESARKVFSDGKAMLSRLIQGRWLTANGVIALLPANT
FT                   VNDDDIEIYTDETRSKVALTWHNLRQQSERPVVDGVRRPNRCLADFVAPKDSGIADYVG
FT                   LFAVTAGLGVEKKEAQFEADHDDYSAIMLKALADRFAEGFAECLHERVRKDLWGYDAGE
FT                   QLSNEQLIAESYRGIRPAPGYPACPEHTVKGPMFEFLDAAEIGMGITESLAMTPAASVS
FT                   GFYLAHPQSTYFSIGKIGQDQLDDMAARRHEDRATLERALAPNL"
FT   CDS_pept        166836..167297
FT                   /transl_table=11
FT                   /gene="h16_A0152"
FT                   /locus_tag="H16_A0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91304"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFB7"
FT                   /protein_id="CAJ91304.1"
FT                   /translation="MKKLLLSLSALSIAAASSLAMAQGTGVSVGTKADVGASVTTPSPA
FT                   AAAQGGLNTAGSAATGAAGAAEKGLSTAGAATSKGLSAAGSAADKGLSTAGAAVDKSVG
FT                   TAADATGGAAADAGTKAKHGKHATKSGKKSKADASVDVSAGAAAGAKAQ"
FT   CDS_pept        167608..168240
FT                   /transl_table=11
FT                   /gene="h16_A0153"
FT                   /locus_tag="H16_A0153"
FT                   /product="response regulator, NarL-family"
FT                   /function="Signal transduction mechanisms / Transcription"
FT                   /note="REC (residues 4 to 118, 3e-23) with a complete
FT                   phosphorylation pocket (DD-D60-S94-K107)"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91305"
FT                   /db_xref="GOA:Q0KFB6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFB6"
FT                   /inference="protein motif:CDD:cd00156"
FT                   /inference="protein motif:SMART:smart00421"
FT                   /protein_id="CAJ91305.1"
FT                   /translation="MIRILIADDHEIVRAGLRQFLSEEPDIQVTGEAGSGDQVMAQLRD
FT                   AEFDVLVLDISMPDRNGIDVLKLIRQRKPELPVLILSTYPEDQYAINLIRAGASGYLTK
FT                   ESAPDDLVKAIRTVAQGRRYVSATVADLLIGGLDKPTEQPVHQMLSEREFQIFCKLSRG
FT                   QSVSVIADELFLSVKTVSTYRSRILEKMGMKTNADLTYYAIKNGLVE"
FT   CDS_pept        168286..168693
FT                   /transl_table=11
FT                   /gene="h16_A0154"
FT                   /locus_tag="H16_A0154"
FT                   /product="response regulator without effector domain"
FT                   /function="Signal transduction mechanisms"
FT                   /note="REC (residues 15 to 130, 5e-14) with a typical
FT                   phosphorylation pocket (1/2 DD,D54,S/T82,K105)"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91306"
FT                   /db_xref="GOA:Q0KFB5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFB5"
FT                   /inference="protein motif:CDD:cd00156"
FT                   /protein_id="CAJ91306.1"
FT                   /translation="MSEQASNTSYRALSILLIEDSAVLRGMLLEYLKDFPFIENVDWAD
FT                   TEAMALRLLAAGKYDVVIVDLQLRQGNGINVLRAMQRIGTGAVRIVYTNHAQVSMYRRQ
FT                   CAEAGADYFFDKSLELEQVFRVIEEHAAPAP"
FT   CDS_pept        complement(168743..170146)
FT                   /transl_table=11
FT                   /gene="h16_A0155"
FT                   /locus_tag="H16_A0155"
FT                   /product="signal transduction histidine kinase containing a
FT                   CHASE3 sensory domain"
FT                   /function="Signal transduction mechanisms"
FT                   /EC_number="2.7.3.-"
FT                   /note="2 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91307"
FT                   /db_xref="GOA:Q0KFB4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFB4"
FT                   /inference="protein motif:COGS:COG4585"
FT                   /inference="protein motif:COGS:COG5278"
FT                   /inference="protein motif:PFAM:PF05227"
FT                   /protein_id="CAJ91307.1"
FT                   /translation="MFKQSFLPHTLLLAGGILLTLAVLVASETGNIRLRESYTDVIRSQ
FT                   RVQTELAALNGELVNAEAGQRGFLLTGKESYLEPYYKALPRIAELMAQIRAGYANDPEG
FT                   LKQFSDTSKLINSKLNEMALTLVYGKRDLEVALDLIRTDYGKETMDNARRGLDQLQARE
FT                   AGAVSHRLEGAENDVQLSRYGIGLLTAINITLMMAVGVGHAKRLSMAEAVRTQLEEEGV
FT                   RLDRKVRARTRQLSALAAHLQRVTEDEKTRLARELHDELGAILTAIKLDLHWVRRKVQE
FT                   DHPVAAERLTRVMLHVDQGIQIKRRLIEDLRPTVLLNLGLRAAVCQLVEEVGARNDWET
FT                   DVSVPEDLPPLRDEAAIALYRIVQESLTNASKYSEARHIDVSLACQDNLLTLTVRDDGK
FT                   GLPADFDAGSTAGHHGLLGMEQRVTALGGSMQIDSSTQAGVRIHIEVPLTEAVLAPAEA
FT                   PENQEPARA"
FT   CDS_pept        170431..170598
FT                   /transl_table=11
FT                   /gene="h16_A0156"
FT                   /locus_tag="H16_A0156"
FT                   /product="small integral membrane protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91308"
FT                   /db_xref="GOA:Q0KFB3"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFB3"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="CAJ91308.1"
FT                   /translation="MLQYALVFFVIALIAAIFGFGGIAAGAVEIAKILFFIFLVVALVA
FT                   AVMGLVRRGR"
FT   CDS_pept        170651..171079
FT                   /transl_table=11
FT                   /gene="h16_A0157"
FT                   /locus_tag="H16_A0157"
FT                   /product="uncharacterized conserved protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91309"
FT                   /db_xref="GOA:Q0KFB2"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFB2"
FT                   /inference="protein motif:PFAM:PF05957"
FT                   /protein_id="CAJ91309.1"
FT                   /translation="MLTQNPKVRKELNHLSDSADSAIRHIRHAARDTRDAAAPVSGEVK
FT                   ALIAQLEHTIEVLAREGSAESMRAGQRLRERATDMAHRLRAQTTDGMMRARERMDGAVE
FT                   HAQHRVAESPLKAVAIAAAVGALIGLLLANGRRHSEED"
FT   CDS_pept        complement(171256..171576)
FT                   /transl_table=11
FT                   /gene="h16_A0158"
FT                   /locus_tag="H16_A0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91310"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFB1"
FT                   /protein_id="CAJ91310.1"
FT                   /translation="MLITFKSHAAQDLIMMKDLAMTLLGIIGKRLGERGVITVEELPTA
FT                   IHKLEAAVADAKAHPASSAVEADTGNDEDEEEPLHLGQRAYPFLDMLRASQREGANVMW
FT                   GV"
FT   CDS_pept        171841..173628
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="H16_A0159"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91311"
FT                   /db_xref="GOA:Q0KFB0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KFB0"
FT                   /inference="protein motif:PFAM:tRNA-synt_1d"
FT                   /inference="protein motif:PFAM:N-Arg"
FT                   /protein_id="CAJ91311.1"
FT                   /translation="MLPVQTSNLAAAFTDAVRALAPADATLPAVTFERPKVAAHGDLAC
FT                   NVAMQVARALKSNPRELAQRIVDAVQADTRAQGLVQAMEIAGPGFINLRLTPAAKADVL
FT                   RAVLAEGDHYGARERGVHGQVLVEFVSANPTGPLHVGHGRQAALGDALANLLSWQGWHV
FT                   HREFYYNDAGVQIQTLALSVQARARGLKPGDASWPEAAYNGDYIADIAADFLAGKTVSA
FT                   SDGEPVTASGNVEDIDSIRKFAVTYLRNEQDIDLQAFGVKFDRYYLESSLYSDGRVEAA
FT                   VQSLVGKGKTYESEGALWLRTTDDGDDKDRVMKKSDGTYTYFVPDVAYHTTKWERGFTK
FT                   VINVQGSDHHGTIARVRAGLQGLDMGIPQGYPDYVLHKMVTVMKNGEEVKISKRAGSYV
FT                   TVRDLIEWSNGGDETIRGCLDTGVADWPQHFTRGRDAVRFFLLSRKADTEFVFDVDLAL
FT                   KQNDENPVYYVQYAHARICSIFESWGGADWEARLAELAGADLSAVTGPEASAQAQALGR
FT                   RLAEFPDMLSGAAAELAPHAVAFYLRDLAGDFHAFYNADRVLVDDEAVKRARLALLAAT
FT                   RQVLRNGLAVIGVSAPRRM"
FT   CDS_pept        173745..174470
FT                   /transl_table=11
FT                   /gene="h16_A0160"
FT                   /locus_tag="H16_A0160"
FT                   /product="cell division protein ftsN"
FT                   /function="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91312"
FT                   /db_xref="GOA:Q0KFA9"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFA9"
FT                   /inference="protein motif:PFAM:SPOR"
FT                   /protein_id="CAJ91312.1"
FT                   /translation="MQQQRKRESRHVRRNQQRGGTFLGLVLGLIVGLAIAVVVALYITK
FT                   SPTPFQQKSAPRPSEPGNVTSQLPPPAQRADEGPSDPNKPLWSKTPAKPVGQAPEPEPK
FT                   QNGQHGQNGQQPPVAVARPAEKPVEKPVEKPADKPVASKPAEKPVADPIAEIAQADANK
FT                   VGYLLQVGAFRSSDDADRQKANLAMQGFEARITERDVNGVKMYRVRLGPFNRIEDMNKA
FT                   RDRLQSSGFEASVIRFTKQ"
FT   CDS_pept        174637..175272
FT                   /transl_table=11
FT                   /gene="h16_A0161"
FT                   /locus_tag="H16_A0161"
FT                   /product="Thiol:disulfide interchange protein DsbA"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91313"
FT                   /db_xref="GOA:Q0KFA8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFA8"
FT                   /inference="protein motif:PFAM:DSBA"
FT                   /protein_id="CAJ91313.1"
FT                   /translation="MKKLAALFAMFAAVGGLLMSAPSRAAPAEGKEYQVLKAAQPVAAG
FT                   KIEVTEFFWYGCPHCYDFEPDLEAWVRKQGGNVVFKRVPVAFRDDLLPHTKIFYALEAI
FT                   GKLDAMHNKVFNAIHVDRKRMTDPNEIADFMAKNGVDRKAFLDAYNSFTVTTNSQRANK
FT                   IADAYKIDGVPTVVVQGKYVTSPSIAGNKQGAIQTMDYLVDQVKAKKM"
FT   CDS_pept        175378..176184
FT                   /transl_table=11
FT                   /gene="h16_A0162"
FT                   /locus_tag="H16_A0162"
FT                   /product="Dehydrogenase/reductase oxidoreductase protein"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91314"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFA7"
FT                   /inference="protein motif:PFAM:adh_short"
FT                   /protein_id="CAJ91314.1"
FT                   /translation="MRPLKVFLTGASSGLGQALAREYASQGAILGLVARREDALREFVA
FT                   TLPNPGAVRVYGADVRDADAMARAAGDFLGHFGCPDVVIANAGVSVGTVASEREDLDAF
FT                   RQVMDTNWFGVLTTFQPFMHAMQEREPGHFGRRGTLVGIASVAGVRGLPGAGAYSASKS
FT                   AVIKLLESLRLEQRAHGIRVVTIAPGYIRTPMTAHNPYRMPFLTDADVFARKAVRVIAA
FT                   GRRFRVIPWPMGVVAALLHVMPRWLYDALAAGAPRKPRRADPPQEP"
FT   CDS_pept        176187..177020
FT                   /transl_table=11
FT                   /gene="h16_A0163"
FT                   /locus_tag="H16_A0163"
FT                   /product="putative periplasmic metal ion binding protein"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91315"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFA6"
FT                   /inference="protein motif:CDD:cd01144"
FT                   /inference="protein motif:CDD:cd01143"
FT                   /protein_id="CAJ91315.1"
FT                   /translation="MWRDAIGQQHAAASGVVRIASLVPSVTELLFALGMARQMVARTGF
FT                   CIHPEPAVCAVPKVGGTKDVNVARLRELAPTHVVVNIDENRRETVDEIRAFVPNVIVTH
FT                   PCAPEDNLGLYQLLGGIFGCHAEAEALCTALQVQLDAIRVRAWPARRVLYAIWQDPWMT
FT                   VSRDTYISRMLALANWHTWPEGSAALQACAGGDCSRPNAPGDRYPTFRWSDALVRELDL
FT                   VLLSTEPYRFTEDHADALERQLGKPVLLVDGEMLSWYGSRAIDGVRYLAALAAAN"
FT   CDS_pept        complement(177026..178102)
FT                   /transl_table=11
FT                   /gene="h16_A0164"
FT                   /locus_tag="H16_A0164"
FT                   /product="Zn-dependent hydrolase including glyoxylase"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91316"
FT                   /db_xref="GOA:Q0KFA5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFA5"
FT                   /inference="protein motif:PFAM:lactamase_B"
FT                   /protein_id="CAJ91316.1"
FT                   /translation="MNALEHQLQYPFGDTMPEPGSRQEVAPGVYWLRMPLPFALDHINL
FT                   WLLRDRLDGRDGWTIIDCGITNDIIKGHWETIFANELEGLPVVRVLVTHSHPDHVGLAH
FT                   WLCKRFGVRLWMSLGDYMSARVMGSGTGAGSSAGGDAAAAHFALHGLTDADSQEKLRAR
FT                   KTYYPSLVPELPAQYRRMMEGDTVRIGTDAATSAWRVITGFGHSPEHVALYNAATNVLI
FT                   SGDMVLPRISTNVSVFDMEPEGNSLQLYLDSLGKYEPLPQDVLILPSHGRPFRNLHTRI
FT                   MQLREHHADRLAETLEACGEKACSAHDIVSVIFKRQFDIHQMTFAMGESLAHLHCLWHR
FT                   GELVRETGDDGVIRFRAA"
FT   CDS_pept        178308..178772
FT                   /transl_table=11
FT                   /gene="h16_A0165"
FT                   /locus_tag="H16_A0165"
FT                   /product="transcriptional regulator, MerR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91317"
FT                   /db_xref="GOA:Q0KFA4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFA4"
FT                   /inference="protein motif:CDD:cd01108"
FT                   /inference="protein motif:SMART:smart00422"
FT                   /protein_id="CAJ91317.1"
FT                   /translation="MSATPAAASATYTITDLAREFDITPRAIRFYEDQGLLSPEREGPG
FT                   GRKRVYNGRERTRLKLTLRGKRLGLTLNEIREILDLYESPRDTAPQLERFLHSLAAHRR
FT                   TLERQMEDLQAQLAEIDQHERQCRALLAAQTGKQQPATEDGDAPARTSVA"
FT   CDS_pept        178900..179376
FT                   /transl_table=11
FT                   /gene="h16_A0166"
FT                   /locus_tag="H16_A0166"
FT                   /product="Uncharacterized protein, possibly involved in
FT                   aromatic compounds catabolism"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91318"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFA3"
FT                   /inference="protein motif:PFAM:4HBT"
FT                   /inference="protein motif:COGS:COG2050"
FT                   /protein_id="CAJ91318.1"
FT                   /translation="MTSSNASAVPAEPGSLSAARADAIATSFSRQGLMTTFGATLRRVD
FT                   RGEVELAMPWSDGVTQQHGFFHGGVVGALADSACGYAALTMVGEDEAGLTAEYKINLLS
FT                   PAQGERLVAVGRVLKPGRTLIVAQGDVYVEQDSRRKQVATMLMTLCVVKTLGHV"
FT   CDS_pept        179441..180622
FT                   /transl_table=11
FT                   /gene="ivd1"
FT                   /locus_tag="H16_A0167"
FT                   /product="Isovaleryl-CoA dehydrogenase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="1.3.99.10"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91319"
FT                   /db_xref="GOA:Q0KFA2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFA2"
FT                   /inference="protein motif:CDD:cd01156"
FT                   /inference="protein motif:CDD:cd01158"
FT                   /protein_id="CAJ91319.1"
FT                   /translation="MTELPGLKFDLGEDIEMLRNSVRDWAQAELAPRAGEIDRTDQFPM
FT                   DAWKKMGDLGVLGITVAEEYGGANMGYLAHMIAMEEISRASASVGLSYGAHSNLCVNQI
FT                   HRNGTPAQKAKYLPKLVSGEWIGALAMSEPNAGSDVVSMKLRAEFKGDRYVLNGTKMWI
FT                   TNGPDCDVLVVYAKTEPELGARGMTAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFQD
FT                   VEVPVENILGAENGGAKVLMSGLDYERAVLSGGPVGIMQACMDVVTPYIHDRKQFGQSI
FT                   GEFQLIQGKVADMYTTLQAARSYLYTVGKNLDALGSGHVRQVRKDCAAVILYTAEKATW
FT                   MAGETVQILGGNGYINEYPAGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETM"
FT   CDS_pept        180734..182575
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="H16_A0168"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91320"
FT                   /db_xref="GOA:Q8KLU8"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8KLU8"
FT                   /inference="protein motif:PFAM:PF06315"
FT                   /protein_id="CAJ91320.1"
FT                   /translation="MSHFPKLLSSQIAFDVARTMLDGFDKHYRLFREVSHQAKLKFEAG
FT                   DWHGLQQIQRDRIAFYNERVRESSVILEDEYDAENIEDEIWQQIKLHYIGLLTNHHQPE
FT                   LAETFFNSVCTRILHRSYFNNDFIFVRPAISTEYIENEESPTRPTFRAYYPGSREGMAA
FT                   CFERVVHNFQLESPFEDLQRDIGYVVRAVSEHFGDLRIAPNFQVHTLSSLFFRNKSAFI
FT                   IGRILNGDRTFPLAIPIVHGPSGKLTLDTVLLKKEQLLILFSFTHSYFMVDMEIPSAYV
FT                   TFLRDIMPRKPRAEIYTSLGLQKQGKNLFYRDFLHHLQHSSDKFIVAPGIRGLVMLVFT
FT                   LPSYPYVFKVIKDFFPAPKETTRELVKSKYQLVKQHDRVGRMADTLEYSDVAFPLSRFD
FT                   EALVREFEQHAPSMIEYQRGKDGGEEIVVRHVYIERRMTPLNIYLTEGTDEQVEHGVIE
FT                   YGNAVKELIAANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNIRDVPQPRNEEEE
FT                   MSGEVWYTVRPHDIFPETFRTFLLGDTRVRAAFLRHHADFFDPAMWQSHKDRLLAGHVH
FT                   DFFAYHSSERFIHRYSEAGSAQGTAAVPDPGPARRVA"
FT   CDS_pept        182572..183243
FT                   /transl_table=11
FT                   /gene="can"
FT                   /locus_tag="H16_A0169"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91321"
FT                   /db_xref="GOA:Q0KFA0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KFA0"
FT                   /inference="protein motif:PFAM:Pro_CA"
FT                   /protein_id="CAJ91321.1"
FT                   /translation="MTDAIAQLFRNNREWVDRVNAEDPTFFMRLANQQAPEYLWIGCSD
FT                   SRVPANQILGLAPGEVFVHRNIANVIAHSDLNALAVIQFAVEVLKVRHITVVGHYGCGG
FT                   VKVALKRERIGLADNWLRHVRDVADKHEAYLGTLLREDDAHTRLCELNVIEQVNNVCQT
FT                   TVLQDAWSRGQAVTVHGWVYGVSDGLLRDLGMAASSNDELREQLAAAYRQYGDPPQASI
FT                   R"
FT   CDS_pept        183291..184469
FT                   /transl_table=11
FT                   /gene="h16_A0170"
FT                   /locus_tag="H16_A0170"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91322"
FT                   /db_xref="GOA:Q0KF99"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF99"
FT                   /inference="protein motif:PFAM:thiolase"
FT                   /inference="protein motif:PFAM:thiolase_C"
FT                   /protein_id="CAJ91322.1"
FT                   /translation="MEEIVIVSAARTPMAAFQGEFASVTAPQLGAVAIRAAVERAGLKP
FT                   EQVEEVVFGCVLPAGQGQAPARQAALGAGLPLGVGCTTVNKMCGSGMRAAMTVYDGLIA
FT                   GSFDIAIAGGMESMTNAPYLVPKGRGGYRIGHGMIYDHMMLDGLEDAYDKGRAMGTFGE
FT                   DCAAKYGFTREQQDEFAMESVRRAQQATENGDFRWEIAPVTVSGRGGDTVIDTDEGPRR
FT                   IKLDKIPSLKPAFAKDGTITAASSSSINDGASALVMMRASTAKKLGLQPIARMLGHTTH
FT                   AQAPGWFTTAPVEAISKLYRKLDWTTDSVDLFEINEAFAVVPMAAMHDLKIPRDKVNIH
FT                   GGACALGHPIGASGARIMTTLIGALRKTGGKRGVASLCIGGGEATAVGIEIL"
FT   CDS_pept        184600..185280
FT                   /transl_table=11
FT                   /gene="h16_A0171"
FT                   /locus_tag="H16_A0171"
FT                   /product="dehydrogenase with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism / General function prediction
FT                   only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91323"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF98"
FT                   /inference="protein motif:PFAM:adh_short"
FT                   /protein_id="CAJ91323.1"
FT                   /translation="MPTVLILGASRGIGLEFVRQYRADGWRVIAAARTPEGVGALQALG
FT                   AEAHQVDLSDAGAVAGLGWKLDGEALDVAIYNAGVLGPRTEGAQPVTPQEFDRVMHVNV
FT                   LGPMMALPLLLPYVEAGQSGHGGVLAVLSSRMGSITAMEHSTSWLYRVSKAGANAALRA
FT                   VSLDARHATCVALHPGWVKTDMGGQEADLTVQQSVKGMRQLLAGVKRRDNGTFHNYDGT
FT                   PIPW"
FT   CDS_pept        185311..186441
FT                   /transl_table=11
FT                   /gene="h16_A0172"
FT                   /locus_tag="H16_A0172"
FT                   /product="Acyl-CoA dehydrogenase, short-chain specific"
FT                   /function="Lipid metabolism"
FT                   /EC_number="1.3.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91324"
FT                   /db_xref="GOA:Q0KF97"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF97"
FT                   /inference="protein motif:PFAM:Acyl-CoA_dh_N"
FT                   /inference="protein motif:PFAM:Acyl-CoA_dh_M"
FT                   /inference="protein motif:PFAM:Acyl-CoA_dh"
FT                   /protein_id="CAJ91324.1"
FT                   /translation="MLLTPEQEMIRDAVRQFAQEVIAPQAAQWDRDKTFPKDVHRELAA
FT                   LGAYGVAVPEAYGGAGLDYLSLALILEEIAAGDGGTSTVISVNNCPVCSMLMSFASEAQ
FT                   KQQWLVPLARGEMLGAFCLTEPHVGSDASALRTTAVRDGDHYVLNGVKQFITSGQNADV
FT                   AIVLAVTDKAAGKRGISAFIVPTSTPGYVVARLEDKLGQHSSDTAQILFEDCRVPAANL
FT                   LGDEGGGYKMALSGLEGGRIGIASQSIGMARAAFEAALAYAKERESFGQPLFQHQAVQF
FT                   RLAEMATRIDVARQMVWHAAALRDAGRPCLKEAAMAKLFASEMAERVCSDAIQVFGGYG
FT                   YVSDFPVERIYRDVRVCQIYEGTSDIQKILIARALA"
FT   CDS_pept        186529..187185
FT                   /transl_table=11
FT                   /gene="h16_A0173"
FT                   /locus_tag="H16_A0173"
FT                   /product="2-Hydroxychromene-2-carboxylate isomerase"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91325"
FT                   /db_xref="GOA:Q0KF96"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF96"
FT                   /inference="protein motif:PFAM:DSBA"
FT                   /protein_id="CAJ91325.1"
FT                   /translation="MTAAIDFYFDFSSPYGYFASTRIDDLAQKYGRIVAWHPILLGVVF
FT                   KTTGASPLPQLPLKGDYSWRDFERTARFHGIEYKRPTHFPLPTTHAARAMLWLQNHHGD
FT                   DIAAAFAKSVYRALFVDDINIAEPAEIMKLAEPLGVDVQALDAGATSYQIKDQLKAEID
FT                   VAMAKGVFGSPFVIIDGEPFWGFDRFDQVEAHLKSRRQTELRAVPSLDTKEKKPA"
FT   CDS_pept        187182..187868
FT                   /transl_table=11
FT                   /gene="h16_A0174"
FT                   /locus_tag="H16_A0174"
FT                   /product="phosphoglycolate phosphatase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91326"
FT                   /db_xref="GOA:Q0KF95"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF95"
FT                   /inference="protein motif:PFAM:Hydrolase"
FT                   /protein_id="CAJ91326.1"
FT                   /translation="MTAATRGHSGRFDCVIFDCDGVLVDSEPIVNRVLNQMLNELGIEI
FT                   SLEDSTRLFLGRAVREELEMIERMRGAPLPENWLSTWLARRNAVLEAEVAAVAHVREAI
FT                   GKIAATGMPVCVASGADRVKVKLQLTRTGLVELFQQDEREHIFSATEVARSKPAPDVYL
FT                   LAARTMGVEPARCAVVEDSPTGVTAGVAAGMTVFGYAERNDAALLREAGAGTIFTDMRD
FT                   LPELVG"
FT   CDS_pept        187865..188302
FT                   /transl_table=11
FT                   /gene="h16_A0175"
FT                   /locus_tag="H16_A0175"
FT                   /product="conserved hypothetical protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91327"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF94"
FT                   /inference="protein motif:COGS:COG3012"
FT                   /protein_id="CAJ91327.1"
FT                   /translation="MTAKAAGRLPKAGPVPCPCGSADYAACCGRFHRGEALPPNAEALM
FT                   RSRYSAYVLNDMEWLRQTWHASTCPADLLPDTATRWLGLTVKAHAQQDDAHAEVEFVAR
FT                   YKVGGRAMRLHERSRFVREPRAPGEAPRWLYVDGDMIGETS"
FT   CDS_pept        188299..188976
FT                   /transl_table=11
FT                   /gene="h16_A0176"
FT                   /locus_tag="H16_A0176"
FT                   /product="Glutathione S-transferase"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91328"
FT                   /db_xref="GOA:Q0KF93"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF93"
FT                   /inference="protein motif:PFAM:GST_C"
FT                   /inference="protein motif:PFAM:GST_N"
FT                   /protein_id="CAJ91328.1"
FT                   /translation="MSIEKRNEPEYLLYCFAQSGNAYKVALLLETVGVQRGQQLWQPRF
FT                   VDFFNGETRTPEYRAINVMGEVPVLECGGQRLSQSGAILETLATRLDAYGPRDEAERAE
FT                   VLRWLLFDNHKFTSYTATYRFMRTFARSPDPAVLEFFRARCEGAWNVLNAQLAGRAFLL
FT                   GERATIADFSLSGYVFFDDEIGVHWRKEYPHIHAWAERIRALPGWKHPYDLMPGHPLPR
FT                   HAG"
FT   CDS_pept        189030..190637
FT                   /transl_table=11
FT                   /gene="h16_A0177"
FT                   /locus_tag="H16_A0177"
FT                   /product="Carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91329"
FT                   /db_xref="GOA:Q0KF92"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF92"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="CAJ91329.1"
FT                   /translation="MPTLETKLNARSESFQANAESMQALVADLKARIAKLAEGGGDDAR
FT                   NKHLSRGKLLPRDRVQQLLDPGTPFLELSQLAAYDMYDNAAPGAGIITGIGRVAGQECV
FT                   IVCNDATVKGGTYYPMTVKKHVRAQEIAEQNNLPCIYLVDSGGANLPNQDDVFPDRDHF
FT                   GRIFYNQANLSKQGIPQIAVVMGSCTAGGAYVPAMSDESIIVKNQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGADVHTRLSGVADYFAQNDHHALSLARNIVQHLNRRKPDQIRLHEPVE
FT                   PLYPVEELYGVIPTDTRKPYDVREVIARLVDGSEFDEFKARYGTTLVCGFARIWGYPVG
FT                   IVANNGILFSESALKGAHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIARNGAKMVT
FT                   AVATAQVPKFTVIIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVR
FT                   RDGIEGKGGKWSAQEEEAFKQPIRDQYEHQGHPYYASARLWDDGVIDPAQTRTVLGLGL
FT                   SASLNAPIDEMKFGVFRM"
FT   CDS_pept        190734..191576
FT                   /transl_table=11
FT                   /gene="h16_A0178"
FT                   /locus_tag="H16_A0178"
FT                   /product="dienelactone hydrolase or related enzyme"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91330"
FT                   /db_xref="GOA:Q0KF91"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF91"
FT                   /protein_id="CAJ91330.1"
FT                   /translation="MLAPLSGHAQSASGNGNPAPRMRFQEQVVMLPKAAIPSRIDLEAT
FT                   VFKPAGDGPFPLVVINHGKAPGRPAMQGRARFPAQSLEFLRRGYAVVLPMRQGFARSGG
FT                   AYVGGSCDIETNGMMQADDVVATLDFMATQPYVDMDRIVVIGQSHGGLTTMAFSTIGYP
FT                   GVLGVVNFAGGLRNLNCADWEERLVDAFASYGGLARYPSLWVYGDNDSYWPVPLPGRMF
FT                   NAFKARATGPAARSRLVDVGEFGNDSHRVFSAREGIPVWLPEVGNFFRSLGLPFDAGT"
FT   CDS_pept        191615..192403
FT                   /transl_table=11
FT                   /gene="h16_A0179"
FT                   /locus_tag="H16_A0179"
FT                   /product="Enoyl-CoA hydratase/carnithine racemase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91331"
FT                   /db_xref="GOA:Q0KF90"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF90"
FT                   /inference="protein motif:PFAM:ECH"
FT                   /protein_id="CAJ91331.1"
FT                   /translation="MEFTALTVNIASHVATVTLNRPDVRNAFNETVIAELTGAFRALGD
FT                   MDEVRAIVLAGNGPAFCAGADLNWMKKMAGYSDDQNRADALTLAQMLHTIWSCPRPVIA
FT                   RIQGDTYAGGMGLVAACDIAVAAEHAHFCLSEARLGLLPATISPYVIRALGEQAARRYF
FT                   ITAERFDAAEALRLGFVHAVVPAEALDAKVAELATALVANSPNAVRESKRLVQDIAGRA
FT                   IDNDLLADTADRIAKIRASEEGREGVKSFLEKRSPSWRPA"
FT   CDS_pept        192732..194234
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="H16_A0180"
FT                   /product="Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="2.6.1.62"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91332"
FT                   /db_xref="GOA:Q0KF89"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF89"
FT                   /inference="protein motif:COGS:COG0161"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="CAJ91332.1"
FT                   /translation="MTLPNLSATVAQPGLAGNGARADGQQRRATLDHLSLSPGRDAQAL
FT                   GQRSRNAVWHPCTRLRPDDDAVPLAIVRGVGPWLHDADGRRYFDATSSWWVNLFGHANP
FT                   RINAALASQLETLEHVMLAGCTHAPAVELAERLSALTGGALGNVFYASDGASAVEIALK
FT                   MSFHYWRNTGLPAKREFVCLRHGYHGETVGALAVTDVEVFRDAYDPLIRRAHVVMSPDA
FT                   RQAAPGESAADVAARALAELETLLRERAGQIAALIVEPLVQGAAGMAMYDPSYLDGARA
FT                   LCDRYRIHLIADEIAVGCGRTGTFFAWEQSRAGEAPLPAHLWPDFLCLSKGISGGYLPL
FT                   SLVLSRPEIQRAFVADELARSFLHSHSYTGNPLACRAALATLDLFAQDDVLARNRERAH
FT                   WLADGMAALAADARLRHVRQRGLIWAADVRDDVAGADFAARFHHAARERELLVRPIGNT
FT                   LYVMPPYVFDAAQARWLGEQMMATLDDVTTDVTTSGEVRHAA"
FT   CDS_pept        194224..195438
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="H16_A0181"
FT                   /product="8-Amino-7-oxononanoate synthase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91333"
FT                   /db_xref="GOA:Q0KF88"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF88"
FT                   /inference="protein motif:COGS:COG0156"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="CAJ91333.1"
FT                   /translation="MLLEQLRRAAEQRHALALTRRRRVAHTACAPHQAVGEDGSEPESL
FT                   LTFCSNDYMGLANHPDVIAALVEGAQRYGAGSGASHLVSGHSLAHTQLEAELARWLAPH
FT                   IPHACTLYFCTGYMANMAVLTALGTAGATLFCESLNHASLIDGARLARADVQRYPHCDT
FT                   AALEALLAASTSERKLIVTDSVFSMDGNVAPLRKLLELAERHDAWIIVDDAHGFGVLGE
FT                   QGHGVLEALGLSSERLIYIGTLGKAAGVAGAFVAAHETIIEHLVNTARPYIYTTAAPPA
FT                   VAHALLASLAIIEGEEGTQRRAQLTRCIGMLREGLAQLAAIAGWTLGDSETAIQPLIVG
FT                   DNGAALALSATLEADGIRVGAIRPPTVPEGTARLRITLSAAHTEDDVRRLLDALSAAVA
FT                   QREVA"
FT   CDS_pept        195435..196172
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="H16_A0182"
FT                   /product="dethiobiotin synthetase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="6.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91334"
FT                   /db_xref="GOA:Q0KF87"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF87"
FT                   /inference="protein motif:PFAM:CbiA"
FT                   /protein_id="CAJ91334.1"
FT                   /translation="MSTRAPFACFVTGTDTGIGKTHASATLLHALHAAGYRTAGMKPVA
FT                   SGSEWRDGHWHNDDVAQLRAASSVAVPLGQTCPFLLRTPCSPHLAAAHEGVRITRAPVR
FT                   AAFDALRRQADAVVVEGVGGFNVPLDAGAVRWNTADLAVMLAVPVVMVVGIRLGCLNHA
FT                   VLTAEAIRARGLPLAGWIANRVDPDMLLADENIATLHASLDAPCLGELPWQLAPAAAAG
FT                   RLDLAPLFAAATQYQAEAAGLAA"
FT   CDS_pept        196192..197223
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="H16_A0183"
FT                   /product="biotin synthase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91335"
FT                   /db_xref="GOA:Q0KF86"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF86"
FT                   /inference="protein motif:COGS:COG0502"
FT                   /inference="protein motif:SMART:smart00729"
FT                   /protein_id="CAJ91335.1"
FT                   /translation="MTQAHTATTVTTVSVDSLRQSARSHALPDDAAWRVDDVAALFALP
FT                   FNDLLFRAQQVHREHFDANTVQLSTLLSIKTGGCEEDCGYCPQSAHHDAGVKAEKLMAL
FT                   DEVLDAARAAKANGATRFCMGAAWRSPKDRHLEPVMDMVREVKAMGLETCVTLGMLKAE
FT                   QAQQLKEAGLDYYNHNLDTSPEFYGKIITTRTYQDRLDTIGHVRDAGINVCCGGIVGMG
FT                   EAREARAGLIAQLANMDPYPESVPINNLVQVEGTPLAGTEALDPFEFVRTIAVARITMP
FT                   RAMVRLSAGREAMDEALQALCFMAGANSIFYGEKLLTTGNPQADRDRALLARLDIRAEG
FT                   YAG"
FT   CDS_pept        197288..199315
FT                   /transl_table=11
FT                   /gene="accC1"
FT                   /locus_tag="H16_A0184"
FT                   /product="biotin carboxylase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91336"
FT                   /db_xref="GOA:Q0KF85"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF85"
FT                   /inference="protein motif:COGS:COG0439"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /inference="protein motif:PFAM:PF02785"
FT                   /inference="protein motif:PFAM:PF00289"
FT                   /protein_id="CAJ91336.1"
FT                   /translation="MFSKILIANRGEIACRVAATCRRLGIRTVAVYSDADADARHVAFC
FT                   DEAVHIGGAAARDSYLRADHIIEMAKEAGAQAIHPGYGFLSENEAFAEACAAAGLVFIG
FT                   PPASAIHAMGSKSAAKQLMEKAAVPLVPGYHGEDQGPALLRREADRIGYPVLLKASAGG
FT                   GGKGMRVVESGDAFEAALASVKREASASFGDDKVLVEKYLTRPRHIEIQVFADTHGNCV
FT                   YLFERDCSVQRRHQKVLEEAPAPGMTEARRRAMGEAAVAAAKAVGYVGAGTVEFIANQD
FT                   GSFYFMEMNTRLQVEHPVTEMITGQDLVEWQLRVAAGEALPLTQDQLRIDGHALEARIY
FT                   AENPDKQFLPSTGTLRFLRTPPAVQFMRGEDVHGPAGIRIDAGVREGDTISPFYDPMIA
FT                   KLIVWGKDRDEALARMRQALASYHVVGLSTNVAFLQRLVSSQAFRTADLDTGLIERNEK
FT                   VLFPPPAPVGLEVIALAVAALFDREARERRIDAADQHSPWTHGGAWRLNGGVSRTLRFG
FT                   YGEQVLEVTLSTNERGSTLIYADQAAPFACTCQADDIRINLGTRRAHGQVHADGETFHV
FT                   FYAGRHVSLAWLDPLAHAGETESEGGKLTAPMPGKVIAVMVEAGSTVTRGTPLLVMEAM
FT                   KMEHTISAPVDGVVSEVLYRVGEQVVEGAQLLAFEGKSGA"
FT   CDS_pept        199420..200361
FT                   /transl_table=11
FT                   /gene="h16_A0185"
FT                   /locus_tag="H16_A0185"
FT                   /product="D-3-Phosphoglycerate dehydrogenase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91337"
FT                   /db_xref="GOA:Q0KF84"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF84"
FT                   /inference="protein motif:COGS:COG0111"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="CAJ91337.1"
FT                   /translation="MKLQLYVPDGRYDAWIAGFAEALPEAQCVTWEDSRGEPADYAVVW
FT                   RPPVEMLRGRTELKAVFNLGAGVDGILRLRDEAPDALPAGVPIVRLDDAGMAAQMAEYV
FT                   THAVLRYFRKMDAYEAQQRAGNWKFLKPHRRADFTIGVMGVGTLGTHIARTLAGFGFPV
FT                   RGWSRTARAIEGVSGFYGDAGQAPFLDGLRVLVNVLPLTPQTENILNAALFARLAQGAY
FT                   VINVARGQHLVEEDLLAAVQSGQVAGATLDVFRTEPLPAEHPFWQEPRITVTPHISALT
FT                   LREDSIAQIAGKIRALRAGQPIAGVVDVQRGY"
FT   CDS_pept        200399..201334
FT                   /transl_table=11
FT                   /gene="h16_A0186"
FT                   /locus_tag="H16_A0186"
FT                   /product="Hydroxymethylglutaryl-CoA lyase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="4.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91338"
FT                   /db_xref="GOA:Q0KF83"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027167"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF83"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="CAJ91338.1"
FT                   /translation="MTMPNYVKIVEVGPRDGLQNEKAMVPTEVKVALINQLTDAGFVNI
FT                   EAASFVSPKWVPQMADGADVMARIQRRPGTLFSALTPNMKGFEGAIEAGADEVVIFGAA
FT                   SEAFSQKNINCSIAESIARFAPVAAAAKEKGVRLRGSISCALGCPYQGEVPVHAVVDVV
FT                   RRMRELGCDEIDIADTIGVGTPVRVQEVMRAAAAEFALDRLSGHFHDTYGQALSNILAS
FT                   LEVGISIFHASVAGLGGCPYAKGATGNVATEDVLYMLHGMGIHTGIDLEAVVRTGDYIS
FT                   QAIGRANSSRVGRALLTKWAAASDAAPACA"
FT   CDS_pept        201376..201876
FT                   /transl_table=11
FT                   /gene="h16_A0187"
FT                   /locus_tag="H16_A0187"
FT                   /product="uncharacterized conserved protein containing
FT                   prolyl-tRNA synthetase domain"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91339"
FT                   /db_xref="GOA:Q0KF82"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF82"
FT                   /inference="protein motif:COGS:COG2606"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="CAJ91339.1"
FT                   /translation="MTVNDEALPESAQRVADLLAGLGHDRPVVMLPATGKTSAEAAAGL
FT                   GCSVAEIAKSIIFRRVADDAPVLVIASGSNRVDEAKVAARVGALGKADARFVREKTGYA
FT                   IGGVCPIGHAVAPVMLLDQDLFRYDSLWAAAGHPHAVFNLTPHQLQQMTGAEVADVAAG
FT                   SVA"
FT   CDS_pept        201873..202301
FT                   /transl_table=11
FT                   /gene="h16_A0188"
FT                   /locus_tag="H16_A0188"
FT                   /product="predicted thioesterase"
FT                   /function="General function prediction only"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91340"
FT                   /db_xref="GOA:Q0KF81"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF81"
FT                   /inference="protein motif:COGS:COG5496"
FT                   /protein_id="CAJ91340.1"
FT                   /translation="MSPDLRPGLTFSWQYTVPPKATVPRLYDDIPGCPEMPDVLATGYM
FT                   VGIMECACLQMLREHLDWPREQSLGTLVSFSHLAPTPPGMTVTVKGELVAVDGRRLRFQ
FT                   LSAWDGEDKISEGVHERHLIDAGRFNEKVAAKAARAAG"
FT   CDS_pept        202312..202572
FT                   /transl_table=11
FT                   /gene="h16_A0189"
FT                   /locus_tag="H16_A0189"
FT                   /product="Predicted Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91341"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF80"
FT                   /inference="protein motif:COGS:COG3313"
FT                   /inference="protein motif:PFAM:PF06945"
FT                   /protein_id="CAJ91341.1"
FT                   /translation="MATMPTPAPSAAELAAQADLALRASPVPSPCRNICHMDPFSGYCA
FT                   GCLRTIDEIAGWSSASDEDKRHVWAQLPQRAAWLAGEEASP"
FT   CDS_pept        202542..203498
FT                   /transl_table=11
FT                   /gene="gloB1"
FT                   /locus_tag="H16_A0190"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /function="General function prediction only"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91342"
FT                   /db_xref="GOA:Q0KF79"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF79"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="CAJ91342.1"
FT                   /translation="MAGRRGGIPLSASPVPQLPPSMRVFERGWLSANNILFVDGDDTVL
FT                   VDTGYVTHAPQTVALVAAALQGRPLARVINTHLHSDHCGGNAALQARWQPRTAIPAAEA
FT                   AAVAAWDTEALSYNATGQQCDRFTFDSVLNDGDTLRLGGIDWQVVAAPGHDPHAVMLFA
FT                   PAGRILVSGDALWENGFGVIFPELDGESGFAEQAAVLERIAQLDARSVIPGHGRMFTDV
FT                   AAAVERAQGRLAYLSADPARNASHAVKVLVKFKLLEQQRMAQDALVAWMEAAPLMVRIR
FT                   QRFMPGLEMAEVCAQTVRALAGVKALAVEGEWVVNRD"
FT   CDS_pept        complement(203521..205773)
FT                   /transl_table=11
FT                   /gene="h16_A0191"
FT                   /locus_tag="H16_A0191"
FT                   /product="outer membrane receptor, TonB dependent"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91343"
FT                   /db_xref="GOA:Q0KF78"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF78"
FT                   /inference="protein motif:TCDB:1.B.14"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="CAJ91343.1"
FT                   /translation="MPGSCRASRADCHCLTPRAMSKNRYTAPTSAPRLTPLAALAASLT
FT                   ATMATAFVAPAALAQATAPAADSAPATATATATATAPAGAMLREVVVTANPLGSDLNDM
FT                   VAPVSTLGGDALAVRQGSTLGDTLDKLPGVSSSYFGPNASRPVIRGLDGDRIKVLQNGG
FT                   TTVDASTLSYDHAVPVDPLVAERIEVVRGPAALMYGGNAIGGVVNVIDNRIPKEPIEGI
FT                   GGAVDASATAGGDQARNASALIEAGNGKFAVHADAFARKTSDLRIPGYARSDRLRSADP
FT                   LPEGETEAYGRLPNTSAQQEGGAMGGSYTWADGFVGANYSAYRNEYGTPAEDDVRLKMR
FT                   QDRFALEGEARNLAGNTAGWLESVKGKFGYTDYEHKEIEGGETGTIFKNRGWDARLEAR
FT                   HAKIGNMTGVIGTQFGHTDFSALGEEAFVPSTNTDNAALFVFEELPLTASGDLKLNLGG
FT                   RLDHSSIKASANGNDRFTDASRSFNATSASAGLLYKVNPLWSLTSNLSYTERAPTFYEL
FT                   YANGPHVATGAWELGDPNANKERATSIDLGVRFKSGAHSAAVSGYYSRFANYLALNATG
FT                   RTRDEAGDVVAAGSPDALPEFQYLGVPATLYGFEVEGKTRLLQKMLTTSDTLDFEARAD
FT                   YVRGENRDTGEPLPRLAPLRLGGALVYGAGPWGARVDVTYAAKQTRVPTNDTPTDAYTL
FT                   LSLALTYKFKVSGTQTLVYLRGDNLTNQDARNSASILRDIAPLAGRSVKVGFRTSF"
FT   sig_peptide     complement(205708..205773)
FT                   /gene="h16_A0191"
FT                   /locus_tag="H16_A0191"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(205876..206346)
FT                   /transl_table=11
FT                   /gene="h16_A0192"
FT                   /locus_tag="H16_A0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91344"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF77"
FT                   /protein_id="CAJ91344.1"
FT                   /translation="MTMAMIAAAAIPTTTTATTPAIRMRTDWFARLRAHGPGLWSALWL
FT                   TLCLLLAQHAGLTHRIVHGSLLAPSASVTTADAASANDPEPHPLAQKFSGHSCVLFDGA
FT                   TVADTLCGKLPLPQLAFGKPVKPANLAWRWPDLPATHPFQSRAPPAPAIALA"
FT   CDS_pept        complement(206267..207535)
FT                   /transl_table=11
FT                   /gene="h16_A0193"
FT                   /locus_tag="H16_A0193"
FT                   /product="Putative GTPase (G3E family)"
FT                   /function="General function prediction only"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91345"
FT                   /db_xref="GOA:Q0KF76"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF76"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /inference="protein motif:COGS:COG0523"
FT                   /protein_id="CAJ91345.1"
FT                   /translation="MADRLPVTVLSGFPGAGKTTLLNHLLAHSAGRRLAVLVCGPQHGQ
FT                   ALAPLPPGCEATLLPVGDALLGEAARLAAEGRFDSLLIEADGLDEPLAIAEGFLFEAEH
FT                   GAGPDAAVQPDTLVTVIDAATFLRDLNEAEFLADRGLAPATDDDRTVAEVLVAQVECSD
FT                   VIVLNKADLASAAELARLHAVLQALNPRADIVEASFGKVAPERVQGTGRFDFEAAADAP
FT                   GWLAALRGELPAADASGVSTLVYRRRRPFHPQRFADLIHTEWLREHGSVLRSRGLFWLA
FT                   SRMDTAGDWNQSGGVCRHGGAGAWWAALDPAEWPADSAERAEVEADMQVDGAPAAFGDR
FT                   RQELVLTGLDLDHAALQARLDACLLTDAEMAAGAEAWAGYADPFPAWVDDFDDDHDHDH
FT                   GDDCGCGDPDHHHGNHAGHPHAH"
FT   CDS_pept        complement(207767..208453)
FT                   /transl_table=11
FT                   /gene="dksA1"
FT                   /locus_tag="H16_A0194"
FT                   /product="DnaK suppressor protein"
FT                   /function="Signal transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91346"
FT                   /db_xref="GOA:Q0KF75"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF75"
FT                   /inference="protein motif:COGS:COG1734"
FT                   /inference="protein motif:PFAM:PF01258"
FT                   /protein_id="CAJ91346.1"
FT                   /translation="MTAATKTKESRSKTGTAAAETLKAQPVKAAPAPRGSTANAEAGAT
FT                   KGGPRSSKTAASQSETTEARKRADSAPERTRTPPAASTRESAATMSSNKLLTEAEILKM
FT                   SDKDYMNEAQLAFFKHRLEQLRDEILKNADQTTEHLRETVIVPDPADRATIEEEHALEL
FT                   RTRDRERKLLKKVEQSLQRIESGDYGWCEETGEPIGVPRLLARPTATLSLEAQQRRELR
FT                   QKLFGD"
FT   CDS_pept        complement(208797..209897)
FT                   /transl_table=11
FT                   /gene="h16_A0195"
FT                   /locus_tag="H16_A0195"
FT                   /product="Putative GTPase (G3E family)"
FT                   /function="General function prediction only"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91347"
FT                   /db_xref="GOA:Q0KF74"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF74"
FT                   /inference="protein motif:COGS:COG0523"
FT                   /protein_id="CAJ91347.1"
FT                   /translation="MSKLTPVTILTGFLGSGKTTLLKRILNEQHGMKIAVIENEFGEEN
FT                   IDNEILVQDGREQIVQMSNGCICCTIRGDLVQALSTLLTRRDAGEIDFDRVVIETTGVA
FT                   NPGPVAQTFFMDEEIASRYLLDAVITLVDAKHAHLQLDKQEEAQRQVGFADAIFITKSD
FT                   LVTEADVAELRHRLLHMNPRAPIRLVNFGEAPIDTIFDLRGFNLNAKLEIDPEFLRADD
FT                   HDHDHDHEHEHGEHCGDDCGHDHGHDHAHGHGHAHDHHHHHHHHHHTDRIASFVFRSDK
FT                   PFHYGKLEEFLSGILAVYGEKLLRYKGVLYMDGVDRKVVFHGVHQLMGSDIGAKWEEET
FT                   PGTRMVFIGVDLPRDAILKGLENCLA"
FT   CDS_pept        complement(209928..210464)
FT                   /transl_table=11
FT                   /gene="h16_A0196"
FT                   /locus_tag="H16_A0196"
FT                   /product="transcriptional regulator, Fur-family"
FT                   /function="Inorganic ion transport and metabolism /
FT                   Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91348"
FT                   /db_xref="GOA:Q0KF73"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF73"
FT                   /inference="protein motif:COGS:COG0735"
FT                   /protein_id="CAJ91348.1"
FT                   /translation="MTRPSPDRPAAVPEPAIPTPESLEAAHERLRQLGARVTQPRLCIL
FT                   ACLIGSEEALTHQAVIDRLPEPGETIDRVTVYRVLDWLVEQGVAQKRAGNDRVFRFSLV
FT                   EHEAARAQEHRQHSHFHCTRCDRTFCLDDASAPAPPAAPRVPSGFAIEHVELTVNGVCA
FT                   ECGKRAPASPGGASH"
FT   CDS_pept        210606..211505
FT                   /transl_table=11
FT                   /gene="h16_A0197"
FT                   /locus_tag="H16_A0197"
FT                   /product="predicted hydrolase or acyltransferase"
FT                   /function="General function prediction only"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91349"
FT                   /db_xref="GOA:Q0KF72"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF72"
FT                   /inference="protein motif:COGS:COG0596"
FT                   /protein_id="CAJ91349.1"
FT                   /translation="MLNDASALLFPNFEPFRQRVGEVEIAGVRGGSGPPLLLLHGHPQS
FT                   HLIWHRVAPALADHFTVIATDLRGYGSSSAPPGNAGHEHYSKRTMAQDQVSLMTAFGFE
FT                   RFALCGHDRGARVAHRLCMDHPDAVSRAMLLDIAPTLAMYERTSMAFAAAYWHWFFLIQ
FT                   PAPFPETLINAEPDFYIEKLMGLRHAGLTPFAPDAMAAYTAAMRDPARVHAMCEDYRAA
FT                   ATIDLEHDRADREAGRRLALPLRVLWGEHGVVARCFEPLALWQEVATDISGQALPCGHY
FT                   IPEEAAEPLLEEMLGFFR"
FT   CDS_pept        211801..212787
FT                   /transl_table=11
FT                   /gene="h16_A0198"
FT                   /locus_tag="H16_A0198"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91350"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF71"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /protein_id="CAJ91350.1"
FT                   /translation="MKRVIKMVAAALAVSAMGVASGAYAQEYPGGKPVSAVVPFAAGGP
FT                   TDKLSRELTAIMSKHLGATMIIENLGGAGGTIGAKKVAQAKNDGHTLLIHHIGMATAPA
FT                   LYRNLGFDPLKDFEMVGEIADVPMILVGNKQLPPNTFKDLLPYLKANASKLSLANAGIG
FT                   SASHLCGLLFQSAIQTELTTVPYKGAAPALTDILGGQVNLLCDQTTNLAGHLKANSVKP
FT                   YAAMQARRVEAFKDIPTAAEQGLPGVEVKVWHAMYAPKGTPKPVIDKLSAALQKAVADP
FT                   TFRSKMAELGAEAAPAQRATPDSLRTLLTAEINKWTPVIKKAGVYAD"
FT   sig_peptide     211801..211878
FT                   /gene="h16_A0198"
FT                   /locus_tag="H16_A0198"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        213006..213542
FT                   /transl_table=11
FT                   /gene="clpY"
FT                   /locus_tag="H16_A0199"
FT                   /product="ATP-dependent protease HslVU, peptidase subunit"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91351"
FT                   /db_xref="GOA:Q0KF70"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF70"
FT                   /inference="protein motif:MEROPS:T01.006"
FT                   /inference="protein motif:COGS:COG5405"
FT                   /inference="protein motif:CDD:cd01913"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="CAJ91351.1"
FT                   /translation="MEQYHGTTIVSVRRGNQVALGGDGQVTLGNIVMKGTARKVRRIYN
FT                   GKVLVGFAGSTADAFSLLDRFEAKLEKYQGNLTRAAVDLAKDWRSDRALRRLEAMLITA
FT                   DRDTTLVITGNGDVLDPEGGIAAIGSGGAYAQSAAKALAENTEMAPKDVVEKALTIAGE
FT                   LCIYTNTNFVIETLE"
FT   CDS_pept        213593..214924
FT                   /transl_table=11
FT                   /gene="clpQ"
FT                   /locus_tag="H16_A0200"
FT                   /product="ATP-dependent protease HslVU, ATP-binding
FT                   subunit"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91352"
FT                   /db_xref="GOA:Q0KF69"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF69"
FT                   /inference="protein motif:COGS:COG1220"
FT                   /protein_id="CAJ91352.1"
FT                   /translation="MSHTMTPSEIVSELDKHIIGQNKAKKAVAVALRNRWRRQQVAEPL
FT                   RQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDTIVRDL
FT                   AEMAIKQTRESEMKKVRTKAEDAAEDRLLDVLLPPARDIGFSQPEEKDSNTRQVFRKKL
FT                   REGSLDDKEIELELSAGMPSMDIMGPPGMEDMTEQIRTMFAGLGQGKKARRKMKVKEAF
FT                   KLLIDEEAAKLVNDEELKHKAIANVEQNGIVFLDEIDKIASRSEIGGGEVSRQGVQRDL
FT                   LPLVEGTTVSTKYGMIKTDHILFIASGAFHLSKPSDLIPELQGRFPIRVELDSLSVQDF
FT                   EAILTQTDASLTKQYQALLSTESVDLVFADDGIRRLAEIAFSVNEKVENIGARRLYTVM
FT                   ERLLEDLSFHATKSSGETVTINAAYVDERLGDLAVNEDLSRYVL"
FT   CDS_pept        215182..215478
FT                   /transl_table=11
FT                   /gene="h16_A0201"
FT                   /locus_tag="H16_A0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91353"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF68"
FT                   /protein_id="CAJ91353.1"
FT                   /translation="MVHYKTRRVVLATGGLLAALAAATAFLCIRPAVPAAEAAQSGSRG
FT                   AATAAAAKLALDSGGLFTLADRHAGDAMRIVAQGSTPQGSADGLDWDYVQLRL"
FT   CDS_pept        complement(215532..216143)
FT                   /transl_table=11
FT                   /gene="h16_A0202"
FT                   /locus_tag="H16_A0202"
FT                   /product="response regulator containing a Fis-type
FT                   DNA-binding domain"
FT                   /function="Signal transduction mechanisms / Transcription"
FT                   /note="REC (residues 19 to 139, 2e-17) with a complete
FT                   phosphorylation pocket (DD-D56-T92-K106)"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91354"
FT                   /db_xref="GOA:Q0KF67"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF67"
FT                   /inference="protein motif:CDD:cd00156"
FT                   /inference="protein motif:COGS:COG4567"
FT                   /inference="protein motif:PFAM:PF02954"
FT                   /protein_id="CAJ91354.1"
FT                   /translation="MTDTLTPVPEATAPAGTPFLVIDDDEVFAGTLARALTRRGYAVQV
FT                   AHDGRTALALASRIEFAYVTLDLHLEPPPDAGSTVPAESGLQLVSPLRQALPDARILIL
FT                   TGYASIATAVAAVKQGADEYLAKPANVDSILTALMAGVSEDAAQAALEEPVPLSVARLE
FT                   WEHIQRVLAEHDGNISATARALNMHRRTLQRKLGKRPVSR"
FT   CDS_pept        complement(216140..217528)
FT                   /transl_table=11
FT                   /gene="h16_A0203"
FT                   /locus_tag="H16_A0203"
FT                   /product="signal transduction histidine kinase"
FT                   /function="Signal transduction mechanisms"
FT                   /EC_number="2.7.3.-"
FT                   /note="6 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91355"
FT                   /db_xref="GOA:Q0KF66"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF66"
FT                   /inference="protein motif:COGS:COG0642"
FT                   /protein_id="CAJ91355.1"
FT                   /translation="MTTAAAVTRLPDLPFLSPLPAGTSARHGQVTLRRLFWLRWALLAG
FT                   QALTVLSCEPIAGIRLPYGPLLVVFGLQALFNLLTGLRLRQHTRRNSAPGEAELMGQLL
FT                   VDLTALSAILFYTGGATNPFVSFYLPGLAIAAAILPWRQVIALALYALVCYTLLLFEYV
FT                   PLDLHNPDNAVNYHLAGMWLNFVASAVMIALFVARLSGVLRQREAQLNLAREQLLREAR
FT                   VEDLNGQAAAVAHEIGTPLATLAVIAGELRADASDAGRGTSAINSYLPDLQTMEQQLAL
FT                   CRTTLARLREDPATLAPQRIDGWLPAFAERWQLRHPNASLQASATPGAGAQAVETARVG
FT                   QILTILLDNAARSQQAAGRGQEPLQLQIAMAPGNTAPWLSFRIADHGDGIPEMLRGQLG
FT                   ETPVASQHGGQGIGLYLAQSAARQMDGELAWHDRAGGGTVAELRLPALSTLSASAAATA
FT                   PRTP"
FT   CDS_pept        217705..218193
FT                   /transl_table=11
FT                   /gene="h16_A0204"
FT                   /locus_tag="H16_A0204"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91356"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF65"
FT                   /inference="protein motif:COGS:COG2847"
FT                   /inference="protein motif:PFAM:PF04314"
FT                   /protein_id="CAJ91356.1"
FT                   /translation="MQAKFRSATLAASVALAAALASGAALAQVDVSNAWVRGTVPTQTA
FT                   SGAFMVLHAHDNAKLVGVSSPVAAAELHEMKMEGNVMRMRQVKSLDLPKMKDVELKPGG
FT                   YHVMLMDLKAQLKKGDTVPITLKIEQGGKMIEQKVTAEVRDMVPAAAGASGGHGEHKH"
FT   sig_peptide     217705..217788
FT                   /gene="h16_A0204"
FT                   /locus_tag="H16_A0204"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(218372..219307)
FT                   /transl_table=11
FT                   /gene="h16_A0205"
FT                   /locus_tag="H16_A0205"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91357"
FT                   /db_xref="GOA:Q0KF64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF64"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91357.1"
FT                   /translation="MNSLRGIDLNLLVVLEALLAERHISRAALRLHLSQPAVSHALGRL
FT                   RQLLDDPILVRGKGGLVLSARAHELSGPLAEALAQVRILLGPSGFQPATARRSFRLAMS
FT                   DYGALVVLPRLLRAVRKAAPNIDLVVSQASREGMTAQVADGEIDMALGVFTHQPEGVKS
FT                   AELFCESYACAVDAATVRDSGRLDQVAYLARSHVLVATHSERMDAIDTAVAKLGGRRKI
FT                   ACVVPHWSVAPALIAGTNLVLTTARRSLAALEEDPRYAVFAPPFALDDFTFSMIWHERT
FT                   EADPAHAWLRERVLAAAASQESEEPISLRG"
FT   CDS_pept        219401..219931
FT                   /transl_table=11
FT                   /gene="h16_A0206"
FT                   /locus_tag="H16_A0206"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /function="Function unknown"
FT                   /note="4 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91358"
FT                   /db_xref="GOA:Q0KF63"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF63"
FT                   /inference="protein motif:COGS:COG3238"
FT                   /inference="protein motif:PFAM:PF04657"
FT                   /protein_id="CAJ91358.1"
FT                   /translation="MSGTQLPFSFPVSLWLPLGTAVLAGAAIPFQAGANATLGRTLGHP
FT                   LSATLVSLLVSLAALLPVLWLMRVPLPAPAALARAPGWLWIGGVLGVFYISAALMMAPK
FT                   LGAAGFIAAVVAGQVLAALLVDQFGLAGFAVRALTPARLAGAALIVAGMLVMQWGSAAG
FT                   PGPAPQPAAESGS"
FT   CDS_pept        complement(219904..220134)
FT                   /transl_table=11
FT                   /gene="h16_A0207"
FT                   /locus_tag="H16_A0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91359"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF62"
FT                   /protein_id="CAJ91359.1"
FT                   /translation="MSDASTVLTGQLRPVEHCSHCGAGFVCGYVAGLPECWCASQPLLP
FT                   ARRIVPGQHCLCPACLAARRQAAQEPDSAAG"
FT   CDS_pept        220489..221406
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="H16_A0208"
FT                   /product="acetylglutamate kinase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91360"
FT                   /db_xref="GOA:Q0KF61"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF61"
FT                   /inference="protein motif:COGS:COG0548"
FT                   /protein_id="CAJ91360.1"
FT                   /translation="MNADNPGPAATTVAAIAPALKAEILAEALPYIRKFHGKTIVVKYG
FT                   GNAMTEEKLKHGFARDVILLKLVGMNPVVVHGGGPQIDEALKKVGKVGTFVQGMRVTDE
FT                   ETMEVVEWVLGGEVQQDIVMLINQYGGQAVGLTGKDGGLIRAKRLQMPDRENPGAFIDI
FT                   GYVGDIEAINPAVVKALQDDAFIPVISPIGFSDDGQAYNINADVVAGKMAEILKAEKLV
FT                   MMTNIPGVMDKKGNLLTDLSAREIEELFADGTISGGMLPKISSALDAAKSGVHSVHIID
FT                   GRIEHSLLLEILTEQAFGTMIRSH"
FT   CDS_pept        221479..222417
FT                   /transl_table=11
FT                   /gene="h16_A0209"
FT                   /locus_tag="H16_A0209"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /function="General function prediction only"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91361"
FT                   /db_xref="GOA:Q0KF60"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF60"
FT                   /inference="protein motif:COGS:COG1011"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="CAJ91361.1"
FT                   /translation="MPSSLPSPRRVRARLCRRPAGNTSGDTVWLFDLDNTLHDASHAIF
FT                   PAINRLMTDYVARVLGCDEATASRVRVDYWQRYGATLLGMIRHHGVDPADFLRAAHEFP
FT                   ALADMVRVRRGLAAHLRRLPGRKILVTNAPQDYARAVLEIAGIRHCFERVVAIEQMWVH
FT                   GHLRPKPDRRMLRRLLVQTRIAPHRAVLVEDTVSHLKRYAGTGIRTAWVTGYLRTIAPS
FT                   RPHEVPAVRDDGSRRDAAVRSTLEAEDRRHVGHAAQEQSVTLVAAETQAPQAQPDNVRR
FT                   VRARVPNRPAYVDIKVQSMHQLQRRMRRIGS"
FT   CDS_pept        222414..223085
FT                   /transl_table=11
FT                   /gene="h16_A0210"
FT                   /locus_tag="H16_A0210"
FT                   /product="transcriptional regulator, TetR/AcrR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91362"
FT                   /db_xref="GOA:Q0KF59"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF59"
FT                   /inference="protein motif:COGS:COG1309"
FT                   /protein_id="CAJ91362.1"
FT                   /translation="MTQSNGREPEAVISGSAQDAQDGGQPPATPARKRPRPGERRVQIL
FT                   QTLATMLEHPRGEKITTAALAARLSVSEAALYRHFASKAQMYEGLIGFIEQTVFGLINQ
FT                   ITDKEEHGLRQAHAIVRMLLSFAEKNPGMTRVLTGEALVGEHERLQERINQVVDRIEAS
FT                   LRQCLKMAVTQAAFPADADIPARAALIMAAVQGQWHRYAKSGFRKSPSDHAEAHLRVLL
FT                   G"
FT   CDS_pept        223540..224721
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="H16_A0211"
FT                   /product="Homoserine O-acetyltransferase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91363"
FT                   /db_xref="GOA:Q0KF58"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF58"
FT                   /inference="protein motif:COGS:COG2021"
FT                   /protein_id="CAJ91363.1"
FT                   /translation="MTDVALPTAAPAAFDLPPDSVGVVAPQRMHFAEPLKLRNGSSIAG
FT                   YDLMVETYGTLNAARSNAVLVCHALNASHHVAGVYAEDPRDVGWWDNMVGPGKPLDTNR
FT                   FFVIGVNNLGSCFGSTGPMSLNPATGAPYGAAFPVVTVEDWVNAQALVADAFGITQFAA
FT                   VMGGSLGGMQAVAWSLLYPERLRHCIVVASTPKLSAQNIAFNEVARSAILSDPDFHGGN
FT                   YYAHGVKPKRGLRVARMIGHITYLSDEDMAEKFGRELKTDDIRFSFDVEFQVESYLRYQ
FT                   GDKFAEYFDANTYLLITRALDYFDPALAFGGDLTRAMAQTQASFLVASFGTDWRFAPSR
FT                   SRELVKALLDNKRPVSYAEIDAPHGHDAFLLDDPRYHNLMRAYYDRIAEEIGA"
FT   CDS_pept        224718..225329
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="H16_A0212"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /function="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91364"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF57"
FT                   /inference="protein motif:PFAM:PF07021"
FT                   /protein_id="CAJ91364.1"
FT                   /translation="MNALANPNILALRPDFRAIARWIEPHSTVLDLGCGDGSLLRVLQD
FT                   ELDVQAYGIEIRDEGVLACAQKGVHVIQQNLEGGLALFEDKSFDTVILSQTLQTIHNTA
FT                   QVLRDTLRVGRECIVSFPNFGYWPHRLSVFRGRMPVSESLPYQWYNTPNVRVLTISDFE
FT                   ALAPKVGLRVIDRVVMHEGVTVNWGGNWRGSLAVYRVCAA"
FT   CDS_pept        complement(225340..225768)
FT                   /transl_table=11
FT                   /gene="h16_A0213"
FT                   /locus_tag="H16_A0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91365"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF56"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="CAJ91365.1"
FT                   /translation="MKITSYYPVIMTGEVAGTAAFYQRHFGFVALFTSDWYVHLQLAGD
FT                   PSVNLAVLDGTHETIPAPARGQRARGLLLNFEVEDPDAVHDRLRAAGLPILLPLRDEAF
FT                   GQRHFITADPNGVLIDIIKPIPPSGEFAAQYEAGALPG"
FT   CDS_pept        225851..226423
FT                   /transl_table=11
FT                   /gene="h16_A0214"
FT                   /locus_tag="H16_A0214"
FT                   /product="transcriptional regulator, TetR/AcrR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91366"
FT                   /db_xref="GOA:Q0KF55"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF55"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="CAJ91366.1"
FT                   /translation="MVARSNRERTEATRQALLDAARTLFVSRGYGETSTPDICAAARIT
FT                   RGALYHHFADKRDLFRHVLAEEAAAVADDIEAAAPAGLDAADALIAGAQAYLDAMTVPG
FT                   RTRLLLVEGPAVLGLREMLALDDANAARTLREGLEAAGVDPQGDVAPLLSAAFDRAALE
FT                   IEAGADAVRVRGAMLWLLRRVLGQSAR"
FT   CDS_pept        complement(226424..227338)
FT                   /transl_table=11
FT                   /gene="h16_A0215"
FT                   /locus_tag="H16_A0215"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91367"
FT                   /db_xref="GOA:Q0KF54"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF54"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91367.1"
FT                   /translation="MPDMPLNAMAVFARVVECGSFSAAALDLGMTPSAVSRHVSRLEAT
FT                   LGASLLQRTTRAFALTELGQSVYAACARMTAAARDVTALAGEHGGTPHGVLRVSAPVSF
FT                   GQAWLAPRLPALLARYPGLDLQLTLADRMVDLVEEGMDVAVRIARELAPGLAARPLREV
FT                   RYRLVASPGYLARHGTPATPADLPAARCLYLGYGNFGERWAMRHQAGGEKVEVRIPPRL
FT                   TLNNSLAIMSMVERDAGIGLVPDFSLGDALDQGRVVTVLADWDILEPYIGTAYAVYTPT
FT                   RHVPPKVRAFVDHLAGTADDAPR"
FT   CDS_pept        227449..228336
FT                   /transl_table=11
FT                   /gene="h16_A0216"
FT                   /locus_tag="H16_A0216"
FT                   /product="integral membrane protein"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91368"
FT                   /db_xref="GOA:Q0KF53"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF53"
FT                   /inference="protein motif:COGS:COG5006"
FT                   /protein_id="CAJ91368.1"
FT                   /translation="MPSQQPLPGGAWRMVAAMLLSGTIGWFVVTSGQPPLDVVFFRCLF
FT                   GGAALLGVLTLQRGWVRMSRAQLGWLALGGVTLVLNWLALFSAYAYSGIAIATVVYHTQ
FT                   PFFLLLLTSVIQREPFPFARLPWLVLAFAGVMLITGLEHGATGTAMLAGIGLGLLAALL
FT                   YAVTTLATRRLQAIPPGQIAGLQMVLGVLMLAPLAHPAAGSYGTGTWAALLALGLVHTG
FT                   VMYTLLYGAFQRLNVVSIATLSFIYPLVAIVIDVMVFGVVLGPLQIAGMALVLLGVVAN
FT                   QLGWSLPLRRRVQG"
FT   CDS_pept        228462..229310
FT                   /transl_table=11
FT                   /gene="h16_A0217"
FT                   /locus_tag="H16_A0217"
FT                   /product="hypothetical membrane associated protein"
FT                   /function="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91369"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF52"
FT                   /inference="protein motif:COGS:COG1946"
FT                   /protein_id="CAJ91369.1"
FT                   /translation="MSTAPQTRAATAARPLHPFDDALALEPAGEHRFLGRTTPEYWNMI
FT                   GPFGGITAATLLQAALDHPQRLGDPVSLTVNFAGPIAEGPFEIEARPVRTNRSTQHWTL
FT                   ELRQGDAVATTATAMFAVRRETWACGEALMPEVPAAEALVAMNGFAPVRWLKSYDMRPV
FT                   RGAKPTAEAGTEHPDSLTQFWLRDAPARTPDFAAVAAWADSFYPRIFLKRAGFVPAGTV
FT                   SMTTYFHADAATLAALGDSHVLASAQAQVFRQGFFDQRAQLWSAGGELIASSHQIVYYK
FT                   E"
FT   CDS_pept        complement(229324..230583)
FT                   /transl_table=11
FT                   /gene="h16_A0218"
FT                   /locus_tag="H16_A0218"
FT                   /product="MFS transporter, PAT family"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /note="12 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91370"
FT                   /db_xref="GOA:Q0KF51"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF51"
FT                   /inference="protein motif:TCDB:2.A.1.25"
FT                   /inference="protein motif:COGS:COG2814"
FT                   /protein_id="CAJ91370.1"
FT                   /translation="MTFQTYLDIFRNRRIGAMLALGFASGLPLALTSGTLQAWMTVEGL
FT                   DIKTIGFFSLVGQAYIFKFLWAPLMDRYTPPLLGRRRGWLLVTQLGLVLGIAGMAFCPP
FT                   REALWTLAALATLVAFLSASQDIVFDAYSTDVLRPPERGAGAAVKVLGYRLAMLVSGGL
FT                   ALWLADRVLGWQQTYLLMAALMGVGIVTLLWAPEPDVPARAPRSLEEAVVGPLRDFFGR
FT                   QGAWWLLLLIVLYKLGDAFAGSLSTTFLIRGVGFSAGEVGIVNKTLGLAATIIGALFGG
FT                   TLMVRLGLYRSLMLFGVLQAVSNLGYWILAVTPPHLWTMGATIAVENLCGGMGTAAFVA
FT                   LLMTLCNRSFSATQYALLSALASVGRVYVGPTSGYMVEAWGWAPFYLGTVVVALPGVML
FT                   LWAMRHTVHRYEAQAREAIA"
FT   CDS_pept        230734..231696
FT                   /transl_table=11
FT                   /gene="h16_A0219"
FT                   /locus_tag="H16_A0219"
FT                   /product="peptidase family M48"
FT                   /function="General function prediction only"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91371"
FT                   /db_xref="GOA:Q0KF50"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF50"
FT                   /inference="protein motif:MEROPS:M48.UPW"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /inference="protein motif:COGS:COG0501"
FT                   /protein_id="CAJ91371.1"
FT                   /translation="MLRRLQGVQRPTRDRLVRALALAAVAAPMAWCLPAQAQDSEAGGI
FT                   RLDRSGSAVRKIVPVEAIEQQAAQEYEQLKQEAIAKHALAAADNPQLVRLRTIGKRLLP
FT                   QTARWNERARQWQWEINLIGSRQVNAFCMPGGKIAFYTGLLDQLKLTDDEIAMAMGHEI
FT                   AHALQEHARERAAKSEITNLGANVISQLFGFGNLGNMALGTGAHLLTLRFSRADESEAD
FT                   LIGMDIAARAGYDPRAAVSLWQKMGKVSQSGTEFLSTHPSGRSRIADLEKHLPEVLPLY
FT                   ARASNTTVEKLPPYRANMAGLGGAPVDSGDDDRQKPLQR"
FT   sig_peptide     230734..230847
FT                   /gene="h16_A0219"
FT                   /locus_tag="H16_A0219"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(231767..232714)
FT                   /transl_table=11
FT                   /gene="argC1"
FT                   /locus_tag="H16_A0220"
FT                   /product="N-Acetyl-gamma-glutamyl-phosphate reductase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91372"
FT                   /db_xref="GOA:Q0KF49"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF49"
FT                   /inference="protein motif:COGS:COG0002"
FT                   /protein_id="CAJ91372.1"
FT                   /translation="MVFKVFVDGQEGTTGLRLLDYLSGRSDVELLRIADDKRKDPAERA
FT                   RFLNAADVAFLCLPDVASREAVSLVTNPNTCVIDASTAFRTADSWAYGLPELARGQREK
FT                   IRDSKRIAVPGCHASAFVLAVRPLVDAGVLPADYPVSAFSLTGYSGGGKSMIAEFEAGG
FT                   NPKLDSPRPYALGLEHKHLPEMRVQAGLAQAPVFNPIVGNFLKGLAVTVPVFTDRLARK
FT                   VSAEQIVEIYRKHYEGEQFVRVMPYNSADNLDGGFFDVQANNDTNRVDLFVFGNAERLN
FT                   LVARLDNLGKGAAGAAVQCMNVHVGADEATGLRA"
FT   CDS_pept        232974..233195
FT                   /transl_table=11
FT                   /gene="h16_A0221"
FT                   /locus_tag="H16_A0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91373"
FT                   /db_xref="GOA:Q0KF48"
FT                   /db_xref="InterPro:IPR031451"
FT                   /db_xref="InterPro:IPR038493"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF48"
FT                   /protein_id="CAJ91373.1"
FT                   /translation="MAAFQGARNMCLTRGDVLDVVARIQPADFYKSMTTYVDHTVWQDV
FT                   YRPCTSYGAIYLKLTVTEEVLIVSFKAR"
FT   CDS_pept        233227..233628
FT                   /transl_table=11
FT                   /gene="h16_A0222"
FT                   /locus_tag="H16_A0222"
FT                   /product="transcriptional regulator, XRE-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91374"
FT                   /db_xref="GOA:Q0KF47"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022452"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="InterPro:IPR032758"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF47"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /inference="protein motif:SMART:smart00530"
FT                   /protein_id="CAJ91374.1"
FT                   /translation="MRCPVCGGAELERGRKDFVYTYRGESTVIEAVLADWCAQCGEGVL
FT                   GQEEEERIGPLALAFNKQVNASLVDPTYIMQVRKKLHLDQREAAEIFGGGVNAFSRYET
FT                   GRTKPPLALVKLLRLLDRHPELLEEVRAA"
FT   CDS_pept        complement(233638..234414)
FT                   /transl_table=11
FT                   /gene="h16_A0223"
FT                   /locus_tag="H16_A0223"
FT                   /product="Exodeoxyribonuclease III"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91375"
FT                   /db_xref="GOA:Q0KF46"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF46"
FT                   /inference="protein motif:COGS:COG0708"
FT                   /protein_id="CAJ91375.1"
FT                   /translation="MLRIISANLNGIRSASKKGFFDWMGKQDADMVCVQELKAQEADMT
FT                   EAFLAPHGYHGFFHYAEKKGYSGVGLYTRHKPERVVTGFGNSEFDSEGRYVEVQYPHLA
FT                   VISVYVPSGSSGEERQLAKFRFMEAFLPHLLQLKASGREIVLCGDVNIAHKEIDIKNWK
FT                   GNLKNSGFLPEERAWIGELFDVHGYVDVFRKLDPRPEQYTWWSNRGQAYAKNVGWRIDY
FT                   HLATPKIADTARLCSIYKDEKFSDHAPLSIDYDYPL"
FT   CDS_pept        234445..235128
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="H16_A0224"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /function="Nucleotide transport and metabolism"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91376"
FT                   /db_xref="GOA:Q0KF45"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF45"
FT                   /inference="protein motif:COGS:COG0461"
FT                   /protein_id="CAJ91376.1"
FT                   /translation="MTQQKPPAGADLSQTFIRFALDAGVLSFGEFVTKAGRKSPYFFNA
FT                   GLFNQGAMLGEVAQFYAKTLLASGVQFDVLFGPAYKGITLASATAVALAGMGRDVGFAY
FT                   NRKEAKDHGEGGTLVGAKLQGKVVIVDDVISAGTSVRESVNMIRAAGAEPAAVLIALDR
FT                   MEKSGTAEQVGTHSAVQDVQREYGIPVIAIASLKDLLAYLDASQDPALSASREAVAAYR
FT                   QRYGV"
FT   CDS_pept        235215..236564
FT                   /transl_table=11
FT                   /gene="h16_A0225"
FT                   /locus_tag="H16_A0225"
FT                   /product="predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /function="General function prediction only"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91377"
FT                   /db_xref="GOA:Q0KF44"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF44"
FT                   /inference="protein motif:COGS:COG1752"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="CAJ91377.1"
FT                   /translation="MAEKERQERQVRQVPQERQEKTARQMARQPTQAKAESGANADSLA
FT                   ERGAQVQPRKPVRRAAKAPDRPAHEAYAVRALVLQGGGALGAYQAGVYQGLAEGGIYPN
FT                   WVAGISIGALNAAIIAGNPPRRRVEQLRAFWEYICAQPWLPSLSHSWFADHAEGWPEPM
FT                   RIWFDGLHAARAMLEGQRGFFQPRGWPELMSRYSDPSHVSFYDTTPLKATLERFADFDL
FT                   INHRPDLMRVSVGAVNVRTGNFAYFDNTRDKLCPEHFMASGALPPGFPAVEIDGEYYWD
FT                   GGLVSNTPLAEVLTAQPRRDALIFQVDLWSARGKLPHDLVDVAERQKDIQYSSRTRAIT
FT                   DYMREQQNMRRMLNEVMALVPPSKRDNAWYRRAAEQACDARRNVIQLIYRDKSFENLAK
FT                   DYQFGALTMHEHWTSGLDDIRQTLRHPQWLAMPSREHPFVTHDVHRGNGG"
FT   CDS_pept        complement(236579..237388)
FT                   /transl_table=11
FT                   /gene="h16_A0226"
FT                   /locus_tag="H16_A0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91378"
FT                   /db_xref="GOA:Q0KF43"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF43"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="CAJ91378.1"
FT                   /translation="MPLDDFRITSGKRFRLADFDPGSKPLSCGKKEEDLARIIELSNAL
FT                   DAQQDIFYAEHRRRLLVVLQGMDTSGKDGTVRGVFRSFDPLGIRVVGFKSPSPEELARD
FT                   FLWRIHLQVPKTGEIVVFNRSHYEDVLITRVHNWIDAAECERRFRQIRDFESMLTETGT
FT                   TIVKCFLHISRDEQKARLEARLADPEKHWKFDTNDLAQRKHWKAYMDAYEAAIMATSTP
FT                   ECPWYVVPADSKTHRNLMVAEILTRVFEDLKPAYPPARPELASTKVD"
FT   CDS_pept        complement(237496..238362)
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="H16_A0227"
FT                   /product="diaminopimelate epimerase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91379"
FT                   /db_xref="GOA:Q0KF42"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF42"
FT                   /inference="protein motif:COGS:COG0253"
FT                   /protein_id="CAJ91379.1"
FT                   /translation="MKLQFTKMHGAGNDFVVLDGIHQQIDLTPAQWRALASRHFGVGAD
FT                   QILIVEKPSRPDVDFRYRIVNADGSEVEHCGNGARCFVRFVTDKGMTDKRSVRVEVMNG
FT                   VITLTLQDDGQVTVDMGAPELEPARVPFRAEGLPTRAEGADTLYGLEVNGRTEWISVVS
FT                   MGNPHAVQVVDDVENFPVLQDGPVVEHHAAFPNRVNAGFMQVQDRHAIRLRVYERGAGE
FT                   TLACGTGACAAVVAGIRRGLLDSPVRVHTHGGDLTIAWDGGAEPVRMTGPATTVFEGSI
FT                   DLAALPA"
FT   CDS_pept        complement(238405..239298)
FT                   /transl_table=11
FT                   /gene="h16_A0228"
FT                   /locus_tag="H16_A0228"
FT                   /product="Lauroyl/myristoyl acyltransferase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91380"
FT                   /db_xref="GOA:Q0KF41"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF41"
FT                   /inference="protein motif:COGS:COG1560"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="CAJ91380.1"
FT                   /translation="MSRVFTWLGIGLLTVLGKLPYPFVARFGEALGSLLYLVPSERRRV
FT                   VQANLRLCFPDRTEAEIDELSRQSFRILFRSFAERGIFWTGSEAQMRRWVQIDDQAGLV
FT                   ALDGTPHILVTLHLSGVEAGAIRLTIDLREHLGRSGASLYTRQKNDLFDHFLKHARGRF
FT                   GANMISRNDSARDILRCLKKGEALQLIADMDFGERDSEFVPFFGVQALTLTSVSRLARL
FT                   TGAKVVPIYTEMLPDYQGYVLRILPPWEDYPGASVTDDTRRMNAFFEDCIRPRVPEYYW
FT                   VHKRFKHRLPGEPEIY"
FT   CDS_pept        complement(239295..240191)
FT                   /transl_table=11
FT                   /gene="h16_A0229"
FT                   /locus_tag="H16_A0229"
FT                   /product="Lauroyl/myristoyl acyltransferase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91381"
FT                   /db_xref="GOA:Q0KF40"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF40"
FT                   /inference="protein motif:COGS:COG1560"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="CAJ91381.1"
FT                   /translation="MTFLFWLISRFPLRLLQAAGGALGLLSARLPGRYGQRLRENFRQA
FT                   FPDATDAMIDEAARSAGRMIVEMPYFWSRSKIGAKLHGFDDYLWPELGKLQARGKGIII
FT                   LTPHLGCFEVLPQSHALQRPVTALFKPPHQPWLRDWIEKMRTRPGMHMAPATPRGVRML
FT                   VKALKRGQAVGILPDQVPSGGEGNWAPFFGKPAYTMALVHRLQQLTGAPVVAVFAERLP
FT                   RGAGYRGHLRVINDGGMLPDDPAAAAAVINRTIEELVGLCPTQYLWAYNRYKQPAGAGT
FT                   PDAPGNDTEPATDRSIS"
FT   CDS_pept        240523..241686
FT                   /transl_table=11
FT                   /gene="metK1"
FT                   /locus_tag="H16_A0230"
FT                   /product="S-Adenosylmethionine synthetase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91382"
FT                   /db_xref="GOA:Q0KF39"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF39"
FT                   /inference="protein motif:COGS:COG0192"
FT                   /inference="protein motif:PFAM:PF02773"
FT                   /protein_id="CAJ91382.1"
FT                   /translation="MANDFLFTSESVSEGHPDKVADQISDAVLDAILAQDKYARVAAET
FT                   LCNTGLVVLAGEITTTANVDYIQIARDTIKRIGYDNTDYGIDYKGCAVLVAYDKQSPDI
FT                   AQGVDRASDDYLNQGAGDQGLMFGYACDETPELMPFPIYYAHRLVERQSLLRRDGRLPW
FT                   LRPDAKSQVTVRYVDGKPHSVDTVVLSTQHSPDITQAQIREAVIEEIIKPVLPAEMLKE
FT                   TKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGASPHGGGAFSGKDPSKVDRSAAYAA
FT                   RYVAKNVVASGLARQCQVQVSYAIGVARPINVTVYTEGTGKIPDAKIAELVQEHFDLRP
FT                   KGIVQMLDLLRPIYEKTAAYGHFGREEPEFSWEATDKAAALRAAAGL"
FT   CDS_pept        241889..242830
FT                   /transl_table=11
FT                   /gene="h16_A0231"
FT                   /locus_tag="H16_A0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91383"
FT                   /db_xref="InterPro:IPR021266"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF38"
FT                   /protein_id="CAJ91383.1"
FT                   /translation="MSEAPVLAPSTSTQPPAAGQLNLIRPQPYADWAPQVTAEERATLR
FT                   RELEQGAVLYFPNLNFRFQPGEERFLDSRYSDGKSKNINLRADDTAVRGAQGSPQDLAD
FT                   LYTLIRRYADNSELLVRTLFPEYIPHMTRAGTSLRPSEIAGRPVSWRKDDTRLHVDSFP
FT                   SNPMLGKRLLRVFHNIDPAAARVWRVGEPFGDFAQKFVPKTHGMWPGQAALMKLLHITK
FT                   RKRSEYDHRMLQLHDLAKADLDYQAKVPQQEFHFPPGSTWIVFSDQLLHAAMRGRAMME
FT                   QTIYLAPQAISDHTHSPEAVLSRMLGRPMLVS"
FT   CDS_pept        complement(242831..244234)
FT                   /transl_table=11
FT                   /gene="h16_A0232"
FT                   /locus_tag="H16_A0232"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /function="Energy production and conversion"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91384"
FT                   /db_xref="GOA:Q0KF37"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF37"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="CAJ91384.1"
FT                   /translation="MREVPDLSSVFGAMHAASRRDQLPAWAVRADRLQRLRRLVTENEA
FT                   AIAAAIHADFTNRPRQETALLEVFPSLGGIDDALRHGKRWMRVRRAATGFWFRPGRSRL
FT                   VPQPLGVVGIVVPWNYPLYLTVGPLAGALAAGNRAMVKLSEYTPRFAALFAQLVPQHFA
FT                   PDEIMVVNGDAEVASAFTALPFDHLLFTGSTAVGHHVMRAAAANLTPVTLELGGKSPAI
FT                   IGAGADLPRAVERILVGKLMNAGQTCIAPDYVLVPEDLRGQLVEPARRCVDRLYPDLAR
FT                   NRDYTSIISPRHFARLAALVDEAAAQGATVVPLSDAQPDAHARRLPPVLLLDVPEGVTA
FT                   MREEIFGPVLPVVTYRTLDEAVDYINARPRPLALYLFERDRGAIGHVMKQTVAGGVTVN
FT                   DTLFHIAQDGLPFGGVGASGMGAYHGQAGFDTFSKVKPVFHQAGLNGAGLLKPPYGKTF
FT                   ETMLRLLLR"
FT   CDS_pept        244550..246229
FT                   /transl_table=11
FT                   /gene="betA2"
FT                   /locus_tag="H16_A0233"
FT                   /product="choline dehydrogenase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="1.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91385"
FT                   /db_xref="GOA:Q0KF36"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF36"
FT                   /inference="protein motif:COGS:COG2303"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /inference="protein motif:PFAM:PF05199"
FT                   /protein_id="CAJ91385.1"
FT                   /translation="METTFDYVIVGAGSAGCALAGRLADSGDDTIALVEAGHHDHHVLV
FT                   RTPAALAALLPRAGARNYGYETVPQPGLNGRRGYQPRGRGLGGSSSINAMIYTRGRAAD
FT                   YDAWAAAGCDGWSWDDVLPYFRRAECNERLAGSDDDPLHGGNGPLHVSDLRTPNPFAER
FT                   FIEAAQQAGFPRNDDFNGEEQEGVGWYQVTQHAGERWNAARAYLHGGNKRDRACNGGRA
FT                   HLRVLTDTQALRIVFEGRHAAGVQLVREGHRQLLRARRDVIVCAGTFGSPQLLMVSGVG
FT                   PAAHLREHGIAVVHDLPGVGANLQDHLDIVLHKRVAVPELFGVSFGGLARLVPEMLRYR
FT                   RERTGMMSSNFAEAGGFLRSRPDLPEPDLQLHFVVGMADDHMRRLNFGHGYSCHVCVLR
FT                   PRSRGEVRLASHDIRRAPLIDPQYLSDARDLDDMVAGVRIVRSIFAQPQLAGFGGRELY
FT                   SAGLRADGSDDAAVREMIREHADTIYHPVGTCRMGMDAMAVVDPQLRVRGVEGLRVVDA
FT                   SVMPTLVGGNINAPAIMIGERAHDLIRYAPRVMLRVLESMEA"
FT   CDS_pept        complement(246234..247997)
FT                   /transl_table=11
FT                   /gene="aidB"
FT                   /locus_tag="H16_A0234"
FT                   /product="Acyl-CoA dehydrogenase, short-chain specific
FT                   (probable AidB protein)"
FT                   /function="Lipid metabolism"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91386"
FT                   /db_xref="GOA:Q0KF35"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF35"
FT                   /inference="protein motif:CDD:cd01154"
FT                   /inference="protein motif:COGS:COG1960"
FT                   /protein_id="CAJ91386.1"
FT                   /translation="MLQRNNHSQGDNRALKRRRRALPCSKTRPSSDPAMTEAATHRVFN
FT                   QVPDLAHYNLFATDPALRGALERLGGGWHAGTLGQFGARLGEPEVQQWAADANRHTPEL
FT                   HTHSRTGERIDAVDFHPSWHALLALLRSQQLQALPFAQPRAGAWVARTAGYFLQAQVES
FT                   GSLCPPTMTFASIPVLRKETALFAELEPRLYATEHDARDLPWRSKSAIMIGMGMTEKQG
FT                   GSDVRANTTVARAVRGEGRGAEYALTGHKWFFSAPMCDAHLVVARMGAEDGPLSCFFVP
FT                   RFRDDGSKNAVLIQRLKDKLGNRSNSSSEVEFRDATGILIGEEGRGIPTIIEMATSTRL
FT                   DCVIGSAAILRAAFVQALHHARHRSAFGRLLADQPLMRNVLADLALESEAATLLMMELG
FT                   HAFEHADDDPLAASWKRVVTPAAKFWVCKRTLEATGEAMEVWGGNGYVEEGPMARLYRE
FT                   APVNSIWEGSGNIMCLDVLRAIQRNPDDAARLLQDLSRRAGGHPAVRAELASLQALLRQ
FT                   PPELLEASARRFAQGLVLTAQAALMLAHADTENAELFVASRLGRQHGRVFGTLDADADV
FT                   LKRVFSRGFEG"
FT   CDS_pept        248296..250176
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="H16_A0235"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /function="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91387"
FT                   /db_xref="GOA:Q0KF34"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF34"
FT                   /protein_id="CAJ91387.1"
FT                   /translation="MARTAPAASFESLESDLDQKFAYPASSKTYLTGSRPDIRVPLRTI
FT                   LQTSTRTDKGEMQNPPIPVYDTSGPYSDPDVHIDLKAGLPAVRAKWIEERGDTEVLPGL
FT                   SSEYGRDRANDPATAHLRFAQLTNPRRAKAGANVSQMHYARKGIITPEMEYVALRESLN
FT                   LQALYDKPDYKALLRQHPGNALGAGLPLRPEDITPEFVRQEIASGRAIIPANINHTELE
FT                   PMAIGRNFRVKINGNLGNSAVTSSLAEEVEKMVWSIRWGADTIMDLSTGKHIHETREWI
FT                   LRNSPVPIGTVPIYQALDKTGGIAEDLTWEMFRDTLIEQAEQGVDYFTIHAGVLLRYVP
FT                   LTADRVTGIVSRGGSIMAKWCLAHHKENFLYTHFDEICEIMKAYDVSFSLGDGLRPGCI
FT                   ADSNDDAQFGELRTLGELTAKAWKHDVQVMIEGPGHVPLQRIQANMDEELKHCYEAPFY
FT                   TLGPLVTDIAPGYDHITSGIGAANIGWMGTAMLCYVTPKEHLGLPDKEDVREGIITYKI
FT                   AAHAADLAKGWPGAQLRDNALSKARFEFRWEDQFNLGLDPERARSYHDATLPAEGAKIA
FT                   HFCSMCGPKFCSMKITQEVRDYAASLPKEAQQGMEEKSIEFLKKGSKIYS"
FT   CDS_pept        250313..251506
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="H16_A0236"
FT                   /product="thiamine biosynthesis oxidoreductase"
FT                   /function="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91388"
FT                   /db_xref="GOA:Q0KF33"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF33"
FT                   /inference="protein motif:COGS:COG0665"
FT                   /protein_id="CAJ91388.1"
FT                   /translation="MTAVQSFDVAILGAGLAGRLAAWQLVRSGARVALVERAGPDGAGS
FT                   AAYVAAAMLAPLAESAIAERRIVDLGIASVDLWRAWLAELPEPVFFQEDGTLVVWHARD
FT                   RAEMSLFTSRVRAVAPPELVSQRLRALDGKGVGEVEPALAGRFPQGLLLAGEGQLDNRG
FT                   ALRALLSCAVSEGVHCVWEAGEVDAESLPKLGIRADVVLDCRGLGARSAWPAQPGGDKP
FT                   GLRGLRGEVVRVHAPDVRLHRPVRLLHPRYPIYIAPKPNDLYVIGATELESEDDSPMSV
FT                   RSALELLSAAHSLHPAFGEARVLELNVQRRPTRPDHLPAIRVDQRARVVRVNGLYRHGF
FT                   LIAPAVTEAACAVVGALLKGDPAAHAVPAALRWPGMIEAVTEAPAAATMAAPGGLLH"
FT   CDS_pept        251519..251716
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="H16_A0237"
FT                   /product="thiamine biosynthesis sulfur transfer protein"
FT                   /function="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91389"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF32"
FT                   /inference="protein motif:COGS:COG2104"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="CAJ91389.1"
FT                   /translation="MEILLNGRPLALADSATLADAVSAAQIAPPFAAAVNGQFVPRGAH
FT                   ANTILAAGDRIDLVQPVTGG"
FT   CDS_pept        251720..252556
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="H16_A0238"
FT                   /product="thiazole biosynthesis protein"
FT                   /function="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91390"
FT                   /db_xref="GOA:Q0KF31"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF31"
FT                   /inference="protein motif:PFAM:PF05690"
FT                   /inference="protein motif:COGS:COG2022"
FT                   /protein_id="CAJ91390.1"
FT                   /translation="MTFEPSETLRDPFVLYGESFGSRLLLGTARYPSPATLEAAVQASR
FT                   PAMITVALRRQGAVGAGEGGQAFWQMLKALDVPVLPNTAGCFTAQEVITTAMMAREVFE
FT                   TPWIKLELIGDDYTLQPDTLNLPAVAETLIKEGFKVLPYCTEDLVLCRRLLDVGCQALM
FT                   PWAAPIGTGRGAVNPHAMRVLRERLPDTPLIVDAGLGLPSHAAQVLEWGYDGVLLNTAV
FT                   AQAAYPVNMARAFAQAVEAGRTAYLAGPMPEREVAQASTPVVGMPFWHADSTEQRA"
FT   CDS_pept        252553..253689
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="H16_A0239"
FT                   /product="thiamine monophosphate synthase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91391"
FT                   /db_xref="GOA:Q0KF30"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF30"
FT                   /inference="protein motif:COGS:COG0352"
FT                   /inference="protein motif:PFAM:PF02581"
FT                   /protein_id="CAJ91391.1"
FT                   /translation="MTRRAVHAASDGPLRQAVLEHYGETFGVDDKPWQAWRLADAPAQP
FT                   GAHDVLLFDGEADAGTIARVAAAGATLIESDREGGQWIDTVRSPMGTWVFSVAADTDQP
FT                   HSPAFVAVLLASLALHFPAHDALCLARAWEPGSADWPSDFARFPHVRHAALVAPEQAAA
FT                   PFAPCPALGLYVVVPSAEWIERLAPLNVPTVQLRFKSEDPAAVRAEIARAAKATQGSSS
FT                   RLFVNDHWQAAIDYRAANGGDQSGIYGIHLGQEDLDDADLDAIRASGLRLGVSTHGYAE
FT                   MLRVAAIRPSYLALGAIFPTTTKVMPTQPQGMGRFRAYVKLMQPVIPSLVGIGGVNAAN
FT                   MREVLAVGVGSAAVVRAVTEADDVPAAVAQLISLFPAA"
FT   CDS_pept        253704..254213
FT                   /transl_table=11
FT                   /gene="h16_A0240"
FT                   /locus_tag="H16_A0240"
FT                   /product="Acetyltransferase (GNAT) family"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91392"
FT                   /db_xref="GOA:Q0KF29"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF29"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="CAJ91392.1"
FT                   /translation="MAAAAHIRLAAADEVPRLADIELAAAALFPDTDLPALLRLVSTPE
FT                   PVLAAAQREARLWVAERDGELAGFALASRNGECAYLDEMDVHPDHGRRGIGRALVGAVQ
FT                   GWARAGGSHSLNLTTFAHLPWNAPFYASLGFRQLRDDELCPLLADALAAQRAAGLRQRV
FT                   AMRQVL"
FT   CDS_pept        254330..254782
FT                   /transl_table=11
FT                   /gene="h16_A0241"
FT                   /locus_tag="H16_A0241"
FT                   /product="Uncharacterized protein, possibly involved in
FT                   aromatic compounds catabolism"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91393"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF28"
FT                   /inference="protein motif:COGS:COG2050"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="CAJ91393.1"
FT                   /translation="MSSQTAPEITPVAPGTPEKPYFGIDVPLMRYFGLQPELIEEGYCR
FT                   TRLPAHPSLVNSRGDVHGGTLMATLDFTLSGAARSHAPLETGVITIDMSTHFLAAARGE
FT                   LTLEARCLRRGARIAFCEGEVKDAAGTVVCVARAAFKLVPLSAGGN"
FT   CDS_pept        complement(254804..255238)
FT                   /transl_table=11
FT                   /gene="h16_A0242"
FT                   /locus_tag="H16_A0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91394"
FT                   /db_xref="InterPro:IPR025688"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF27"
FT                   /protein_id="CAJ91394.1"
FT                   /translation="MPMLADIDLRSDPAAAFYLKHEVVDVVFATEPGELISREGPNRYQ
FT                   PGDALITSRGGDRWCVSRDRFDPKYEAVPPLAHGQDGAYRNKPIPVLAREMHEAFSIAR
FT                   SAGGDVLHGKPGDWLMQYAPGDYGITERARFEQVYRPLQD"
FT   CDS_pept        complement(255244..256116)
FT                   /transl_table=11
FT                   /gene="h16_A0243"
FT                   /locus_tag="H16_A0243"
FT                   /product="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91395"
FT                   /db_xref="GOA:Q0KF26"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF26"
FT                   /inference="protein motif:COGS:COG0351"
FT                   /inference="protein motif:CDD:cd01169"
FT                   /protein_id="CAJ91395.1"
FT                   /translation="MPGRLAHRLPPIPAQMIPTPPRTLTIAGSDSGGGAGIQADLKTFS
FT                   ALGCFGMSAITAITAQNTLGVTGVHAIPADMVAAQIDAVASDIGMDAAKTGMLGTAAIV
FT                   EAVAAAADRHGISKLVVDPVMISTSGATLSDDATTQAMVRLLFPRALLVTPNLPEASYL
FT                   LGRRITRRAEMEQAAADLIAMGCPAVLLKGGHLEDGAAAGGLDDLLMLADGSVRVFTHP
FT                   RVDTRNLHGTGCTLAAAIAAQLARGDALEPAVGTALDYVAQAIAAGAGLRLGAGNGPLN
FT                   HLFAPRALG"
FT   CDS_pept        256368..257786
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="H16_A0244"
FT                   /product="Adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91396"
FT                   /db_xref="GOA:Q0KF25"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF25"
FT                   /inference="protein motif:PFAM:PF00670"
FT                   /protein_id="CAJ91396.1"
FT                   /translation="MNAVTDLKQDYLVADINLAGWGRKEIAIAETEMPGLMAIRDEFAA
FT                   AQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAAGGTPVF
FT                   AFKGESLKEYWDFTHRIFDWADGGTPNMILDDGGDATLLLHLGARAEKDQSVIAKATSE
FT                   EETYLFAAIKEKLAKDPSWYSRNLAAIRGVTEETTTGVHRLYQMAQKGELRFPAINVND
FT                   SVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAIVAGYGDVGKGSAQALRALSAQVWV
FT                   TEIDPICALQAAMEGYRVVTMDYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIG
FT                   HFDNEIDIASIEKYEWDEIKPQVDHVKFPDGKKLIILAKGRLVNLGCATGHPSYVMSSS
FT                   FANQTIAQIELWQERDSGKYPVGVYTLPKHLDEKVARLQLRKLNAQLTELTEQQAAYIG
FT                   VKKEGPYKADHYRY"
FT   CDS_pept        257858..258208
FT                   /transl_table=11
FT                   /gene="h16_A0245"
FT                   /locus_tag="H16_A0245"
FT                   /product="hypothetical membrane spanning protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91397"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF24"
FT                   /inference="protein motif:COGS:COG1950"
FT                   /protein_id="CAJ91397.1"
FT                   /translation="MRLLVVWIINAVALFVLPYIISSIHIQSFGSAMLAALVLGLVNTL
FT                   IRPILVILTLPVTLLTLGLFIFVINALLFLFVGNLLSGFTVGGFWAALLGSILYSVISW
FT                   LLASLLLGERTA"
FT   CDS_pept        258270..259100
FT                   /transl_table=11
FT                   /gene="h16_A0246"
FT                   /locus_tag="H16_A0246"
FT                   /product="5,10-Methylenetetrahydrofolate reductase"
FT                   /function="Amino acid transport and metabolism"
FT                   /note="deleted EC_number 1.7.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91398"
FT                   /db_xref="GOA:Q0KF23"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF23"
FT                   /inference="protein motif:CDD:cd00537"
FT                   /protein_id="CAJ91398.1"
FT                   /translation="MQDRYFSFEFFPPKTAEGTEKLRNTRAQLAPLKPKYISVTFGAGG
FT                   TTQQGTLDAVLEIQREGIEAAPHLSCVGSSRESIRAILQQYRDGGIRHIVALRGDMPSG
FT                   MGEIGEFRYANELVEFIRAETGDWFNIEVAAYPEYHPQAKSPRHDLENFVRKVKAGANS
FT                   AITQYFYNADAYFRFVDDVRATGLEVPIVPGIMPITNYTQLMRFSESCGAEVPRWVAKR
FT                   LESFGDDRESIRAFGLDVVTALCERLLAAGVPGLHFYTLNAAGATKAIWQRLKL"
FT   CDS_pept        259109..259468
FT                   /transl_table=11
FT                   /gene="h16_A0247"
FT                   /locus_tag="H16_A0247"
FT                   /product="regulator of competence-specific genes"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91399"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF22"
FT                   /inference="protein motif:COGS:COG3070"
FT                   /inference="protein motif:PFAM:PF04993"
FT                   /protein_id="CAJ91399.1"
FT                   /translation="MATRRPDPFIEHLLELMGPLAARIGPITAKRMFGGHGLFYDGLMF
FT                   ALVSRGTCYLKADDATRGKFEAEGSEPFRYQSAKREVTMRHYLSLPPAALESPGAMTPW
FT                   AKLAVEAALRLGNAG"
FT   CDS_pept        259566..260324
FT                   /transl_table=11
FT                   /gene="h16_A0248"
FT                   /locus_tag="H16_A0248"
FT                   /product="uncharacterized conserved protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91400"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF21"
FT                   /inference="protein motif:COGS:COG1656"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="CAJ91400.1"
FT                   /translation="MVTATFRFYEELNDFLAPDQRRRDLSCACARAATVKHMIEALGVP
FT                   HTEVELILVNGESSGFERQLCDGDRVSVYPKFERLDVSPLLRVREQPLRVMRFVADAHL
FT                   GGLAHLLRMTGFDTLYDNHFEDSEIERIAVDQGRVVLTRDRELLKRRGITHGCYVRAIK
FT                   SQLQVREIFARLDLARSARPFSLCLDCNAPLRSLDAAGAAGRVPQGVLERHRSFVTCDQ
FT                   CRRVFWEGSHWRCMRALVDELVRRDEAKQG"
FT   CDS_pept        complement(260321..260905)
FT                   /transl_table=11
FT                   /gene="h16_A0249"
FT                   /locus_tag="H16_A0249"
FT                   /product="5-Formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91401"
FT                   /db_xref="GOA:Q0KF20"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF20"
FT                   /inference="protein motif:PFAM:PF01812"
FT                   /protein_id="CAJ91401.1"
FT                   /translation="MSSTPATTAPTPAAEDRRALRTQLLAQRAALPARAEADARIAAAL
FT                   SGLLAGLAVRCLGFYWPIQQEFDARDAVGIWLAAMPGRSAALPSVSRPGAPLDFHLWTP
FT                   DTPMATGHYGIPVPDGTEAATPDALLIPCVGFSPDKFRLGYGGGFYDRTLAAMAQRPVA
FT                   IGIGYENCRAPLQAQPHDIAMDWIVTESGAF"
FT   CDS_pept        261011..262963
FT                   /transl_table=11
FT                   /gene="h16_A0250"
FT                   /locus_tag="H16_A0250"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="3.2.1.147"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91402"
FT                   /db_xref="GOA:Q0KF19"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF19"
FT                   /inference="protein motif:COGS:COG0741"
FT                   /protein_id="CAJ91402.1"
FT                   /translation="MLKGVYLQRAGRAAWIALACALLVTPVHAQKRPQAVSRPQAAVIP
FT                   SDPDEAFTALREAARKNDVERAYAISATLVDYPVPSYVEYFRIKPQLFDASGLARIDAP
FT                   DDQVRVFLQRYKGDAIADRMRNDWLLVLGKKRDWANFDVEYPQFALKDDTQVECYALLS
FT                   RALKGQNVAADARNVLSDPRYYGEGCVDLIGYLAQSQQIQRSDVAYQARLALEQNYVTL
FT                   AGKIAALVPDARADGDTLATIVKMARSDPSQAAAYLGTAQGALSRDEQGAAWGVIGQFA
FT                   ARKLLPDAAGYYRRQMDLGGNQWLSDDTQEWRVRAALRQGDWKQVRQAVELMRPELRAK
FT                   DPAWIYWYGRALKADGRDTEAQQNFQQIAGQFNFYGQLASEELGNRITLPARTTVSDAE
FT                   AMAMRSRPGFQRAQKFYNMNLRFEGNREWNWELRNMSDRELLAAAEYARRLELLDRTVN
FT                   SADRTRNEHDFTLRFLMPYRDIMQRATDDVGLDMAWVYGLIRQESRFIMNARSSAGAHG
FT                   LMQVMPATAKYVARKIGMNDFSPSMMGDPNINILLGTNYLNMVLTDLDSSWTLASAAYN
FT                   AGPGRPKAWRSTLVRPVEGAIFAETIPFNETRGYVKNVLSNATYYAALMSGRPQSLKSR
FT                   LGMVAPSAVTTTSLP"
FT   CDS_pept        263070..264092
FT                   /transl_table=11
FT                   /gene="h16_A0251"
FT                   /locus_tag="H16_A0251"
FT                   /product="predicted nucleoside-diphosphate-sugar epimerase"
FT                   /function="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /EC_number="5.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91403"
FT                   /db_xref="GOA:Q0KF18"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF18"
FT                   /inference="protein motif:COGS:COG0702"
FT                   /protein_id="CAJ91403.1"
FT                   /translation="MQTSNVLVIGGAGFIGSHLVSRLAGAASASGAPLEPGANPDSPIA
FT                   PDRIVVGTRNIEHAQHLLLLPRVEVVELGLADNAALDDAIGSLGVDGIVVNLVGVLHGE
FT                   RADPYGEAFASAHVEMVRQIAASCLSTGVRRLLHMSALGADSNGPSMYLRSKGDGERVV
FT                   RASGLDWTIFRPSVVFGPDDHFLNLFAHMQQMAPVVPLACAHARFQPVFVQDVVQAYLN
FT                   AMVNPATIGHGYELGGPRVYTLEELVRFAGRASGHPRPVIALPDALARVQATIMEHMPG
FT                   EPMLSRDNLDSMQLDNVLEHPVAPELNLHPVSLESVMTDALAGRNRDTAMTHMRASVHR
FT                   "
FT   CDS_pept        264278..264976
FT                   /transl_table=11
FT                   /gene="h16_A0252"
FT                   /locus_tag="H16_A0252"
FT                   /product="Glutathione S-transferase"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91404"
FT                   /db_xref="GOA:Q0KF17"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR034339"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF17"
FT                   /inference="protein motif:COGS:COG0625"
FT                   /protein_id="CAJ91404.1"
FT                   /translation="MKLVIGNKNYSSWSLRPWLLLRQAGIDFEEVQVRLFTGSFAAEIA
FT                   RYSPAGKVPALVDGEVTVWDSLAICEYLAERFPEKNLWPAERAQRAVARAVCAEMHSGF
FT                   GNLRSQLPMNVTAVLPGRGWNVAVQRDVERIAAIWEGLRQQHGANGPFLFGGFTVADAF
FT                   FAPVVSRFATYGIHLPDDAEDAKAYADFMLALPAMQQWIAGAREERDFLADDEPYRLAP
FT                   DRPDAIIINH"
FT   CDS_pept        265032..266267
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="H16_A0253"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="2.7.7.25"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91405"
FT                   /db_xref="GOA:Q0KF16"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF16"
FT                   /inference="protein motif:COGS:COG0617"
FT                   /inference="protein motif:PFAM:PF01743"
FT                   /protein_id="CAJ91405.1"
FT                   /translation="MQVYAVGGAIRDELLGKPSQDRDYVVVGATPAQMEAAGYKPVGKD
FT                   FPVFLHPRTKEEYALARTERKTAMGYKGFAFYCEPDVTLEDDLVRRDLTINAMARAVDA
FT                   DGNLTGPVIDPHGGQRDLAARLFRHVSDAFAEDPVRILRVARFAARFHEFGVAAETMRL
FT                   MREMVAAGEVDALVPERVWQELARGLMEAKPSRMFEVLRECGALARLLPELERLWGVPQ
FT                   RADYHPEIDTGVHVMMVIDQAAAMGAPLTVRFAALVHDLGKGTTPADVLPRHIGHESRS
FT                   AQLLEDVCVRLRVPNECRDLALVVAREHGNIHRSQEFSAAAVMRLLERCDALRKPARFA
FT                   EALQACEADLRGRKGFESSAYPQAARLLAALEAAAAVDAGAIARACGDDVGQIRDRVQA
FT                   ARVAAVAARIGG"
FT   CDS_pept        complement(266456..266893)
FT                   /transl_table=11
FT                   /gene="h16_A0254"
FT                   /locus_tag="H16_A0254"
FT                   /product="universal stress protein, UspA family"
FT                   /function="Signal transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91406"
FT                   /db_xref="GOA:Q0KF15"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF15"
FT                   /inference="protein motif:COGS:COG0589"
FT                   /protein_id="CAJ91406.1"
FT                   /translation="MFKHLLVAVDGSDLSDTAYRKAIALASSIQARLTAIQVVAHYDVM
FT                   RLQTAMLQETRQRFMQEAYRQAEAYLATIVQEAAAAGVPCEIACPTVDHIFQAIVDEAE
FT                   ARKCDLIVMASHGRRGMQALVIGSETQKVLTHTKIPVLVYR"
FT   CDS_pept        complement(266935..267222)
FT                   /transl_table=11
FT                   /gene="h16_A0255"
FT                   /locus_tag="H16_A0255"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91407"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF14"
FT                   /protein_id="CAJ91407.1"
FT                   /translation="MCGSQWDRTLSYKVRWFGTADQYAQRFEKEYRYEAPYQAAGSTAA
FT                   VLAFADAFERAGSFDTEKVGYVLVAGQLAMAGTGSELGRDPEVGRLFLGA"
FT   CDS_pept        complement(267277..267471)
FT                   /transl_table=11
FT                   /gene="h16_A0256"
FT                   /locus_tag="H16_A0256"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91408"
FT                   /db_xref="GOA:Q0KF13"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF13"
FT                   /protein_id="CAJ91408.1"
FT                   /translation="MLRWTLTIFLSVIILSAALPWLQRIGLGRLPGDVRFRVFGREFVL
FT                   PFASTILISLMALAIGKLL"
FT   CDS_pept        complement(267488..268687)
FT                   /transl_table=11
FT                   /gene="h16_A0257"
FT                   /locus_tag="H16_A0257"
FT                   /product="uncharacterized conserved protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91409"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF12"
FT                   /inference="protein motif:COGS:COG1565"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="CAJ91409.1"
FT                   /translation="MQKAASLPLPPADAQAASDTLTARIGESIDAAGGWIGFDRYMALA
FT                   LYAPGLGYYSGGSAKFGRDARDGSDFITAPELSPFFARTLARQFAPLMAQGLPRMLEFG
FT                   AGTGRLAADLLLGLEQEGQLPDTYAIVELSGELRARQQATLAQRAPHLADRVTWLDTLP
FT                   ASFEGVIVGNEVLDAMPVQLYARSGGRWHERGVVHSVARSDDAAPAFRFEDRPLADADM
FT                   PEALRAIPGDHDLVTETHAEAEGFIRAVGAMLARGAAFFIDYGFPAGEYYHPQRAGGTL
FT                   MCHYRHHAHPDPFLYPGLQDITAHVNFSGIALAAVDAGLTVAGFASQARFLMNAGITEL
FT                   LMALDPSDARAFLPQANAVQKLLSEAEMGELFKVIALTRGLDDSEPMDGFTRGDRCHTL
FT                   "
FT   CDS_pept        268703..269557
FT                   /transl_table=11
FT                   /gene="h16_A0258"
FT                   /locus_tag="H16_A0258"
FT                   /product="short chain dehydrogenase"
FT                   /function="General function prediction only"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91410"
FT                   /db_xref="GOA:Q0KF11"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF11"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /inference="protein motif:COGS:COG1028"
FT                   /protein_id="CAJ91410.1"
FT                   /translation="MPASKTPASQTADQTHSQTGSQRATARGVALVTGGARRLGRAIAL
FT                   ELAAQGWDVAVHCHRSVDEAEALATQIRALGRRAAVLRADLADEAATGRLVADCTAVLG
FT                   VPACLVNNASLFQYDVATSFSYASLDTHMRTNVAAPLLLARELHKALGAAAGKDKAAEP
FT                   RGVVINLLDQKLDNLNPDFLSYTLSKAALQTATVQLAQALAPRLRVVGVAPGITLVSGE
FT                   QSEQSFRRAHRVTPLGQSSTPEDIAQAVAYLAQARAVTGTTLYVDGGQHLMPLARDVMF
FT                   LTE"
FT   CDS_pept        269644..270045
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="H16_A0259"
FT                   /product="dihydroneopterin aldolase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91411"
FT                   /db_xref="GOA:Q0KF10"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF10"
FT                   /inference="protein motif:COGS:COG1539"
FT                   /inference="protein motif:CDD:cd00534"
FT                   /protein_id="CAJ91411.1"
FT                   /translation="MTMLAALSHPSLQDCRRMFLRNYEVQINIGVHEFEKKGEQRVLIN
FT                   IDLFVPLAQSTPQADKLDEVVDYDFMRNTVAERMAQGHVHLQETLCDDVARAMLKHPKV
FT                   RAVRVSTEKPDVYPDCDSVGVEVFHIKQA"
FT   CDS_pept        270155..271099
FT                   /transl_table=11
FT                   /gene="h16_A0260"
FT                   /locus_tag="H16_A0260"
FT                   /product="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /function="Cell division and chromosome partitioning"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91412"
FT                   /db_xref="GOA:Q0KF09"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF09"
FT                   /inference="protein motif:COGS:COG0037"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="CAJ91412.1"
FT                   /translation="MSHSNNFYRLETRLQSQTGKAIGDFGMIEDGDTVLVCMSGGKDSY
FT                   TMLSVLMALQKRAPIKFKLIAMNLDQKQPGFPEHILPEYLKSVGVEYVIVEADTYSIVK
FT                   EKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVQTFFLNMFFGGKMKAM
FT                   PPKLSTDDGQHIVIRPLAYCSEKDIASYARAMEFPIIPCNLCGSQENLQRKKVSEMLQD
FT                   WERQNPGRIDNIFSALRNVVPSHLADTDLFPFTGLATGLAKVDEASLFGETTFQQQPLM
FT                   FAGNVEENRMEFVRFERPPAAAAAPAAEQAGTQ"
FT   CDS_pept        complement(271164..271991)
FT                   /transl_table=11
FT                   /gene="h16_A0261"
FT                   /locus_tag="H16_A0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91413"
FT                   /db_xref="InterPro:IPR016875"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF08"
FT                   /protein_id="CAJ91413.1"
FT                   /translation="MKLGYQQGDHLAYWWIDNYVDVSTAQEPLTREAIARFFAWHRKAQ
FT                   LPEIATLLQQAKADVRQPVTPATVEHFQDASQQLARKSFEQAMPDLADLLLTLTPEQIG
FT                   RMEKKFAEGNAKYRKKFLNPDPAEREEARYDKVMDYARLVYGNFSSDQEKAIRARMGPV
FT                   VQNAEARYAERVARQQEWLRMVRYVQATQPPKAQVIDVLRRFREYWQNPPAKHAASHEA
FT                   SINAGIALTVAIANMTTPQQKAHAQDRFQKWIDDTHALIREKANAPVQSAATN"
FT   CDS_pept        272282..273646
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="H16_A0262"
FT                   /product="UDP-N-acetylglucosamine
FT                   pyrophosphorylase/Glucosamine-1-phosphate
FT                   acetyltransferase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91414"
FT                   /db_xref="GOA:Q0KF07"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KF07"
FT                   /inference="protein motif:COGS:COG1207"
FT                   /protein_id="CAJ91414.1"
FT                   /translation="MNIVILAAGMGKRMYSDLPKVLHPVAGRPMLAHVLDTARALSPSR
FT                   LVVVVGHGAARVREAVAADDVAFAEQPQQLGTGHAVMQALPLLDDSQPTLVLYGDVPLT
FT                   SAATLQALVAEAGTQRLGVLTVEMPDPTGYGRIVRDAAGSIVRIVEQKDASEAEKAIRE
FT                   INTGIIVCPTGHLRKWLSTLRNDNAQGEYYLTDTVERAVADGVETVSAQPAAIWETLGV
FT                   NSKLQLAEVERIHQGNQARRLLEAGVTLLDPARIDVRGELSCGRDVTIDVGCVFEGRVH
FT                   LEDGVRIGAHCVIRNSTVGAGAQVHPFCHIDEARVGPAGRIGPYARLRPGTELGEDVHI
FT                   GNFVEVKNAQVAAHSKANHLAYVGDATVGSRVNIGAGTITCNYDGVNKHRTVIEDDVFI
FT                   GSDTQLVAPVTVRRGATLGAGTTLTKEAPADKLTLSRAKQLTIDAWQRPVKQPKK"
FT   CDS_pept        273764..275602
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="H16_A0263"
FT                   /product="Glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91415"
FT                   /db_xref="GOA:Q0KF06"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF06"
FT                   /inference="protein motif:COGS:COG0449"
FT                   /inference="protein motif:CDD:cd00714"
FT                   /inference="protein motif:COGS:COG2222"
FT                   /protein_id="CAJ91415.1"
FT                   /translation="MCGIVGAVSTRNIVPVLIEGLRRLEYRGYDSCGVAVVRDDAVERA
FT                   RTVSRVADLEAQTQASGLSGFTGVAHTRWATHGKPDTVNAHPHLSGETIALVHNGIIEN
FT                   YEPLREELRAVGYGFESQTDTEVVAHLIHQAYTYPSSATRGDLFASVRAVTKRLHGAYA
FT                   IAVFAKDQPGRVVGARAGSPLVVALGENEAFLASDALAVAGTANRIIYLEEGDVVELTL
FT                   DGVTIHDVDDHPVEREARVVEAHAASVELGPYRHFMQKEIFEQPRALGDTLEGIESISP
FT                   ELFGSGAAEVFAGIDSVLILACGTSYYSGCTAKYWLESIARIPTQVEVASEYRYRETVP
FT                   NPRALVVVISQSGETADTMAALRHARALGHVHTLAVCNVATSAMVRETELRFLTRAGTE
FT                   IGVASTKAFTTQLAALYMLTLALAKVRGLLTEDAEAKALTNLRHLPAALHGVLALEPQI
FT                   IAWSEDFARRENALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVTEA
FT                   MPVVTVAPNDALLEKLKSNIQEVRARGGRLYVFADSDTQIQSSDGIQVIRLPEHYGDLS
FT                   PILHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE"
FT   CDS_pept        complement(275679..276236)
FT                   /transl_table=11
FT                   /gene="h16_A0264"
FT                   /locus_tag="H16_A0264"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91416"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF05"
FT                   /inference="protein motif:COGS:COG3851"
FT                   /protein_id="CAJ91416.1"
FT                   /translation="MARALGIQPAATAGCTASTRDGRCAASRRRERSGLSTYRPASDDT
FT                   DASMARIAPRYSRGLRTTLLLLEAGRRLLRAHAGTGLDPGNLRAAGVTTGAFYSRFEGK
FT                   DSYFRALQALVLATLRKGMAEPLAQLHPAGASPELELRIRFAHQALAGTLLYALINRDS
FT                   TFALSDRRLDMEMARAFLLYVA"
FT   CDS_pept        complement(276246..277187)
FT                   /transl_table=11
FT                   /gene="h16_A0265"
FT                   /locus_tag="H16_A0265"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91417"
FT                   /db_xref="GOA:Q0KF04"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF04"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91417.1"
FT                   /translation="MGLRQLHHFVTLVEQGSFARAAGALHLSQPALTRSIQALEADLGP
FT                   LIDRSYGKVRPTAAGMLALERARRMLREQRELRRDLQLLEEVEIGTIRAGFGPFAASFL
FT                   LDPVLETLVRRYPHLRIDLETADTPAMRRSLEAERLDVFVGESRSLAELGHLQIDRLPA
FT                   LETAFFVRSGHPLARQREVTLAELRAYPVAGTRLPAHILRFFRQALHQASGGSGPVSED
FT                   APGLMTVTCNDMHALRSLLLAVDAVALVPVAMMAEACAQGLAVALPMHPPTELRAQYGI
FT                   VSLAGRSPSPAMRVFAALVHEAVAQAGGGAAL"
FT   CDS_pept        277294..278286
FT                   /transl_table=11
FT                   /gene="h16_A0266"
FT                   /locus_tag="H16_A0266"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91418"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF03"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /protein_id="CAJ91418.1"
FT                   /translation="MNRRASLALAAGGLIGGLSLSLALPAAAQTYPAKPIRIVVPYVAG
FT                   GGTDTIARAMGEKLSKRLGQPVVVDNKAGASGIIGTDAVAKAAPDGYTLLMTLTQSVLT
FT                   NQFLYQKLPYDPRKDLTMISVLADAQLVLVAHPSVPARTVRELGDYARSRPGKLSYASW
FT                   GVGSLSHLSGAYYSKLVHGQAAHVPYKGEAPMMQDLLGGQVQFGFASILTAKPYIQSGK
FT                   LKALAVTGTQRSSALPDMPTFAESGMQDSAFKTVGWIGLVAPVGVPAPILARLEGEVRA
FT                   ILQAPDMQERLVALGLRTVGSSPAEAQALYARDWPVLKTLVADSGAKLD"
FT   sig_peptide     277294..277380
FT                   /gene="h16_A0266"
FT                   /locus_tag="H16_A0266"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        278581..279057
FT                   /transl_table=11
FT                   /gene="bfr1"
FT                   /locus_tag="H16_A0267"
FT                   /product="Bacterioferritin (cytochrome b1)"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91419"
FT                   /db_xref="GOA:Q0KF02"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF02"
FT                   /inference="protein motif:CDD:cd00907"
FT                   /inference="protein motif:COGS:COG2193"
FT                   /protein_id="CAJ91419.1"
FT                   /translation="MKSDKKVIQLLNGQLRHELTAINQYFLHARMYRHWGLGALGKHEY
FT                   EESIEEMKHADKLIERILLLDGLPNLQDLDKLLLGENTEEMLGCDLKLEQVSQASCKEA
FT                   IKFFESVGDYVSREIVVDILADTEEHIDWLEAQLELVNKVGLQNYIQSAMGGIG"
FT   tRNA            279140..279212
FT                   /gene="tRNA-Cys (GCA)"
FT                   /locus_tag="H16_A0268"
FT                   /product="transfer RNA-Cys (GCA)"
FT                   /note="tRNA-C1 gene"
FT   CDS_pept        279533..279976
FT                   /transl_table=11
FT                   /gene="h16_A0269"
FT                   /locus_tag="H16_A0269"
FT                   /product="N-Acetylglutamate synthase or related
FT                   acetyltransferase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91420"
FT                   /db_xref="GOA:Q0KF01"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF01"
FT                   /inference="protein motif:COGS:COG1246"
FT                   /protein_id="CAJ91420.1"
FT                   /translation="MIKDLRIRAAMPSDAPAVGSVLERCGLPVDDVARLLEHFHVAILG
FT                   SQIIACAAGERFGETVVIRSVAVLPEHRDQGVATHVVRAALMRARANGARRAVLLASSC
FT                   PSYFSRYGFTLVPAAKLPAEVMSSSEFHRHTDTPPLCMWCELD"
FT   CDS_pept        complement(280001..280990)
FT                   /transl_table=11
FT                   /gene="czcD1"
FT                   /locus_tag="H16_A0270"
FT                   /product="Co/Zn/Cd efflux system component"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /note="5 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91421"
FT                   /db_xref="GOA:Q0KF00"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KF00"
FT                   /inference="protein motif:COGS:COG1230"
FT                   /inference="protein motif:PFAM:PF01545"
FT                   /inference="protein motif:COGS:COG0053"
FT                   /protein_id="CAJ91421.1"
FT                   /translation="MHSHDLSAWTHSHAFDAGNRAAERGTRLVMAITAATMVVEIAAGL
FT                   WFNSMALLADGWHMSSHALAIGLSAFAYAAARRYAGDRRFAFGTWKIEVLAGFASAVFL
FT                   LGIAALMAAGSVERLLSPQDIHYREAMAVTALGLLVNLGCALILGGHAHGHDHGHDHGH
FT                   HHHGHDHDHGHSHHHDINLRAAYMHVLADAATSVLALVALAGGWWLGWAWLDPVMGLVG
FT                   AALVGRWAVCLLRQSGAVLLDREMDHPVVEEVREVLAGLDPADANGEERTSVTDLHVWR
FT                   VGRQQFACIACLVTHDPALTPQRVREALSVHEELVHVTVEISRCEGAH"
FT   CDS_pept        complement(281368..282828)
FT                   /transl_table=11
FT                   /gene="h16_A0271"
FT                   /locus_tag="H16_A0271"
FT                   /product="transcriptional regulator, MocR family"
FT                   /function="Transcription / Amino acid transport and
FT                   metabolism"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91422"
FT                   /db_xref="GOA:Q0KEZ9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEZ9"
FT                   /inference="protein motif:COGS:COG1167"
FT                   /inference="protein motif:COGS:COG0436"
FT                   /protein_id="CAJ91422.1"
FT                   /translation="MLTLNLTRTRRDGDTLTEQIVAGIAALVEQRALRAGTALPSVRRF
FT                   AQHHHVSTFTVAEAYGRLTALGYLAARPGSGYTVAHRHAPAGHARAPQWEAPGLNAAWL
FT                   LSDVFADHSVPIKAGAGWLPGDWLNEEGLHQAMRASARVPAAQLSGYGHPYGFAPLREH
FT                   IAAGLGQYGIPLQAQQVVLTQGATQALDLVVRTLLRAGDRVLVESPCYCNLLQILRLAG
FT                   LRVVGVPRSAAGLDTDALDDAIRAHAPRALFINTVLQNPTGASLSSMNAFRVLQLAEQH
FT                   RLLVVEDDIYRELAPAGSPMLAAMDGLSQVVYINGFSKTITPSLRVGYLAASPDLAKAF
FT                   ARTKMAVGLTSSEVTERLVYSVLTSGHYGRHVAALAERLRAQQDRVTEKMEAHGLEVLL
FT                   RPEGGMFAWARLTEAAQARLQASRRGGPLHGNRLATLALEYGIWLAPGSYFEPDETDSP
FT                   WIRFNVATGDAPQLWQFFDRLAQAPRAA"
FT   CDS_pept        283157..284488
FT                   /transl_table=11
FT                   /gene="aptA"
FT                   /locus_tag="H16_A0272"
FT                   /product="Omega-amino acid-pyruvate aminotransferase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="2.6.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91423"
FT                   /db_xref="GOA:Q0KEZ8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEZ8"
FT                   /inference="protein motif:COGS:COG0161"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /inference="protein motif:COGS:COG0160"
FT                   /protein_id="CAJ91423.1"
FT                   /translation="MDAAKTVIPDLDALWMPFTANRQYKAAPRLLASASGMYYTTHDGR
FT                   QILDGCAGLWCVAAGHCRTEIAEAVARQAATLDYAPPFQMGHPLSFEAATKVAAIMPQG
FT                   LDRIFFTNSGSESVDTALKIALAYHRARGEGQRTRFIGRERGYHGVGFGGMAVGGIGPN
FT                   RKAFSANLMPGTDHLPATLNIAEAAFSKGQPQWGAHLADELERILALHDPSNVAAVIVE
FT                   PLAGSAGVLVPPVGYLEKLREITSKHGILLIFDEVITAFGRLGAATAAERFKVTPDLIT
FT                   MAKAINNAAVPMGAVAVRREVHDTVVNSAAPGAIELLHGYTYSGHPLAAAAAIATLDLY
FT                   QRENLFGRAAELAPVFEAAVHGVRGAPHVKDIRNYGLVAGIELEPRPGQPGARAYEAFL
FT                   KCLELGVLVRYTGDILAFSPPLIISEAQIGELFDTVKKALQDIK"
FT   CDS_pept        284597..286114
FT                   /transl_table=11
FT                   /gene="mmsA1"
FT                   /locus_tag="H16_A0273"
FT                   /product="Methylmalonate-semialdehyde dehydrogenase"
FT                   /function="Energy production and conversion"
FT                   /EC_number="1.2.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91424"
FT                   /db_xref="GOA:Q0KEZ7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEZ7"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /inference="protein motif:COGS:COG1012"
FT                   /protein_id="CAJ91424.1"
FT                   /translation="MSIAENRQLAEIHHFIGGAVRRAGGQRLADVFNPATGEVAARVAL
FT                   GTTQDVADAVAAAHAAFPAWADTPPLRRARILFKFKELLDQHHDDLAALITREHGKVFS
FT                   DARGEVTRGIEVVEFACGIPNLLKTDFTDNIGGGIDNWNLRQPLGVVAGITPFNFPVMV
FT                   PMWMFPVALACGNTFVLKPSERDPSPSLLIADLLRQAGLPDGVFNVVQGDKEAVDALLA
FT                   HPDVQALSFVGSTPIAEYIYTEGTKHGKRVQALGGAKNHLVVMPDADLDQAVDALIGAA
FT                   YGSAGERCMAISVAVAVGDVADKLVPRLAERASSLKIRNGMESDAEMGPLVTAAHKAKV
FT                   EGYIAKGVEEGAMLVTDGRGHTVPGHENGFYVGGTLFDHVKPDMTIYKEEIFGPVLSVV
FT                   RVHDFAEAVALINAHEYGNGVSCYTSDGGIARAFARQIQVGMVGINVPIPVPMAWHSFG
FT                   GWKRSLFGDHHAYGEEGVRFYTRYKSVMQRWPDSIAKGAEFTMPVAK"
FT   CDS_pept        286128..286478
FT                   /transl_table=11
FT                   /gene="h16_A0274"
FT                   /locus_tag="H16_A0274"
FT                   /product="lactoylglutathione lyase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91425"
FT                   /db_xref="GOA:Q0KEZ6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEZ6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="CAJ91425.1"
FT                   /translation="MKVNRIVANIAVADPASARAFYQDILGLDVLMDHGWIRTYGSTST
FT                   MTVQLSFATEGGNGTPVPDLSIEVDDVDEAHCRMLAGGFAIEYGPADEPWGVRRFYVRD
FT                   PLGRLVNILMHT"
FT   CDS_pept        complement(286485..287462)
FT                   /transl_table=11
FT                   /gene="h16_A0275"
FT                   /locus_tag="H16_A0275"
FT                   /product="transcriptional regulator, AraC-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91426"
FT                   /db_xref="GOA:Q0KEZ5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEZ5"
FT                   /inference="protein motif:COGS:COG4977"
FT                   /inference="protein motif:SMART:smart00342"
FT                   /protein_id="CAJ91426.1"
FT                   /translation="MTTAYLLVLPNVHMLDLGGPLQILASVSELGIGPLKVRCVGPHSS
FT                   VPSFQGPALSQVERLPARLASGDVVLAIGSKLLDTLTRSPAWHDSVNWLKRSFADGRNA
FT                   DVQVAAVCTGAFLLGAAGLLDGRLCTTHHAHTRRLRTRHPAASVIENRVFVRDGNVWTS
FT                   AGVASGIDLALRLVADAYGDEAAIAVARDNVVPFRRFGGDPQLAPQLRARSHGNPLVHA
FT                   VQDAISRELDTNVADPRFADRFAISVRHLSRVFHEETGLTPKQYQLTLRMARARKLLAS
FT                   SSLPVEEIALKSGFASVQAFRACWNKAEPATPKAYRQARAGSAE"
FT   CDS_pept        287629..288879
FT                   /transl_table=11
FT                   /gene="h16_A0276"
FT                   /locus_tag="H16_A0276"
FT                   /product="Transporter, MFS superfamily"
FT                   /function="General function prediction only"
FT                   /note="12 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91427"
FT                   /db_xref="GOA:Q0KEZ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEZ4"
FT                   /inference="protein motif:TCDB:2.A.1"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /inference="protein motif:COGS:COG2814"
FT                   /protein_id="CAJ91427.1"
FT                   /translation="MPRTRIPAITLALVAIGFAAMFVSTAVKGLYQVYFVDLATHFGQG
FT                   RAQFAWSGSVFMLATGLMSPVVGALSDRVGPLRTAAAGALAAGIALGGAALWPGSLTFF
FT                   VLMFGLAGAFGLAAMTFVPMGILVDRLFEERKKGLAYAVVTNGTAIGFIVLSPLWIWLQ
FT                   PQAGWITAFGVAGAVFALPVAGALWLTSRWEPASAPAPCTAGADVPAWTVVRRDPVFYA
FT                   LAAGFFGCGATMAFIDVHLIAYWQGQGVPRLAMGYAMSTLGALELASGLVSGALALRWD
FT                   KHRLLAAFYALRSASMLLLLVPGLGVLPFAVGFGASYLGTVILTSMFCFERYGSRIKGK
FT                   VFGLLFLGHQLGAFLTVQLGAWSFDATRSYQHSITALVAVTLCSAACSWLGLRRAGPLP
FT                   ALAKGPAHAAVPEAASR"
FT   CDS_pept        289267..290664
FT                   /transl_table=11
FT                   /gene="h16_A0277"
FT                   /locus_tag="H16_A0277"
FT                   /product="APC transporter, CAT family"
FT                   /function="Amino acid transport and metabolism"
FT                   /note="13 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91428"
FT                   /db_xref="GOA:Q0KEZ3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEZ3"
FT                   /inference="protein motif:TCDB:2.A.3.3"
FT                   /inference="protein motif:COGS:COG0531"
FT                   /protein_id="CAJ91428.1"
FT                   /translation="MSLFRTKDIDAMLAVARDDGLKKVLGPTDLVMMGIGAIIGTGIFV
FT                   LTGTGALTAGPALTVSFVIAALACGFAALCYAEFASAIPVSGSIYTYSYATLGEIVAWM
FT                   IGWDLLLEYGLATSAVSVGWSGYFQSLMAGFGLKLPAALTAAPGSVPGVKSMLNLPACL
FT                   IMLAITWVVSYGVRESTRINNLMVAVKIGVVLLFIAVGVWHVQPANWQPFAPFGFAGIF
FT                   NAAALVFFAFIGFDAVTSAAEEVRNPRRDLPIGIIGSLAVCTVLYVVVAAIMTGIVPFA
FT                   KFAGVDHPVSLALQFAGQNWVAGFVDLGAILGMTTVILVMTYGQTRVIFAMSRDGLLPE
FT                   RLSSVHPVHATPYFATWIVGIVFAAIAAFVPLNVLAELINIGTLAAFTLISVAVLVLRK
FT                   TRPELPRAFRCPGVPVVPLLSIGFCLFLMAHLQALTWIAFLVWLSVGLVIYFGYARRNA
FT                   VLHNHGG"
FT   CDS_pept        complement(290671..292077)
FT                   /transl_table=11
FT                   /gene="h16_A0278"
FT                   /locus_tag="H16_A0278"
FT                   /product="transcriptional regulator, MocR family"
FT                   /function="Transcription / Amino acid transport and
FT                   metabolism"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91429"
FT                   /db_xref="GOA:Q0KEZ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEZ2"
FT                   /inference="protein motif:COGS:COG1167"
FT                   /inference="protein motif:COGS:COG0436"
FT                   /protein_id="CAJ91429.1"
FT                   /translation="MKLILDASTGIPLTEQIVAGVKAWIGNREARPGARLPSIRQLAAE
FT                   NGISRFPVIEAYDRLVSQGLLDSRQGSGFYVADSPLAGRSACGWSDPSLAEDLSDHILE
FT                   QFNHPSGTLKLAGGFVPETWRDVEGLTQAIRAISRNEIDSVIHYATPMGHPELRRQVLL
FT                   RVRQLGIAAELPQVLITTGASQALDLVVRHLLKPGDTVFVEDPGYYNLFGLLRLHGVQL
FT                   VGVPHTANGPDPDATEALLRQHKPKLFFTNSVLQNPTGSTLAPPVAFRLLELARRHGFR
FT                   FVEDDIFSDFQTHFTDRLATLDQLEHVIYIGGFSKTVSASLRVGYLVADKALVKDLVDV
FT                   KVLTSVAGSHFAEAVTAALLERGGYRKYVERLRLRVREACANAVRQLTGNGWEVFCQPS
FT                   GGNFLWARPPGIEDSRELVTLGEEYGVTLAPGNYFRPGGETSAWIRINAAYANEPRAVA
FT                   FMKAAAGRGG"
FT   CDS_pept        292206..292640
FT                   /transl_table=11
FT                   /gene="h16_A0279"
FT                   /locus_tag="H16_A0279"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91430"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEZ1"
FT                   /protein_id="CAJ91430.1"
FT                   /translation="MEAWRRKAPATVIIRHPRGPAPDATAGYEEWDMRELRTFELDEPG
FT                   LPVSWRAGYGQTVCAVAGKLWVTVEGSPNDIWLEPGTELALPEGYRVWLSGDGAGARFT
FT                   LAQVPAPWSLRRLVAWLRAMRHRVEEHSTDAFGECPRIWA"
FT   CDS_pept        292924..296214
FT                   /transl_table=11
FT                   /gene="sbm1"
FT                   /locus_tag="H16_A0280"
FT                   /product="Methylmalonyl-CoA mutase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91431"
FT                   /db_xref="GOA:Q0KEZ0"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEZ0"
FT                   /inference="protein motif:PFAM:PF01642"
FT                   /inference="protein motif:COGS:COG1703"
FT                   /inference="protein motif:CDD:cd02071"
FT                   /inference="protein motif:COGS:COG2185"
FT                   /protein_id="CAJ91431.1"
FT                   /translation="MTDLSDVHDVRRGAPQPKPTAQGRGPVNKVRFVTAASLFDGHDAS
FT                   INIMRRILQSHGCEVVHLGHNRSVEEVVTAALQEDAQGIAISSYQGGHVEYFKYMVDLL
FT                   REKGGEHVQVFGGGGGVIVPDEIRELQAYGVARIFSPEDGQRMGLAGMIADMVQRCDID
FT                   LSRYAPASLEPVTGGDRRALAQLITALENGKADPALVQAMHAQAAAASIPVLGITGTGG
FT                   AGKSSLTDELIRRFRLDQQDALSIAVISIDPSRRKSGGALLGDRIRMNAINHPNIFMRS
FT                   LATREAGSEISQALPDVIAACKVAGFDLVIVETSGIGQGDAAIVPHVDLSLYVMTPEFG
FT                   AASQLEKIDMLDFADFVAINKFDRKGAQDAWRDVAKQVQRNREQWHGKAEDMPVYGTQA
FT                   SRFNDDGVTMLYQGLRAALAERGLKLQPGVLPAQAGRISTGQNVIVPPARSRYLAELAD
FT                   TVRGYHRRVMEQSRIARERQQLRESSRMVQAAQGDGAALDALAAERDSALGQVERKLLA
FT                   MWPQMREAYSGDEYVVKIRDREIRTGLVTTTLSGTKVRKVVLPRFEDDGEVLKWLMREN
FT                   VPGSFPYTAGVFAFKRENEDPTRMFAGEGDAFRTNRRFKLVSEGMDAKRLSTAFDSVTL
FT                   YGEDPHVRPDIYGKVGNSGVSIATLDDMKVLYDGFDLTSPSTSVSMTINGPAPTILAMF
FT                   MNTAIDQQLDKFRADNQREPTADEEAKIRAWVLQNVRGTVQADILKEDQGQNTCIFSTE
FT                   FSLKVMGDIQEYFVHHQVRNFYSVSISGYHIAEAGANPISQLAFTLSNGFTYVEAYLAR
FT                   GMHIDDFAPNLSFFFSNGMDPEYSVLGRVARRIWAVTMRDKYGANERSQKLKYHIQTSG
FT                   RSLHAQEIDFNDIRTTLQALIAIYDNCNSLHTNAYDEAITTPTGESVRRALAIQLIINR
FT                   EWGVARCENPNQGSFLIEELTDLVEEAVLQEFERIAERGGVLGAMETGYQRGKIQEESL
FT                   YYEQLKHDGTLPIIGVNTFRNPDGDPTPQKLELARSSEAEKQSQLDRLHAFQQAHAAEA
FT                   PAMLAQLRQAVIDNQNVFAVLMDAVRVCSLGQITHALFEVGGQYRRNM"
FT   CDS_pept        296357..296794
FT                   /transl_table=11
FT                   /gene="h16_A0281"
FT                   /locus_tag="H16_A0281"
FT                   /product="diadenosine tetraphosphate (Ap4A) hydrolase"
FT                   /function="Nucleotide transport and metabolism /
FT                   Carbohydrate transport and metabolism / General function
FT                   predi"
FT                   /EC_number="3.6.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91432"
FT                   /db_xref="GOA:Q0KEY9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEY9"
FT                   /inference="protein motif:CDD:cd01277"
FT                   /inference="protein motif:COGS:COG0537"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="CAJ91432.1"
FT                   /translation="MDTQYNPTNIFAKILRGELPCIKVYEDDDTIAFMDIMPQADGHTL
FT                   VVPKEAAVNLFDLSEQGAQAAIVATQRVARAVRAAFAPDGISIGQFNGAAAGQTVPHVH
FT                   FHIVPRYADSALRGHAREMQDPEQLKGHAQRIIAALREQGA"
FT   CDS_pept        296846..297700
FT                   /transl_table=11
FT                   /gene="paaH1"
FT                   /locus_tag="H16_A0282"
FT                   /product="3-Hydroxyacyl-CoA dehydrogenase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91433"
FT                   /db_xref="GOA:Q0KEY8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4PZC"
FT                   /db_xref="PDB:4PZD"
FT                   /db_xref="PDB:4PZE"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEY8"
FT                   /inference="protein motif:COGS:COG1250"
FT                   /protein_id="CAJ91433.1"
FT                   /translation="MSIRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVAT
FT                   VASSLDRLIKKEKLTEADKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQI
FT                   DGIVGENVIIASNTSSISITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTT
FT                   HAAVEALSKQLGKYPITVKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGC
FT                   NHPIGPLALADMIGLDTMLAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYV
FT                   YSK"
FT   CDS_pept        complement(298276..298698)
FT                   /transl_table=11
FT                   /gene="h16_A0283"
FT                   /locus_tag="H16_A0283"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91434"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEY7"
FT                   /protein_id="CAJ91434.1"
FT                   /translation="MASAIDDATLQAYRETHYRVLGDLPMVLRVDQPSAPLAALHRALG
FT                   VAASAFITAANPFSLRCDDDTNAKRQQALAQDLARMGLRAIEAAGEHPRNGWPAEPSFL
FT                   VPGLSLADARALGEKYEQNAVVWSGADAVPRLVLLR"
FT   CDS_pept        complement(298700..299368)
FT                   /transl_table=11
FT                   /gene="crp1"
FT                   /locus_tag="H16_A0284"
FT                   /product="transcriptional regulator, CRP-family"
FT                   /function="Signal transduction mechanisms / Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91435"
FT                   /db_xref="GOA:Q0KEY6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEY6"
FT                   /inference="protein motif:COGS:COG0664"
FT                   /protein_id="CAJ91435.1"
FT                   /translation="MLNDFVDRCVWAADLSPEQRERVRRAMFVHEYTQGDYVCHKGDMA
FT                   EHWMGVLEGIVKITTVSPSGKSVTFTGVPTGGWFGEGAVLKSEIRKYDVMALRRSTIAF
FT                   LPRDTFLWLLDTSLPFTRFLLTQFNERLGQFIAAVEYERLLDIDSRVARAVSSLFNEHL
FT                   YPGIGKTLEISQEEIGLLAGISRQRANQALKVLEQQGLVRVDYGVIEVLDLEGLRQYGE
FT                   "
FT   CDS_pept        299606..301564
FT                   /transl_table=11
FT                   /gene="h16_A0285"
FT                   /locus_tag="H16_A0285"
FT                   /product="Long-chain acyl-CoA synthetase (AMP-forming)"
FT                   /function="Lipid metabolism"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91436"
FT                   /db_xref="GOA:Q0KEY5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEY5"
FT                   /inference="protein motif:COGS:COG1022"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="CAJ91436.1"
FT                   /translation="MQESSATTFPRWLLAHAQQRPDHPAHREKDLGIWQTYSWAQAAQQ
FT                   VRALACGLAALGFRRGMNLAVVGDNRPRLYWAMTAAQALGGVPVPLYQDAIANEMVYVL
FT                   NDAEIEFAIVEDQEQVDKLLEVEAQLAESGRAVRHVIFEDPRGLMDYDHPSLMSYEQLQ
FT                   ELGREFDQAHPGFYDEAIAAGQPDDTAIILYTSGTTGKPKGVCHSHYGLIGAARNGCAF
FT                   DKLSADDDVLSYLPMAWVGDNLFSYAQAMVAGFTVNCPESRETVMTDLREIGPTYYFAP
FT                   PRIYEGLLTQVMIRMEDAGWIKRKLFHWAMDVAKRCGTDILDGKPVSLADRARYALGEA
FT                   LVYGPLRNVLGMSRIRVGYTAGEAIGPDLFRFYRSIGVNLKQFYGQTETCAYVCLQPDG
FT                   KVKFDSVGPAAPGMEIRIADNGEVLVRGVGLLKSYYKRDDATREAINDEGYFMTGDAGV
FT                   IDADGHLKIIDRAKDVGKLADGSMFAPKYIENKLKFFPYIKEAVAFGNDRDQVCAFINI
FT                   DFEAVGNWAERRHLPYAGYVDLAAQPEVLEMIGECVNQVNADLANDPMLAGSQVARFLV
FT                   LHKELDPDDDELTRTRKVRRGFIADKYGVLVEALYAGKSEQFIETRVKFEDGREGSVSA
FT                   TLKLVNAKRLPVAARAA"
FT   CDS_pept        301561..302541
FT                   /transl_table=11
FT                   /gene="h16_A0286"
FT                   /locus_tag="H16_A0286"
FT                   /product="ABC-type transporter, ATPase component: HAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="3.6.3.22"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91437"
FT                   /db_xref="GOA:Q0KEY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEY4"
FT                   /inference="protein motif:TCDB:3.A.1.4"
FT                   /inference="protein motif:COGS:COG0411"
FT                   /protein_id="CAJ91437.1"
FT                   /translation="MSEGSKMTQVAWQGAGQREWAGTARTDASGAGSGGAIAPTGPMSP
FT                   AELTDDSGAHPGTQRAQRTGEQARTGGEVILDLQHISLSFGGVKALTDISFDVCEHEVR
FT                   AIIGPNGAGKSSMLNVINGVYHPQQGRIVFRGEERKQMHPTAAARQGIARTFQNIALFK
FT                   GMTVLDNIMTGRNTQFRTGLFAHALWWGPARNEEMRHRQKVEEVIDFLEIQSIRKTPVG
FT                   RLPYGLQKRVELARALAAEPSMLLLDEPMAGMNVEEKQDMCRFILDVNRQFGTTIVLIE
FT                   HDMGVVMDISDRVVVLDYGKKIGDGTPEEVKGNPDVIKAYLGTSH"
FT   CDS_pept        302553..303467
FT                   /transl_table=11
FT                   /gene="h16_A0287"
FT                   /locus_tag="H16_A0287"
FT                   /product="ABC-type transporter, permease component: HAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /note="8 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91438"
FT                   /db_xref="GOA:Q0KEY3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEY3"
FT                   /inference="protein motif:TCDB:3.A.1.4"
FT                   /inference="protein motif:COGS:COG0559"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="CAJ91438.1"
FT                   /translation="MTFFFEILIGGLLSGLMYSLVALGFVLIYKASGVFNFAQGAMVYF
FT                   AALAVVGLMDKGLPMWAAVIGAFVVMILVGMSTERFVLRKLVNQPPITLFMATIGLSFF
FT                   LEGLGPLLFGNEVRPINLGIVDEPIESIMTNFNIVLSKFDIAAAAIAGLLVGSLALFFQ
FT                   YTKVGRALRAVADDHQAALSLGIPLQNIWAIVWGVAGFVALVAGMLWGSRNGVQFALTL
FT                   TALKALPVLILGGFTSVPGAIVGGLIIGASEKLAEIYIPPVFQSMFGGNFGGIEGWFPY
FT                   VFALLFLLVRPEGLFGEKHIDRV"
FT   CDS_pept        303492..304568
FT                   /transl_table=11
FT                   /gene="h16_A0288"
FT                   /locus_tag="H16_A0288"
FT                   /product="ABC-type transporter, permease component: HAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /note="10 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91439"
FT                   /db_xref="GOA:Q0KEY2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEY2"
FT                   /inference="protein motif:TCDB:3.A.1.4"
FT                   /inference="protein motif:COGS:COG4177"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="CAJ91439.1"
FT                   /translation="MFYREAGQFKTSYVADSQIFPIRQDRIGFAVLMAVAFVAIPFVGS
FT                   EYWFSAILIPFLIFSLAALGLNILTGYAGQLSLGTAAFMAVGAYAAYNFQLRVEGMPVL
FT                   LTFVMAGLSAALVGVAFGLPSLRIKGFYLAVATLAAQFFVVWALTKFPWFSNNSSSGVI
FT                   TAQRLDLFGFAIDTPLKKYLFVLAIVTVLALAAKNLVRSATGRAWMSVRDMDVAAEVIG
FT                   IPLMRTKLLAFAVSSFYCGVAGALYAFCYLGSVEPDGFSLDLSFRVLFMIIIGGVGSIL
FT                   GSFLGAAFILLLPIFLDNVLPSLAALLHLPFTNATVSHIQLMVFGGLIIFFLIVEPHGL
FT                   ARLWQIAKEKLRLWPFPH"
FT   CDS_pept        304659..305996
FT                   /transl_table=11
FT                   /gene="h16_A0289"
FT                   /locus_tag="H16_A0289"
FT                   /product="ABC-type transporter, periplasmic component: HAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91440"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEY1"
FT                   /inference="protein motif:TCDB:3.A.1"
FT                   /inference="protein motif:COGS:COG0683"
FT                   /protein_id="CAJ91440.1"
FT                   /translation="MTNLIRNVQRAALVVSAAAALLAPAAPAMAQSNEQFVALPSYRVG
FT                   PYGANGQSWYGGFIDYLNYVNLKEGGVNGVKLSWEECETEYNNAKGVECYERLKSKNAT
FT                   TKGTAYHAMSTGISYALVDKTAADKVPLVMMGYGRTDAVDGSVFPYAFPLVTTYQMQVS
FT                   AIVKYLASKNGGSLAGKKIVYLYHDSAYGKEPIVALQAEAKLGKFNLVEIPVAHPGNEQ
FT                   GAQWLKIRQENPDYVIFWGWGVMNQTALKAAQKVGFARDKIIGSWWAGSEEDTVPAGDA
FT                   SKGYMSATWNVAGRNVPLIADIEKVVYGAGKGNMQDKNKVGSVLYNRGVSAAVVTVEAV
FT                   RVAQAKFGKGKPMTGEQMRWAFENLNLTNARLQQLGATGLLPEIKTSCDNHEGSGKVKI
FT                   QQWDGTKWVVVSDWIEGNKGLIHPLFKATAAQYAKEKGITPACSKS"
FT   sig_peptide     304659..304751
FT                   /gene="h16_A0289"
FT                   /locus_tag="H16_A0289"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        306075..306893
FT                   /transl_table=11
FT                   /gene="h16_A0290"
FT                   /locus_tag="H16_A0290"
FT                   /product="ABC-type transporter, ATPase component: HAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="3.6.3.22"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91441"
FT                   /db_xref="GOA:Q0KEY0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEY0"
FT                   /inference="protein motif:TCDB:3.A.1.4"
FT                   /inference="protein motif:COGS:COG0410"
FT                   /protein_id="CAJ91441.1"
FT                   /translation="MSLLSVNNIEVIYDHVILVLKGVSLEVPEGKIVALLGANGAGKTT
FT                   TLKAISNLLQAERGDVTKGSIEYRGDRVDQLTPNDLVRRGVIQVMEGRHCFAHLTIEEN
FT                   LLTGAYTRGLSRGQTRDELEKIYEYFPRLKTRRKSQAGYTSGGEQQMCAIGRAMMAKPA
FT                   MILLDEPSMGLAPQIVEEIFEIVRGLNSRENVSFLLAEQNTMVALRYADYGYILENGRV
FT                   VMDGDAESLRTNEDVKEFYLGVAANDADDGAGRKSFRDVKSYRRRKRWLA"
FT   CDS_pept        306980..308230
FT                   /transl_table=11
FT                   /gene="h16_A0291"
FT                   /locus_tag="H16_A0291"
FT                   /product="Coenzyme F390 synthetase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91442"
FT                   /db_xref="GOA:Q0KEX9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEX9"
FT                   /inference="protein motif:COGS:COG1541"
FT                   /protein_id="CAJ91442.1"
FT                   /translation="MPEHFDSLETRAPEVREQALLAALARQVAHARDNAPYFAEMLGGV
FT                   DPRLLSSRAALAALPVTRKSDLTARQRALPPLGGLNATPLGKLRHVFQSPGPIHEPDGH
FT                   DADWWRVARAMHAAGFRAGELVYNTFSYHFTPAGMMMETGAHRLGCCVFPAGVGQTDSQ
FT                   VQALASLQPTAYAGTPSFLKLLLERGDELGTPCTSLAKALVSGEALPPSLRAWFQARGV
FT                   RVQQMYGTADVGLIAYETEGGDGWVVDEGVLVEIVEPGGSRPMPEGETGEVVVTVLGNG
FT                   DYPLIRFGTGDLSAIVAESSQRPSPCGRTNIRLKGWLGRADQATKVKGMFVHPGQVADV
FT                   LRRHPEIRAARLVVTGDPGADVMTLRCEATREDGDLQRAVAESLREVMRLRGEVAFVAA
FT                   GSLPQDGKLIEDARRYD"
FT   CDS_pept        complement(308279..308647)
FT                   /transl_table=11
FT                   /gene="h16_A0292"
FT                   /locus_tag="H16_A0292"
FT                   /product="hypothetical membrane spanning protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91443"
FT                   /db_xref="GOA:Q0KEX8"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEX8"
FT                   /inference="protein motif:COGS:COG2832"
FT                   /protein_id="CAJ91443.1"
FT                   /translation="MWVVLGAVFLLLGVIGIFLPVLPTTPFVLLAAACFARGSRRFHEW
FT                   LLGHPRFGPLVSDWQRNRSIPFRAKCLALSMMWASMGTTAWMLRARPLASAALLACAVG
FT                   VSVWMVRLPTRPVEGGKS"
FT   CDS_pept        complement(308767..309744)
FT                   /transl_table=11
FT                   /gene="nppD"
FT                   /locus_tag="H16_A0293"
FT                   /product="Putative 2-nitropropane dioxygenase"
FT                   /function="General function prediction only"
FT                   /EC_number="1.13.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91444"
FT                   /db_xref="GOA:Q0KEX7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEX7"
FT                   /inference="protein motif:COGS:COG2070"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="CAJ91444.1"
FT                   /translation="MPAAKQLPQALQNLALPVIASPMFIVSYPELVLAQCKAGIVGSFP
FT                   ALNARPAELLDEWLTQIEGELATFKAANPGAQVGPVAVNQIVHTSNARLEHDVKVCVDH
FT                   KVPIFITSLRAPVKEMIDAVHSYGGIVLHDVISMRHAEKAIEAGVDGLILVAAGAGGHA
FT                   GMLSPFALVGEVRKIFDGPIALSGSIATGEAVLAAQAMGADFAYVGTRFIASQEAHAAE
FT                   SYKQSITSSAAADIIYTNLFTGVHGNYIRESISNVGLDPDNLPVADKSKMDFSSGASKA
FT                   KAWKDVWGAGQGVGQIHDIPTAGEIVARMKAEYDAAKARLGIAR"
FT   CDS_pept        complement(309871..311307)
FT                   /transl_table=11
FT                   /gene="h16_A0294"
FT                   /locus_tag="H16_A0294"
FT                   /product="signal transduction histidine kinase"
FT                   /function="Signal transduction mechanisms"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91445"
FT                   /db_xref="GOA:Q0KEX6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEX6"
FT                   /inference="protein motif:COGS:COG0642"
FT                   /protein_id="CAJ91445.1"
FT                   /translation="MHIGLRIFFGFFLIVGLATVLTLRVFVQEVKPGVRQAMEDTLIDT
FT                   AHVLAALAADDMKAGRIADGDFARHMAALRDVAVNADVSGLHKDSIGYRVYVTDANGIV
FT                   RFDSTGTDVGRDYSRWNDVYLTLRGKYGARSTRTDPDDEASTVMHVAAPIRDADGERII
FT                   GVLTVAKPNAAMAPFIERSQRKILLYGGLLIGAACVIGLACTLWLAHGLSRLRGYARAV
FT                   AAGERAEMPLRGGSELAELGRAVQGMRERLEDKQYVEHYIHTLTHEMKSPLAAIGGAAE
FT                   LLQEEMPAADRQRFVANIRAQSGRLETMIRKLLALADVEQRQRLEVREPVRLAPLLAQL
FT                   GSELEPRARQRGVTLRLAADASPDLVAGDPFLLRQAIANLLENAIDFAPPDSKVMVRLE
FT                   RRGGALAIAVADQGPGIPDYALPRVFERFYSLPRPHGADKSTGLGLCFAREVATLHDGD
FT                   VTLANRPGGGALAELTLPAG"
FT   CDS_pept        complement(311317..312015)
FT                   /transl_table=11
FT                   /gene="h16_A0295"
FT                   /locus_tag="H16_A0295"
FT                   /product="response regulator, OmpR-family"
FT                   /function="Signal transduction mechanisms / Transcription"
FT                   /note="REC (residues 9 to 120, 7e-24) with a typical
FT                   phosphorylation pocket (1/2 DD,D54,S/T82,K105)"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91446"
FT                   /db_xref="GOA:Q0KEX5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEX5"
FT                   /inference="protein motif:CDD:cd00156"
FT                   /inference="protein motif:COGS:COG0745"
FT                   /inference="protein motif:CDD:cd00383"
FT                   /protein_id="CAJ91446.1"
FT                   /translation="MPGMEQPRILVVEDEQAIADTILYALRTDGMLAEHCTLGGAALER
FT                   MRAGAADLVILDVGLPDLSGFEVCRTLRTFSNAPVVFLTARHEEIDRIVGLEIGADDYV
FT                   VKPFSPRELAARVRAILRRARGGGATAAKSDEVAGFTHDKDGARLAYRGRWLELTRYEY
FT                   LLLAWLVTHPGRIYSRAQLMECVWEDALDTSDRTVDTHIKTLRAKLREASADGAERIRT
FT                   HRGMGYSLEP"
FT   CDS_pept        complement(312266..313393)
FT                   /transl_table=11
FT                   /gene="h16_A0296"
FT                   /locus_tag="H16_A0296"
FT                   /product="putative membrane associated dehydrogenase
FT                   (flavoprotein)"
FT                   /function="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91447"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039649"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEX4"
FT                   /inference="protein motif:COGS:COG0644"
FT                   /inference="protein motif:COGS:COG0654"
FT                   /protein_id="CAJ91447.1"
FT                   /translation="MPSFDYDIVIAGASFAGAACALAAARAGLRVLVLERKTDPGDKLH
FT                   TTGILVKEAIEQTWLGRAPADCVHRVEQVRLYSPRLRSIDLSAPGYYFHTTDTPRLMRW
FT                   LAAELVRHRVELRLGQAFVGAVPRNGGWHVTGVGNTRYLVGADGAKSRVAQCAGLGRVH
FT                   SFLYGVEYEFPGLALPEPGALHCFITRRFAPGYIGWIAQNPTGVQAGLALRYLPRHGRA
FT                   PDLDGLLAHVRERAGLPQLAQPAATRAGLIPCGGPAFPLARDGVILTGDAAGIVSPVTA
FT                   GGIHYAFAHGESVGQAVAAHLLRGGPAPEAVATAGAPRFRAKRALRWMFDRFQCDWPFD
FT                   LMLYSPPLRWAAEQIYFHKRRGEDPAPPPRAATSA"
FT   sig_peptide     complement(313322..313393)
FT                   /gene="h16_A0296"
FT                   /locus_tag="H16_A0296"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(313632..314969)
FT                   /transl_table=11
FT                   /gene="gltR1"
FT                   /locus_tag="H16_A0297"
FT                   /product="response regulator of C4-dicarboxylate
FT                   transportsystem"
FT                   /function="Signal transduction mechanisms / Transcription"
FT                   /note="REC (residues 11 to 123, 1e-21) with a typical
FT                   phosphorylation pocket (1/2 DD,D54,S/T82,K105)"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91448"
FT                   /db_xref="GOA:Q0KEX3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEX3"
FT                   /inference="protein motif:CDD:cd00156"
FT                   /inference="protein motif:COGS:COG2204"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /inference="protein motif:COGS:COG1221"
FT                   /protein_id="CAJ91448.1"
FT                   /translation="MSIAMQDGLRVLFVEDEPLVRQATAQSLELAGFAVLALPSAEAAI
FT                   PHLHGAFAGVVVTDVRLPGASGLDLLQHCRNAAPGVPVILVTGHGDITMAVQAMREGAY
FT                   DFIEKPFGADRLTDTVRRALERRALELENQALRRELAGPAAGTRIIGRSPAIGQVRALV
FT                   ANVAPTDVPVMINGETGTGKELVARSLHALSGRAEGPFIALNCGAVPEAIFESEMFGHE
FT                   AGAFTGAGKRRIGKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGSLERLGSNASVKI
FT                   DVRIVAAAKGDMDALVVQGSFREDLYYRLNVVTIALPPLRERREDIVPLFEHFSLVSAV
FT                   RYQRPAPILSEAQRQALAQRPWPGNVRELRNAADRMVLGVPEGGQAGAQAAGPDETAPL
FT                   RERMEHFERAVIADALARTGGAVSQAADLLQVGKATLYDKIKRYGL"
FT   CDS_pept        complement(314966..316963)
FT                   /transl_table=11
FT                   /gene="gltS1"
FT                   /locus_tag="H16_A0298"
FT                   /product="signal transduction histidine kinase regulating
FT                   C4-dicarboxylate transport system"
FT                   /function="Signal transduction mechanisms"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91449"
FT                   /db_xref="GOA:Q0KEX2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEX2"
FT                   /inference="protein motif:COGS:COG4191"
FT                   /protein_id="CAJ91449.1"
FT                   /translation="MTHSDDFLAVHDPAATRPAHAPDVGSGRWWGFAVALAAGLLLLCA
FT                   LTWLVSVQRGLASLQQSTATRADRYAATLESTLDRYEFLPALVSLHPFVRGLLDSPDDP
FT                   QRVAAANQYLAEVNRRAHASATYVIAANGIALAASNHGQPGSFVGTDYRFRPYFQTAAG
FT                   GKMGRFYAIGITSDEPGYYLAQPVESGGKVIGVTVVKLNLEWFQRAGSGAEPLMVSDDH
FT                   GVIFLSSVSAWQYRTLRPLPPPLQAEMEKTRQYHGRAVTPLPLEPLTSPVTRWLADTTL
FT                   ADGARLVRVRDESPASKTTSAPDGAERAVRYLELDRTVGAAGWTMQVMAPLEPVLANAR
FT                   NATVAAALAYACICLLLVNWRQRRQRARDMQYSRRLLEAAYDQLERRVEARTADLMAIN
FT                   EKLEDEVAERTRAESELRAAQDELVQASKLAALGQMAAGITHELNQPLAALRTFSDNTR
FT                   VLLERGQLAAAEGNLTAIADLTERMGKITGQLKLFAGKARPVHRPVALRAAVDHVLALL
FT                   APRLGAVTVNVTGLDALPGLAVRADELKLEQVLLNLLGNALDAIAAAAPAQGQIDLEVQ
FT                   AEDHAVTIVVRDNGTGIAPQALPRLFEPFFTTKETGQGLGLGLAISSSIVREFGGQLSV
FT                   ANVPGGGAQFTLVLARAPAIDPAPSVSASQ"
FT   CDS_pept        complement(317046..318344)
FT                   /transl_table=11
FT                   /gene="gltP1"
FT                   /locus_tag="H16_A0299"
FT                   /product="Sodium:dicarboxylate symporter: DAACS family"
FT                   /function="Energy production and conversion"
FT                   /note="8 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91450"
FT                   /db_xref="GOA:Q0KEX1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEX1"
FT                   /inference="protein motif:TCDB:2.A.23"
FT                   /inference="protein motif:COGS:COG1301"
FT                   /protein_id="CAJ91450.1"
FT                   /translation="MRKPFYKILYVQVLFAICVGILLGHYWPDTGVAMKPLGDGFIKLI
FT                   KMIIGPIIFCTVVTGIAGMSDMKKVGRVGGKALLYFEVVSTFALLIGLGAAHLLKPGVG
FT                   FNIDPATLDTKAIAQYVSKAHGQSTVEFLMHIIPDTVFSAFANGDILQILLVSLFFGAA
FT                   LAVLGERARIVVQLIEQVSKVFFHIVHVITKVAPIGAFGAMAFTIGKYGLGSLVPLLKL
FT                   IGTFYFTAIIFVLVVLGTIARMTGFSIVRFISYIKEELLIVLGTSSSEAALPHMMEKLE
FT                   KLGCSRSVVGLVVPTGYSFNLDGTNIYMTMAVIFIAQATGIELTLMQQLTILAVAMITS
FT                   KGASGVTGSGFITLAATLAVVPTIPVAGMVLILGIDRFMSECRALTNIIGNGVATVVVS
FT                   AWERELDRKRLASVLNGGSGDVADLADVGQGVR"
FT   CDS_pept        318738..319058
FT                   /transl_table=11
FT                   /gene="h16_A0300"
FT                   /locus_tag="H16_A0300"
FT                   /product="Ferredoxin"
FT                   /function="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91451"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEX0"
FT                   /inference="protein motif:COGS:COG3411"
FT                   /protein_id="CAJ91451.1"
FT                   /translation="MSSYYQHHVFFCLNQREAGENCCANHNAQAMQEYAKKRCKELGIA
FT                   GGEGRVRINKAGCLNRCELGPVLVVYPEAIWYTFVDEHDIDEIIDSHLMKGKPVERLMV
FT                   DR"
FT   CDS_pept        319207..319848
FT                   /transl_table=11
FT                   /gene="h16_A0301"
FT                   /locus_tag="H16_A0301"
FT                   /product="predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /function="General function prediction only"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91452"
FT                   /db_xref="GOA:Q0KEW9"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEW9"
FT                   /inference="protein motif:COGS:COG2945"
FT                   /protein_id="CAJ91452.1"
FT                   /translation="MNAHTQVLSIAGPAGAIDLSVDLPQGEPRGLALVAHPHPLFGGTK
FT                   DNKVAQTLARSFVQLGYATVRPNFRGVGGSAGEHDNGIAEQDDLLAVVAWMRQQTAWSA
FT                   QAATLPLAMGGFSFGSFVTTHVARRLAEAGTPAQRLVLVGTAASRWQVAEVPADTIVIH
FT                   GEQDDTVPLASVFDWARPQELPVIVIPGADHFFHRKLHLIKQLVVNAWDR"
FT   CDS_pept        319911..321110
FT                   /transl_table=11
FT                   /gene="dac"
FT                   /locus_tag="H16_A0302"
FT                   /product="D-Alanyl-D-alanine carboxypeptidase
FT                   (serine-type)"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91453"
FT                   /db_xref="GOA:Q0KEW8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEW8"
FT                   /inference="protein motif:MEROPS:S11.003"
FT                   /inference="protein motif:COGS:COG1686"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="CAJ91453.1"
FT                   /translation="MLNRATTRLSSAFAPAAIAAAIVLAAAPAAVLAQGVPMPQVAAKS
FT                   WMLYDVTSGQALASQNADARIEPASLTKLMTAYLAFEALKEKRLTLDQAVVPTSVVLKV
FT                   KSDESRMFIEPNKPVTVQDLLLGLIVQSGNDAALALAEAVGGSEEGFVAMMNREAQRMG
FT                   MKNTHFTNTDGIPDPNHYTTAVDLATLTTRLIKDFPEYYAMYSQKEFTYNKIRQPNRNR
FT                   LLYIDPTVDGVKTGHTKSAGYCLISSAKRPLANVPDGSRRLISIVIGTTTEQVRTQESL
FT                   KILNYGFQFFDTLRLYDKGQVLATPDIYKGKSGTVKIGVQNETFVTVPKGTGGRLKPVL
FT                   ERQELLIAPISAGQQVGMVKLMDGTNKVAEFPVVALEEVPEAGFFGRLWDTIRLWFKRK
FT                   "
FT   sig_peptide     319911..320012
FT                   /gene="dac"
FT                   /locus_tag="H16_A0302"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        321172..321477
FT                   /transl_table=11
FT                   /gene="h16_A0303"
FT                   /locus_tag="H16_A0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91454"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEW7"
FT                   /inference="protein motif:PFAM:PF04359"
FT                   /protein_id="CAJ91454.1"
FT                   /translation="MTTDKQGSNKPGDIPPEQSLIEYPSHFPIKVMGAMQDGFAEAIVT
FT                   LVQEFDPDFHAGKMEMRPSSGGNYLGLTVTVWVTSREQLDDLYRALTSHPMVKVVL"
FT   CDS_pept        321591..322787
FT                   /transl_table=11
FT                   /gene="asmT"
FT                   /locus_tag="H16_A0304"
FT                   /product="putative acetylserotonin O-methyltransferase"
FT                   /function="General function prediction only"
FT                   /EC_number="2.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91455"
FT                   /db_xref="GOA:Q0KEW6"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEW6"
FT                   /inference="protein motif:COGS:COG1092"
FT                   /protein_id="CAJ91455.1"
FT                   /translation="MNTITLKPGKEKSLLRRHPWIYATGIATTEGRCEPGATVIVRAAD
FT                   GRFLAKAAYSPESQIRARAWTFDENEPVDHALFKRRVAAAVAYRRQWVKDSDAVRLIFG
FT                   ESDRLPGLIVDYYGNGDKGQLVCQFNSAGVEHWKTAIVQALVKETGCPNVYERSDAAVR
FT                   QREGLELVTGVLAGAEPDPALSVTEHGVRYYVDVRNGHKTGFYVDQRDNRKLVGDLAAG
FT                   REVLNCFCYTGGFSLAALRGGATSVTSIDSSGEALKIAAGNVTLNGFEPERATWLDADV
FT                   FKTLREFRAEGRQFDLIVLDPPKFAPSAQHIDRAARAYKEINLVGMQLLRPGGLLFTYS
FT                   CSGAISMELFQKIVAGAVTDARADARILRRLSAGTDHPMLAAFPEGEYLKGLLLEKVA"
FT   CDS_pept        complement(322807..324906)
FT                   /transl_table=11
FT                   /gene="uvrD1"
FT                   /locus_tag="H16_A0305"
FT                   /product="Superfamily I DNA and RNA helicase"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91456"
FT                   /db_xref="GOA:Q0KEW5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEW5"
FT                   /inference="protein motif:COGS:COG0210"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="CAJ91456.1"
FT                   /translation="MTLDLAPAADLAAPGADDVPAYLSRLNPEQRAAVEHGSDAPLLII
FT                   AGAGSGKTNTLAHRVAHLVLAGADPRRILLLTFSRRAAAEMGRRVERIVDQALGTQTGA
FT                   GRAALQWSGTFHAIGARLLREYAETLGLSPAFTISDRGDAADLMHVVRHDLGLSETASR
FT                   FPKKETCLAIYSRVVNTQAPLEDVLKQQFPRYAMWADALRTLFAGYVEAKQKQHVLDYD
FT                   DLLLYWAQAMAEPTIAQDMGARFDHVLVDEYQDTNALQASILLAMRPDGRGLTVVGDDA
FT                   QSIYAFRGATVRNILDFPAQFTPAAQQVTLSQNYRSTQPILQAANAVIGLAAERYTKDL
FT                   WSERASAEKPGVIVVNDEADQARYVVEQVLARREAGLTLMAQAVLFRAADHSAQVEIEL
FT                   ARRNIPFVKFGGLKFLESTHVKDALAVVRWLENPRDRMAGFRTLQLLPGIGPKTAARVL
FT                   DALALATEPLFSLEQFEPPPAAAPAWADLLALARALMAPTSPWPSEFEQVLAWYAPHLE
FT                   RLHDDAAARQADLQQLERIAATYGARERFLTELTLDPPSASSDESGVPSRDEDYLILST
FT                   IHSAKGQEWKAVYVLNAVDGCMPSDLATGTTEEIEEERRLLYVAMTRARDHLDIVVPQR
FT                   FYVHQQVGFGDRHVYASRTRFLPNRVMPNFYSRSWPPPPMPGEGPARPALAPVDLASRM
FT                   RNMWR"
FT   CDS_pept        complement(325066..325602)
FT                   /transl_table=11
FT                   /gene="bcp"
FT                   /locus_tag="H16_A0306"
FT                   /product="Peroxiredoxin"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /EC_number="1.11.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91457"
FT                   /db_xref="GOA:Q0KEW4"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEW4"
FT                   /inference="protein motif:COGS:COG1225"
FT                   /inference="protein motif:COGS:COG0526"
FT                   /protein_id="CAJ91457.1"
FT                   /translation="MTTAAPATKSSRKPWPIVAAVVVLALLGWFGYRALAPANTAPAAT
FT                   FTLLSGEKVSTADLKGKVYMINFWATSCATCVKEMPDMVRTYEQFKGKGLEFVAVAMNY
FT                   DPPMYVMNYARTRGLPFKVAMDSDGTAARAFGNVQLTPTTFVVDKDGRILKRYVGEPEW
FT                   DALHKLLDGALAKSA"
FT   CDS_pept        complement(325714..326238)
FT                   /transl_table=11
FT                   /gene="h16_A0307"
FT                   /locus_tag="H16_A0307"
FT                   /product="Thioredoxin-related protein, possibly truncated"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91458"
FT                   /db_xref="GOA:Q0KEW3"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEW3"
FT                   /inference="protein motif:COGS:COG2143"
FT                   /protein_id="CAJ91458.1"
FT                   /translation="MPAALIARHAFAIASLRWVAAGALLAAAAGMPAAAAGMPAAAASP
FT                   AHLPPATDLAAHGTEAARRGEPLVVLVSMPGCSYCDAVRRNYLGPQAAAGEIAVRELDM
FT                   TADTPLRDADGSLTTARAWARAHQVRVAPTVLFLDRQGRAAAGPLRGMQPDFYGAYLEQ
FT                   ALDQARAAVRR"
FT   CDS_pept        326387..326989
FT                   /transl_table=11
FT                   /gene="h16_A0308"
FT                   /locus_tag="H16_A0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91459"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEW2"
FT                   /protein_id="CAJ91459.1"
FT                   /translation="MRLVPPPPSFPAAVRRPLLCCAAVLAFALCACSPRYDWRTIQSGE
FT                   GAYAALYPGKPTSAARDVTIAGRKLPMTMEAARVDDTLFAVGVVTLPADDEALRREALA
FT                   AMQAGLLANLGTPSGEPRARPVTVMSADRPGRPLAGVEVQASGVSPQDQSPRRLTARLV
FT                   AVGTRAYQAVVLESGDAARDARQAEQVEQFLGGFHPF"
FT   CDS_pept        327072..327719
FT                   /transl_table=11
FT                   /gene="h16_A0309"
FT                   /locus_tag="H16_A0309"
FT                   /product="putative threonine efflux protein"
FT                   /function="Amino acid transport and metabolism"
FT                   /note="5 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91460"
FT                   /db_xref="GOA:Q0KEW1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEW1"
FT                   /inference="protein motif:TCDB:2.A.76"
FT                   /inference="protein motif:COGS:COG1280"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="CAJ91460.1"
FT                   /translation="MRWEVWLAFFAACWVIAVSPGSGAVLSMSHGLSYGLRRTTTTIFG
FT                   LQAGLVIVLLVAGGGLGALLLASEQAFMVVKTIGALYLIYLGVQQWRAQVESGADQGGS
FT                   TAPVRVAVMSRRRRFATGLLTNVTNPKGIIFMVAVLPQFIDPNRPLALQLAILAATMCC
FT                   VDLVVMHGYALLASRMQGLFRNARAVRWQNRFFGSVLMAVGAALFFVRRQHA"
FT   CDS_pept        complement(327968..328690)
FT                   /transl_table=11
FT                   /gene="h16_A0310"
FT                   /locus_tag="H16_A0310"
FT                   /product="transcriptional regulator, GntR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91461"
FT                   /db_xref="GOA:Q0KEW0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEW0"
FT                   /inference="protein motif:COGS:COG2188"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /inference="protein motif:SMART:smart00345"
FT                   /protein_id="CAJ91461.1"
FT                   /translation="MDQRLQALKPDEAEATPIYLQVARRLAAAIQAGQWRVGDALPSER
FT                   TLVDSLEISRVTARRALQVLAEEGAITRSRGAGTFVAPRPEQKAARLDNFSELARRRGM
FT                   TPASELVAFERRRATPQEAAALALQEGEEIVSLTRLRKADGQVFWMDVTTLALAVLPDA
FT                   SAIGESLYAYLERIGKPVLRVTERLRAIVAGEALAARLQIAPGEPLLHILRTGYTHGDQ
FT                   PVELTDGYCLNDFYELKQ"
FT   CDS_pept        329083..331635
FT                   /transl_table=11
FT                   /gene="nagF"
FT                   /locus_tag="H16_A0311"
FT                   /product="Protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase II ABC"
FT                   /function="Carbohydrate transport and metabolism / Signal
FT                   transduction mechanisms"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91462"
FT                   /db_xref="GOA:Q0KEV9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEV9"
FT                   /inference="protein motif:TCDB:8.A.7"
FT                   /inference="protein motif:COGS:COG1080"
FT                   /inference="protein motif:PFAM:PF02896"
FT                   /inference="protein motif:CDD:cd00210"
FT                   /inference="protein motif:COGS:COG1925"
FT                   /protein_id="CAJ91462.1"
FT                   /translation="MAETSETLLLRAPVSGVLLPLAAVPDPVFADGMFGDGLAIDPLSD
FT                   TLVAPCDGTIVHLAATGHALTLQAPCGAQVLLHVGIDTVSLRGEGFAPCVAQGAAVRQG
FT                   DALIRFDVDRVAQQASSLVTVMAIANGDAFTVAGRTGAAQADAGRTVLLQVRAAGAAAP
FT                   AQEDHASAAEQRRTVTLACPGGLHARPAARAREAARGLDAAVALHYGGRQASLASLVSL
FT                   LGLAADEGAAVELVATGRDAGAALDAVAYELQRAGVGEEEPVPTVAAPIAQPGPGAGLP
FT                   ADGIPGVAAAPGIAIGTLHWWRETTPEPAEAGQGIAAEREALRAALAAIDAQLAHESEA
FT                   ATARRAGAEAGIFAMHRALLEDPALQAAAETMIAAGKSAGFAWREATRAEAAMLSAMAD
FT                   RRMAERAADLLDLGKRVLRALAPAGSAPVQLPAPAADGDVIVLAAGEFTPSDLTGLDRT
FT                   RVAALVMARGGPTSHAAIIARQLGIPCLVALGSALERLQDGTPVIADGDSARLHACPDA
FT                   HLLAAAASAVRLRAQQREADLRAAHAAASTRDGVPIEVAANIGSLDDARNAVAHGADAV
FT                   GLLRTELLFLHGDAAPAAADHTASCQAIADALQGRSAIVRTLDIGADKDAAWLHLPAED
FT                   NPALGLRGVRLAQVRPQLLDDQLRGLLAVRASGPLRILLPMVSEVGELLAWRERIRALA
FT                   AEAGTDPEIEVGVMIEVPSAALLADQLAEHADFFSIGTNDLTQYTLAIDRCQPELAARM
FT                   DGLHPAVLRMIAATTEGAARHGRWVGVCGALAGDPLAVPVLVGLGVTELSVDAGLVPGV
FT                   KARVRALSHADCRQRAGELLRLPSAAAVRDACRRYWPA"
FT   CDS_pept        331693..333402
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="H16_A0312"
FT                   /product="Protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase II ABC, N-acetylglucosamine-specific"
FT                   /function="Carbohydrate transport and metabolism / Signal
FT                   transduction mechanisms"
FT                   /EC_number="2.7.1.69"
FT                   /note="14 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91463"
FT                   /db_xref="GOA:Q0KEV8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEV8"
FT                   /inference="protein motif:TCDB:4.A.1"
FT                   /inference="protein motif:COGS:COG1263"
FT                   /inference="protein motif:PFAM:PF02378"
FT                   /inference="protein motif:CDD:cd00212"
FT                   /protein_id="CAJ91463.1"
FT                   /translation="MKMDLLPRVQRLGATLMLPIAVLPVAGLLLRLGQPDVFDIKLMAE
FT                   AGNAVFANLALLFAIGVAVGFARDNNGAAALAGTIGYLVLTTVLKTIDKSLDMGVLAGI
FT                   VAGAVAGGLYNRYRNVALPPYLGFFSGKRFVPIVTALCCLLLGIVLAYAWAPVQAGINA
FT                   AGAWLTTAGSAGALVFGLLNRLLLVTGLHHLINTLAWFVFGNYADPATGAAVSGDLHRY
FT                   FAGDPGAGLFMTGFFPVMMFGLPAACLAMYHETPPARRALVGGMLFSMALTSFLTGITE
FT                   PIEFSFMFLAPVLYGLHALMTGLSMALCHALDIRLGFTFSAGAIDYVLGYGLSSRGWLA
FT                   IPLGLAYALVYYGLFRFFIRRFNLLTPGRDEVVPVAAAGGAAQPAAGSVAQQYVEALGG
FT                   PANLVVVDACTTRLRLNVADIGAVSEPRLKALGVRGVLKRPPNVVQVVIGPQAEQVAGD
FT                   IRAVLQQAPQATAVVAAAPAVATQASVPAAGAFDPAWWIDALGGAANIASVGVVALTRL
FT                   RVVVRERARVRADHLAGSQLMWIGDDTAHIAFGHAADGHAAAFERALQAMPT"
FT   CDS_pept        333519..334583
FT                   /transl_table=11
FT                   /gene="nagC"
FT                   /locus_tag="H16_A0313"
FT                   /product="outer membrane protein (porin)"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91464"
FT                   /db_xref="GOA:Q0KEV7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEV7"
FT                   /inference="protein motif:TCDB:1.B.1"
FT                   /inference="protein motif:CDD:cd00342"
FT                   /inference="protein motif:COGS:COG3203"
FT                   /protein_id="CAJ91464.1"
FT                   /translation="MKRIALTALLAASAGGACAQSAGTGITLYGRAVAGLDYVNGIARP
FT                   GGDVDTFRFGSNQYGVSFWGMRGAEDLGGGLRGVFNLEGMITSGTGRSDPLFNRRAQVG
FT                   LASNDWGTLLLGRAMSLTDDESGAIDPMGLQASSVATLVYGRNWGSRTNAVTYNSPVWG
FT                   GLSVRAQAGSDGVAGSFNSGKQLSAAVKYAQGNLSLTGIYEELRDTQGRMDNLYVNSRQ
FT                   YTLGGSYALNNLRLFAGYNLTVSSGDTVATPENPYAATRSQMAWVGANYRLLPALTLLS
FT                   GVYYATLNNGGGHGTLVTLGAKYDLSKRTSLYGTVASVFNSRNATFSVEASPDTMPGAG
FT                   ANQQGAYAGIIHLF"
FT   sig_peptide     333519..333578
FT                   /gene="nagC"
FT                   /locus_tag="H16_A0313"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        334626..335729
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="H16_A0314"
FT                   /product="N-Acetylglucosamine-6-phosphate deacetylase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91465"
FT                   /db_xref="GOA:Q0KEV6"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEV6"
FT                   /inference="protein motif:COGS:COG1820"
FT                   /protein_id="CAJ91465.1"
FT                   /translation="MKGNILTPAGWIFGEIHAGPDGRIARIEGVPASPEHNDAPYVLPG
FT                   FVDLLNHGGGGKDFMDGEAAVPVILRAHVRFGTTSLLGSTMTSPHDVLLPALQALNRAC
FT                   AQRPPGAARMLGVHLEGPYINPGKLGAQPDTSATATPEELEQYLGAAPLKVVTLAPELP
FT                   GHLDIIRLLVARGVRVQLGHTLGTYEDAVAALDAGASGFTHLFNAMTPLQHRAPGMVAA
FT                   ALAHAEFAELIPDLLHVHPGAIRAALRAIPRLYAVTDATAAAGMPDGVYHLGSQTVYKV
FT                   HGSVRLADGTLAGSVLTMDQALRNFVSIGLDLADASRRVSLYPAQYLGMSDRGMLAQGC
FT                   WADAVVLDRALLVRTVYVEGECCVENA"
FT   CDS_pept        335722..336753
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="H16_A0315"
FT                   /product="Glucosamine-6-phosphate deaminase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91466"
FT                   /db_xref="GOA:Q0KEV5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEV5"
FT                   /inference="protein motif:COGS:COG2222"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="CAJ91466.1"
FT                   /translation="MLEEALSAPAVVAAQLAQAPRVAALAAQLAAQAWPAALTVARGSS
FT                   DHAASYFATLVTRRLGVPVASLPMSTVTLHDSALRVAGQLAVAFSQSGRSPDLVETMQA
FT                   LRDRGAATVALVNAPDSPLAQACAHELPLLAGPEQSVAATKSYIAMLSMSALLVGHLEA
FT                   ARSGEHELVDACAGLPAALAQAAAQDWSALVPALRDVERMIVLGRGAGLAIAQEAALKL
FT                   KETSGIQAEAFSGAEVRHGPMEIIGDGYPLLVFAPRGPEQAGLLALAAEMRKRGARVLL
FT                   AAPPGTVDAELPLELPLVPAGHPLLDPVCAIQGFYVAAQALALARGRNPDQPQYLRKVT
FT                   ETR"
FT   CDS_pept        336812..338299
FT                   /transl_table=11
FT                   /gene="zwf1"
FT                   /locus_tag="H16_A0316"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91467"
FT                   /db_xref="GOA:Q0KEV4"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEV4"
FT                   /inference="protein motif:PFAM:PF02781"
FT                   /inference="protein motif:PFAM:PF00479"
FT                   /protein_id="CAJ91467.1"
FT                   /translation="MQTTRTASSSGTADARPLDLVIFGGAGDLSARKLLPSLYMCHRDG
FT                   NLPDGTRIIGVGRHRWDREAFVNFADESAQPFVEARYLEPAKWQTFLQRLDFVHVDASQ
FT                   SGDYPALAAQLRQEALRIYYMAMPPGLFAATCDNLASHGLIANDTRLVLEKPLGVDLAS
FT                   AIGIGEVVSRYFSEDRTYRIDHYLGKETVQNLMALRFGNSIFEPLWRTPFVRSVQITVA
FT                   ETVGVGTRGGFYDEAGAMRDMVQNHLLQLVSILAMEPPAALTSDAVRDEKLKVLRSLRP
FT                   MSPEDVRRNTVRGQYTAGAIAGELVRGYLQEEGIPPDSRTETFVAMRAELGTWRWNKVP
FT                   FYLRTGKRMQERVTEVVINFAEVPHSIFDAGSTLQPNRMVIRLQPEESVRLTLMVKQPG
FT                   EGMKLKPLSLALNLDSAFTTRRAEAYERLLLDVIRGRLALFVRRDELQAAWTWVDPILE
FT                   AWRQQDEGPRPYTAGTWGPAASSAFMAREGVQWSEEA"
FT   CDS_pept        complement(338359..339903)
FT                   /transl_table=11
FT                   /gene="h16_A0317"
FT                   /locus_tag="H16_A0317"
FT                   /product="Predicted ATPase with chaperone
FT                   activity/Magnesium chelatase, subunit ChlI"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91468"
FT                   /db_xref="GOA:Q0KEV3"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEV3"
FT                   /inference="protein motif:COGS:COG0606"
FT                   /inference="protein motif:PFAM:PF01078"
FT                   /protein_id="CAJ91468.1"
FT                   /translation="MSLAVLRSRALTGIAAPPVRVETHLANGLPAFTIVGLADTGVRES
FT                   RERVRAAILNSGYEFPNRRITVNLAPADLPKESGRFDLAIALGILAASGQIPSEALDAH
FT                   EFAAELSLSGELRPVRGALAMAMGLARDNAARAAAGEAPRAFLVAAGNGAEAALIEDLA
FT                   VHAAATLRQACDHLCPLPDARLPRSMPALLPAATDRGPDMRDVRGQAQARRAMEVAAAG
FT                   QHSALLVGPPGTGKSMLAQRLPGLLPPMTLQEALESAAVMSLTPGGFRTALWGQRPFRS
FT                   PHHTASGPAMVGGGGNPRPGEISLAHHGVLFLDELPEFDRRVLEVLREPLESGRITIAR
FT                   AAGHADFPACFQFVAAMNPCPCGYLGHPDRPCRCTPDQVRRYQSRISGPMLDRIDLQVE
FT                   VPAQDQGEMLDGPPGEPSAVVCTRVLAARERQLARQGKPNNELGGREIEQHCTMEAQAQ
FT                   ALLRGAMTRLAWSARSYYRVLKVARTIADLEGAEVLTATHVGEAIQYRRALRMAGG"
FT   CDS_pept        complement(339984..340262)
FT                   /transl_table=11
FT                   /gene="h16_A0318"
FT                   /locus_tag="H16_A0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91469"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEV2"
FT                   /inference="protein motif:PFAM:PF04380"
FT                   /protein_id="CAJ91469.1"
FT                   /translation="MKPTDLFNDLQNKVSEALRNSPARDIEKNVRSMMTQGFAKLDLVT
FT                   REEFDVQSQVLARTRARLEELEGRVAELERRAGITPGAGSVDSTGGA"
FT   CDS_pept        340649..341446
FT                   /transl_table=11
FT                   /gene="h16_A0319"
FT                   /locus_tag="H16_A0319"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91470"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEV1"
FT                   /protein_id="CAJ91470.1"
FT                   /translation="MKKLALAVSALVLTSAAATAHAQSTDAAAPAPAAAAAEPASPHTF
FT                   TANVSLVSDYRYRGISQTNLRPAIQGGFDYAHESGFYLGNWNSSISWLEDANPAVSAPV
FT                   EMDFYGGFKNTFKVAGTEFSYDLGVLEYYYPGGYNNPRPYTTELYAGIGWGPVFLKYSH
FT                   SVTNLFGWADSKNSGYIDLSANVPLNFWDLTLNAHVGYQDVKHNSDASYTDWKIGLTKD
FT                   LGKGFALAVAYVDTNAKEVAYTSANRGRYLGKATAWASITKTF"
FT   CDS_pept        341499..341837
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="H16_A0320"
FT                   /product="nitrogen regulatory protein PII"
FT                   /function="Signal transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91471"
FT                   /db_xref="GOA:Q0KEV0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEV0"
FT                   /inference="protein motif:COGS:COG0347"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="CAJ91471.1"
FT                   /translation="MKLIIAVIKPFKLDEVREALSDVGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYIVDFLPKVKIEVAVPDDVVERAIEAVEKSARTGKIGDGKIFVAPIEQVIRIRT
FT                   GETGGDAL"
FT   CDS_pept        341870..343417
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="H16_A0321"
FT                   /product="ammonium transporter"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /note="12 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91472"
FT                   /db_xref="GOA:Q0KEU9"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEU9"
FT                   /inference="protein motif:TCDB:2.A.49"
FT                   /inference="protein motif:PFAM:PF00909"
FT                   /protein_id="CAJ91472.1"
FT                   /translation="MKTWFKRFLTAGAMALAIGTAGVGISTPAAAQDKPAAEASAPAAS
FT                   AAPAAAAAEASAPAAAAAAPAAAPAEAAAAPAAPVPNKGDTAWLLVSTAFVILMTLPGL
FT                   ALFYGGLVRSKNMLSVLMQCLVIFSLVALLWAIYGYSFAFTEGNAFFGGTDRLFMKGLT
FT                   VEAVAATFSKGVVVPELGYFAFQCAFACITCGLIIGAFAERAKFSAVLVFVVLWFTFSY
FT                   IPMAHMVWFWPGPDAYTDAAAGAAATAKSGWLFQKGALDFAGGTVVHINAAVAGLVGAY
FT                   MFGKRIGFGREAIRPHSLTFTMVGASLLWFGWFGFNAGSALEANGSAALAFVNTLLATC
FT                   AAVLAWTFGEWIGKGKPSMLGGASGAVAGLVAITPAAGFVGPMGSIVMGLIAGLLCLWG
FT                   VTGLKRMLGMDDSLDVFGVHGVGGIVGALLTGVFAAPSLGGTGIYDYVANKVADDYSIA
FT                   GQLWIQFEGVLTTVVWSGVVAFVAYKLVDMLIGLRVPEDEEREGLDITSHGETAYEV"
FT   CDS_pept        343971..345266
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="H16_A0322"
FT                   /product="Gamma-glutamate-cysteine ligase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91473"
FT                   /db_xref="GOA:Q0KEU8"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEU8"
FT                   /protein_id="CAJ91473.1"
FT                   /translation="MVPHLITALNGPLLELEKKILDATPSIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDTNLFPGGFNNLAPEMLPLAVQAAMAAIEKICPDAKNLLLIPERHT
FT                   RNMFYLQNVARLSLIMRQAGLNVRLGSLSEEITEPTPIELPDGQTLVVEPLARLGTRGR
FT                   RLGLKDFDPCSILLNNDLSAGIPPILENINEQYLLPPLHAGWSTRRKSSHFAAYDEVAK
FT                   KFAKLIDIDQWMVNPYFARCSGVDFHERVGEEELADAVEGVLKKIAKKYREYGIKETPY
FT                   VVVKADAGTYGMGIMTVRDPSEVKGLNRKERNKMSVVKEGLEVSDVIIQEGVHTFEKVN
FT                   EAVAEPVVYMIDRYVVGGFYRVHTGRGNDENLNAPGMHFVPLAFAPNGIPDSHAKPGAA
FT                   VPNRFYMYGVVARLALLAASLELEKTDPNPIL"
FT   CDS_pept        345275..346228
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="H16_A0323"
FT                   /product="glutathione synthase"
FT                   /function="Coenzyme metabolism / Translation, ribosomal
FT                   structure and biogenesis"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91474"
FT                   /db_xref="GOA:Q0KEU7"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEU7"
FT                   /inference="protein motif:COGS:COG0189"
FT                   /protein_id="CAJ91474.1"
FT                   /translation="MRILFITDPLETFKTYKDSTYAMMTEAAARGHELYWCLQPQLTLS
FT                   GRVVETMATRLHLTGDDHAWYREGNSALEPLSAFDAVLMRKDPPFDMEYVTSTWLLELA
FT                   EAQGARVFNKPRAIRDHSEKLAIAQYPEFITPTLVTRDLARIRDFHAEHRDIIVKPLDG
FT                   MGGMGVFRVGADGMNLAAIVETLGHDGARTLMVQRYIPAIKDGDKRILLIGGVPVPYSL
FT                   ARVPMAGEVRGNLAAGGTGRAQELSPRDREIAEALAPGLWEQGLLLVGLDVIGDYLTEV
FT                   NVTSPTCFQEITQQTGFHVAAMFIDALEHAVDAAGR"
FT   CDS_pept        346297..346752
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="H16_A0324"
FT                   /product="phosphotransferase system, fructose-specific
FT                   component IIA"
FT                   /function="Carbohydrate transport and metabolism / Signal
FT                   transduction mechanisms"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91475"
FT                   /db_xref="GOA:Q0KEU6"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEU6"
FT                   /inference="protein motif:COGS:COG2893"
FT                   /inference="protein motif:CDD:cd00006"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="CAJ91475.1"
FT                   /translation="MAGILIIAHTPLASALRDCAAHVYCGQPQRLESIDVLPDADPAVV
FT                   LAEARRRLAAICEDNGALVLTDIFGATPANIAARLAEPGRVRVLAGVNLPMLVRAICYR
FT                   GEKLDQLATKALAGGSQGVLQVGTTTVQNQTANHPDKYAAEGHHHHQ"
FT   CDS_pept        346721..346990
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="H16_A0325"
FT                   /product="Phosphocarrier protein (HPr)"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91476"
FT                   /db_xref="GOA:P23537"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23537"
FT                   /inference="protein motif:CDD:cd00367"
FT                   /inference="protein motif:COGS:COG1925"
FT                   /inference="protein motif:PFAM:PF00381"
FT                   /protein_id="CAJ91476.1"
FT                   /translation="MLQRDTTIINKLGLHARASAKLTQLAGNFVSQVKMSRNGRQVDAK
FT                   SIMGVMMLAAGIGSTVTLETDGPDEQEAMDALLALIANRFGEGE"
FT   CDS_pept        347040..348800
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="H16_A0326"
FT                   /product="Phosphoenolpyruvate-protein kinase (PTS system EI
FT                   component)"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91477"
FT                   /db_xref="GOA:P23536"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23536"
FT                   /inference="protein motif:TCDB:8.A.7"
FT                   /inference="protein motif:COGS:COG1080"
FT                   /inference="protein motif:PFAM:PF02896"
FT                   /inference="protein motif:PFAM:PF05524"
FT                   /protein_id="CAJ91477.1"
FT                   /translation="MPFALHGIPVSRGVAIGRAHLLAPAALDVSHYLVDEDQLDAEVER
FT                   LRAARAAVRAELAALKRDLPRDAPEELGAFLDVHAMILDDEALAREPEALIRGRRYNAE
FT                   WALTTRLEELMRQFDEIEDEYLRERKTDIRQVVERILKALAGAPVLVPAPVPALAADGE
FT                   AATGVIVVAHDIAPADMLQFRHTVFHGFVTDMGGRTSHTAIVARSLDIPAAVGVQSASE
FT                   LIRQDDWIIIDGDAGLVIVDPTAIILEEYRHRQSERALEKKRLQRLRHTPAVTLDGLEI
FT                   DLLANIEMAEDAGAALAAGAVGVGLFRSEFLFMNRRDELPGEDEQFQAYRGAVDAMHGL
FT                   PVTIRTIDIGADKPLDARGDEFETALNPALGLRAIRWSLSEPGMFLTQLRALLRASAFG
FT                   PVRLLVPMLAHASEIDQTLALIAKAKRQLDERGEAYDPGMKVGAMIEIPAAVLLLPLFL
FT                   RKMDFLSIGTNDLIQYTLAIDRADNAVAHLFDPLHPAVLQLVARTIREANRAGVPVAVC
FT                   GEMAGDPSMTRLLLGMGLREFSMHPAQLLRVKQEILHAHCERLEPLVDQVLQAFDPEEQ
FT                   AAALRQLARP"
FT   CDS_pept        349015..349320
FT                   /transl_table=11
FT                   /gene="bfd"
FT                   /locus_tag="H16_A0327"
FT                   /product="Bacterioferritin-associated ferredoxin"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91478"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEU3"
FT                   /inference="protein motif:COGS:COG2906"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="CAJ91478.1"
FT                   /translation="MYVCICNQITDREIHGAAHLGIETLDELAETLGVGTCCGRCRECA
FT                   HQVLQEGVAAVRNVTVATLANIQVVEISSCSASGPCTIMDTRDPAVANDQRKALVA"
FT   CDS_pept        349446..349925
FT                   /transl_table=11
FT                   /gene="bfr2"
FT                   /locus_tag="H16_A0328"
FT                   /product="Bacterioferritin (cytochrome b1)"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91479"
FT                   /db_xref="GOA:Q0KEU2"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEU2"
FT                   /inference="protein motif:CDD:cd00907"
FT                   /inference="protein motif:COGS:COG2193"
FT                   /protein_id="CAJ91479.1"
FT                   /translation="MKGDKKVIQHLNAQLKNELTAINQYFLHARMYRHWGLKKLGDVEY
FT                   KESIGEMKHADRLIERILMLDGLPNLQDLHKLLLGEDTPEMLKCDLKLEQTAHATVKEG
FT                   IAYCESVGDYVSREILVDILTDTEEHIEYLETQLDLIDKVGLQNYLQSQMEPGEQ"
FT   CDS_pept        350117..351220
FT                   /transl_table=11
FT                   /gene="h16_A0329"
FT                   /locus_tag="H16_A0329"
FT                   /product="Predicted ATPase"
FT                   /function="General function prediction only"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91480"
FT                   /db_xref="GOA:Q0KEU1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEU1"
FT                   /inference="protein motif:COGS:COG2603"
FT                   /inference="protein motif:CDD:cd01520"
FT                   /protein_id="CAJ91480.1"
FT                   /translation="MRPDTADFRTLFLSGVAMLDVRAPLEFARGAFPGAVNLPLMDDAE
FT                   RHEVGLCYAQKGQQAAIELGHQLVSGLRKAARIAAWAEFARAHPDGYLYCFRGGLRSQL
FT                   VQQWLHAAGVDYPRVTGGYKAMRGFLIETTDAAAAEQQWFVLGGLTGSGKTDVLADVPA
FT                   AIDLEGHARHRGSAFGRRALAQPPQIDFENALAIDVLRHIDAGWRALLVEDEGRFIGSR
FT                   DVPQVLTQRMQASPLVWLEASFDERVERVLRDYVQGLAAEFIAEKGSTEGFEAYATRLR
FT                   EAMAGISPRLGGARYGKLSALLDQALAQQAERGEVDLHRGWIEVLLREYYDPMYAFQRE
FT                   QREARIVFRGDRAAVTDWLRAHTAQRG"
FT   CDS_pept        complement(351230..351994)
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="H16_A0330"
FT                   /product="Dinucleotide-utilizing enzyme involved in
FT                   molybdopterin thiamine biosynthesis family 2"
FT                   /function="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91481"
FT                   /db_xref="GOA:Q0KEU0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEU0"
FT                   /inference="protein motif:CDD:cd00757"
FT                   /inference="protein motif:COGS:COG0476"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="CAJ91481.1"
FT                   /translation="MSDDGLNDEQLLRYSRHILLDELGIEGQRRLLAGHALVIGAGGLG
FT                   AAALPFLASAGVGRITVVDDDEVDLTNLQRQIIHTTANVGRPKVDSAREGMLRINPGLE
FT                   IVTVPARVGDAELAQLVASADVVLDCCDNFATRQAVNRACVRHKVPLVSGAALRFDGQI
FT                   SVFDRRQPDAPCYACLFPPAEPAPEVACATMGVFAPLVGMVGTVQAAEALKLLAGVGES
FT                   LAGRLLMVNALSMEWTTMRLARTPDCPVCAGH"
FT   CDS_pept        complement(352258..353865)
FT                   /transl_table=11
FT                   /gene="ctp"
FT                   /locus_tag="H16_A0331"
FT                   /product="C-terminal processing peptidase-3, periplasmic"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="3.4.16.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91482"
FT                   /db_xref="GOA:Q0KET9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KET9"
FT                   /inference="protein motif:MEROPS:S41.004"
FT                   /inference="protein motif:COGS:COG0793"
FT                   /inference="protein motif:PFAM:PF03572"
FT                   /inference="protein motif:SMART:smart00245"
FT                   /inference="protein motif:CDD:cd00988"
FT                   /protein_id="CAJ91482.1"
FT                   /translation="MRKTLKNISLVSVGLVAGVLATLQISATAQNSSGPLPLDQLRLMA
FT                   DIFGQIKREYVEPVDDKKLLTEAIKGMVASLDPHSSYLDEKDFKELQEGTRGRFAGLGI
FT                   EISQEEGLVKVINPIEDTPAFRAGIQPGDLITRIDDKPVRGLPLEQAVKRMRGEPGTKV
FT                   TLTIYRKSEERTFPVSITRAEIRVQSVKAKMLDNNIGWIRLTSFQERTIADLSRKLAEL
FT                   AQKNPNMKGLVLDLRNNGGGVLQGAVGVAAAFLPEDATVVSTNGQVPDAKRVYKATYNN
FT                   YRLSSLEDDPLKDLPALYKKIPMVVLTNAYSASASEIVAGALQDHHRAQIMGKTTFGKG
FT                   SVQTVRPLTNDTGIKLTIAYYYTPSGKSIQAKGIRPDIPVDQNPEGDPDDALITREIDT
FT                   ERHLHNKQESEQPEMTEREQRRVDELRRLEEENAKKTPEEREKDRRKKPVEFGTADDFM
FT                   LQQAIAQLNGQPVKRSKSKLETNPPADNGKAAKPSGKSGAKGASAPAAKPAVPAPGKQP
FT                   PASAPIGEPLGTPTGKAP"
FT   sig_peptide     complement(353776..353865)
FT                   /gene="ctp"
FT                   /locus_tag="H16_A0331"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(354045..354791)
FT                   /transl_table=11
FT                   /gene="pgam1"
FT                   /locus_tag="H16_A0332"
FT                   /product="phosphoglycerate mutase 1"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91483"
FT                   /db_xref="GOA:Q0KET8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KET8"
FT                   /inference="protein motif:COGS:COG0588"
FT                   /protein_id="CAJ91483.1"
FT                   /translation="MYKLVLIRHGESTWNLENRFTGWVDVDLTETGADQARQAGKLLKD
FT                   AGLGFDVAYTSVLKRAIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKAETAAK
FT                   FGDEQVLVWRRSYDTPPPALEPTDPRASYDDPRYANVPRNEIPLTECLKDTVARVMPLW
FT                   NESIAPDIQSGKRVVIAAHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDADLRP
FT                   LRHYYLGDQDAIAASLAAVASQGKAR"
FT   CDS_pept        354979..355392
FT                   /transl_table=11
FT                   /gene="h16_A0333"
FT                   /locus_tag="H16_A0333"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91484"
FT                   /db_xref="GOA:Q0KET7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KET7"
FT                   /inference="protein motif:CDD:cd00158"
FT                   /protein_id="CAJ91484.1"
FT                   /translation="MNFFADYNNLALIALAVVSGGLLAWPAISRSTRGKTVNTATATQL
FT                   INKRGAVVVDIREPAEYAKGHLPQAKSAPLADLPSRAAGLAKDKAAPIIVVCQTGQRSG
FT                   KAQAALKEAGYSEIYALEGGIAAWQQAGLPLVK"
FT   CDS_pept        355478..355735
FT                   /transl_table=11
FT                   /gene="h16_A0334"
FT                   /locus_tag="H16_A0334"
FT                   /product="Glutaredoxin-related protein"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91485"
FT                   /db_xref="GOA:Q0KET6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KET6"
FT                   /inference="protein motif:COGS:COG0695"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /protein_id="CAJ91485.1"
FT                   /translation="MARVVMYSTVVCPYCLMAERLLKSRGVETIEKVLIDREPGKREEM
FT                   MARTGRRTVPQIYIDETHVGGFDDLSALDRQGGLVPLLAA"
FT   CDS_pept        355935..356453
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="H16_A0335"
FT                   /product="preprotein translocase subunit SecB"
FT                   /function="Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91486"
FT                   /db_xref="GOA:Q0KET5"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KET5"
FT                   /inference="protein motif:COGS:COG1952"
FT                   /inference="protein motif:CDD:cd00557"
FT                   /protein_id="CAJ91486.1"
FT                   /translation="MSDQQNTQQDDQPFFNIQRVYLKDMSLEQPNSPGIFLESEAPSVE
FT                   VQVNVGASQLQEGIFEVVVTGTVTTKVQDKVAFLVEAHQAGIFDIRNVPVEQLDPLLGI
FT                   ACPTILYPYLRGNIADVITRAGFQAIHLSEINFQALYEQRLQAAMEEAQGAEGGNSGIV
FT                   MPDGSQARH"
FT   CDS_pept        356547..357563
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="H16_A0336"
FT                   /product="Glycerol-3-phosphate dehydrogenase [NAD(P)+]"
FT                   /function="Energy production and conversion"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91487"
FT                   /db_xref="GOA:Q0KET4"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KET4"
FT                   /inference="protein motif:COGS:COG0240"
FT                   /inference="protein motif:PFAM:PF01210"
FT                   /protein_id="CAJ91487.1"
FT                   /translation="MKLTFLGAGAWGTALASHAAAANDVVLWGRDPAQLAAIAATRENA
FT                   AYLPGVTLSERLAVQADFEQAVAHAADDADGIVVVATPVAGLREMTRRLAARGARPVSM
FT                   LWLCKGFESGTHLLPHQMVRAELDAAGRTEGFAYGVLTGPSFAREVALGLPCALTVAGN
FT                   EPSLAERAQAAFHHHAMRIYGSDDLTGVEVGGAVKNVLAIATGASDGLGLGLNARAALV
FT                   TRGLAEMTRLGLALGGRVETFMGLAGVGDLILTATGDLSRNRKVGQQLAAGQSLEQILA
FT                   GLGHVAEGVRCAQAVAELASAYGVEMPIARAVCAVLFDGLSAADAVAQLLQRDARDE"
FT   sig_peptide     356547..356615
FT                   /gene="gpsA"
FT                   /locus_tag="H16_A0336"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        357600..358577
FT                   /transl_table=11
FT                   /gene="h16_A0337"
FT                   /locus_tag="H16_A0337"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91488"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KET3"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="CAJ91488.1"
FT                   /translation="MPTRRQALIALAAACAAGTSGGVFAQPWPARPIRMVVPFPPGSSP
FT                   DLIARIVTEKLAAALGQPVVVENRPGAGGNIGTGMVARAAPDGYTLLFTINGPLVTAPT
FT                   LSRNLNYDPFRQLAPVTLVATSPNVLVVDARLPVHNLREFVALARAKPGELNYGSPGNG
FT                   SASHLAMEQLKAMAGIDLQHVPYPGFPQITTAMVGGQVQAGFMVPAIAMPQVNAGKLRV
FT                   LAVTTTGRTAVLPSVPTVAESGYPGFEAISWQAVLAPAGTPQAVIDRLYRELVAIIGSA
FT                   DVRDKMRAQYFVPAGTAPASLRQTMVSEKARWDKVIRAAGVQPE"
FT   sig_peptide     357600..357677
FT                   /gene="h16_A0337"
FT                   /locus_tag="H16_A0337"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(358594..359064)
FT                   /transl_table=11
FT                   /gene="h16_A0338"
FT                   /locus_tag="H16_A0338"
FT                   /product="predicted rRNA methylase (SpoU class)"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /note="unknown EC_number=2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91489"
FT                   /db_xref="GOA:Q0KET2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KET2"
FT                   /inference="protein motif:COGS:COG0219"
FT                   /protein_id="CAJ91489.1"
FT                   /translation="MFNVVLVEPEIPPNTGNVIRLCANTGAQLHLVKPLGFPLEDARMR
FT                   RAGLDYHEYATMRVHESWDALMASEQPDPARMFALTTRGSTPFGEVAFRPGDWFVFGSE
FT                   TRGLSPERRDWFPPAQRIRLPMRPDNRSLNLSNTVAVVVFEAWRQNGFEGGS"
FT   CDS_pept        complement(359148..360005)
FT                   /transl_table=11
FT                   /gene="h16_A0339"
FT                   /locus_tag="H16_A0339"
FT                   /product="predicted amidophosphoribosyltransferase"
FT                   /function="General function prediction only"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91490"
FT                   /db_xref="GOA:Q0KET1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KET1"
FT                   /inference="protein motif:COGS:COG1040"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="CAJ91490.1"
FT                   /translation="MQGHGQTGQQENQEPARGQIQDQARAPDECGRRARWAAAGRQVYA
FT                   RAALAAGAAGKALAGAAELLLPSACALCGAVQRQVVCAPCAADLLRPVRRCPACALAQG
FT                   RHFHCPACAASPPAYDQAHTLGDYASPQDQLVLALKFGHALPLAGWLAARLAAGLQGAW
FT                   ARQPAPDLLAPIPLSPQRLAARGFNQAWEIARPLARHLGLRADPVLLQRQRDTGSQRAL
FT                   DLAARQVNLRGAFRLARAARLDGMHVALVDDVMTSGATLHEAAGVLKAHGAARVSVIVA
FT                   LRTP"
FT   CDS_pept        359994..360947
FT                   /transl_table=11
FT                   /gene="h16_A0340"
FT                   /locus_tag="H16_A0340"
FT                   /product="predicted methyltransferase"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism / General function prediction
FT                   only"
FT                   /note="unknown EC_number=2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91491"
FT                   /db_xref="GOA:Q0KET0"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KET0"
FT                   /inference="protein motif:COGS:COG2226"
FT                   /inference="protein motif:COGS:COG0500"
FT                   /inference="protein motif:PFAM:PF01209"
FT                   /protein_id="CAJ91491.1"
FT                   /translation="MSLHAADSPDAFLPPARLTRLAFDRRSRGFGQLDFLLGEIGRRMQ
FT                   ERMEVIRLAPQRALDIGCGHGQGLAGLRARFPDAQIAGLDISGAMLAEAGQRDPQRRPG
FT                   WIGRMLGKRPLFDLVQADLATLPFAPASFDLLWSNLALHWHPEPHRVFPEWHRVARDEG
FT                   LVLFSLFGPDTLKELRAAFAEVDQAPHTLRFVDMHDIGDMLVHSGWSTPVMDMETLTVT
FT                   YESPATLLREVQAFGGLRGPVGSLPQGLRGRGWYQALAQALERRRNADGVIPLTFEIVY
FT                   GHAWKLAPRGGQAVDDQGRAVVPLDQIGRARPRRTS"
FT   CDS_pept        361220..361729
FT                   /transl_table=11
FT                   /gene="h16_A0341"
FT                   /locus_tag="H16_A0341"
FT                   /product="hypothetical membrane spanning protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91492"
FT                   /db_xref="GOA:Q0KES9"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KES9"
FT                   /inference="protein motif:COGS:COG5488"
FT                   /protein_id="CAJ91492.1"
FT                   /translation="MQDLGIAFQTAGGDSGGNLDGPPPAPHDWLMKRNCSLSPRQVGWF
FT                   YLSILTVSLAIALFFAWQGSWLVLPFASIELIGLGIALLVYARHATDYERVSITDGTLV
FT                   VETASAGRVTRQEFNPRWVRIELGESFRALVTLRSGGREVQVGCHVDPYRRRKFAQELA
FT                   AALRRL"
FT   CDS_pept        361788..363050
FT                   /transl_table=11
FT                   /gene="ctaC"
FT                   /locus_tag="H16_A0342"
FT                   /product="aa3-type cytochrome oxidase, subunit II"
FT                   /function="Energy production and conversion"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91493"
FT                   /db_xref="GOA:Q0KES8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KES8"
FT                   /inference="protein motif:COGS:COG1622"
FT                   /inference="protein motif:PFAM:PF00116"
FT                   /protein_id="CAJ91493.1"
FT                   /translation="MKMWKKASAVCLAGASLLASQAASAVSDMPGGPAVRQLNLTEPVT
FT                   KIAEQIHWLNWMMLIMCTVIFVAVFSVMFYSVFKHRKAKGAKPAAFHESITVEVIWTIV
FT                   PFIIVIAMALPATKTVVAMKDTTNSDITIKATGYQWKWGYDYLKGEGEGISFVSTLTTP
FT                   REQINNEQPKSNTYLMEVDNELVVPVNKKIRIVTTANDVIHAWMIPAFGVKQDAIPGFV
FT                   RDTWFKAEKIGVYRGQCAELCGKEHAFMPIVVRVVSDADYTKWVDGKKKELAAKADDPN
FT                   KTWTLDESKVRGEKVYAANCAVCHQPNGKGGGAFPALDGSKLVNGPKAGQMHIMLEGKA
FT                   AMPSWKQLSDTELAAVMTYTRNAWSNKTGEVVQPSDFVGARAGKFPEGGGAAGGAAPKA
FT                   EAKPADKADKQASLAGNRVAG"
FT   CDS_pept        363089..364696
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="H16_A0343"
FT                   /product="aa3-type cytochrome oxidase, subunit I"
FT                   /function="Energy production and conversion"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91494"
FT                   /db_xref="GOA:Q0KES7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KES7"
FT                   /inference="protein motif:COGS:COG0843"
FT                   /inference="protein motif:PFAM:PF00115"
FT                   /protein_id="CAJ91494.1"
FT                   /translation="MSTATPDALAHPHDHAHDDHAHDHPHGWRRWLFATNHKDIGTLYL
FT                   LFSFIMLLSGGLLALLIRLELFEPGLQFFRPELFNQFTTMHGLVMVFGAIMPAFVGFAN
FT                   WMIPLQIGASDMAFARMNNFSFWLMPPAALLLAGSFLVPGGATAAGWTLYAPLSVQMGP
FT                   GMDMAIFAMHIMGASSIMGSINIIVTILNMRAPGMTLMKMPMFCWTWLITAYLLIAVMP
FT                   VLAGAITMVLTDRHFGTSFFSAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQVVP
FT                   AFARKRLFGYSSMVYATASIAILSFIVWAHHMFTTGMPVTGQLFFMYATMLIAVPTAVK
FT                   IFNWIATMWRGSMTFETPMLFSIGFIFVFTIGGFTGLMPAVAPIDIQLQDTYFIVAHFH
FT                   YVLVAGSLFALFAGFYYWGPKWSGFMYNETRGQIHFWGSIIFFNVTFFPMHFLGLAGMP
FT                   RRYADYPTQFADFNAIASIGALGFGLMQVYFFFFVVLPSYRGGEKAADKPWDGAEGLEW
FT                   TVPSPAPFHTFEVPPQVR"
FT   CDS_pept        364770..364901
FT                   /transl_table=11
FT                   /gene="h16_A0344"
FT                   /locus_tag="H16_A0344"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91495"
FT                   /db_xref="GOA:Q0KES6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KES6"
FT                   /protein_id="CAJ91495.1"
FT                   /translation="MQSPDKSPSRPDQKAANRRLGLILLSIVVVFFLGFFAKMMFLG"
FT   CDS_pept        364919..365530
FT                   /transl_table=11
FT                   /gene="ctaG"
FT                   /locus_tag="H16_A0345"
FT                   /product="cytochrome oxidase assembly protein"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91496"
FT                   /db_xref="GOA:Q0KES5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KES5"
FT                   /inference="protein motif:COGS:COG3175"
FT                   /inference="protein motif:PFAM:PF04442"
FT                   /protein_id="CAJ91496.1"
FT                   /translation="MSIDQQAGREADKRFNRGMMLRLVVIVAVMFGFGYALVPLYKKIC
FT                   EITGINVITTRELHGAVKNTQVDKSRTITVEFDSNARGPFAFRPVKNSMEVHPGEMATI
FT                   VYEVANGQPRDISAQAIPSYAPKQATQYFMKLECFCFKQQTLKAKEAREMPVVFVIDPA
FT                   LPKDVKNITLSYTFFEVGAPVAQAPEGQLAPQPATAGKGI"
FT   CDS_pept        365570..365794
FT                   /transl_table=11
FT                   /gene="h16_A0346"
FT                   /locus_tag="H16_A0346"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91497"
FT                   /db_xref="GOA:Q0KES4"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KES4"
FT                   /protein_id="CAJ91497.1"
FT                   /translation="MDEMKDAVKRKMSFGQTMRAVLWSFIGLRKGAEHERDMARLNPVH
FT                   VVIAGVIAAAIFIAVLVLIVRTVVGQAAG"
FT   CDS_pept        365939..366799
FT                   /transl_table=11
FT                   /gene="ctaE"
FT                   /locus_tag="H16_A0347"
FT                   /product="aa3-type cytochrome oxidase, subunit III"
FT                   /function="Energy production and conversion"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91498"
FT                   /db_xref="GOA:Q0KES3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KES3"
FT                   /inference="protein motif:PFAM:PF00510"
FT                   /inference="protein motif:COGS:COG1845"
FT                   /protein_id="CAJ91498.1"
FT                   /translation="MSANRANAPYYFVPGPSRHPITASFGLLMTGAGAAGWVNGQPWAP
FT                   YLCGLGLLWFLFVLKSWFGDAISESEGGMYGKNIDLSFRWSMGWFIFSEVMFFAAFFGA
FT                   LFYARTIAMPWLGDLNNKILWPDFAAVWPNTGPAGVVESFQTMGPWPIPTINTALLLMS
FT                   GLTLTWAHHALLAGKRSQLIQGLSLTILLGAVFMCFQVYEYMHAYSELNLKLTSGIYGS
FT                   TFFLLTGFHGFHVTMGAIMLAVVLVRVLKGHFTPDHHFAFEGAAWYWHFVDVVWLFLYV
FT                   VVYWL"
FT   CDS_pept        complement(366929..367138)
FT                   /transl_table=11
FT                   /gene="h16_A0348"
FT                   /locus_tag="H16_A0348"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91499"
FT                   /db_xref="GOA:Q0KES2"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KES2"
FT                   /protein_id="CAJ91499.1"
FT                   /translation="MRFVIIVAFILIIASLASALFFMMRDRGTTPNMMRSLMLRVGFSM
FT                   ALFLFILFSNWMGWIHSTGIRMAP"
FT   CDS_pept        367125..367934
FT                   /transl_table=11
FT                   /gene="surf1"
FT                   /locus_tag="H16_A0349"
FT                   /product="cytochrome oxidase assembly protein, SurF1
FT                   related"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91500"
FT                   /db_xref="GOA:Q0KES1"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KES1"
FT                   /inference="protein motif:COGS:COG3346"
FT                   /protein_id="CAJ91500.1"
FT                   /translation="MTKRMAGQVGARSDGKTHYRTSPLPLAAALVMIAVTCALGNWQLN
FT                   RAHDKEARAARLQALSAQPPVVLGTAPLPQVVTDRTVRVTGRFDTARTVLLDNRPHGNG
FT                   SSPGDSRAGFLVLTPLRISAASPAPAGAAGAMQAVLVLRGWLPRDAQDRTRIAPFPTPE
FT                   GEVTIEGTALAAVPRVYSLGQDAAGSKIRQNLDLAAYAAETGLALHPLVLEQRSDSGDG
FT                   LARDWAPADLGADRHYGYAFQWFGLAALTVVLVVVLGWRRARRVAAP"
FT   CDS_pept        367940..368638
FT                   /transl_table=11
FT                   /gene="sco1"
FT                   /locus_tag="H16_A0350"
FT                   /product="cytochrome oxidase assembly protein, Sco1/SenC
FT                   family"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91501"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KES0"
FT                   /inference="protein motif:COGS:COG1999"
FT                   /protein_id="CAJ91501.1"
FT                   /translation="MNQAHALAEDKGQTYSMAQQDSAPAAAASPPDTRIDARTRRGRLQ
FT                   MLMLLLVCASPVIASYFTYYVIKPRGGATNYGALVDPQRPMPPVRVTDEQGRAVPLEQF
FT                   RGKWLLVTTDPSACDEACAKKLFTIRQIRAGQGQDRERIVPVWLVTDDGKIDERLNAAY
FT                   NEPYAGVRFLRIDRQAAQQWLPAEPGKRAEDTLFLVDPLGNLMMRFPQDPDPKKMSGDL
FT                   KKLLKVSRIG"
FT   CDS_pept        368649..369761
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="H16_A0351"
FT                   /product="putative hemeA synthase"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91502"
FT                   /db_xref="GOA:Q0KER9"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KER9"
FT                   /inference="protein motif:PFAM:COX15-CtaA"
FT                   /protein_id="CAJ91502.1"
FT                   /translation="MLLQLAIIGILIALFPLSYVLVKGDRNKYRKLAWITAFLTLDLIM
FT                   FGSFTRLTDSGLGCPDWPGCYGHSNPHAAMEPIRAAETALPSGPVTLAKAWIEMIHRYF
FT                   AMAVGVLIITLMVLAWVKRRELKQSPWFATGVLLLVCVQGAFGAFTVTLKLQPIIVVTH
FT                   LMLGMVLLAVLIQLGSRNDPPHPVAARAARLRWPVRIGLLLLVIQIFLGGWVSTNYAVL
FT                   ACTDFPLCNGQLVPEMDFRHGFTLWRQLGMTADGDYIPHAALVAIHWVHRGFAFVVLGY
FT                   LAWLGLRARRLEGLARAAGWLLATLVLQLATGMSNIVFDWPLVAAVAHNGGAALLLLLL
FT                   VRLHYNTGLAGLTMRAAGAPAAVPNAARAT"
FT   CDS_pept        369779..370702
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="H16_A0352"
FT                   /product="Protoheme IX farnesyltransferase (heme O
FT                   synthase)"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91503"
FT                   /db_xref="GOA:Q0KER8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KER8"
FT                   /inference="protein motif:COGS:cog010"
FT                   /inference="protein motif:PFAM:UbiA"
FT                   /inference="protein motif:COGS:COG0109"
FT                   /inference="protein motif:COGS:COG1381"
FT                   /inference="protein motif:COGS:COG0119"
FT                   /protein_id="CAJ91503.1"
FT                   /translation="MVTATHPHSLGKLSRIRHLARQYAALTKPRVTQLAVFCAIIGMFL
FT                   ATPGMVPWRVLIGGAAGIWLLAGAAFAINCLVEQKIDALMRRTAWRPSATGEITTPQTL
FT                   VFSAILGGAGMWLLHVYANDLTMWLTFATFLGYAVVYTILLKPATPQNIVIGGLSGAMP
FT                   PALGWAAVAGEVPAEAWFLVLIIFTWTPPHFWALALYRRADYAKSGLPMLPVTHGERYT
FT                   LLHILLYTLIMIAATLLPFVYGMSGYIYLAAALALGAGFLAYAWKMYRNYSDELAQRAF
FT                   RFSILYLSLLFAALLVDHYFKFVPQV"
FT   CDS_pept        370831..371451
FT                   /transl_table=11
FT                   /gene="sco2"
FT                   /locus_tag="H16_A0353"
FT                   /product="cytochrome oxidase assembly protein, Sco1/SenC
FT                   family"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91504"
FT                   /db_xref="GOA:Q0KER7"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KER7"
FT                   /inference="protein motif:COGS:COG1999"
FT                   /inference="protein motif:PFAM:SCO1-SenC"
FT                   /protein_id="CAJ91504.1"
FT                   /translation="MPRLSPASGLFAAFRRFSLLAALALAVAACGQQKASFRNVDITGA
FT                   ADFGKDFSLTDHHGKVRTIADFKGKAVVMFFGYTHCPDVCPTTMAELKAVMEKLGPDAD
FT                   RVQVLFVTVDPERDTQALLAQYVPAFDARFLGLRPADEAALQKLTKDFKVFYAKVPGSS
FT                   PNNYTVDHSAGSYVFDPDGKLRLFIRHGQGPDPIAHDLKQLLS"
FT   CDS_pept        complement(371558..372484)
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="H16_A0354"
FT                   /product="DNA-directed RNA polymerase sigma subunit (RpoH)"
FT                   /function="Transcription"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91505"
FT                   /db_xref="GOA:Q0KER6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KER6"
FT                   /inference="protein motif:COGS:COG0568"
FT                   /inference="protein motif:COGS:COG1191"
FT                   /protein_id="CAJ91505.1"
FT                   /translation="MNAVLSADQTLNNRLPTAPRSTGSFALTFPATVGNLDSYIQAVHR
FT                   IPLLTAEEEQRLARELRDHDSVDAARQMVMSHLRLVVSIARQYLGYGLPHADLIQEGNI
FT                   GLMKAVKRFDPDQGVRLVSYAMHWIKAEIHEYVLKNWRMVKVATTKAQRKLFFNLRSHK
FT                   QGAHTFTPEQVEAVARELNVKPEEVMEMETRLSGGDLALEGQIDDGEEEFAPIAYLADN
FT                   HNEPTRVLEAKRHDRMQVEGLEEALGKLDERSRRIIEARWLHVEDDGSGGSTLHELADE
FT                   FGVSAERIRQIEAAAMKKMKGALQAFA"
FT   CDS_pept        372825..373700
FT                   /transl_table=11
FT                   /gene="h16_A0355"
FT                   /locus_tag="H16_A0355"
FT                   /product="Pirin-like protein"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91506"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KER5"
FT                   /inference="protein motif:PFAM:Pirin"
FT                   /inference="protein motif:PFAM:PF05726"
FT                   /inference="protein motif:PFAM:Pirin_C"
FT                   /inference="protein motif:COGS:COG1741"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="CAJ91506.1"
FT                   /translation="MSAIEHLLKPHVRDLGDFTVRRLLPAAATQTVGPFIFFDHMGPVQ
FT                   LPPGGGADVRPHPHIGLATVTYLFEGEIIHRDSLGSDQAIRPGDVNWMTAGHGIVHSER
FT                   SPEHVRPAGARLHGIQTWVALPQEHEGAEPSFFHHPAATLPRIERPGVRMVVIAGDAFG
FT                   QVSPVKVFSRTLYVAIELDAGASVEIPADHAERGIYPVDGAVALDGEPLPAEHMVVLTP
FT                   GQPATLTATTPSRVMLLGGDPTDGHRFIYWNFVASSKVAIEAAAQRWEDDQFPHVPGET
FT                   ERIPLPPRKP"
FT   CDS_pept        complement(373720..374772)
FT                   /transl_table=11
FT                   /gene="trpD2"
FT                   /locus_tag="H16_A0356"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="2.4.2.18"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91507"
FT                   /db_xref="GOA:Q0KER4"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KER4"
FT                   /inference="protein motif:PFAM:Glycos_trans_3N"
FT                   /inference="protein motif:PFAM:Glycos_transf_3"
FT                   /inference="protein motif:COGS:COG0547"
FT                   /protein_id="CAJ91507.1"
FT                   /translation="MGAAAWLRYHEPRTDYPHAAMTTPATSFPAARYIKEIGRGVNGAR
FT                   ALPREDAQALFDAMLAGRVSDLELGAILMAYRIKGEAPHELAGMLEAAHAHCQPLPAPP
FT                   DRQVVVIPSYNGARKQPNLVPLLALLLAREDVPVLVHGTRLFNGRVTSMALFEALGVPL
FT                   CATTGDASARLRESSDLGPLAVLPVDVLSPGLSQLLERRTVIGLRNSAHTVAKMLQPVG
FT                   EHSPAEGLRLYSYTHPEYRETLTDYFSHEPANVLLARGTEGEVVADARRTSRIDWLHEG
FT                   HQQTLVDPAVGSLAEVPELPPGSDAGQTVAWIRRVLDGAAPVPAPIAIQVEAIRECLRQ
FT                   GTRVTWASPV"
FT   CDS_pept        complement(374822..375625)
FT                   /transl_table=11
FT                   /gene="h16_A0357"
FT                   /locus_tag="H16_A0357"
FT                   /product="ABC-type transporter, ATPase component: NitT
FT                   family"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91508"
FT                   /db_xref="GOA:Q0KER3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KER3"
FT                   /inference="protein motif:TCDB:3.A.1.16"
FT                   /inference="protein motif:COGS:COG1116"
FT                   /protein_id="CAJ91508.1"
FT                   /translation="MDKFVSIENVGQTFKTRKGPFVALRDINLHIAEGEFITLIGHSGC
FT                   GKSTLLNLVAGLATPTTGALICAGREIAGPGPERAVVFQNHSLLPWLTCFENVYLGVER
FT                   VFAASESKPQLKARTHDTLALVGLTHAENKYPHEISGGMKQRVGIARALAMAPKVLLMD
FT                   EPFGALDALTRAHLQDELIKIVARTRSTVVMVTHDVDEAVLLADRIIMMTNGPAATIGE
FT                   ILKVELPRPRDRVALADDKAYHACRTAVLDFLYRKQRNPALQEAA"
FT   CDS_pept        complement(375644..376549)
FT                   /transl_table=11
FT                   /gene="h16_A0358"
FT                   /locus_tag="H16_A0358"
FT                   /product="ABC-type transporter, permease component: NitT
FT                   family"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /note="6 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91509"
FT                   /db_xref="GOA:Q0KER2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KER2"
FT                   /inference="protein motif:TCDB:3.A.1.16"
FT                   /inference="protein motif:COGS:COG0600"
FT                   /protein_id="CAJ91509.1"
FT                   /translation="MNAIAHPTPDGATVAASADPDTKERARRREQEIAAQARRAQRREA
FT                   VAALVLKAVPPVLGFALFVLAWHGIATMIPAIPTPQATWNAAVPLFADPFYRNGPNDQG
FT                   IGWNVLASLARVAAGFGLAALVGIPAGFLIGRFAFLNAMTAPVISLLRPVSPLAWLPIG
FT                   LLLFKAANPAAIWAIFICSIWPMVINTAVGVTRVPQDYLNVARVLDLSEWKVFTRVLFP
FT                   AVLPYMLTGVRLSIGTAWLVIVAAEMLTGGTGIGFWLWDEWNNLKVEHIVIAIFVIGII
FT                   GLLLEHALLALARRFSYGTN"
FT   CDS_pept        complement(376601..377911)
FT                   /transl_table=11
FT                   /gene="h16_A0359"
FT                   /locus_tag="H16_A0359"
FT                   /product="ABC-type transporter, periplasmic component: NitT
FT                   family"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KER1"
FT                   /inference="protein motif:TCDB:3.A.1.16"
FT                   /inference="protein motif:COGS:COG0715"
FT                   /protein_id="CAJ91510.1"
FT                   /translation="MPSRLRIAKPLHAAVHVPDAAADAVPASSGRRRALATIAGASVMT
FT                   LVDPLVRAGAWAAGSDAPEKTDVRIGFIPLTDCASVVMAATLGLDKKYGIKITPTKEAS
FT                   WAGVRDKLVNGELDAAHVLYGLIYGVQLGIGGPKKDMAVLMNLNHNGQAITLSSKLAEK
FT                   GVKDGASLKALMMKEKRDYTFAQTFPTGTHAMWLYYWLAANGINPMQDAKAITVPPPQM
FT                   VANMRVGNMDGFCVGEPWGARAIADKIGFTAETTQAIWKGHPEKTLGTTAEFVQKYPNT
FT                   ARAMVAAVLEASKFIDASASNRRKTAETIAAKSYVNTDMDIILDRMLGRYTNGLGKTWD
FT                   DPDAMKFYQDGAANYPYLSDGMWFLTQHKRWGLLKEHPDYLAVARQVNRIDVYKQAAAA
FT                   AQVPLPKSDMRSAKLIDGVVWDGKDPKAYADGFKIKA"
FT   CDS_pept        complement(378277..378855)
FT                   /transl_table=11
FT                   /gene="h16_A0360"
FT                   /locus_tag="H16_A0360"
FT                   /product="response regulator with putative antiterminator
FT                   output"
FT                   /function="Signal transduction mechanisms"
FT                   /note="AmiR"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91511"
FT                   /db_xref="GOA:Q0KER0"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KER0"
FT                   /inference="protein motif:PFAM:ANTAR"
FT                   /inference="protein motif:SMART:smart00448"
FT                   /protein_id="CAJ91511.1"
FT                   /translation="MLRILLVRDPHDADPLNVETIRGGLVSAGFTEIQIVDADLRLPDV
FT                   ITATQPDMLIIASESAARDTIEHVCVSTQHAPRPIVLFTDNDDSQRIKAALTAGITAYI
FT                   VDGLRAERVKTVLDVAYTRFELDQQLRAELDATRLKLAERKVVERAKGLLMQARGLSED
FT                   EAYKRLRSMAMERGLKLVDAAQRVIDVMG"
FT   CDS_pept        379178..379879
FT                   /transl_table=11
FT                   /gene="h16_A0361"
FT                   /locus_tag="H16_A0361"
FT                   /product="putative fumarylacetoacetat hydroxylase"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /EC_number="3.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91512"
FT                   /db_xref="GOA:Q0KEQ9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEQ9"
FT                   /inference="protein motif:PFAM:FAA_hydrolase"
FT                   /inference="protein motif:COGS:COG0179"
FT                   /protein_id="CAJ91512.1"
FT                   /translation="MTEFVFAPAAPVGVPVRGSNASFPVRRVYCVGRNYAAHAREMGSD
FT                   PDREPPFFFCKPSDAVSYVADGTEGAFPYPPGTSNCHYEVELVVAIGKGGRDIPVDKAA
FT                   GHVFGYAVGLDMTRRDLQNESKKTGRPWETGKAFDQSAPIGPIVPVSAIGHPQKGAVTL
FT                   AVNGVEKQRGDLSDLIWSVPEMVSYLSKLFELQPGDLIFSGTPEGVGPVVKGDVMQCHV
FT                   GGVGDLTIKVV"
FT   CDS_pept        379884..380531
FT                   /transl_table=11
FT                   /gene="h16_A0362"
FT                   /locus_tag="H16_A0362"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91513"
FT                   /db_xref="GOA:Q0KEQ8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEQ8"
FT                   /inference="protein motif:PFAM:GST_N"
FT                   /inference="protein motif:COGS:COG0625"
FT                   /protein_id="CAJ91513.1"
FT                   /translation="MLKLYSYFRSSASFRVRIALELKGLSYDYVPVHLLKEGGQQLKPE
FT                   FRAVNPDGLVPALADGEHVLQQSLAIVEYLDEVHPEPKLLPGTALDRAYVRGLAQEIAC
FT                   EIHPLNNLRVLKYLKHTVGVTDEVKDAWYHHWIELGFASLQANLERGGKAGRFCFGDTP
FT                   TLADICLVPQVFNAQRFNIDLARYPAIARIYETCMELPAFQKAEPKAQPDAE"
FT   CDS_pept        complement(380549..381709)
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="H16_A0363"
FT                   /product="signal recognition particle receptor FtsY"
FT                   /function="Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91514"
FT                   /db_xref="GOA:Q0KEQ7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEQ7"
FT                   /inference="protein motif:COGS:COG0552"
FT                   /inference="protein motif:PFAM:PF00448"
FT                   /protein_id="CAJ91514.1"
FT                   /translation="MFSFWKKRKAEPAPAEAPAPAPAPVEVPAPVPAPAPTPAPVPAPA
FT                   PAPVPAQVPPPAPAPVAAPIPLPAPAPAEALELVPPPAQTAEAKLGWMHRLRTGLSKTS
FT                   RNIGTLFVGVKVDEALFEELETALLMADAGVEATEYLLGELRKRVKAERIETAEGVKAA
FT                   LRELLTQLLRPLEKTMALGREQPLVMMIAGVNGAGKTTSIGKLCKHFQRYDQKVLLAAG
FT                   DTFRAAAREQLTIWGERNNVTVVAQESGDPAAVIFDAVNAAKARGIDIVMADTAGRLPT
FT                   QLHLMEELKKVKRVISKAMPSAPHEVLLVIDANTGQNALQQTRAFDDALGLTGLIVTKL
FT                   DGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFKADEFAEALLG"
FT   CDS_pept        381928..383475
FT                   /transl_table=11
FT                   /gene="h16_A0364"
FT                   /locus_tag="H16_A0364"
FT                   /product="Predicted Zn-dependent peptidase, M16B subfamily"
FT                   /function="General function prediction only"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91515"
FT                   /db_xref="GOA:Q0KEQ6"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEQ6"
FT                   /inference="protein motif:MEROPS:M16.UPB"
FT                   /inference="protein motif:COGS:COG0612"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="CAJ91515.1"
FT                   /translation="MNHCAVLAAAGAQGTKACVATRFQRLSPSSKPLPARAARLARRVI
FT                   PTLLLALLPWSMPAGAQGVVASPMPGTQTAPAGATAHGTTEYRLSNGLRLIVKEDHRAP
FT                   TVAHQIWYRVGGIDEVSGTTGVAHMLEHMMFKGTPKVGVGEFSKQVAALGGRENAMTNR
FT                   DFTMYYQQIGKQYLPRMMELEADRMANLVITKDEFEREMKVVMEERRLRTDDSARGTVY
FT                   EQLLATVYTAAAYRHPVIGWMDDLVNMRVDDVKEWYRHWYVPNNAMVIVTGDVKAEEVR
FT                   ALAERYYGKLKPRTLPLRKDQEEPAQKGIKRIWVKAPAENQYMVMAYKVPRLRDIEKDV
FT                   DPYALEVLAAVLNGYDNARLTRELVREQRLADDVNVGYDSINRGESLFVLDGTPATGHN
FT                   TDEIERALRAEVQRIAKEGVSPEELKRVKAQVVAGQIYKRDSVFGQGMEIGVSEISDIS
FT                   WRQIDRMLDKIKAVTPAQVQAVAAKYFNDDNLTVATLVPQPIDPNKPKSQAPSGLRH"
FT   CDS_pept        383485..384867
FT                   /transl_table=11
FT                   /gene="h16_A0365"
FT                   /locus_tag="H16_A0365"
FT                   /product="Predicted Zn-dependent peptidase"
FT                   /function="General function prediction only"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91516"
FT                   /db_xref="GOA:Q0KEQ5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEQ5"
FT                   /inference="protein motif:COGS:COG0612"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="CAJ91516.1"
FT                   /translation="MTQSVTTPQRALRKLAGAALGAVVLLAAQLAQAAIPIEHWTASTG
FT                   ARVFFVHSPSIPMLDVNIDFDAGSRYDPPGKAGLATLTAALLDKGAAALEGQPARDEAK
FT                   IADGFADTGAAFGGAAGGDRGGIGLRTLTAQPELDQSVALAAQLIKAPTYPDAVVGREK
FT                   QRLITAIREADAKPGVIADKALAKAMYPDHPYGVAATPDSVASITRDDIVRFWRDNYGA
FT                   QRAVVTLIGAVDRKQAEAIAEQLTRGLPPGSAAPAMPQVRLNIAPSEQRMPHPAQQSSV
FT                   AIGQPAIARGDPDYFALLVGNYVLGGGGFSSRLTDEVREKRGLTYGVDSYFAPSKQPGP
FT                   FGISLQTKKAQTDEALALVRQVLARFVAEGPTEKELRAAKDNLINGFPLRIDNNRKLLT
FT                   NVANIGWYGLPLDYLDTWTAQIGKVTREQVRAAFQRHVRPDNMATVIVGGPVAAPATAA
FT                   RQ"
FT   sig_peptide     383485..383586
FT                   /gene="h16_A0365"
FT                   /locus_tag="H16_A0365"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        384950..385642
FT                   /transl_table=11
FT                   /gene="h16_A0366"
FT                   /locus_tag="H16_A0366"
FT                   /product="Methyltransferase"
FT                   /function="DNA replication, recombination, and repair"
FT                   /note="unknown EC_number=2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91517"
FT                   /db_xref="GOA:Q0KEQ4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEQ4"
FT                   /inference="protein motif:COGS:COG0742"
FT                   /inference="protein motif:PFAM:PF03602"
FT                   /protein_id="CAJ91517.1"
FT                   /translation="MNSRSRLPSPATGGRPASPAAASGGRSPVSAAPRQAPRQEPSQVR
FT                   IIGGRWKRTLLPVPDAQGLRPTPDRVRETLFNWLGQDLSGLECLDLFAGSGALGFEAAS
FT                   RGAAAVTLVESNARVAKQLRDNQYRLDAAQVRVMQGDAFAIAAQLPDASFDVVFLDPPF
FT                   AEDWVGPALEHAARLSRPGGAVYVETDHALTGADAPVPASLEIVRHARAGAVHFHLLQH
FT                   RVPGNGAA"
FT   sig_peptide     384950..385045
FT                   /gene="h16_A0366"
FT                   /locus_tag="H16_A0366"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        385883..386368
FT                   /transl_table=11
FT                   /gene="h16_A0367"
FT                   /locus_tag="H16_A0367"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /function="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91518"
FT                   /db_xref="GOA:Q0KEQ3"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEQ3"
FT                   /inference="protein motif:COGS:COG0669"
FT                   /protein_id="CAJ91518.1"
FT                   /translation="MVIAVYPGTFDPMTRGHEDLVRRASNIFDELVVGVAHSPNKRPFF
FT                   SLEERIGIAREVLGHYPNVRVEGFSGLLKDFVRNNNARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVERWLQEKIGKPE"
FT   CDS_pept        386437..386697
FT                   /transl_table=11
FT                   /gene="h16_A0368"
FT                   /locus_tag="H16_A0368"
FT                   /product="Ferredoxin"
FT                   /function="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91519"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEQ2"
FT                   /inference="protein motif:COGS:COG1145"
FT                   /inference="protein motif:PFAM:fer4"
FT                   /protein_id="CAJ91519.1"
FT                   /translation="MALMITDDCINCDVCEPECPNEAISMGPEIYEIDPNKCTECVGHF
FT                   DEPQCQQVCPVACIPKDPNRVETHEVLMQRYRLLTAAKHAA"
FT   CDS_pept        complement(386799..388649)
FT                   /transl_table=11
FT                   /gene="rfbB1"
FT                   /locus_tag="H16_A0369"
FT                   /product="dTDP-D-glucose 4,6-dehydratase"
FT                   /function="General function prediction only"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91520"
FT                   /db_xref="GOA:Q0KEQ1"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEQ1"
FT                   /inference="protein motif:COGS:COG3211"
FT                   /inference="protein motif:PFAM:PF05787"
FT                   /protein_id="CAJ91520.1"
FT                   /translation="MSYLTDQARAASRAAKPDADVPGQMLEDIVAANPARRRVLRGGLG
FT                   LSLASAFGSGLLAACGGDDDPAPAPAPAPAPAPAPAAAAPSYDVTFEPVAKSTADAVVV
FT                   PNGYSVDVLFSAGDPVEAGATGYAGAFQSSAETERQAGGNHDGMHYFALPGVDPQKGGL
FT                   LAINHELPDYKILFAGGTYDAATASPEQKRIALSAVGISVIEVELAASGKWQVKRDSIY
FT                   NKRYTGNTLYRVGGPAASVVGSTVVGMLNNCSSGHTPWGTYLTCEESTDNYIDPTQAEN
FT                   GYGWVVEVDPYGTLGSPAKRTAMGRFDHENVAFLTDASNNVAFYMGDDGTPGCIYKFIP
FT                   SKAFDPNNRAANANLLDSGTLYVARFNADGSGQWIELTQGKNGLTVGASDPGNWTQSAV
FT                   SPAPTTVDFASQADVLINTKSAARVAGGTLMDRPEWITAAPDKTLYCTLTNNSGRQQTD
FT                   AANPRKNNLHGHIVKWNEAGNSPLATTFTWSILLQAGDPSLATDNLKGNINGDTFSSPD
FT                   GLRVDPQGRLWVQTDSSTSATYTSTFGNNSMYYISPTGQSKRFLVGPTGCEITGIAYTP
FT                   DLTTCFINIQHPTGAWPDAAKPPRSSTIVVRRGDGKPIGA"
FT   CDS_pept        complement(388846..389442)
FT                   /transl_table=11
FT                   /gene="pth1"
FT                   /locus_tag="H16_A0370"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91521"
FT                   /db_xref="GOA:Q0KEQ0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEQ0"
FT                   /inference="protein motif:PFAM:PF01195"
FT                   /protein_id="CAJ91521.1"
FT                   /translation="MIKLIVGLGNPGAEYEATRHNAGFWLVDQLARMGGATMRVEGRFH
FT                   GLAARARLWDQDIWLLKPSTFMNRSGLAVVSLARFYKVLPDEIVVAHDEMDLPAGAAKL
FT                   KRGGGAGGHNGLKDISAHLSTQDYWRLRLGVGHPRNAPGGAGAGREDVVNFVLKPPRRE
FT                   EQEAIDAAIDRCIEPLGLLARGDAERAMAQLHTTR"
FT   CDS_pept        complement(389594..390211)
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="H16_A0371"
FT                   /product="LSU ribosomal protein L25"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91522"
FT                   /db_xref="GOA:Q0KEP9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEP9"
FT                   /inference="protein motif:PFAM:PF01386"
FT                   /protein_id="CAJ91522.1"
FT                   /translation="MKVVAFERSVQGTGASRRLRNSGKTPGIIYGGAAEPKMIELDHNA
FT                   LWHALKKEAFHSSILELEVAGKSEQALLRAFQMHPFKPLVLHVDFQRVSANDKIHVKVP
FT                   LHFMNQETAPGVKLGHGIVNHILNDLEVSCLPADLPEFIEVDLAAVELNQTVHLSDIKL
FT                   PKGVTVITHGDDNPAVASISQPAGAVSEAAEGGEAAGETPAA"
FT   CDS_pept        complement(390344..391297)
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="H16_A0372"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /function="Nucleotide transport and metabolism / Amino acid
FT                   transport and metabolism"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91523"
FT                   /db_xref="GOA:Q0KEP8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEP8"
FT                   /inference="protein motif:COGS:COG0462"
FT                   /protein_id="CAJ91523.1"
FT                   /translation="MSSEGLMVFTGNANPKLAEAVVQHLGIPLGKALVGRFSDGEVQVD
FT                   IQENVRGKHVIVLQSTCAPTNDNLMELMVMVDALKRASARSITAAMPYFGYARQDRRPR
FT                   SARVAISAKVVANMLEVAGVERVLTMDLHADQIQGFFDIPVDNIYASPVLLGDLREKNY
FT                   GDLLVVSPDVGGVVRARALAKELNCDLAIIDKRRPKANVAEVMNIIGEVDGRNCVIMDD
FT                   MIDTGGTLCKAAQVLKERGALKVFAYCTHPVLSGGAAARIADSALDEVVVCDTIPLSEE
FT                   AAKCTKIRQLSTAPLLAETFTRIVKGDSIMSLFAGS"
FT   tRNA            complement(391392..391468)
FT                   /gene="tRNA-Gln (TTG)"
FT                   /locus_tag="H16_A0373"
FT                   /product="transfer RNA-Gln (TTG)"
FT   CDS_pept        complement(391528..392406)
FT                   /transl_table=11
FT                   /gene="h16_A0374"
FT                   /locus_tag="H16_A0374"
FT                   /product="4-Diphosphocytidyl-2-C-methyl-D-erythritol
FT                   2-phosphate kinase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91524"
FT                   /db_xref="GOA:Q0KEP7"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEP7"
FT                   /inference="protein motif:COGS:COG1947"
FT                   /protein_id="CAJ91524.1"
FT                   /translation="MHRSQPLPPPELRDCPAPAKLNLFLHVTGRRADGYHTLQTVFQLV
FT                   DWCDTLHFRRRDDGVVARVTDVPGVPAETDLVVRAARALQAATGATFGADIAIDKVLPM
FT                   GGGIGGGSSDAATTLLALNHLWGLGLARAELMRIGLALGADVPVFVLGQNAFAQGIGED
FT                   LTPVELPESWFVVIHPKQHVPTAEIFSDECLTRDTPLSIIAVFAARTNKFDFGRNDLEP
FT                   IATAKFGEVARALAWLKQHNQHARMTGSGACVFARFPDAATAQQVLERLPPEWDGRCVR
FT                   SLARHPLAALA"
FT   CDS_pept        complement(392415..393008)
FT                   /transl_table=11
FT                   /gene="lolB"
FT                   /locus_tag="H16_A0375"
FT                   /product="outer membrane lipoprotein involved in outer
FT                   membrane biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91525"
FT                   /db_xref="GOA:Q0KEP6"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEP6"
FT                   /inference="protein motif:PFAM:PF03550"
FT                   /protein_id="CAJ91525.1"
FT                   /translation="MNRSRRLALFCLGAPLLLQACASVAPSRSFDGDQAAASQQYTGRF
FT                   SANYVRYGRDEGVQGSFRWEEQGRNVRLDLVSPLGQTLAVVTATPSGATLDLPNQPPRN
FT                   APEVDTLMEEALGFALPVAGMRDWLHGRATQGAPARTTRDEQGRLATLAQNGWTVRYVA
FT                   WQDAAAQVPRRIDLARDAGSNPLSVRLVIDPRTP"
FT   sig_peptide     complement(392940..393008)
FT                   /gene="lolB"
FT                   /locus_tag="H16_A0375"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(393102..395057)
FT                   /transl_table=11
FT                   /gene="h16_A0376"
FT                   /locus_tag="H16_A0376"
FT                   /product="O-linked N-acetylglucosamine transferase OGT"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91526"
FT                   /db_xref="GOA:Q0KEP5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEP5"
FT                   /inference="protein motif:CDD:cd00189"
FT                   /inference="protein motif:COGS:COG4700"
FT                   /protein_id="CAJ91526.1"
FT                   /translation="MSDLMPDLMPDSTLQATAGGLPIAFPGAVSRTARTAGALARFFQA
FT                   PRRHARALAASALLALAAGTSHAAPPAGAMPLPPALQLAAAESERPAAARSARSALPSL
FT                   ELTDDIVYMVLAAEISMQRGLVGPAYRTYMELARQTRDPRFAQRATEIAFNARIPQQAL
FT                   DSARLWKEISPTSPAAAQVLSTLLVLNGRWDDARPLLQQQLAAVPASQRGEAILQLQQQ
FT                   LSRTSDAAGAATLLQDLTKNDAKLPETQLALARAREVAGDEPGALAALDQALRLRPGYE
FT                   AAALMAAELRAEKQPDEAVAILKRFLDKSPDSVNGHITLARLYLLRNDMQSARQEFETL
FT                   RKVAPGDPRVPLALGLTSLQAKSYGEAEQYLKEYLQLVEKQPTANPDIAYQYLAQIAEE
FT                   RKDYAGAIRWLDRIEDIRLAPAATAKRAQLLARMGKLDDAQALFGEMLTDAEDISDPGQ
FT                   RAQRMTAIRQAEVATLMESKAYDRARKLLNDRITAEPDNADWIYELAMLDERQKRYDSM
FT                   EKGLRKVIALQPQQKQGYNALGYSLADRNERLPEALKLLERASELGPDDPYIMDSLAWV
FT                   KFRMGDLRPAADLLRNAYSKAPEAEIGAHLGEVLWQLGEHDEARKTWTEAVRIDPENET
FT                   LVDTLRRYKVNVQVSK"
FT   CDS_pept        395212..396090
FT                   /transl_table=11
FT                   /gene="h16_A0377"
FT                   /locus_tag="H16_A0377"
FT                   /product="Formamidopyrimidine-DNA glycosylase"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91527"
FT                   /db_xref="GOA:Q0KEP4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEP4"
FT                   /inference="protein motif:COGS:COG0266"
FT                   /protein_id="CAJ91527.1"
FT                   /translation="MPELPEVEVTRRGLLPHVVGRRIAAVTVRHRGLRWPVDPQLEMRL
FT                   AQRVVRRIERRGKYLLLECVSEAAGEPAGWLLVHLGMTGTLRVLPEAPSPGAHDHLDLV
FT                   LAPGPGAALGTKPGTIVLRFRDPRRFGAILWSTLPEAELPSHPLLRTLGIEPFDPAFDG
FT                   AWLHRHTRGRSAAIKTVLLAGGIVVGVGNIYASESLFRAGIRPTTPAGRLSRARCDRLA
FT                   QAVRETLAQAIERGGSTLRDFVGSDGASGYFQLDCLVYDRAGQPCRVCATPVRQIVQGQ
FT                   RSTFYCPNCQH"
FT   CDS_pept        396369..398321
FT                   /transl_table=11
FT                   /gene="h16_A0378"
FT                   /locus_tag="H16_A0378"
FT                   /product="Predicted GTPase"
FT                   /function="General function prediction only"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91528"
FT                   /db_xref="GOA:Q0KEP3"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEP3"
FT                   /protein_id="CAJ91528.1"
FT                   /translation="MTTLAHQFEQYGAWRTGVLQSLAEFQSWLQQHDLYDAQADDRVQR
FT                   IQSVLRSDRLKVAFIAEFSRGKSELINAIFFADYGRRILPSSAGRTTMCPTELRYDEAE
FT                   PPCIRLLPIETRLQEASTADFLEAGTSASHWHSVPLDPSSPEGMLAAFQHVVQTVRVPP
FT                   AQAEALGLYHENDPDAAYAVDAEGMVEISRWRHAVINFPHPLLRQGLVILDTPGLNAIG
FT                   TEPELTLRLIPDAHVVVFVLAADAGVTKSDLELWRSHVGAGHRRGCLAVLNKIDGLWDP
FT                   LREPGEIAQEIARQVSTTAQVLGIEQSRVYPVSAQKGLVAKVTHDDELLARSGLPEFEH
FT                   VLSDQLIPRRREIVSDQAHRLVQDMARAAQQLLQSRRRDIVEQLFELRGLRGKNHAMVK
FT                   HMLMRVQGEKEEFEQSISKFQALRLVFGRHSADIIKSLQLRDVRLTMRSAREQMKERFF
FT                   SRGLREDMDALFAQLTRLVTDADNKIGQLHQLIESMYRRFNAEHGFTLPAPMQFTAERY
FT                   VAELEETLRLVHAHFGTVSMLTRSRPQLVQSAFSTMASRVLENFRDLNRDIEVWLKSVM
FT                   TPLEAQVREHQKQLRRRVDSIERIHEATDTLESRIAELEEVLNGLDERSGRIEGYAQRL
FT                   LRPTAAADSASLAVA"
FT   CDS_pept        398414..399592
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="H16_A0379"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91529"
FT                   /db_xref="GOA:Q0KEP2"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEP2"
FT                   /inference="protein motif:COGS:COG1194"
FT                   /protein_id="CAJ91529.1"
FT                   /translation="MPRKPAPRAVPAIPDDICVPPDFGASVVDWQRQHGRHDLPWQNTR
FT                   DPYRIWLSEIMLQQTQVSAVIDYFQRFVSQLPTVQALAAAPADQVMALWAGLGYYSRAR
FT                   NLHRCAMQVVSEHGGRFPTDPAVLATLPGIGRSTAAAIAAFSAGVRSPILDGNVKRVFA
FT                   RCFGIHGHPGERVVETRMWQLAELALPAAGPRQAEDMIAYTQGLMDLGATVCSRGKPAC
FT                   LADAGACPLSADCVARRDGLTGVLPTPKPRAAIPERSTVMLLVRRQREVLLRLRPGSGI
FT                   WGGLWSLPEMPVDSVPFDTEAAEAAALDYARAFGKPARAALTGELTHVFTHFRLLIRAI
FT                   RVDVSADGASLMAQDGAAEAAQRWISLDDLDAVGTPAPVRRLLEDQARGGLF"
FT   CDS_pept        complement(399597..400256)
FT                   /transl_table=11
FT                   /gene="h16_A0380"
FT                   /locus_tag="H16_A0380"
FT                   /product="Uncharacterized protein, similar to the
FT                   N-terminal domain of Lon protease"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91530"
FT                   /db_xref="GOA:Q0KEP1"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEP1"
FT                   /inference="protein motif:COGS:COG2802"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /inference="protein motif:COGS:COG0466"
FT                   /protein_id="CAJ91530.1"
FT                   /translation="MSSTDLYRPTASEDPPRTLDNLPLFPLHTVLFPGGRLPLRVFEAR
FT                   YVDMVRNCLRDNTPFGVCLIESGEEVARPDQPTVPELIGCLAEIVDCNMEQLGVLLIRA
FT                   RGRERFHIVSHDTRDDGLLVARAEVLPPDIIDCKLELLGECLDALRRIVTRLHAEQPDR
FT                   LPFDEPYLWDDPSWVANRLCELLPVPLKAKQMLMALPDAGMRIEIVHRYMRQNHML"
FT   CDS_pept        complement(400348..401232)
FT                   /transl_table=11
FT                   /gene="h16_A0381"
FT                   /locus_tag="H16_A0381"
FT                   /product="Predicted P-loop-containing kinase"
FT                   /function="General function prediction only"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91531"
FT                   /db_xref="GOA:Q0KEP0"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEP0"
FT                   /inference="protein motif:COGS:COG1660"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="CAJ91531.1"
FT                   /translation="MRIILITGISGSGKSVALNVLEDAGYYCVDNLPAQFIPELTRYLD
FT                   SQGYTHLGVATDIRSRESLDQLPDTVRALAAEHQVEVVFLTASTDALVQRYSETRRRHP
FT                   LSVRTDGVPGPGGEPAFNDTALMEAIEMERALLSPLAEAAHRIDTSNVRTNTLRSWIKE
FT                   LIRDDSQRLTLLFESFGFKHGVPSDADMVFDVRSLPNPYYDLALRPLTGRDTPVIDFLQ
FT                   AQPMVLAMAEDIRAYVEKWLPSFIADNRSYLTVAIGCTGGQHRSVYIAERLANYFRAHG
FT                   NVLVRHRELAPAG"
FT   CDS_pept        complement(401351..401752)
FT                   /transl_table=11
FT                   /gene="h16_A0382"
FT                   /locus_tag="H16_A0382"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91532"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEN9"
FT                   /protein_id="CAJ91532.1"
FT                   /translation="MKKLIAMCALVTPMIAASAFAQTTATPATPATPAKPAATAPATPA
FT                   MPATPATPATPATPDKPAANAQQDKMKACNTQAAGKKGDERKAFMKECLSKGASKTQQE
FT                   KMASCSKSGKGKKGDEYKAYMKECLSKAA"
FT   CDS_pept        complement(401915..402886)
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="H16_A0383"
FT                   /product="serine kinase of the HPr protein"
FT                   /function="Signal transduction mechanisms"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91533"
FT                   /db_xref="GOA:Q0KEN8"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEN8"
FT                   /inference="protein motif:COGS:COG1493"
FT                   /protein_id="CAJ91533.1"
FT                   /translation="MELTGVTSQSIFDDNAADIKLSWVAGLEGADRAFDVEFAREATSA
FT                   ADLVGHLNLIHPNRIQVLGKPEITYYQRLDDETRKRQMGELILLEPPFLVIADGMEPPP
FT                   DLELRCTRSSTPLFTTPVSSAAVIDHLRLYLSRISAPRVTMHGVFLDILGMGVLIMGES
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFIEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKIKLVVQLVRRNDGEFERLPLDSQYLDVLGLPIHMVKIQVAAGRNLAVL
FT                   VEAAVRNTILRLRGIDTLRDFMDRQRAAMQADAVSRGQGRLL"
FT   CDS_pept        complement(402968..403423)
FT                   /transl_table=11
FT                   /gene="h16_A0384"
FT                   /locus_tag="H16_A0384"
FT                   /product="phosphotransferase system
FT                   mannitol/fructose-specific IIA domain protein (Ntr-type)"
FT                   /function="Carbohydrate transport and metabolism / Signal
FT                   transduction mechanisms"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91534"
FT                   /db_xref="GOA:Q0KEN7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEN7"
FT                   /inference="protein motif:CDD:cd00211"
FT                   /inference="protein motif:COGS:COG1762"
FT                   /protein_id="CAJ91534.1"
FT                   /translation="MNRLAKLLPPGNITLDVSVTSKKRVFEQAGLLFENNHGVARAIVT
FT                   DNLFARESLGSTGLGAGVAIPHGRIKGLKQPLAAFMRLAEPIPFESPDGKPVSLLIFLL
FT                   VPEQATQQHLEILSEIAQLLSDRDMREGLATLPTPDAVHQLLIAWHP"
FT   CDS_pept        complement(403441..403740)
FT                   /transl_table=11
FT                   /gene="h16_A0385"
FT                   /locus_tag="H16_A0385"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91535"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEN6"
FT                   /protein_id="CAJ91535.1"
FT                   /translation="MAPEPMLFTRMSKGVRKRCAKVYAAPYKERESWPCPAPVHRLPAA
FT                   EAPLHHHVSFCTGLPRCAAQCGSSRCSIMGRTPPARPTAGRSRPTARRNGPPAN"
FT   CDS_pept        complement(403880..404230)
FT                   /transl_table=11
FT                   /gene="h16_A0386"
FT                   /locus_tag="H16_A0386"
FT                   /product="Sigma54 (RpoN) modulation protein"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /note="unknown EC_number 2.7.76"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91536"
FT                   /db_xref="GOA:P28613"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28613"
FT                   /inference="protein motif:PFAM:PF02482"
FT                   /inference="protein motif:COGS:COG1544"
FT                   /protein_id="CAJ91536.1"
FT                   /translation="MNFKISGHHLDITPPLREYVETKLERIVRHFDQVIGVSVLLSVDN
FT                   HKEKDRRQYAEINLHLKGKDIFVEAHHEDLYAAIDALVDKLDRQVIRYKDRVQGHDREA
FT                   VKYQMAAAQMQQ"
FT   CDS_pept        complement(404279..405760)
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="H16_A0387"
FT                   /product="DNA-directed RNA polymerase sigma subunit (RpoN)"
FT                   /function="Transcription"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91537"
FT                   /db_xref="GOA:P28615"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28615"
FT                   /inference="protein motif:COGS:COG1508"
FT                   /protein_id="CAJ91537.1"
FT                   /translation="MKPSLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVEQALTENP
FT                   LLERENDWIESPLRVAADGSVNLQSAPAPAPAEPQGNGEARADGAADDDSYGDSGNGDD
FT                   YGSSDWSLDDFARRPQGDEDEKTPMQLREAEPTLREYLMEQLTPLKISARDKGLAIFLI
FT                   ESLDDDGYLSASLEEICTELPEELEFEIEEVHAILTLLQSFDPPGVGARNAAECLALQL
FT                   RRLTHPQRELALNIVTNHLELLAVRDYTRLKKALQVDEAALKSAHELIRSLAPYPGHAY
FT                   SRPEADFVVPDVFVRKGGGGWIAQLNPDVMPRLRINDMYAQILRGAKGESGTAGLQQKL
FT                   QEARWLIKNIQQRFDKILRVSQAIVERQKNFFSHGEIAMRPLVLREIADTLGLHESTIS
FT                   RVTTNKYMATPMGTFELKYFFGSHVSTETGGAASSTAIRALIKQLIGAEDPRNPLSDSR
FT                   IAELLGEQGFVVARRTVAKYREALKIPAVNLRKSL"
FT   CDS_pept        complement(405895..406695)
FT                   /transl_table=11
FT                   /gene="h16_A0388"
FT                   /locus_tag="H16_A0388"
FT                   /product="ABC-type transporter, ATPase component: HAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="3.6.3.22"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91538"
FT                   /db_xref="GOA:Q0KEN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEN3"
FT                   /inference="protein motif:TCDB:3.A.1.4"
FT                   /inference="protein motif:COGS:COG1137"
FT                   /protein_id="CAJ91538.1"
FT                   /translation="MTDTATIADKPSVEASTVLAGGSTLVVRHLKKRYGSRTVVKDVSL
FT                   DVKSGEVVGLLGPNGAGKTTSFYMLVGLVALDEGDIVLDGDHISGLPIHERARMGLSYL
FT                   PQEASVFRKLNVEENIRAVLELQVSNGKPLPKAEIERRLDSLLDDLQIAHLRNNPALSL
FT                   SGGERRRVEIARALASSPRFILLDEPFAGVDPIAVGEIQRIVSFLKARNIGVLITDHNV
FT                   RETLGICDHAYIISEGTVLAAGQPEEIIANDAVRRVYLGENFRM"
FT   CDS_pept        complement(406764..407414)
FT                   /transl_table=11
FT                   /gene="h16_A0389"
FT                   /locus_tag="H16_A0389"
FT                   /product="OstA-like protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91539"
FT                   /db_xref="GOA:Q0KEN2"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEN2"
FT                   /inference="protein motif:COGS:COG1934"
FT                   /protein_id="CAJ91539.1"
FT                   /translation="MTASLTTSSRRRTAPALLALAMAFGLLAQPALAERADRDKPMVLE
FT                   ADNASYDDVKQIYTLTGNVVLTKGTMILKSDAAELRTDPEGYQFAVATAKPGKQAYIRQ
FT                   KREGVDEYIDGWGDRIEYDGKQEYSKLIGNARMARLQGAKQVDEIRGAVLTYDSRKEFY
FT                   TAAGGGSGDAAAANPSGRVRAVLSPRQDQKAGATGSGGSPLDLKPAPAPANKP"
FT   CDS_pept        complement(407482..408111)
FT                   /transl_table=11
FT                   /gene="h16_A0390"
FT                   /locus_tag="H16_A0390"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91540"
FT                   /db_xref="GOA:Q0KEN1"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEN1"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /inference="protein motif:COGS:COG3117"
FT                   /protein_id="CAJ91540.1"
FT                   /translation="MQALLASLSGIVMRLLPLLLMAFVAGSTFWLVQINSPKEDPAAQS
FT                   AKKHEPDYFMDRFSATELAPDGSTKIRFTGERMVHFEDDQTYEVTRPAMRAYEPDRPPV
FT                   TARADMGRMNAEGSVIDLYGNGFVMRQQGVDVSKDPQLTAASSYFQLLVNDDIVKTDKP
FT                   VKLTRGPSVMTANGLIFNNVTREVQLLGNVRGTIITGPTPGRAPGS"
FT   CDS_pept        complement(408155..409156)
FT                   /transl_table=11
FT                   /gene="gutQ"
FT                   /locus_tag="H16_A0391"
FT                   /product="predicted sugar phosphate isomerase involved in
FT                   capsule formation"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91541"
FT                   /db_xref="GOA:Q0KEN0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEN0"
FT                   /inference="protein motif:COGS:COG0794"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="CAJ91541.1"
FT                   /translation="MVYFVAMIANFDADRALRLARDTLQTEADAVSALSGRLNGDFARA
FT                   VLLILQCTGRVVVSGIGKSGHIGRKVAATLASTGTPAFFVHPAEASHGDLGMVTRDDVL
FT                   IAFSNSGETGELLSIIPIVKRIGARLISVTGNPDSNLAKLADVHLDAAVEKEACPLNLA
FT                   PTASTTAALALGDALAVAVLDARGFGEEDFARSHPGGALGRKLLTHVRDVMRTGNAVPE
FT                   VRENTPLAQALMEITRKGMAMTAVVDPDGHAIGVFTDGDLRRLLETPRDWKTVPIGDVM
FT                   HRNPHVVNENQLAVEAVQVMEANRINQLLVVDDDGRLTGALHIHDLTRAKVI"
FT   CDS_pept        409280..411259
FT                   /transl_table=11
FT                   /gene="kefC1"
FT                   /locus_tag="H16_A0392"
FT                   /product="Kef-type K+ transport system, membrane and
FT                   NAD-binding component"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /note="11 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91542"
FT                   /db_xref="GOA:Q0KEM9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEM9"
FT                   /inference="protein motif:TCDB:2.A.37"
FT                   /inference="protein motif:COGS:COG0475"
FT                   /inference="protein motif:COGS:COG1226"
FT                   /protein_id="CAJ91542.1"
FT                   /translation="MHSPLELTLVLLAAAVFGVVAFRMLQLPPMLGYLAVGILIGPHAL
FT                   GLASDTAQTKYLAEFGVVFLMFSIGLEFNLTKLRSMKRLVFGLGGSQVVLSMLAVVPAS
FT                   WAFNWLFPLSWQASVALGGALAMSSTAIVSKMLSERMELESEQGRNIISILLFQDLAVV
FT                   PLLIVIPALSRDPGDLMVALGLATVKIVVALGVIFFLGQRLMSRWFHVVAARRSQELFM
FT                   LNLLLVTLGMAALTERLGLSMALGAFMAGMLISETPYRHQVEEDIKPFRDVLLGLFFVT
FT                   IGMLLNIRVVLDHVWLVLALLVVPVLFKLVLIALLARVFGSRQGVAIRTGLGLAQAGEF
FT                   GFVLLNQIDGLNLVDPVLIQVILASMLLSMLAAPFLIQYSDAIVLRFAANEWLMQSLNM
FT                   TRIAAQSLQTEKHAIICGFGRSGQNLAHMLEREGINYVALDLDPDRVREAAAAGDTVVY
FT                   GDAGRREALIAAGIHRAAALIVTYANTPSALKVLHHVQELAPALPVIVRTVDDSELDTL
FT                   QKAGATEVVPEIIEGSLMLASHALVLLGVPMRHVLRGVQEARDARYSLLRGYFHGRDDD
FT                   EDMVERDSVRLHSVSLGPQSTAVGRRLGVLGLERIGVEVTAVRRRGIRAFDPEPETVLE
FT                   PGDIVVLRGPPEALEAAETRILNG"
FT   CDS_pept        complement(411278..411652)
FT                   /transl_table=11
FT                   /gene="h16_A0393"
FT                   /locus_tag="H16_A0393"
FT                   /product="Uncharacterized protein related to arylsulfate
FT                   sulfotransferase involved in siderophore biosynthesis"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91543"
FT                   /db_xref="GOA:Q0KEM8"
FT                   /db_xref="InterPro:IPR027373"
FT                   /db_xref="InterPro:IPR038268"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEM8"
FT                   /inference="protein motif:COGS:COG4321"
FT                   /protein_id="CAJ91543.1"
FT                   /translation="MCEIFIRANPASYQSQSRSLRLHGVATSIRLESLFWEVLEELARR
FT                   DDMTVNQLITRLHDELTEHRGSEAVAGNFSSFLRVCCLRYLMLQGEGRIPADASVPIRS
FT                   LDARAVLDNLPESWVEARPH"
FT   CDS_pept        complement(411753..412331)
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="H16_A0394"
FT                   /product="putative intracellular protease/amidase/DJ-1/PfpI
FT                   family"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91544"
FT                   /db_xref="GOA:Q0KEM7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEM7"
FT                   /inference="protein motif:COGS:COG0693"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="CAJ91544.1"
FT                   /translation="MAKKILMLVGDYAEDYETMVPFQALQMVGHTVHAACPDKQAGDAC
FT                   ATAIHDFEGDQTYTEKRGHNFTLNASFAEIDPAGYDALVIPGGRAPEYLRLNARVLEIV
FT                   RHFAQADKPIAAVCHGAQLLAAAGVLEGKTCSAYPACAPEVKLAGGTYADIPVDQAHTD
FT                   GNLVTAPAWPAHPAWLAQFLAVLGTRIVH"
FT   CDS_pept        412548..413120
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="H16_A0395"
FT                   /product="Adenine/guanine phosphoribosyltransferase"
FT                   /function="Nucleotide transport and metabolism"
FT                   /EC_number="2.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91545"
FT                   /db_xref="GOA:Q0KEM6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEM6"
FT                   /inference="protein motif:COGS:COG0503"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="CAJ91545.1"
FT                   /translation="MADSIIQSPELGDVTGYLRERIRTVPDWPMPGVMFRDITPLLQNP
FT                   KTLRVLIDVFVHRYMDAQLDLVAGIDARGFILGAIVAYELNLGFVPIRKKGKLPFQTVA
FT                   EEYELEYGSATVEIHADACKSGDRVLLVDDLIATGGTMMAGLKLLERLGATVVEGAAIV
FT                   DLPELGGSKLLQDGGLPLFTVCKFEGH"
FT   CDS_pept        413164..413775
FT                   /transl_table=11
FT                   /gene="h16_A0396"
FT                   /locus_tag="H16_A0396"
FT                   /product="putative threonine efflux protein"
FT                   /function="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91546"
FT                   /db_xref="GOA:Q0KEM5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEM5"
FT                   /inference="protein motif:COGS:COG1280"
FT                   /protein_id="CAJ91546.1"
FT                   /translation="MPDLLLFLLTSIAVTVAPGPDNLQVLARGMAQGRRAGLVAALGFS
FT                   VGCLFHTVIAAVGLAAVLRSSPLAFQLIKYAGAAYLIWIGIQALRAKGGLAQGGDVDAV
FT                   PLARVFRQSVLGNIMNPKVTLFFLVFLPQFVRADAAHPGLQFLLLGVVFMLQTAVVFSL
FT                   FGLCAGWLGAWLRRRPATGRWLDRAAGAIFVGLGIKVALP"
FT   CDS_pept        413945..415624
FT                   /transl_table=11
FT                   /gene="nptA1"
FT                   /locus_tag="H16_A0397"
FT                   /product="Na+/phosphate symporter"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91547"
FT                   /db_xref="GOA:Q0KEM4"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEM4"
FT                   /inference="protein motif:COGS:COG1283"
FT                   /protein_id="CAJ91547.1"
FT                   /translation="MGVLLHLLSGVALLVWGTNIVKVGILRVYGANLRHVLSTSVSNRF
FT                   TAFLAGLGVTGLVQSSNATAVIVSSFVGQGLIAVAPALAIMLGANVGTALMVQVFSLDL
FT                   SWLSPLLIFVGVICHLTWKGSRAGHVGRVLIGLGLITLALELISIATRPVVQAAGVKVL
FT                   FASLTGDAGLDMLVGAFLTILCYSSLAVVLFCGALASAGVVSIHVALALVLGANLGSGI
FT                   SALLTTSGNNQPGKRVTLGNLLSRLLGCLVALPLLGQAEELLALLDHDPQRLIVNFHLL
FT                   FNVALAVLLLGATAPLARLCEKVLPGRNTGDSQVTPRHLDTAALSTPTLALANAAREVL
FT                   RIGDRVEQMLDNMLRVLRTNDAKLADATCRIDNEVDDLYTAIKLYLTRISLEALDERDG
FT                   QRWTEIISLTINLEHAGDIIERILLDTKDKKIAHNLMFSEAGMQEIAEMHARLVANLRL
FT                   GLSVFLNGDLKSAQALMAEKANFRELERKYARTHLQRVAVQTAESIETSSLHLDVISEL
FT                   KRLNSLFCATAYPVLEQAGVLNRSRMKEDDVPAVPAVQAAQH"
FT   CDS_pept        complement(415634..416119)
FT                   /transl_table=11
FT                   /gene="h16_A0398"
FT                   /locus_tag="H16_A0398"
FT                   /product="uncharacterized conserved protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91548"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEM3"
FT                   /inference="protein motif:COGS:COG1839"
FT                   /inference="protein motif:PFAM:PF04008"
FT                   /protein_id="CAJ91548.1"
FT                   /translation="MELTVVPVTKPEATNFIFGHSHFIKTVEDLHEALVGTVPGILFGL
FT                   AFCEASGKRLVRWSGTDEDLIDLACENARAIGAGHTFVIFLGDGFFPVNVLAAVRAVPE
FT                   VCRIFCATANPTEVIIAQTDAGRGVVGVIDGASPLGIETDADVAERKALLRKFGYKL"
FT   CDS_pept        416262..416855
FT                   /transl_table=11
FT                   /gene="h16_A0399"
FT                   /locus_tag="H16_A0399"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91549"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEM2"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /inference="protein motif:COGS:COG2062"
FT                   /protein_id="CAJ91549.1"
FT                   /translation="MPLLRLFLAWLAMAPCVAAAQVVPASQGEIAVSELKRPNVVVVLR
FT                   HASAPGVGDPPGFKLDDCSTQRNLDANGRQQAARLGSSWKAAGFRPTRVYSSAWCRCQD
FT                   TARLIDLGPVRVQPLLNSFFGADAQRREAQTAQLSRFIDGLDPRGGPYLLVTHQVVITA
FT                   LSGHGADSGGGVAIELQPGGAPRRARVLPNAGLD"
FT   CDS_pept        complement(416981..419842)
FT                   /transl_table=11
FT                   /gene="uvrA1"
FT                   /locus_tag="H16_A0400"
FT                   /product="Excinuclease ABC, ATPase subunit (A)"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91550"
FT                   /db_xref="GOA:Q0KEM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEM1"
FT                   /inference="protein motif:COGS:COG0178"
FT                   /protein_id="CAJ91550.1"
FT                   /translation="MEEIKIRGARTHNLKNINLDLPRNRLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLYARAGTPYCPDHNLPLQAQSVSQMVDAALALPEDTKLMILAPVVADRKGEHS
FT                   DLFDSMQAQGFVRFRIRSGGGTAHEAEAKVYEVDALPKLKKTEKHTIEVVVDRVKVRAD
FT                   IKQRLAESFETALRLADGRALALELDSGKEHMFSSKFACPICSYSLQELEPRLFSFNNP
FT                   MGACPSCDGLGQITFFDPKRVVAFPNLSLASGAIKGWDRRNQFYFQMLQGLAAYYDFDT
FT                   ETPFEELPENVQQSVLHGSGEQEIPFTYINERGRTTVREHVFEGIIPNLERRYRETDSV
FT                   AVREELAKYQNNQPCPACQGTRLRTEARHVKLGEGEQARAIFEINGWPLRDALTYFLTL
FT                   DMHGAKREIGDKIIKEISARLNFLNNVGLDYLSLERSADTLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLIGTLKHLRDIGNSVLVVEHDEDMIRACDYVVDIGPGA
FT                   GVHGGMIVAEGTPRQIEESPASLTGQYLSGQRRIEVPKERAAPDDERLLRIVNASGNNL
FT                   RNVTAEVPVGLLTCITGVSGSGKSTLINDTLYHAVARHLYGSTPEPAPHDRIEGLEHFD
FT                   KVINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPSAKERGYDPGRFSFNVKGGRCES
FT                   CQGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLEVLYKGKNISEVLDLTVEQAHEFFS
FT                   AVPVVRRKLQTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPT
FT                   TGLHFHDIELLLKVIHKLRDQGNTVVIIEHNLDVIKTADWLIDMGPEGGAGGGQVIARG
FT                   TPEDVARSKASFTGKYLKPLLER"
FT   CDS_pept        420209..421459
FT                   /transl_table=11
FT                   /gene="h16_A0401"
FT                   /locus_tag="H16_A0401"
FT                   /product="MFS transporter, Sugar (and other) family"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91551"
FT                   /db_xref="GOA:Q0KEM0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEM0"
FT                   /inference="protein motif:COGS:COG2814"
FT                   /protein_id="CAJ91551.1"
FT                   /translation="MPSIQSSSPGAGAADASQAPARERMTRAELRAAVSLASIFALRML
FT                   GLFLILPVFAEYAHSLPDGHDAQRVGLAMGIYGLMQAFLHIPLGWLSDRIGRKPVMVAG
FT                   LLLFIAGGLVAAFSDTLSGIIAGRALQGTGAISAAITACIADLTRERHRTKAMAMVGGS
FT                   IGLTFALSLVIASPLLHSIGMSGIFGLMSVLGLVAIGVTLFLVPTPPPPHPVRLPFRKV
FT                   LLNADLARLNVGVLALHASQVAMFMVVPTMLADAGMPLDQHWKVYLPVVLVSFVLMLGP
FT                   MMAAERYGRVRPVLLGAVALMTAVQLLFAAVHGLWAIVGVLLLFFVAFNVLEAMQPSLV
FT                   SRYAAAARGAALGVYNTTQALGLFLGGAAGGWLLKHEGRSAVFVGCAVVLLLWLIIAWS
FT                   MKAPPARGQEAAPATPA"
FT   CDS_pept        421642..422181
FT                   /transl_table=11
FT                   /gene="h16_A0402"
FT                   /locus_tag="H16_A0402"
FT                   /product="Single-strand binding protein"
FT                   /function="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91552"
FT                   /db_xref="GOA:Q0KEL9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEL9"
FT                   /inference="protein motif:PFAM:PF00436"
FT                   /protein_id="CAJ91552.1"
FT                   /translation="MASVNKVILVGNLGADPETRYLPSGDAVTNIRLATTDRYKDKQSG
FT                   EMKEATEWHRVSFFGKIAEIAGQYLRKGSSVYIEGRIRTRKWQDQSGQDKYSTEIVADQ
FT                   MQMLGSRQGGGGGGGDEGGYGGGAGGGGGYSREASGGGYGGGRGGQGGGQSGGAARRPQ
FT                   QPASNGFEDMDDDIPF"
FT   CDS_pept        422351..423427
FT                   /transl_table=11
FT                   /gene="h16_A0403"
FT                   /locus_tag="H16_A0403"
FT                   /product="outer membrane protein (porin)"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91553"
FT                   /db_xref="GOA:Q0KEL8"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEL8"
FT                   /inference="protein motif:CDD:cd00342"
FT                   /inference="protein motif:COGS:COG3203"
FT                   /protein_id="CAJ91553.1"
FT                   /translation="MKVGNTRRSHAMALAGVLAGASCGVTQQAQAQSVSTSISVYGLID
FT                   TMVRYSDNNRGDERLAELSEGYFSGSRWGARGNEALGAGWSALFNLESGFDLASGTSLQ
FT                   GTAASNYGQVGTQGTGRLFGRQSYLGIEHQAWGKLTFGRQFTTAYDATFRFQPYGHPNL
FT                   DAVAILNGYTGPRQDNMAKYAGRWGAFSAAAHYTFGEVPGDAAASSSRGLALAWTTARI
FT                   DIGALFQSTNALATEEKRTIWGIGGSSQLGRVKLALGYLDNRYHLSPTRNHVLTGGATV
FT                   QATPALAVSLAAGYDRQSAASGHRLMLTSVAEYSLSRRTSVYAEADFNRISGSYALPAF
FT                   MGVRGNKFGGGVGLRHRL"
FT   sig_peptide     422351..422446
FT                   /gene="h16_A0403"
FT                   /locus_tag="H16_A0403"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        423443..424429
FT                   /transl_table=11
FT                   /gene="h16_A0404"
FT                   /locus_tag="H16_A0404"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91554"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEL7"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="CAJ91554.1"
FT                   /translation="MISRRQFLAAALAAPALPGMPARADSGAAAWPRHPVRLVVTFPPG
FT                   GSSDIVARLLAPVLQEKLGQPFVTDNRPGAGSTIGAAAVAAAPNDGYTLLMSNSAALSI
FT                   SPFLLRRPAYDPVRSFTHVHYIGAVPTVFAVHPSVPARNLAELAAWIRAQREPVPFGSG
FT                   GAASVAHIVGELFGQQAGLRLTHVPYKGAGPMRADLLGGQIPFAVDALPQNLPLLQSGA
FT                   LRLLAVTSAQRVPQAPQLPTVAQAGYPGLVAENFVGVSAPANLPEDIVQRLHQQLQVIL
FT                   QQPALRGRLEAQGFVLAERRPDEFAAYVRQQAQAWGPVVVATGATLS"
FT   CDS_pept        424426..425361
FT                   /transl_table=11
FT                   /gene="h16_A0405"
FT                   /locus_tag="H16_A0405"
FT                   /product="ABC-type transporter, periplasmic component"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91555"
FT                   /db_xref="GOA:Q0KEL6"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEL6"
FT                   /inference="protein motif:TCDB:3.A.1"
FT                   /inference="protein motif:COGS:COG1744"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="CAJ91555.1"
FT                   /translation="MSARIQVVLFGPEGRGSFNEAGHAGAMRARNAGHDVAVTWIADPD
FT                   PQARAAALLALCQTGPDLIVAHGGQGDYPVSVAAARHPARRFVVTQGSVLCANTASYEV
FT                   LQEQSAFLAGVLAATDSRTGVVAHLSGEKVRPGLKGRAAFLHGVRSVVPGLPALTTFCG
FT                   NQHDPALAGDAVAAQARAGADIVFAMIDGGRDGAIAACRAAGIRQIGNVVDWTSRHPDV
FT                   FLASAVADSGLCVEQAIGDFERDQIAWGTTRSFGLEAPAAVRLALGRDVSQAARAALDH
FT                   WSQRLLDGGVSVAQSYDGPEFAVVGTPTVA"
FT   CDS_pept        complement(425389..426561)
FT                   /transl_table=11
FT                   /gene="h16_A0406"
FT                   /locus_tag="H16_A0406"
FT                   /product="Hypothetical protein with GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91556"
FT                   /db_xref="GOA:Q0KEL5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEL5"
FT                   /inference="protein motif:CDD:cd01949"
FT                   /protein_id="CAJ91556.1"
FT                   /translation="MLHDTGQFLALVNPAMAILLSLCFLLAWNHERTRHYLLELGACYL
FT                   LYAVAITLQIIWQPRNDGGNATVTGALYLGSAVLMLRGMLARIGARVDTCALVSLPLAL
FT                   FAALAWFDFMQPQLVARICILNIGIALILLLGIAPLARLRTGSTADQVLFWVFLLFALH
FT                   FLPRTVLTIAPVIGQDAAALTRSAYWLWLQVTMALLLLTLALALLAATTLDVIDGLRHE
FT                   RDTDPLTQLHTRRSLEALAAREIPPPQGKPLSVLLCDLDFFKFINDNYGHSAGDAVLAQ
FT                   IGRIIAAGIRRRDIAARLGGEEFVVLLPDTPPDAALHLAERLRQTLESTEMDVLPGMHT
FT                   VTASFGVATLRPGEDLEALLMRADNVLYAAKNKGRNCVEWEREAGLPVLA"
FT   CDS_pept        426959..427297
FT                   /transl_table=11
FT                   /gene="h16_A0407"
FT                   /locus_tag="H16_A0407"
FT                   /product="hypothetical membrane associated protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91557"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEL4"
FT                   /inference="protein motif:COGS:COG5455"
FT                   /protein_id="CAJ91557.1"
FT                   /translation="MKTKKAMPALLLAASVLAAPFAMAQGGAKSKPMADPMAASAPAAQ
FT                   NSPYMQVQQWKKGDRLPTEFRDRQYVIDDYKQYNLPAPRKGTRWVGIGAEYYLVAPNGV
FT                   VQQVGSGS"
FT   CDS_pept        complement(427383..427676)
FT                   /transl_table=11
FT                   /gene="h16_A0408"
FT                   /locus_tag="H16_A0408"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91558"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEL3"
FT                   /protein_id="CAJ91558.1"
FT                   /translation="MDYAGNPNSVLAEAIVRKSVLVLTALLLASAPGLALAHNCPNEMK
FT                   AIDAKLSTKPALSPENSAKVAKLRADGEAYHKAGKHDESMKSLLEAKKILGI"
FT   CDS_pept        428150..429121
FT                   /transl_table=11
FT                   /gene="h16_A0409"
FT                   /locus_tag="H16_A0409"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91559"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEL2"
FT                   /protein_id="CAJ91559.1"
FT                   /translation="MQRIDLKLAAIPLACLAILLAGCGGGGGDSAPASAAPSASAAGPA
FT                   GANGKTILSGANAPAADVGTDGDFYLNASTSTLYGPKADGAWPAGVSLVGPQGVAGAPG
FT                   AVLLHGAADPTAADGSKGSFYLNTATNTLFGPKTAEGWPAGVSVVGLTGPVGAQGPQGE
FT                   KGEKGDTGPQGQQGETGAGATIYTANFAVYDSPDGNGTYVMTGTALDRQSNDPNFGAVM
FT                   PVGCSGGLTLNASLAGPVPDDEVKYTLAAYRVASGAALETIAPLAITDASACSLGATVR
FT                   TCSAPATTAVAANDIVQVQVSGNRNFKWGGGLYVNLSCKSSS"
FT   CDS_pept        429301..429801
FT                   /transl_table=11
FT                   /gene="h16_A0410"
FT                   /locus_tag="H16_A0410"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91560"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEL1"
FT                   /protein_id="CAJ91560.1"
FT                   /translation="METSAEHYSLALLCAAVLTVTVVGIHYEALRLLSAIHPRRWSGRM
FT                   NIGVLIVCIIVVHCLEALVFALGFWFADQVLGLGGLTAMGVAGVSGVHTQPGALVYAYF
FT                   ALETFTTQSLGDIVPVGASRLIASIEPLVGLILIGWSTSFTYVMMRRDWELERDEGGGR
FT                   RAP"
FT   CDS_pept        429844..430167
FT                   /transl_table=11
FT                   /gene="h16_A0411"
FT                   /locus_tag="H16_A0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91561"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEL0"
FT                   /protein_id="CAJ91561.1"
FT                   /translation="MAQPRAAPAAGPATDTAAAADAPDMTIWDGPPGPGEHALTVHVWT
FT                   PVGSARGEARRQPLVDRYIAAVDRDGVISTGHAALESPEGIYISLYPGRRRWHRRRKCR
FT                   KCR"
FT   CDS_pept        430238..430588
FT                   /transl_table=11
FT                   /gene="h16_A0412"
FT                   /locus_tag="H16_A0412"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91562"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEK9"
FT                   /protein_id="CAJ91562.1"
FT                   /translation="MPSQRTLTRISAIAALAMACSAHAQRPDGDSAAAAAINEAVQQGT
FT                   TPYRPDPAATPGSIQSDECRALAAQIAEAPKREYRATQPAIETAQGRMIPELERDRPKR
FT                   SLQQAYREKCTQ"
FT   CDS_pept        complement(430612..431520)
FT                   /transl_table=11
FT                   /gene="h16_A0413"
FT                   /locus_tag="H16_A0413"
FT                   /product="transcriptional regulator, GlvR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91563"
FT                   /db_xref="GOA:Q0KEK8"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEK8"
FT                   /inference="protein motif:COGS:COG1737"
FT                   /protein_id="CAJ91563.1"
FT                   /translation="MPPDSPTPSPQAPPQDLDALLALLRSNFPTLSTQFQGGARYLLDH
FT                   PQDVPVLSMRKIAASAGVQPATLVRLSQHLGFEGWQGLRELFVDALRGGSQPYARRARK
FT                   VVRESSSSRMLGEILDAQHHNLDMIAANNEKTLQQAAELLSHAACVHVAGFRSCFPIAF
FT                   TFHYVYRLFRSTVHLIRADAGTLEMELRGLAPKDAVLVVSFAPYSQESIRVAAAARECG
FT                   CKVIALTDSTVAPIALAADCTLLFSVESPSFFPSVTAGVAVVEALVEQLLARKGKGAIR
FT                   ALEQAEGELHRTGAYVVAGRE"
FT   CDS_pept        431808..432329
FT                   /transl_table=11
FT                   /gene="pilE1"
FT                   /locus_tag="H16_A0414"
FT                   /product="Type IV pilus assembly protein PilE"
FT                   /function="Cell motility and secretion / Intracellular
FT                   trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91564"
FT                   /db_xref="GOA:Q0KEK7"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEK7"
FT                   /inference="protein motif:COGS:COG4968"
FT                   /protein_id="CAJ91564.1"
FT                   /translation="MGHRSPAVRHGGRVNPSFRVIGEVGATGNPCRGWRLRGARAAHGF
FT                   TLIEVMITVAVIAILAAVAIPNYSRHVVRSHRAAIESFMLEVASAQERYLVDNRAYAAN
FT                   LGALGMSVPAAQATRYDVAVTPNAALPPGYSIVATPKGSQLAGDADCGSLTLTSAGAKS
FT                   ASGSGTDCWN"
FT   CDS_pept        432332..432826
FT                   /transl_table=11
FT                   /gene="fimT1"
FT                   /locus_tag="H16_A0415"
FT                   /product="Type IV pilus transmembrane protein FimT"
FT                   /function="Cell motility and secretion / Intracellular
FT                   trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91565"
FT                   /db_xref="GOA:Q0KEK6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEK6"
FT                   /inference="protein motif:COGS:COG4970"
FT                   /protein_id="CAJ91565.1"
FT                   /translation="MRRATFPPSSPGRPTRRGFTLVELLCAMSVLAILAVAAAPSFSSL
FT                   IANQRVRGASLDLTSALLLARSEAVKRNATVTLAATGAAWTAGWAVTAGAETVRSFGPY
FT                   GGLTITPSAAGALALGNDGRLTGAAMTFEVAPNGDTAAASRVCVQVSETGRVASDTGAC
FT                   S"
FT   CDS_pept        432823..433446
FT                   /transl_table=11
FT                   /gene="pilV3"
FT                   /locus_tag="H16_A0416"
FT                   /product="Type IV pilus assembly protein PilV"
FT                   /function="Cell motility and secretion / Intracellular
FT                   trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91566"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEK5"
FT                   /inference="protein motif:COGS:COG4967"
FT                   /protein_id="CAJ91566.1"
FT                   /translation="MKQRIPRLRPSMPVRRTQRGFLLIEVLVAAVILLVALLGTAGLVA
FT                   RSGQTEMESYQRVQALALLQDMVARLNANRQVASCYANGATGMQLGSAAAPPAACTQGT
FT                   AAQKATADADLQAWNTALLGSAEMRLGASAADAAQAVGAMIGARGCIETVDAVNNIYRI
FT                   TVAWQGLATTGAPALGCGKGQYGNDAYRRAVSTQIRIGTLGTVS"
FT   CDS_pept        433443..434486
FT                   /transl_table=11
FT                   /gene="pilW"
FT                   /locus_tag="H16_A0417"
FT                   /product="Type IV pilus assembly protein PilW"
FT                   /function="Cell motility and secretion / Intracellular
FT                   trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91567"
FT                   /db_xref="GOA:Q0KEK4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEK4"
FT                   /inference="protein motif:COGS:COG4966"
FT                   /protein_id="CAJ91567.1"
FT                   /translation="MSPLRLSARRLRRQRGISLVELMIGITIGLVLLTALASLYLANSL
FT                   SRTEFTKSAEQVENGRYALEQIRREVELAGFFGVGNIARSTKAADPALCATDAAALGFS
FT                   PAAETVPVALTGYAPGVAAPCLPDLAPTSEVLVIRRVSTTAVAAPAPGVPYLQVSACSQ
FT                   DTQTFVFDASGAAAFGLRTKACDPAQPAELRRAMVRIFYLAGCDRCSNGGDGIPTLKMA
FT                   ELVNGAFQSRSVAQGVQDMHVLYGVDQDSNGSADCYVSDPRANNSAVCTAVPGYDWGVV
FT                   LNNLANVTTVRVHLLARTLKPSGGHSDNRTYDLGRAAAAGPFNDGYKRHVYAQVARLVN
FT                   VAGLREQ"
FT   CDS_pept        434521..435078
FT                   /transl_table=11
FT                   /gene="h16_A0418"
FT                   /locus_tag="H16_A0418"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91568"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEK3"
FT                   /protein_id="CAJ91568.1"
FT                   /translation="MMKSTGRPLRRRQFGVTLVVTLVFMVLFLLVAVAMVNSGLVNVKV
FT                   AGNQQHSAEARDVAQQAIEQVISDDFTKAPVAVDVPVDVTGDGKADYIAQVAAPTCVTS
FT                   KPVAKVIDPEKHPEDAECTLGSSTGNGNLVMGASGVSAISSLCNDTQWDVAATVNDVNT
FT                   TGAVATVHQGVAVRTLYGSTCP"
FT   CDS_pept        435119..438391
FT                   /transl_table=11
FT                   /gene="pilY1"
FT                   /locus_tag="H16_A0419"
FT                   /product="Type IV pilus assembly protein, tip-associated
FT                   adhesin PilY1"
FT                   /function="Cell motility and secretion / Intracellular
FT                   trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91569"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEK2"
FT                   /inference="protein motif:COGS:COG3419"
FT                   /protein_id="CAJ91569.1"
FT                   /translation="MSMPARRLRASAACATALLGLAAAPAAIAEDIDLFTGLQANSGSR
FT                   PNVLLILDNASAWNANAQVDCEMQNVVSANNDNSNVGAEQCALYKAVSDLINDDKTNGK
FT                   INLGVMMFGQGTNTGGQFRFPKVTPPTAPSGLVLMEKGAGGQDMLDYIKTIDRTKDSAN
FT                   NSQVGGAMQEAWAFFSGKTGLSGTTYKSPITNPCQKNFIIYIANALNNGKPQDSGQDAY
FT                   NKLKEAGATTAQLTPIPLPKGNNIDNWGDEWARFLNDLDLNAANNAGSTTATRQNIITY
FT                   TIGVTDGSQQSQDYLQFVTSMAQKGGGGNFTVRAGDDDALSKALKDIFNEMQAVNNVFA
FT                   SVSLPVSVNGQGSYLNQVYIGMFRPDGKARPRWVGNLKQYKLGYDSNGNLVMLDAGVQG
FT                   AIDQPPKNAVSNAGTGFISPNARSYWTEDPPKAVGSSSIVTDWPSDGFWKNASSLLRNA
FT                   KDSPDGEVVEKGGAGEMLRADYLTSQAGRRLLTCADAKCSKGTALANFDTANKALTEGN
FT                   GPSLLKTTAADVANMISWVRGKDVFATLTGTDPKKEAEPGPGGNVTVRGSIHGDVLHSR
FT                   PVVVDYGGTTGVVVFYGANDGVFHAVNGNRTAAISTTAGTVRAGGELWGFIAPEFYGKL
FT                   ARIYSNAPEVRLTGSPQDTAEVQFVPRDYFFDGTTTVYQDLSTPATPQVKIYLTARRGG
FT                   RLIYALDVKDPAKPEYLWSKTNADIPELGQTWSQPRVMRVRGYPTPVLIMGAGYDPDGE
FT                   DTDPALNGIATATNKQGRGVIVLDAGTGDVVWAALANCAGISTGTCVTINSRAIPSDVA
FT                   VVDRNGDGYAEKAYVGDVGGNVWRIDFGSTDTDTPSTWTVGKLAQLGGAVDTNEARKFL
FT                   YPPDVVATGKYDAVMIASGDREKPLYSLSQTPGAAQNVQNRFFMVKDPNVDGRLPSTWT
FT                   AVKAADLVDATNVAYRDSAVASGFYLSLEFGEKAVNAPLTVAGYTYFGTNTPSKVEPGA
FT                   CYPDLGVARGYAVSFLSGLGMNNGPRFVRFDNGGLPPSPVFGMVSVTQTDGSTRLVPVL
FT                   IGGGKAGASGGDDKSSLGGQEVKPASTGKRKRTYWHTQSDKT"
FT   CDS_pept        complement(438402..439892)
FT                   /transl_table=11
FT                   /gene="opcM"
FT                   /locus_tag="H16_A0420"
FT                   /product="outer membrane exporter of multiple drugs"
FT                   /function="Cell envelope biogenesis, outer membrane /
FT                   Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91570"
FT                   /db_xref="GOA:Q0KEK1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEK1"
FT                   /inference="protein motif:TCDB:1.B.17"
FT                   /inference="protein motif:COGS:COG1538"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="CAJ91570.1"
FT                   /translation="MQRLTPLFAAAALLCGCAVGPDFRAPAPPDDAGYVPGPQPVATVA
FT                   ADSADAAGQSHAQTLAAGADVPAQWWTLFRSPALDATIRSALDTSPTLAQARARLREAQ
FT                   ENLAARTGATRWPAVDAKLNTTRQQVDFQSLGITAIPSPGPFTLYGATVQVSYVLDLFG
FT                   GQRRELEGLQAAVDYQRYELEAARLALAANVATAAIREAGLRAQLADTAAVAAAQQRQL
FT                   GITEERLRSGGVARVDVQRQRAELAQAQALVPALQRQLDATRHQLAVYTGQTPASATLP
FT                   EFRLDDLHLPDTLPVSLPATLARRRPDIRAAEALLHQASANIGVATANLYPQITLSASG
FT                   GTQATAARDLFSSLNVWSLAAGLVQPVFRGGELQARKRAAEAAYEQSLAAYRQAVLQGL
FT                   QNVADSLRALETDAAALRERADSARQARDTLAVVSEQYQLGGVSQLTVLDAERQSRQAS
FT                   LELAQARADRLADSAALLQALGGGWWEEEGGAVAAAPR"
FT   CDS_pept        complement(439904..441067)
FT                   /transl_table=11
FT                   /gene="h16_A0421"
FT                   /locus_tag="H16_A0421"
FT                   /product="ABC-type transporter, permease component"
FT                   /function="Energy production and conversion / Inorganic ion
FT                   transport and metabolism"
FT                   /note="6 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91571"
FT                   /db_xref="GOA:Q0KEK0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEK0"
FT                   /inference="protein motif:TCDB:3.A.1"
FT                   /inference="protein motif:COGS:COG1668"
FT                   /protein_id="CAJ91571.1"
FT                   /translation="MTAAARNPAAQQRFSLQRWWSIVLKEFLQLRRDRVTFGMIIGLPI
FT                   MQLLLFGFAINTDPRHLPTAVIAADQSEFTRSFIASMEQSTYFKLVGTLPDEQAGREAL
FT                   MKGEVQFVLTIPPDFTRRLLRGERPALLVEADATDPSATGQAIAALPQLPYRVATHDLK
FT                   GSLAPLAGGKPPFDVQVQRLYNPEGITQYNIIPGLMGVILTMTMVMMTGLAMTRERERG
FT                   TMENLLATPVRPLEVMTGKIVPYIFIGLIQATIVLLAARWIFSVPFVGSVLAVYLAALL
FT                   FIAANLTVGITLSSLAQNQLQAMQLTFFYFLPNILLSGFMFPFAGMPGWAQAIGNILPM
FT                   TYFHRMVRGILLKGNGWVELWPNVWPMALFIVVVMAISVRFYRRTLD"
FT   CDS_pept        complement(441064..442032)
FT                   /transl_table=11
FT                   /gene="h16_A0422"
FT                   /locus_tag="H16_A0422"
FT                   /product="ABC-type transporter, ATPase component"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91572"
FT                   /db_xref="GOA:Q0KEJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEJ9"
FT                   /inference="protein motif:TCDB:3.A.1"
FT                   /inference="protein motif:COGS:COG1131"
FT                   /protein_id="CAJ91572.1"
FT                   /translation="MNTRANGGAAALAIDVRGLNKHFGDKHVVNDLSMQVARGEIFGFL
FT                   GPNGSGKTTSIRMMCGLLTPDSGEGTCLGYDIRSESDEIKRRVGYMTQKFSYWDDLSIR
FT                   ENLDFVARVYGMPNRREAVDRALEDLGLATRSAQLAGALSGGWKQRLALAACLLHEPEL
FT                   LLLDEPTAGVDPKARRDFWEQLHQLAARGISVLVSTHYMDEAERCHKLAYIAYGKLLAQ
FT                   GTADEVVASQKLSTWSVEGDDLAALSEQLQGAPGVEQTVAFGTALHVTGRDAQALADTL
FT                   ARLAGPGRRVEQTQTSLEDVFIHMMSGAEDNMAARKAREAS"
FT   CDS_pept        complement(442029..443009)
FT                   /transl_table=11
FT                   /gene="h16_A0423"
FT                   /locus_tag="H16_A0423"
FT                   /product="multidrug resistance efflux pump"
FT                   /function="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91573"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEJ8"
FT                   /inference="protein motif:COGS:COG1566"
FT                   /protein_id="CAJ91573.1"
FT                   /translation="MKHAHPTRPQLPAAALATLAAVLLLAACSRERADTWQGYVEGEFV
FT                   SVASPFAGRLDTLSVQRGQQVGQGAALFALESDDERAARQQAEDQLRAAEAQLQDMKTG
FT                   KRPVEVEVSRAQLAQAQAQAQRSAAALRRDQRQYEIGGIAQAQLDESRAQAGSDAARVR
FT                   ELQRDIDVARLPGRDAQQAAQAAQVAAARAALAQAEWKLSRKTVATTQAGLVYDTPYRL
FT                   GEWVPAGSPVVRMLPPGNVKVRFYVPETVVGALRNGQAVQVRCDGCAAPVAATISYVAN
FT                   EAEYTPPVIYSNETRRKLVFLVEARPAAADAPKLRPGQPVEVVRQ"
FT   CDS_pept        complement(443006..443701)
FT                   /transl_table=11
FT                   /gene="h16_A0424"
FT                   /locus_tag="H16_A0424"
FT                   /product="transcriptional regulator, TetR/AcrR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91574"
FT                   /db_xref="GOA:Q0KEJ7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEJ7"
FT                   /inference="protein motif:COGS:COG1309"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="CAJ91574.1"
FT                   /translation="MPRPPAKPKPSARRSPGRPAAGQPGQRERILDAATELFSRQGVAG
FT                   TPVKAIATQAGVTPALVHYYFSDRELLLDAVVEEKLQPLVAGVFAAAGDAEPMAMLIGI
FT                   AGQLIRTAAATPWFPGLWIREVASAEGALRERVLDRFALQRAGALSAPLAAAIARGQLN
FT                   SGLEPALVMPSLIGLTLLPLATTHIWRRLPGGEAVDTDTLVRHVSALLTHGLAPAPDAG
FT                   KSRLSPESS"
FT   CDS_pept        443807..445255
FT                   /transl_table=11
FT                   /gene="oprB"
FT                   /locus_tag="H16_A0425"
FT                   /product="Carbohydrate-selective porin"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91575"
FT                   /db_xref="GOA:Q0KEJ6"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEJ6"
FT                   /inference="protein motif:PFAM:PF04966"
FT                   /protein_id="CAJ91575.1"
FT                   /translation="MSWVLGYAAGAGARRLRHIPCRSPLPMPFPPLASAPVRIRFRRVL
FT                   AALACCACLPAMAQQAEPVQGPAEAESPFAFHGQSTYIWQRKPAFGAAYSGPNSLGTER
FT                   AKSYSFSATLDLGLKLWPGAEFHFNPEATQGVPFSGLHGLGGLSNGELGKAASTNPVFY
FT                   RARAFVRQTWGLGGGSEALEADFNQFGRTVDQQRVVLTAGNFSVLDVFDQNEFGSDPRT
FT                   QFMNWSFMTHGAFDYPADARGYSWGLSLEYIGDGWSARIGRFLQPLESNGLRLDTRMFE
FT                   HYGDIIEVEKRYQLAGRPGTARLLWFRNKARMGAFSDAIGFGMANNTTPDVADVRREHA
FT                   KSGVGVTLLQQVTDSLGMFARASLSDDKTETYAFTEIGRQVSAGGVLKGDAWGRARDAL
FT                   GVAVAINMLGPDHRNYLAAGGQGAFLGDGALRYGPEQILEIYYSFQPVKYLSISPDFQY
FT                   VRNPGYNRDRGPAKFYGVRLHGEF"
FT   CDS_pept        complement(445271..446104)
FT                   /transl_table=11
FT                   /gene="h16_A0426"
FT                   /locus_tag="H16_A0426"
FT                   /product="enzyme related to GTP cyclohydrolase I"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91576"
FT                   /db_xref="GOA:Q0KEJ5"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEJ5"
FT                   /inference="protein motif:COGS:COG2904"
FT                   /inference="protein motif:COGS:COG0780"
FT                   /protein_id="CAJ91576.1"
FT                   /translation="MSLPEHSPLGKPSAYKTEYDASLLFPIPRQPKRTEIGLPEGKPVP
FT                   FFGVDIWNAYELSWLNLKGKPQVALASFIIPSDTPNIIESKSFKLYLNSFNQTRIASPE
FT                   ALQQLLHHDLSEATGGTVQVRLVTEADLGKQKMGELDGLLLDRLDIEVDRYEPAPELLS
FT                   ADQQESPVEETLVSHLLKSNCLVTGQPDWGSVQIRYVGAPINQEGLLKYLISFRNHNEF
FT                   HEQCVERIFMDVMRECKPVKLAVYARYTRRGGLDINPFRTNFNTAWPDNKRNARQ"
FT   CDS_pept        complement(446122..447660)
FT                   /transl_table=11
FT                   /gene="h16_A0427"
FT                   /locus_tag="H16_A0427"
FT                   /product="threonine dehydratase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91577"
FT                   /db_xref="GOA:Q0KEJ4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEJ4"
FT                   /inference="protein motif:COGS:COG1171"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /inference="protein motif:PFAM:PF00585"
FT                   /protein_id="CAJ91577.1"
FT                   /translation="MTRTSAARPDYLKKILTAKVYDVAQETELTYAHQLSARTGNSVWF
FT                   KREDTQPVFSFKLRGAYNKMASLTPEELRRGVIAASAGNHAQGVALSAARLQCKAIIAM
FT                   PVTTPQVKIDAVRERGGQWVEIVLHGESYSDAYNHAAELEKKHKLTFIHPFDDPEVIAG
FT                   QGTIAMEILRQHPGPIHAVFVAIGGGGLISGIASYIKAVRPEIKVIGVQTVDSDAMKRS
FT                   VDAGKRVELKEVGLFSDGTAVKLVGKETFRITRELVDDIILVDTDAICAGLKDVFQDTR
FT                   SILEPAGALAVAGLKAYAEREKLKGQHLVAIACGANMNFDRLRFVAERAEVGEAREAVF
FT                   AVTIPEERGSFKRFCELVGTRSVTEFNYRIADTSMAHIFVGVQIASRAENDKIAASFRK
FT                   HGFDTLDLSNDELAKQHIRYMVGGRSALAHDELLYRFEFPERPGALMRFLSSMSPNWNI
FT                   SLFHYRNQGADTSNILVGIQVPKNEKRAFRAFLSTLGYVHWDETDNPVYKLFLS"
FT   CDS_pept        447972..448775
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="H16_A0428"
FT                   /product="Trehalose-6-phosphatase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="3.1.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91578"
FT                   /db_xref="GOA:Q0KEJ3"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEJ3"
FT                   /inference="protein motif:COGS:COG1877"
FT                   /inference="protein motif:PFAM:PF02358"
FT                   /protein_id="CAJ91578.1"
FT                   /translation="MPQLPLIESNTALFLDFDGTLADLAPRPELVQVEPELVGTLHTLF
FT                   QRLDGALAVISGRPISELDHFLQPLRLPAAGVHGAEFRTDGGMVSKTSAAPGLELLIPH
FT                   LEALVRAYPALRLERKSVAVAIHYRQAPELAGVVDAAVTEVLRHAVGLEALPGKMVVEI
FT                   KPAGVDKGDAIAAFMKSAPFAERMPLFAGDDLTDEPGFAAVRKLGGLGVLVGQRETVAS
FT                   VTVPGPAALRSWLHRSARALEGAGGHPRAVPNEAEPGPARRTTTS"
FT   CDS_pept        448789..450654
FT                   /transl_table=11
FT                   /gene="h16_A0429"
FT                   /locus_tag="H16_A0429"
FT                   /product="Glucoamylase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="3.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91579"
FT                   /db_xref="GOA:Q0KEJ2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEJ2"
FT                   /inference="protein motif:COGS:COG3387"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="CAJ91579.1"
FT                   /translation="MTNPSSPSEPGQPPTEGVHKTVDGGSRFAIPSLSLGMIGNCAISA
FT                   LVDCRARIVWSCLPRFDGDPVFNALLDPSENAGHFSIEIEDFQSSRQWYEPNTAVLRTR
FT                   LTDIHGNCLEITDFAPRFFRLGRYFRPTTLVRRIRPVRGAPRVRVVVAPRFEWGRKAPQ
FT                   TTRGSSHVRYIGDDMTLRMTTDAPMAYVLSHTPFLVTRGYNFILGPDETLAHGVEETAR
FT                   DFEQETTAYWRLWSRRLAVPREWQDAVIRAAITLKMSLFEETGAIVAAMTTSIPEAPGS
FT                   GRNWDYRFCWLRDAFFVVRALNSLSEVGTMEDYLRWLSNVVMQSQDGHIQPLYGIGLER
FT                   ELPESMLDHLPGYRGMGPVRVGNQAQEHFQHDVYGNVVLGAAQAFHDHRLLHRGGPAEF
FT                   RRLEEVGEQAVKVFGTPDAGMWELRTRARVHTSSALMSWAACDRLAKVADKLQLQARAA
FT                   YWHDHAERMKERILAESWSEERQAFAESFGGRELDASVLLMAEVNFIEPRDPRFIATVK
FT                   ALEASLCDGPYMRRYEAPDDFGKPETAFNICTFWRIDALARIGRREEAREIFESMLASR
FT                   NPLGLLSEDTHPVTGEMWGNFPQTYSMVGLINGAMRLSAPWDTVI"
FT   CDS_pept        450703..452094
FT                   /transl_table=11
FT                   /gene="h16_A0430"
FT                   /locus_tag="H16_A0430"
FT                   /product="Trehalose-6-phosphate synthase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="2.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91580"
FT                   /db_xref="GOA:Q0KEJ1"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEJ1"
FT                   /inference="protein motif:COGS:COG0380"
FT                   /inference="protein motif:PFAM:PF00982"
FT                   /protein_id="CAJ91580.1"
FT                   /translation="MPRLVAVSNRVADPRNVAAGGLAVALSEALRQTGGMWFGWSGKAL
FT                   ETAQGGTPGEGDLHLQQAGNVTLATVDLSREDHDAYYLGYSNGVLWPVFHYRLDLADFD
FT                   SNFLNGYRRVNQLFARKLAPLLQPDDIIWIHDYHLIPLASELRAIGCGQKIGFFLHVPL
FT                   PPPLILAAIPQHEWLMRALFAYDLLGFQSHADVEHFSRYVQAEAQAEPMGEHRYRAFHR
FT                   TVRAQAFPIGIDVDEFMELGRGADAQETYEMMCAQYARRRLLLGIDRLDYSKGLPQRLK
FT                   AFYRLLAEYPENRSSATLVQIAAPSRESVDAYVDLRREMEQLSGSINGEFGELDWMPVR
FT                   YIHRTTARKRLPGLCRASRVALVTPLRDGMNLVAKEFIAAQDPEDPGVLVLSRFAGAAE
FT                   QLREALLVNPYDTRATAQAIQQALHMPLAERQQRHQKLLERIRAQDVHWWSSEFLRALT
FT                   ETEGA"
FT   CDS_pept        452130..452474
FT                   /transl_table=11
FT                   /gene="h16_A0431"
FT                   /locus_tag="H16_A0431"
FT                   /product="Pterin-4a-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91581"
FT                   /db_xref="GOA:Q0KEJ0"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEJ0"
FT                   /inference="protein motif:PFAM:PF01329"
FT                   /protein_id="CAJ91581.1"
FT                   /translation="MSEDLAAQSCTPCRGGVPPLTPAEAEMLLQQAPGWELVDSATRIE
FT                   RRFTFGNFAQALAFVNGVGQLAETQGHHPEISFGWGHATVSWRTKKIKGLHRNDFIMAV
FT                   KTSELAEGIG"
FT   CDS_pept        complement(452487..452975)
FT                   /transl_table=11
FT                   /gene="h16_A0432"
FT                   /locus_tag="H16_A0432"
FT                   /product="Uncharacterized MobA-related protein"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91582"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEI9"
FT                   /inference="protein motif:COGS:COG2068"
FT                   /inference="protein motif:COGS:COG0746"
FT                   /protein_id="CAJ91582.1"
FT                   /translation="MLPGGRSVAWRSARTLAAALPESIAVIRPGNPALAEELRRGGCRV
FT                   LESPDAEAGMGAALRAAVAATPEARGWVVALADMPWLPMELIRAVALTITAPDTIAAPW
FT                   RNGQRGHPVGFGAAWREELLKLDGDEGARALLKDKPVTRILTEDEGAFRDIDTPGDLK"
FT   CDS_pept        complement(453113..454150)
FT                   /transl_table=11
FT                   /gene="coxF"
FT                   /locus_tag="H16_A0433"
FT                   /product="xanthine and CO dehydrogenase, maturation factor"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91583"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEI8"
FT                   /inference="protein motif:COGS:COG1975"
FT                   /protein_id="CAJ91583.1"
FT                   /translation="MDSVDLEVLKNSVQWQQQGHRVLLVTVVRTWGSSPRPEGAMLAVR
FT                   DDGLVVGSVSGGCIEDDIIDRVRRQGITADHPEAIKYGISAEEAHRFGLPCGGTIELVT
FT                   EPLTPASGIAELLDAVENGRLVARTLDMATGTATLGPANATDGLVFDGKTLLTIHGPRY
FT                   RMLVIGAGQLSKYLCQIAVGLGFQVTVCDPREEYTETWDIPGVTMVRTMPDDTVTDMKL
FT                   DERCAVIALTHDPKLDDLALMEALRTRAFYVGALGSRRNNQARRERLKEFDLTELQLAR
FT                   LHGPVGIYIGSRTPPEIAISILAEVIAARNHVSLPDILQVEGAKAAREMAAGTGSSCDV
FT                   APDPT"
FT   CDS_pept        complement(454123..454680)
FT                   /transl_table=11
FT                   /gene="coxG1"
FT                   /locus_tag="H16_A0434"
FT                   /product="carbon monoxide dehydrogenase homolog, subunit G"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91584"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEI7"
FT                   /inference="protein motif:PFAM:PF06240"
FT                   /inference="protein motif:COGS:COG3427"
FT                   /protein_id="CAJ91584.1"
FT                   /translation="MEMNQSQRLPVPQQVAWEALNDTELLKHCIPGCESIEPDGDNAYQ
FT                   LALTAAVGPVKARFKGRMALEDIQAPDSYTIRFDGQGGAAGFGKGSAQVRLEADGDETV
FT                   LTYTVNAHVGGKIAQIGSRLVDAAARKMADTFFARFTEAVTPDATDETPAAESAPAAAA
FT                   GDNEPTEEPKRKRSWTAWISKS"
FT   CDS_pept        complement(454671..455927)
FT                   /transl_table=11
FT                   /gene="coxE1"
FT                   /locus_tag="H16_A0435"
FT                   /product="protein containing von Willebrand factor type
FT                   A(vWA) domain"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91585"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEI6"
FT                   /inference="protein motif:COGS:COG3552"
FT                   /inference="protein motif:PFAM:PF05762"
FT                   /protein_id="CAJ91585.1"
FT                   /translation="MATLHAAARPAAPALPVLARNVTHFMRLLRDGGFALSPAHAVDAL
FT                   EALRHIDIGQRDEVRAALAALVLSGPDQRPLFDAAFDLFWRDPDWEGKLRALLLPRVDS
FT                   GAPPPKRSNRLADALAARQPEAQSRPAQAEAERIHVPLTFSDQERLAQRDFETLTAQEW
FT                   RALQHLVRTRRAHLALQRTRRLRAATCGTHADLRASARLAVRQHGEWLRWKFRKHAERK
FT                   PPVVLLLDISGSMSQYSRAVLYFCHALMQSRERLSVFLFGTRLTNITRSLRERDPDEAV
FT                   ALITGQVRDWAGGTRIGAALASFNRHWARRTLSGRATVLLVTDGLDHEHIDLLGDEMAR
FT                   LRRFAHRIVWLNPLLRYPGFTPQARGVQAILPHVDALRPAHNLDSLLALETLLSDHGGP
FT                   PRAATPALARHNKEAPPWK"
FT   CDS_pept        complement(455930..456826)
FT                   /transl_table=11
FT                   /gene="coxR"
FT                   /locus_tag="H16_A0436"
FT                   /product="putative chaperone-like ATPase, involved in
FT                   protein complex assembly"
FT                   /function="General function prediction only"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91586"
FT                   /db_xref="GOA:Q0KEI5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEI5"
FT                   /inference="protein motif:COGS:COG0714"
FT                   /inference="protein motif:COGS:COG5271"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="CAJ91586.1"
FT                   /translation="MLPTSIDDTIAQLERQQYFADRETATVLYLALRMQRPLFLEGEPG
FT                   VGKTAMAQAMAGVLGTRLLRLQCYEGLDAASALYEWDYPRQIMALRLAEARGERPEAQS
FT                   LYHDDYLLKRPLLESLLPDPAAPDVPRVLLIDEIDRADEPFEAFLLEVLSEFQVSIPEI
FT                   GVIRAERPPLIVITSNRTREVHDALKRRCLYQWMGYPERDRELQIVAARAPEAAAALQA
FT                   QAIDFIHRLRGIDLFKAPGIAEAIDWCRALSALGATELDPQSVRDTLGVLLKYQDDLAR
FT                   VDGPTVAELLAGATPGG"
FT   CDS_pept        complement(456922..457722)
FT                   /transl_table=11
FT                   /gene="coxM1"
FT                   /locus_tag="H16_A0437"
FT                   /product="carbon monoxide dehydrogenase homolog, medium
FT                   chain"
FT                   /function="Energy production and conversion"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91587"
FT                   /db_xref="GOA:Q0KEI4"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEI4"
FT                   /inference="protein motif:COGS:COG4630"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="CAJ91587.1"
FT                   /translation="MYAFNFERAADAKAAVATLRADPDAKFLGGGQSLLAAMKLRLAAP
FT                   SVLVDVARIPGMAEIRVEGNEIVVGGAARHADVAEHAEVRRRIPALAALAGGIGDRQVR
FT                   AMGTIGGALANDDPAADYPAGVLGLGATVVTDRRTIAADDFFKGLYETALEPDELITAV
FT                   RFPIPEQAAYAKFRNPASRFALVGVMVARTGNTVRVAVTGAADSVFRCQPLEQALSAAF
FT                   TAQAARGVKVDASTLNADLHASAEYRAHLIPVLAARAVEAAAKG"
FT   CDS_pept        complement(457750..460125)
FT                   /transl_table=11
FT                   /gene="coxL1"
FT                   /locus_tag="H16_A0438"
FT                   /product="Aerobic-type carbon monoxide dehydrogenase
FT                   homolog, large subunit"
FT                   /function="Energy production and conversion"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91588"
FT                   /db_xref="GOA:Q0KEI3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEI3"
FT                   /inference="protein motif:COGS:COG1529"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /inference="protein motif:COGS:COG4631"
FT                   /inference="protein motif:PFAM:PF01315"
FT                   /protein_id="CAJ91588.1"
FT                   /translation="MNAPESQRLVGAPVKRKEDYRFLTGNGQYTDDIVLPQQSYAYFLR
FT                   SPHAHARIRSIDKTEALAAPGVIAVLTGDELAADKVGGLPCGWLIHSIDGSPMKEPPHP
FT                   VIAHDKVRHVGDQVALVIAETLQQARDAAEKIDVDYEELPAVVSAADAAKASTLVHDDV
FT                   PANTCYTWGHGDKAATDAAFAKAAHVTTLDIVNNRLIPNAIEPRAVNASYTRQDDSYTV
FT                   YVANQNPHVERLLMGAFVLGLPESRLRIIAPDVGGGFGSKIFLYPEDVALTWASKKIGR
FT                   PVKWTADRSESFLTDAHGRDHVTRAELALDADGKFLAMRVHTTANMGAYLSTFASSVPT
FT                   ILYATLLAGQYATPAIYAEVQAVFTNTAPVDAYRGAGRPEATYVVERLVETAAHEMKID
FT                   PAELRRKNFIRQFPYATPVGLTYDTGDYEPCLARAQELADVKGFPARRDEAKQRGKLRG
FT                   LGYSCYIEACGLAPSNIAGALGARAGLFEVGEIRVHPTGTVTVFTGSHSHGQGHETTFA
FT                   QVVADRLGLQLDQVEIVHGDTGRVPFGMGTYGSRSLAVGGSAIVKALDKIEAKAKKIAA
FT                   HLLEAADTDIEFSNGVFRVAGTDRTKTFGEVALSAYVPHNYPLDKLEPGLNENAFYDPT
FT                   NFTYPSGAYVCEVEVDPDTGESQVVKFTAVDDFGNIINPMIVEGQVHGGIGQGLGQAML
FT                   EQCVYDNDSGQLLTGSYMDYAMPRAGDLPDFTVETATGTPCTHNPLGVKGCGEAGAIGS
FT                   PPAFINALVDALSPLGVKDIQMPATPHRVWQAIQAARP"
FT   CDS_pept        complement(460138..460626)
FT                   /transl_table=11
FT                   /gene="coxS1"
FT                   /locus_tag="H16_A0439"
FT                   /product="Aerobic-type carbon monoxide dehydrogenase
FT                   homolog, 2Fe-2S iron-sulfur subunit"
FT                   /function="General function prediction only"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91589"
FT                   /db_xref="GOA:Q0KEI2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEI2"
FT                   /inference="protein motif:COGS:COG2080"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="CAJ91589.1"
FT                   /translation="MAIPIRLTVNGKPVDAQVEPNTLLVQFLREQLRLTGTHVGCDTAQ
FT                   CGACTVHLDGRAVKSCNILAVQADGAAVTTIEGLAAPGTLHPMQEAFRECHGLQCGFCT
FT                   PGMVMSATALVQEHPGADAATIRAHLEGNLCRCTGYHNIVRAVQQGQAAMQGTAASAE"
FT   CDS_pept        460973..461551
FT                   /transl_table=11
FT                   /gene="h16_A0440"
FT                   /locus_tag="H16_A0440"
FT                   /product="hypothetical membrane spanning protein"
FT                   /function="Function unknown"
FT                   /note="4 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91590"
FT                   /db_xref="GOA:Q0KEI1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEI1"
FT                   /inference="protein motif:COGS:COG1238"
FT                   /protein_id="CAJ91590.1"
FT                   /translation="MEAFFDWLFETIALPKVGLPAIFVVSLISATLLPLGSEPAVFGYV
FT                   KLNPQMFWPAIVVATAGNTVGGAIDWWLGYAAKLALVRYHKRRRAREHDREHLEHREHA
FT                   RKPPKPKLDARYFRWMRRLGPPTLLFSWLPGIGDPLCTLAGWLRLSFWPSLAWMAVGKF
FT                   IRYLFMTASLLWIPDSFWQNIAQTFKAWF"
FT   CDS_pept        461732..465706
FT                   /transl_table=11
FT                   /gene="glpCD"
FT                   /locus_tag="H16_A0441"
FT                   /product="Dehydrogenase (FAD/FMN-containing) and Fe-S
FT                   oxidoreductase (two domain protein)"
FT                   /function="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91591"
FT                   /db_xref="GOA:Q0KEI0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEI0"
FT                   /inference="protein motif:COGS:COG0247"
FT                   /inference="protein motif:COGS:COG0277"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="CAJ91591.1"
FT                   /translation="MNAPLVLDAKLAAQDAPPRLREIPYNYTSFSDREIVIRLLGEEAW
FT                   RILDELRSERRTGRSARMLYEVLGDIWVVRRNPYLQDDLLENPKRRQMLVSALHHRLNE
FT                   IEKRRAADRAEHAEPAAEDRSHRVEQLVAFAKQAIEDFKNEFAAAYDLRKRAQRVLGKV
FT                   TQKDNIKFDGLSRVSHVTDATDWRVEYPFVVLTPDTEEEIAGLVKGCFELGLTIIPRGG
FT                   GTGYTGGAVPLTPMSAVINTEKLEQLGPVEQTDLPGVSHKVATIFSGAGVVTRRVADAA
FT                   DKAGLVFAVDPTSIDASCIGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPEGNWLEITR
FT                   LDHNLGKIHDVPVATFELKWSDGNRAPGEKVLRTETLAIEGRKFRKEGLGKDVTDKFLA
FT                   GLPGVQKEGCDGIITSARWILHRMPKFIRTVCLEFFGQARDAIPSIVEIKDFLDAETKK
FT                   PGGAILAGLEHLDERYLRAVGYATKSKRNAFPKMVLIGDIVGDDEDAVARATSEVIRMA
FT                   NGKSGEGFIAVSPEARKKFWLDRSRTAAIAKHTNAFKINEDVVIPLNRMGEYTDGIERI
FT                   NIELSIKSKLKLVDTLEAFFARGNLPLGRSDDANEIPSAELLEDRVQHALTLLREIRAR
FT                   WRYLQDHMDVPLTQAKASLIGHGLGLLGQEFDARLQHQPDATVFHLLQDRTIRVSWKAE
FT                   IRAELRKIFNGGEFKPILDEAQKIHKQVLRGRVFVALHMHAGDGNVHTNIPVNSDDYDM
FT                   LQDAHRAVARIMDLARSLDGVISGEHGIGITKLEFLTEEEIGDFRAYKLKVDPQGRFNK
FT                   GKLLPGADLRNAYTPSFGLMGHESIIMQQSDIGAIAESVKDCLRCGKCKPVCATHVPRA
FT                   NLLYSPRNKILATSLLVEAFLYEEQTRRGISVKHWDEFSDVADHCTVCHKCVTPCPVKI
FT                   DFGDVSMNMRNLLRKMGQKKFNPGTAASMFFLNATNPETINLTRKVMIDWGYKAQRLGN
FT                   DVLKKFAKKQTAHPPATVGKAPVREQVIHFINKKMPGNLPKKTARALLDIEDNEIVPII
FT                   RDPKATTPETEAVFYFPGCGSERLFSQVGLATQAMLWHVGVQTVLPPGYLCCGYPQRGN
FT                   GQYDKAEKIVTDNRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFDKIFPGCRIID
FT                   IHEYLLEKGVKLEGVTGTRYMYHDPCHTPIKTMDPTKLVNDLMGGNTGLGKIEKNERCC
FT                   GESGTLAVTRPDISTQVRFRKEEEMTKGADKLRADGFTGDVKILTSCPSCLQGLSRYKE
FT                   DATVQADYIVIEMAKHLLGENWMPEYVAKANAGGIERVLV"
FT   CDS_pept        465716..466153
FT                   /transl_table=11
FT                   /gene="h16_A0442"
FT                   /locus_tag="H16_A0442"
FT                   /product="diadenosine tetraphosphate (Ap4A) hydrolase or
FT                   other HIT family hydrolase"
FT                   /function="Nucleotide transport and metabolism /
FT                   Carbohydrate transport and metabolism / General function
FT                   predi"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91592"
FT                   /db_xref="GOA:Q0KEH9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEH9"
FT                   /inference="protein motif:COGS:COG0537"
FT                   /protein_id="CAJ91592.1"
FT                   /translation="MARVPNCPLCETDGGELVWMGDRARLILVEHDRFPGFCRIVWNDH
FT                   VAELSDLEDADQAWLMRLVARVERVVREVMAPDKVNLAAFGNMVPHLHWHIIPRYRWDT
FT                   HFPEAIWAAPQRAADAVRVQELASRLPALRTALSLLEAGDA"
FT   CDS_pept        466277..468142
FT                   /transl_table=11
FT                   /gene="h16_A0443"
FT                   /locus_tag="H16_A0443"
FT                   /product="ABC-type transporter, ATPase and permease
FT                   components"
FT                   /function="General function prediction only"
FT                   /EC_number="3.6.3.-"
FT                   /note="5 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91593"
FT                   /db_xref="GOA:Q0KEH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEH8"
FT                   /inference="protein motif:TCDB:3.A.1"
FT                   /inference="protein motif:COGS:COG4178"
FT                   /inference="protein motif:COGS:COG2274"
FT                   /protein_id="CAJ91593.1"
FT                   /translation="MSSTPTSVTVPGPAVPARALKIQSRLRMAATWALIKPYWKSEDRL
FT                   AGLGLLALVVVLNLGIVYINVLLNEWNRVFYNALEQRDYASFKVLLLRFSWIAAFFIVA
FT                   AISRQYYTMMLQMRWRTWMTGRFMGHWLGHQAYYRIEQTHTTDNPDQRIADDLRLFTDG
FT                   ALSLSLGLLNSVVTLLSFVGILWTVSGPISFALGGTEWTIPGYMVWFAAGYAVIGSLVA
FT                   HVVGRPLIGLNFQQEQYEADFRFTLVRLRENSEPVALYRGEPTEQAGLRARFDRIRANW
FT                   NQLMRYTRRLTFVSSGYAQFAIIFPILVAAPRYFAGKMTLGGLMQTSSAFGQVQGALSW
FT                   FVDSYATLVGWKAAANRLIDFQEAIRVAERQDLAPGGVRDIEVEHTGKPQNGITIDGLA
FT                   LALPVRAARSAAVGQRPLVAPFSLSVAPGERWLVSGPSGCGKSVLFRALAGIWPYGSGT
FT                   VTMPDGARMLFLPQRSYLPIGTLADALAYPDAGTVHSAEALQAALRQARLAALADQLDV
FT                   FDNWALRLSPGEQQRLAFARALLQKPDYLFLDEATSALDEETEGAMYRLMVESLPQAAI
FT                   ISIAHRSTVAAYHQRRLRYVPQDGEAARAAQAGEPGVSYRVVCEA"
FT   CDS_pept        468215..468637
FT                   /transl_table=11
FT                   /gene="h16_A0444"
FT                   /locus_tag="H16_A0444"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91594"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEH7"
FT                   /inference="protein motif:COGS:COG3536"
FT                   /inference="protein motif:PFAM:PF06155"
FT                   /protein_id="CAJ91594.1"
FT                   /translation="MAGLEKDTPHPTALTVHTQSRVLEIGFDNGRSFRLPFELLRVYSP
FT                   SAEVQGHGPGQEVLQTGKREVGVNAVEPVGNYAIQIRFTDGHDTGIYSWDLLYRLGDNQ
FT                   DALWQDYLQRLEAAGADRDTPMPAAGAAGGHGCGHH"
FT   CDS_pept        468672..469403
FT                   /transl_table=11
FT                   /gene="ubiE1"
FT                   /locus_tag="H16_A0445"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /function="Coenzyme metabolism"
FT                   /note="unknown EC_number=2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91595"
FT                   /db_xref="GOA:Q0KEH6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEH6"
FT                   /inference="protein motif:COGS:COG2226"
FT                   /inference="protein motif:PFAM:PF01209"
FT                   /protein_id="CAJ91595.1"
FT                   /translation="MSETHFGFEKVDEAEKADKVAGVFHSVASKYDVMNDLMSGGMHRL
FT                   WKMFTIAQAGVRPGHKVLDIAGGTGDLAKAFAKQAGPTGEVWLTDINESMLRVGRDRLL
FT                   NKGIVTPVCLCDAERIPFPDNHFDLVTVAFGLRNMTHKDAALAEMRRVVKPGGKVMVLE
FT                   FSKVWKPLEKAYDVYSFKVLPWLGERVAGDAPSYRYLAESIRMHPDQASLVRLMEHAGL
FT                   ENVEYFNLTAGVVALHVGRKY"
FT   CDS_pept        469467..470456
FT                   /transl_table=11
FT                   /gene="h16_A0446"
FT                   /locus_tag="H16_A0446"
FT                   /product="hypothetical membrane spanning protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91596"
FT                   /db_xref="GOA:Q0KEH5"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEH5"
FT                   /inference="protein motif:COGS:COG4395"
FT                   /inference="protein motif:PFAM:PF04280"
FT                   /protein_id="CAJ91596.1"
FT                   /translation="MSSFRGKFLVGSLITAIALGVMFDANAKRMGGSRSIGKQSESVTQ
FT                   RQQAPQPTSPTQQAQQPAQQAAPATAGAAGAAAAAAPKRNWGGILGGIAAGLGIGWLLS
FT                   HFGLGGAALSFLSNLILIALVAFAAIWLIRKFRGGSKRTQQPAYAGAGNAPNLGRSAEP
FT                   MFRGEPTPVSSGSPAGPAANTVLPAASAAPVAADAVAQQPWGVPADFDTEAFLRNAKVH
FT                   FVRLQAAWDAGNLDDIREFTTPEMFAEIKMDLADRGAEVNKTDVVTLEAQLLGIESAAA
FT                   QHIASVRFSGMIREKSGEAAQPFGEVWNLAKPASGTGGWLLAGIQQES"
FT   CDS_pept        470521..471276
FT                   /transl_table=11
FT                   /gene="h16_A0447"
FT                   /locus_tag="H16_A0447"
FT                   /product="protein of unknown function"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91597"
FT                   /db_xref="GOA:Q0KEH4"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEH4"
FT                   /inference="protein motif:PFAM:PF06843"
FT                   /protein_id="CAJ91597.1"
FT                   /translation="MGLFLFGTPDLRRRCLPANRAVMNTLPSALAMPAISALNHLLEQE
FT                   PWARNQLTPFAGRVIRFDAAAFVLSLKVTEHGCTEPAPEAEAPAVTLRVPVQQWPLVAA
FT                   DVAEGGQAAAMRHVRIEGDAELANTISTLARNLRWDAAEDLSRALRGILGGPVSDSVAQ
FT                   RVVDGARQVHEQATRVGRALVDNVTDYLLDEHPTLVRHAALDAFGTDVGRLRDSLARLE
FT                   KRLERLERAGPPPASGQSGQSGKLPSPHR"
FT   CDS_pept        471344..472921
FT                   /transl_table=11
FT                   /gene="aarF"
FT                   /locus_tag="H16_A0448"
FT                   /product="predicted unusual protein kinase"
FT                   /function="General function prediction only"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91598"
FT                   /db_xref="GOA:Q0KEH3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEH3"
FT                   /inference="protein motif:COGS:COG0661"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="CAJ91598.1"
FT                   /translation="MTRLLRLGKILFVILYYGLDELVLSGFSSRRIRFLVRVITIGRKL
FT                   EMPRGERLRLALTRLGPIFVKFGQVLSTRRDLMPADIADELAKLQDQVPPFDSVVAVKI
FT                   IERALGRPLDQLFETFEHQPVASASIAQVHFATLKGGPCHGREVAVKVLRPGMLPVIDS
FT                   DLALMRDMATWLERFWADGKRLKPREVVAEFDKYLHDELDLMIEAANASQLRRNFADTS
FT                   LLLVPEVFWDWCSSTVFVMERMHGIPISRTESLKAAGVDMHQLAEEGVEIFFTQVFRDG
FT                   FFHADMHPGNILVSVQPETFGRYIALDFGIVGALSEFDKNYLAQNFIAFFRRDYHRVAL
FT                   LHVESGWVPPDTRVEELESAVRACCEPYFDKPLKEISLGMVLMRLFQTSRRFNVEIQPQ
FT                   LVLLQKTLLNIEGLGRQLDPDLDLWKTAKPFLERWMHEQVGWKGAWERVKVEAPLWAKM
FT                   LPDFPRLAHQFLERRALTSNGEQDKLLAMLVVEQRRTNRLLGTGLLLLGGFVAGIVLTH
FT                   VLGWAGYW"
FT   CDS_pept        472954..473574
FT                   /transl_table=11
FT                   /gene="h16_A0449"
FT                   /locus_tag="H16_A0449"
FT                   /product="Thiopurine S-methyltransferase (TPMT)"
FT                   /function="General function prediction only"
FT                   /note="unknown EC_number=2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91599"
FT                   /db_xref="GOA:Q0KEH2"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEH2"
FT                   /inference="protein motif:PFAM:PF05724"
FT                   /protein_id="CAJ91599.1"
FT                   /translation="MSDPAKPVPTFATRNAADPAFWDERFEQGFTPWDQGGVPEEFRQF
FT                   IEGRAPCPTLVPGCGNGWEAAWLFERGWPVTAIDFSPQAVASARQTLGPAGVVVQQGDF
FT                   FAFTPQPPCELIYERAFLCALPPAMRADYAARVAQLLPPGGLLAGYFYLGENRGGPPFA
FT                   MPAEALDALLAPAFERLEDRPTAAPLPVFQGQERWQVWRRRSG"
FT   CDS_pept        473868..475304
FT                   /transl_table=11
FT                   /gene="h16_A0450"
FT                   /locus_tag="H16_A0450"
FT                   /product="APC transporter, SSS family"
FT                   /function="Amino acid transport and metabolism / General
FT                   function prediction only"
FT                   /note="13 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91600"
FT                   /db_xref="GOA:Q0KEH1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEH1"
FT                   /inference="protein motif:COGS:COG0591"
FT                   /inference="protein motif:COGS:COG4145"
FT                   /protein_id="CAJ91600.1"
FT                   /translation="MLIWFVIIYWVISVGIGLWAALRVRNTTDFAVAGRSLPFHIVTAT
FT                   VFATWFGSETVLGIPAVFLKEGLSGVVSDPFGSSLCLILVGLFFARPLYRMNLLTIGDY
FT                   YHNRYGRLAEVLTTLCIVVSYLGWVAAQIKALGLVFYTVSDGALSQEAGMMIGAASVLV
FT                   YTLFGGMWSVAITDFIQMIIIVIGMLYIGYEVSGQAGGVTAVVSHAAAAGKFEFLPSLD
FT                   FIQIIGFAAALFTMMLGSIPQQDVFQRVTSSRTEQIAGRASVLGGVLYFCFAFIPMFLA
FT                   YSATLIDPGMVARYIDTDSQLILPKLILQHAPMFAQVMFFGALLSAIKSCASATLLAPS
FT                   VTFAENILRPYFRHLDDRQFLRVMQTVVLVFTALVTLFALNSHLSIFHMVENAYKVTLV
FT                   SSFVPLAFGMFWKHATRQGGLAAILLGLSSWLTCEVAFADAVVPPQMVGLLFSISGMVI
FT                   GSLLPQWIADHAPVKEVHIA"
FT   CDS_pept        475409..475813
FT                   /transl_table=11
FT                   /gene="h16_A0451"
FT                   /locus_tag="H16_A0451"
FT                   /product="conserved hypothetical protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91601"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEH0"
FT                   /inference="protein motif:COGS:COG2331"
FT                   /protein_id="CAJ91601.1"
FT                   /translation="MARADVRLCTNSEVFSRNNTMPIYAYRCDACGHGRDVLQKMSDAP
FT                   LTDCPSCGTAGAFKKQLTAAGFQLKGSGWYVTDFRGGSAGTPTATGAAGGAAAAAASTP
FT                   AAAESPASPASSASATPAAAGGCGSACACH"
FT   CDS_pept        475828..476541
FT                   /transl_table=11
FT                   /gene="h16_A0452"
FT                   /locus_tag="H16_A0452"
FT                   /product="hypothetical membrane spanning protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91602"
FT                   /db_xref="GOA:Q0KEG9"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEG9"
FT                   /inference="protein motif:COGS:COG2928"
FT                   /inference="protein motif:PFAM:PF04367"
FT                   /protein_id="CAJ91602.1"
FT                   /translation="MVAKKTSALKTWFLTGLLVLVPLGITLWVLSLIIGTMDQSLALLP
FT                   EAWRPDRLMFGKRVTGLGAILTLLVILLVGLLAHNFIGQRLVRWWEALLGHIPVVGPIY
FT                   TSVKQVSDTLLSSSGNAFRKALLVQYPREGSWTIAFLTGRPGGDVQNHLQGEYVSVYVP
FT                   TTPNPTSGFFLMMPKADTIELDMTVDAALKYIVSMGVVAPAELPRKNGSMSRPAAPANP
FT                   AGRASSEETVETTDP"
FT   CDS_pept        476608..478416
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="H16_A0453"
FT                   /product="Aspartyl-tRNA synthetase"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91603"
FT                   /db_xref="GOA:Q0KEG8"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEG8"
FT                   /inference="protein motif:COGS:COG0173"
FT                   /inference="protein motif:CDD:cd00777"
FT                   /protein_id="CAJ91603.1"
FT                   /translation="MSSMRTHYCGLVTEQFSGQEVALTGWVQRRRDHGGVIFIDLRDRE
FT                   GLVQVVCDPDRPEMFKAAEEIRNEFCIRVTGKVRPRPAGTENANLTSGKIEVLCHELTV
FT                   LNPSVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQYNLRLRYKVAMEVRKFLDAQGFID
FT                   IETPMLGKSTPEGARDYLVPSRVNPGHFFALPQSPQIFKQMLMVSGFDRYYQITKCFRD
FT                   EDLRADRQPEFTQIDCETSFLTEQEIRDLFEDMMRTVFKNAIDVDLDARFPVMEFREAM
FT                   ARFGSDKPDLRVKLEFTELTEVMKDVDFKVFSSPANSDNGRVVGLRVPGGGAISRGEID
FT                   AYTQFVGIYGAKGLAWIKVNEVAKGRDGLQSPIVKNLHDAAIAEILKRTGAQDGDIIFF
FT                   GADKAKVVNDSIGALRLKIGHSDFGKANGLFEDTWKPLWVVDFPMFEYDEEDARWVAMH
FT                   HPFTSPKDEHLEYLETDPGKCLAKAYDMVLNGWEMGGGSVRIFRSDIQSKVFRALNIND
FT                   DEARAKFGYLLDALQYGAPPHGGLAFGLDRIVTMMAGADSIRDVIAFPKTQRAQDLLTQ
FT                   APSSVDEKQLRELHIRLRATEPKPTA"
FT   CDS_pept        478629..479540
FT                   /transl_table=11
FT                   /gene="h16_A0454"
FT                   /locus_tag="H16_A0454"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91604"
FT                   /db_xref="GOA:Q0KEG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEG7"
FT                   /protein_id="CAJ91604.1"
FT                   /translation="MTLDIDLIRQFLLAHDQTILTWLVAGLVMMLLARFELRRAVRRSA
FT                   QAMSESVATTVAACVPDIAHAVQSAAPAAAAEPVEMQRAEALRRLALDTVGVVMTRGRW
FT                   LDELGNLRLADDALLAGQRADGADPLLVVAPQPVVQAYLDAQRVFEDEAAQVQALRRDA
FT                   QRVQEALQALDAEVAHIEQETGSIVLRFEQVNAQAAQGMDGGDYQRFLIQKYNSLGQRE
FT                   KEIALERTRLQGEVRHRADALATHAHGASKRYRQALAPLMDQLRAAWGHGDSPQVFDTW
FT                   QRTAADEPYLAPRATYGTRSAA"
FT   CDS_pept        479639..480127
FT                   /transl_table=11
FT                   /gene="h16_A0455"
FT                   /locus_tag="H16_A0455"
FT                   /product="dATP pyrophosphohydrolase"
FT                   /function="DNA replication, recombination, and repair /
FT                   General function prediction only"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91605"
FT                   /db_xref="GOA:Q0KEG6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEG6"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="CAJ91605.1"
FT                   /translation="MSYKIPESVLVVIYTPDLQVLLLERADRPGFWQSVTGSLDTLDEP
FT                   LALTAAREVAEETGIIAGEHQLTDWAHTIQYEIYPQWRHRYAEGVTRNTEHWFGLRVQQ
FT                   ALPVTLAPREHLQYQWLPWEQAAQQCFSSSNAEAIRQLAWRAAGAGAGERQAVYGAQP"
FT   CDS_pept        480124..480906
FT                   /transl_table=11
FT                   /gene="h16_A0456"
FT                   /locus_tag="H16_A0456"
FT                   /product="Metal-dependent hydrolase"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91606"
FT                   /db_xref="GOA:Q0KEG5"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEG5"
FT                   /inference="protein motif:COGS:COG3568"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="CAJ91606.1"
FT                   /translation="MKLRVVTYNIHKGVTGISRRPRIQNVRAGLHAMDADIVFLQEVQD
FT                   RNDRLVAAALFDPEHTQLNYLATDAYPHSVYGRNAVYDYGHHGNAILSRHPILMSENLD
FT                   ISDHRFEQRGLLHAVADVHGVETHLICVHFGLFARSRVRQAEALVERVRTVVPAGMPLV
FT                   IAGDFNDWNHRLDAQICNTLGAVEASHARGARLHTFPSHMPWWQLDRIYVRGYEIERAH
FT                   ALTGRDWAQRSDHVPLVAELGHPRGELAMPAEPAGKAA"
FT   CDS_pept        complement(480909..481424)
FT                   /transl_table=11
FT                   /gene="mobB2"
FT                   /locus_tag="H16_A0457"
FT                   /product="Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /function="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91607"
FT                   /db_xref="GOA:Q0KEG4"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEG4"
FT                   /inference="protein motif:COGS:COG1763"
FT                   /inference="protein motif:PFAM:PF03205"
FT                   /protein_id="CAJ91607.1"
FT                   /translation="MKVFGITGSSGSGKTTLLDQLIPCFVAAGLRVAGVKHTHHGFDPD
FT                   TPGKDSWRMREAGCANVVLVGARHLTLMRHYPEAVPSPELDDALAVLPADTELVLVEGY
FT                   KRSDFPKLEVYRPALGRTPLWDEVPGVVAVASDDPAAVAAMTALPVLDLNDPQAVFAFI
FT                   RDYPDSAR"
FT   CDS_pept        481505..482860
FT                   /transl_table=11
FT                   /gene="h16_A0458"
FT                   /locus_tag="H16_A0458"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate
FT                   cardiolipin synthase or related enzyme"
FT                   /function="Lipid metabolism"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91608"
FT                   /db_xref="GOA:Q0KEG3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEG3"
FT                   /inference="protein motif:COGS:COG1502"
FT                   /inference="protein motif:CDD:cd00138"
FT                   /protein_id="CAJ91608.1"
FT                   /translation="MRLPMCARRLAPGNLSDNHGMSRISHSAHADTRAHDPAAAGDHAP
FT                   RRHMLRWTWRRGKPTTGNAVRLLHGGQDFFPALIAAIDQAAFQVMLETYIYADDEVGRA
FT                   VSDALIRAAARGVTVRVTVDGFGAGDMPAELAARLRAGGVQLRVFRMLRGFRLARRHLR
FT                   RLHRKLAVIDRRVAFVGGINIIDDHNHGPFEGANLGPRYDFAVQVGGPLVDGIALSAER
FT                   LWWRLSLRDMHGTERAAAVADYPLVTDLPPRPEAAGGVRAALLLRDNLRNRRTIEREYL
FT                   RALGAARHDVILANAYFLPGHKMRRALLACRARGVRVRLLLQGRVEYRLQHYATHALYA
FT                   SLLEAGVEIYEYAESFLHAKVGVVDEAWATVGSSNMDPFSLLLAREANVAVYDAAFAAE
FT                   LRTALEYAIAHRSVRVMPEVHARRSPLHRLANWAAYMLLRLGVVIAGVAGRY"
FT   CDS_pept        483171..483812
FT                   /transl_table=11
FT                   /gene="h16_A0459"
FT                   /locus_tag="H16_A0459"
FT                   /product="transcriptional regulator, TetR/AcrR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91609"
FT                   /db_xref="GOA:Q0KEG2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEG2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="CAJ91609.1"
FT                   /translation="MRHQSARLESAAASPAPMRKGEMTRVAILDAALELSSRDGLEGLT
FT                   IGLLAERMQMSKSGVFAHFGSREDLQVEVVREYHRRFEQEVFYPSLQEPRGLPRLWSMV
FT                   RRWMEKRIQEVTTGCIYISGAVEYDDRAGSLVRDELVKSVTIWRAALTRAINQAREEGH
FT                   LRADCDPRLMLFEMYSLELGLHHDARFLRLPDSAELAMVALNKLIQSYRT"
FT   CDS_pept        483889..485676
FT                   /transl_table=11
FT                   /gene="acaD"
FT                   /locus_tag="H16_A0460"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91610"
FT                   /db_xref="GOA:Q0KEG1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEG1"
FT                   /inference="protein motif:CDD:cd01153"
FT                   /inference="protein motif:COGS:COG1960"
FT                   /protein_id="CAJ91610.1"
FT                   /translation="MGQYTAPLRDMQFVLHELLGAEAELKAMPPHADIDADTINQVIEE
FT                   AGKFCSDVVFPLNQVGDREGCTYVGDGVVKAPTGFKEAYQQYVEAGWPALACDPEFGGQ
FT                   GLPIVINNVVYEMLNSAGQAWTMYPGLSHGAYEALHAHGTPELQQTYLPKLVSGVWTGT
FT                   MCLTEPHCGTDLGILRSKAEPQADGSYLISGTKIFISAGEHDMAENIIHLVLARLPDAP
FT                   GGTKGISLFVVPKFIPDANGNPGERNGIKCGSIEHKMGIHGNATCVMNLDGARGWMVGE
FT                   PNKGLNAMFVMMNAARLGVGAQGLGLTEVAYQNSLAYAKDRLQMRALTGPKAPDKPADP
FT                   IIVHPDVRRMLLTQKAYAEGGRAFSYWTALQIDRELSHPDEAVRKQAGDLVALLTPVIK
FT                   AFLTDNAFTSTNEGMQVFGGHGYIAEWGMEQYVRDARINMIYEGTNTIQALDLLGRKIL
FT                   GDMGARMKAFGKIVQEFVEAEGTNEAMQEFINPLADIGDKVQKLTMEIGMKAMGNADEV
FT                   GAAAVPYLRVVGHLVFSYFWARMAKIALEKEASGDKFYTAKLATARFYFARLLPETAAE
FT                   IRKARAGSATLMALDADLF"
FT   CDS_pept        485753..488176
FT                   /transl_table=11
FT                   /gene="h16_A0461"
FT                   /locus_tag="H16_A0461"
FT                   /product="two domain protein: 3-hydroxyacyl-CoA
FT                   dehydrogenase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91611"
FT                   /db_xref="GOA:Q0KEG0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEG0"
FT                   /inference="protein motif:COGS:COG1250"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /inference="protein motif:COGS:COG1024"
FT                   /protein_id="CAJ91611.1"
FT                   /translation="MSNFIVKKVAVLGAGVMGAQIAAHLINARVPVVLFDLPAKEGPKN
FT                   GIALRAIENLKKLSPAPLGIKEEAGLIQAANYEDDIALLKECDLVIEAIAERMDWKHDL
FT                   YKKVAPHLASHAIFATNTSGLSITALSDGFDADLKSRFCGVHFFNPPRYMHLVELIPTA
FT                   TTQPQILDQLEAFLTTTLGKGVVRAKDTPNFIANRVGIFSILAVFAEAEKFGIPFDVVD
FT                   DLTGSKLGRAKSATFRTADVVGLDTMAHVIKTMQDTLHDDPFAPVYKTPAVLKGLVDAG
FT                   ALGQKTGAGFYKKEGKAIKVLDAKTGQYVDAGKKADEIVVRMLKKDAAERIKLLRESTN
FT                   PQAQFLWAVFRDVFHYIAVYLEQIAGSAADIDLAIRWGFGWNSGPFEDWQSAGWKQVAE
FT                   WVKEDVEAGKALSAAPLPAWVFEGPVAENQGVHAAAGSWSPATQSFVARSKLPVYQRQA
FT                   FRAAIKGTAAADPRKAGRTVEENDAVRIWVSEGQDDVLVVSFKSKMNTIGPDVIDGLTR
FT                   AIDLAEAGYKGLVVWQPTSLQLGAPGGPFSAGANLEAAMPAFMMGGAKGIEPFVKRFQD
FT                   GMMRVKYASVPVVSAASGIALGGGCELMLHSASRVAALETYIGLVEVGVGLVPAGGGLK
FT                   EAALAAARAAQAAGSTNILQFLTSRFQSAAMAKVSASALEARQMGYLQPSDKIVFNVHE
FT                   LLYVAQNEVRALASAGYRAPLPTLVPVAGRSGIATIKASLVNMRDGGFISTHDFLIASR
FT                   IAEAVCGGDVEAGSLVSEDWLLALERKAFVDLLGTGKTQERIMGMLQTGKPVRN"
FT   CDS_pept        488201..489397
FT                   /transl_table=11
FT                   /gene="h16_A0462"
FT                   /locus_tag="H16_A0462"
FT                   /product="Acetyl-CoA C-acyltransferase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91612"
FT                   /db_xref="GOA:Q0KEF9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEF9"
FT                   /inference="protein motif:CDD:cd00751"
FT                   /inference="protein motif:COGS:COG0183"
FT                   /inference="protein motif:PFAM:PF00108"
FT                   /inference="protein motif:PFAM:PF02803"
FT                   /protein_id="CAJ91612.1"
FT                   /translation="MKQLQDAYIVAATRSPIGKAPKGAFKNTRPDDLLATILKAAVAQV
FT                   PDLDPKLIEDAIVGCAIPEAQQGLNVARIGALLSGLPNTVGGITVNRFCASGVSAVAMA
FT                   ADRIRVGESDVMIAAGVESMSMVPMMGNSPSMSPEIFTRDENVGIAYGMGLTAEKVAQQ
FT                   WQVSREDQDAFSLASHQKAIAAQQAGEFKDEITPIEIVERFPDLASGQVNVKSRTISLD
FT                   EGPRPETSLEGLGKLRPVFANKGSVTAGNSSQTSDGAGALILVSEKILKQFNLVPLARF
FT                   VSFAVRGVPPEIMGIGPKEAIPAALKAAGLTQDQLDWIELNEAFAAQSLAVMRDLQLDP
FT                   AKVNRMGGAIALGHPLGATGAIRSATVVHALRRHNLKYGMVTMCVGTGMGAAGIFERV"
FT   CDS_pept        489515..490471
FT                   /transl_table=11
FT                   /gene="h16_A0463"
FT                   /locus_tag="H16_A0463"
FT                   /product="hypothetical membrane associated protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91613"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEF8"
FT                   /inference="protein motif:COGS:COG1307"
FT                   /protein_id="CAJ91613.1"
FT                   /translation="MQETAILADAACDLPRDVMAQLKVHTIPFRIRAGEHFVADTRDED
FT                   ALPTLYQQYLIGRQDHYAESIPLLERELEEHLLRNVVAHCDRAILFTIASSRSKLYAHA
FT                   TGAVIGTVARSVRLRKEAGRTGLFDLTVVDTGAIGPGQALIVREAARMAAAGASPQAVR
FT                   EAVETRLRDAAHMFLVPDELLYMYTRARQKGEGSITWGRYVMGSAFNIRPVVRMHRGHT
FT                   EAIARARGSEEGARRVLQHAEQCIRGGDLMVPAISVCYAGPLDDVREMPAFQSLERTAR
FT                   GQGVALMLAPMSLTVALNVGARAFGLSYLSESPPPFE"
FT   CDS_pept        490503..491279
FT                   /transl_table=11
FT                   /gene="h16_A0464"
FT                   /locus_tag="H16_A0464"
FT                   /product="Enoyl-CoA hydratase/carnithine racemase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91614"
FT                   /db_xref="GOA:Q0KEF7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEF7"
FT                   /inference="protein motif:COGS:COG1024"
FT                   /protein_id="CAJ91614.1"
FT                   /translation="MSIRTGIEQGILTIEFDRIDKKNAITAAMYQAMADALRAAETDRN
FT                   VRAILLRGKPEIFTAGNDLEDFMQRPPTAGEGAEQAPVFQFLYQISHATKPVVAAVSGA
FT                   AVGVGTTMLLHCDLVYASDTAKLSLPFVQLGLCPEAASSLLLPRLVGYQRAAEKLLLGE
FT                   AFSAQEALEIGLVTRVLPVAELHDFALEQARKLAALPASSLRETKRLMKAGDVAVVEKQ
FT                   MADEGAVFRRMLVAPEAKEAFAAFFQKRKPDFTKFE"
FT   CDS_pept        complement(491370..491708)
FT                   /transl_table=11
FT                   /gene="h16_A0465"
FT                   /locus_tag="H16_A0465"
FT                   /product="Acyl-CoA hydrolase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="3.1.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91615"
FT                   /db_xref="GOA:Q0KEF6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEF6"
FT                   /inference="protein motif:COGS:COG1607"
FT                   /protein_id="CAJ91615.1"
FT                   /translation="MPADANVHGDVFGGWIMAQVDIAGSIPAVERAQGRVATVAVNSFL
FT                   FKHPVFVGDLVSFYADIVKTGRTSITVSVEVYAQRMRHSNEIVKVTEATLTYVATDESR
FT                   QPRMLPSA"
FT   CDS_pept        491883..493781
FT                   /transl_table=11
FT                   /gene="h16_A0466"
FT                   /locus_tag="H16_A0466"
FT                   /product="ABC-type transporter, ATPase and permease
FT                   components: HMT family"
FT                   /function="Defense mechanisms"
FT                   /EC_number="3.6.3.-"
FT                   /note="6 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91616"
FT                   /db_xref="GOA:Q0KEF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEF5"
FT                   /inference="protein motif:TCDB:3.A.1.210"
FT                   /inference="protein motif:COGS:COG5265"
FT                   /inference="protein motif:COGS:COG1132"
FT                   /protein_id="CAJ91616.1"
FT                   /translation="MRRYSTTAEPAPAPASNTLFPGQRAPRSDWQTVRNLLPYVWHYKW
FT                   RVMLALACLVSAKVANLGVPVLMKQLIDSMNLQPGDPRALLAVPVGLIVAYGLLRLSAT
FT                   LFTELREMLFSKVTQSAVREIALQVFRHLHALSLRFHLDRQTGGMSRDIERGTRGIQSL
FT                   ISYSLYSILPTLVEMGLVIGFFILHYDIWFAAITGCALVGYIVFTIVVTEWRTHFRRRM
FT                   NELDSRANQKAIDSLLNFETVKYFGNEEYEAQRYDENLRKYRTAAIRSQNSLSFLNFGQ
FT                   QTIIALGLILILWRATVGVVDGKLTLGDLVLVNTLMIQLYIPLNFLGVIYREIKQATTD
FT                   MDRMFVLLGTNQEVADAPGAQPLQVSGAQVRFRDVRFSYEPDRLILDGVDFTIAAGTTT
FT                   AVVGHSGSGKSTLARLLFRFYDVNGGAIEIDGQDIRAITQDSLRRAIGIVPQDTVLFND
FT                   SIFYNIAYGRPDASRDEVIAAARAAQIDSFIRELPQGYDTPVGERGLKLSGGEKQRVAI
FT                   ARTLLKDPPVLVFDEATSALDSRTEQAIQAELMRLAQNRTTLLIAHRLSTVVHADQILV
FT                   MDHGRIVERGTHAELMRARGRYAEMWDIQARAAAKGGEAVGADALALDVGDATQDA"
FT   CDS_pept        493986..495128
FT                   /transl_table=11
FT                   /gene="h16_A0467"
FT                   /locus_tag="H16_A0467"
FT                   /product="ABC-type transporter, periplasmic component: TauT
FT                   family"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91617"
FT                   /db_xref="GOA:Q0KEF4"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEF4"
FT                   /inference="protein motif:TCDB:3.A.1"
FT                   /inference="protein motif:COGS:COG0715"
FT                   /protein_id="CAJ91617.1"
FT                   /translation="MPHFHAALASPGVCAAAAENHEHTGTRASRTAARRRLLKLGVMIG
FT                   TSLVLSTQFAGAAHAQAAPTKVRFQLDWRFEGPAALFLLGEQKGYYKAEKLDVSIDAGN
FT                   GSGNVVNRVASGTYDMGFADMSSVMEFYGNNPDAKNKPVAVMMVYNNTPAAVLALKKSG
FT                   IRAPKDLAGKRMGAPVFDAGRRAFPIFARANGLQASSFNWQAMDPTLRETMLTRGDLDA
FT                   ITGFSFTSILNLNARGVKDEDIVVLPYPQFGVKLYGNAVIASEDFMKKNPEAVKAFLRA
FT                   FSKSARDVIARPEEGIKAVKARDGIIDEKLEVRRLKLALDSVVKSPDAKAEGFGRVSEP
FT                   RLSLMASQVADAFGTKGRINPDALWTDAFLPSAAELDVLR"
FT   sig_peptide     493986..494042
FT                   /gene="h16_A0467"
FT                   /locus_tag="H16_A0467"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        495125..495979
FT                   /transl_table=11
FT                   /gene="h16_A0468"
FT                   /locus_tag="H16_A0468"
FT                   /product="ABC-type transporter, ATPase component: TauT
FT                   family"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91618"
FT                   /db_xref="GOA:Q0KEF3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEF3"
FT                   /inference="protein motif:TCDB:3.A.1.17"
FT                   /inference="protein motif:COGS:COG1116"
FT                   /inference="protein motif:COGS:COG4525"
FT                   /protein_id="CAJ91618.1"
FT                   /translation="MMTRQAAFMPASGGSAAPAAAEPFVDFNRVWLAYNDELAHKGEFA
FT                   VEDISLQVAPGEFIAIVGPSGCGKSTFMKLATGLKAATRGVVRIAGEKVTGPLKQVGMA
FT                   FQAPTLLPWRTTLDNVMLPLEIVEPYRSTLRARRDEYVERSRKLLHTVGLAGYEDKYPW
FT                   QLSGGMQQRASICRALVHEPRMLLLDEPFGALDAFTREELWCVLRDLWQAQRFNVILVT
FT                   HDLREAVFLADTVYVMSQRPGRILMRKEIDLPRPRDLELTYTEPFADLVHMLREKIGHV
FT                   RQH"
FT   CDS_pept        495992..496765
FT                   /transl_table=11
FT                   /gene="h16_A0469"
FT                   /locus_tag="H16_A0469"
FT                   /product="ABC-type transporter, permease component: TauT
FT                   family"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /note="5 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91619"
FT                   /db_xref="GOA:Q0KEF2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEF2"
FT                   /inference="protein motif:TCDB:3.A.1.17"
FT                   /inference="protein motif:COGS:COG0600"
FT                   /inference="protein motif:COGS:COG1174"
FT                   /protein_id="CAJ91619.1"
FT                   /translation="MMTLTSAQERRVQRVAPWLLLAAVLLLWQGACMAFGVSDFILPTP
FT                   SAIVASLVEYADVIAGHAWRTFWTTMVGFGVAIAVGVLLGLAMGSSRLLYAASYPLMTA
FT                   FNALPKAAFVPILVVWFGLGAGPAILTAFLISFFPIMVNIATGLATLEPELEDVLRVLG
FT                   AKRRDVLFKVGLPRAMPYFFASLKVAITLAFVGTTVSEMNAANEGIGYLLVSAGSAMKM
FT                   PLAFAGLVVIAVMAMAMYELFAVVEKRMTGWAHRG"
FT   CDS_pept        496821..497804
FT                   /transl_table=11
FT                   /gene="h16_A0470"
FT                   /locus_tag="H16_A0470"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91620"
FT                   /db_xref="GOA:Q0KEF1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEF1"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91620.1"
FT                   /translation="MEIKWLEDFVSLAETHSFSRSAELRHVTQPAFSRRIQSLEAWVGT
FT                   ELIDRSSYPTSLTPAGKVFYEQALAMLAQVSETRALMRGQRSANAQVLEFAVPHTLSLT
FT                   FFPEWLKALERRIGTLPCRLRALNVHDAVLMLVEGGCDLVMVYHHARQAIQLDPARYDM
FT                   LVLGTERLSPYSVPDAAGKPQFRLPGTDKKPVPFLSYTPNAFLGRMVDLLLADTSEALK
FT                   LDKCYETDMAEALKVMALAGHGMAFLPESAVREDVAAGRLVRAESARGLPLSIDMEIRL
FT                   YRERPGENGNERRAGARRKRQLVDQVWSTLSAAQSAQPAGSPVSAR"
FT   CDS_pept        497908..499215
FT                   /transl_table=11
FT                   /gene="gdhA1"
FT                   /locus_tag="H16_A0471"
FT                   /product="glutamate dehydrogenase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="1.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91621"
FT                   /db_xref="GOA:Q0KEF0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEF0"
FT                   /inference="protein motif:COGS:COG0334"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /inference="protein motif:PFAM:PF02812"
FT                   /protein_id="CAJ91621.1"
FT                   /translation="MSSAAPTNIAGQKHALPSYLNADHLGPWGIYLQQVDRVTPYLGSL
FT                   ARWVETLKRPKRAMIVDVPIELDNGTIAHFEGYRVQHNLSRGPGKGGVRFHQDVTLSEV
FT                   MALSAWMSVKNAAVNVPYGGAKGGIRVDPRTLSHAELERLTRRYTSEINIIIGPSKDIP
FT                   APDVNTNAQVMAWMMDTYSMNSGSTATGVVTGKPISLGGSLGRHEATGRGVFVVGSEAA
FT                   RNIGLEIKGARVAVQGFGNVGAVAAKLFHEAGAKVVAVQDHRTTLFDPAGLDVPAMMEY
FT                   ASHSGTIEGFRGEVLRTEQFWEVDCDILIPAALEGQITVQNAPKITAKLVIEGANGPTT
FT                   PQADDILRERNILVCPDVIANAGGVTVSYFEWVQDFSSFFWTEEEINQRLVRIMQEAFR
FT                   AIWQVAQDNKVTLRTAAFIVACTRILQAREMRGLYP"
FT   CDS_pept        499482..500381
FT                   /transl_table=11
FT                   /gene="h16_A0472"
FT                   /locus_tag="H16_A0472"
FT                   /product="ABC-type transporter, periplasmic component: PAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism / Signal
FT                   transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91622"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEE9"
FT                   /inference="protein motif:TCDB:3.A.1.3"
FT                   /inference="protein motif:SMART:smart00062"
FT                   /inference="protein motif:COGS:COG0834"
FT                   /protein_id="CAJ91622.1"
FT                   /translation="MNFAKLAALMIAGGVMCGTAQAAEQLTGTLKKIKDTGVITLGVRE
FT                   SSIPFNYNLGGVRQVGYSYDINMKIVEAIKDQLKLPNLQVKEIPITSQNRITLLQNGTI
FT                   DIECGSTTNNLERQKQVGFTNSIFIIGTRIMVKKDAGIKDWADLKGKNVVTTAGTTSER
FT                   LLRKMNDDQKLGVNIISTKDHGQSFLTLESGRAVAFMMDDALLYGERAKAKNPADWIVV
FT                   GKPQSRESYGCMIRKDDPQFKKLSDTVISGMMKDGSINTLYTKWFMTPVPPKGLNLDFP
FT                   LSEDMKALFKTPNDKALD"
FT   sig_peptide     499482..499550
FT                   /gene="h16_A0472"
FT                   /locus_tag="H16_A0472"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        500445..501173
FT                   /transl_table=11
FT                   /gene="h16_A0473"
FT                   /locus_tag="H16_A0473"
FT                   /product="ABC-type transporter, permease component: PAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /note="4 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91623"
FT                   /db_xref="GOA:Q0KEE8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEE8"
FT                   /inference="protein motif:TCDB:3.A.1.3"
FT                   /inference="protein motif:COGS:COG0765"
FT                   /protein_id="CAJ91623.1"
FT                   /translation="MNYNWHWAVFLEQAAQNETYLDWMISGLKVTLALGLSSWVIALVI
FT                   GSVLGVLRTVPNKWLAGIAATYVEIFRNIPLLVQLFIWYFVAPELLPGGEAIKQMNPFA
FT                   QQFLAAMLCLGTFTAARVCEQVRSGINSLARGQKNAGLAMGFTLPQTYRHVLLPMAFRV
FT                   IVPPLTSEFLNIFKNSAVASTIGLLELAAQGRQLVDYTARPYESFIAVTLMYALINVTV
FT                   MLIMRWVEARTRVPGFIGGK"
FT   CDS_pept        501183..501866
FT                   /transl_table=11
FT                   /gene="h16_A0474"
FT                   /locus_tag="H16_A0474"
FT                   /product="ABC-type transporter, permease component: PAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /note="5 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91624"
FT                   /db_xref="GOA:Q0KEE7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEE7"
FT                   /inference="protein motif:TCDB:3.A.1.3"
FT                   /inference="protein motif:COGS:COG0765"
FT                   /protein_id="CAJ91624.1"
FT                   /translation="MAYSFDFTSITPATLEVLGEGMMVSLKITVTAVVVGIVWGTILAM
FT                   MRLSSFRLLNWFAQGYVTIFRSIPLVMVLLWFFLIIPQVLQNLFNLSPATDLRMTSALV
FT                   AFALFEAAYYSEIIRAGIQSVSRGQMFAAQALGMTYGQSMRLVILPQAFRNMVPLLLTQ
FT                   GIILFQDTSLVYVSALADFFGQAYGIGERDGRIVEMLLFAGVVYFVICFSASLLVKRYQ
FT                   KKVAV"
FT   CDS_pept        501863..502597
FT                   /transl_table=11
FT                   /gene="h16_A0475"
FT                   /locus_tag="H16_A0475"
FT                   /product="ABC-type transporter, ATPase component: PAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91625"
FT                   /db_xref="GOA:Q0KEE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEE6"
FT                   /inference="protein motif:TCDB:3.A.1.3"
FT                   /inference="protein motif:COGS:COG1126"
FT                   /protein_id="CAJ91625.1"
FT                   /translation="MIEINNVSKWYGAFQVLTDCTTKVAKGEVVVVCGPSGSGKSTLIK
FT                   TVNALEPFQKGDILVDGTSVGNPKTNLPKLRSRVGMVFQNFELFPHLSITENLTIAQMK
FT                   VLGRSKDEAMAKGLKYLDRVGLKSQAEKYPGQLSGGQQQRVAIARALSMDPICMLFDEP
FT                   TSALDPEMVNEVLDVMVQLAQEGMTMMCVTHEMGFARKVANRVIFMDQGKIVEDCEKEE
FT                   FFGNIEHRSERARQFLSKILHH"
FT   CDS_pept        complement(502659..503489)
FT                   /transl_table=11
FT                   /gene="h16_A0476"
FT                   /locus_tag="H16_A0476"
FT                   /product="predicted glutamine amidotransferase class II"
FT                   /function="General function prediction only"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91626"
FT                   /db_xref="GOA:Q0KEE5"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEE5"
FT                   /inference="protein motif:COGS:COG0121"
FT                   /inference="protein motif:CDD:cd01908"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="CAJ91626.1"
FT                   /translation="MCQLLGMNCATPTDVTFSFTGFAARGGLTDHHADGFGVAFFEDKA
FT                   CRLFIDNQSAGTSPVADLIKRYPIKSKNVISHIRKATQGTVLLENCHPFMRELWGRHWI
FT                   FAHNGDLKGFTPFLSGVYQPVGDTDSELAFCTLMQGLRKRFPGSQPPLNELCHALADIT
FT                   REITLHGVFNYLLCNGQAQFAHCSTHLYYIVRQWPFSTAHLIDADLSIDFAQVTTPDDR
FT                   VAVIATQPLTDNETWTRFAPGELIMFEDGHPTMTLTVPIPPEVQAKNAANTACT"
FT   CDS_pept        503628..504701
FT                   /transl_table=11
FT                   /gene="leuB1"
FT                   /locus_tag="H16_A0477"
FT                   /product="3-Isopropylmalate dehydrogenase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91627"
FT                   /db_xref="GOA:Q0KEE4"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEE4"
FT                   /inference="protein motif:COGS:COG0473"
FT                   /protein_id="CAJ91627.1"
FT                   /translation="MRQYKIAVIPGDGIGTEVMPEGIRVMDAAARRFGIDFQWDHFDFS
FT                   SCDYYARHGKMLPDDWFDTLVKYDAIYFGAVGWPDAVPDHVSLWGSLLQFRRSFDQYVN
FT                   LRPVRLMPGIRSPLAGRQPGDIDFYVVRENTEGEYSSIGGRMFPGTEREIVVQETVMSR
FT                   TGVDRILKFAFELAQKRPKKHLTSATKSNGISITMPYWDERVEAMAASYPGIKVDKYHI
FT                   DILTAHFVQHPDWFDVVVASNLFGDILSDLGPACTGTIGIAPSGNINPDRTFPSLFEPV
FT                   HGSAPDIAGRGVANPIGQIWCGAMMLEHLGHEAAGAAVLGAIEKVLAAGPEHAPLTRDI
FT                   GGKAGTADLGLAIAEAL"
FT   CDS_pept        504698..506005
FT                   /transl_table=11
FT                   /gene="ldhA"
FT                   /locus_tag="H16_A0478"
FT                   /product="dehydrogenase related to lactate dehydrogenases"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91628"
FT                   /db_xref="GOA:Q0KEE3"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEE3"
FT                   /inference="protein motif:COGS:COG1052"
FT                   /protein_id="CAJ91628.1"
FT                   /translation="MSAAVAGDPRALLLDSFHAAVAAADPLQIVAQHLPPPHAGGRTLV
FT                   VGAGKAAASMAAAVERAYAGKATLEGLVVTRYAHGLPTDHIRVIEAGHPVPDEAGEQAA
FT                   ADILASVQSLTPQDRLLVLVSGGGSSLLSLPAEGIPMADLKAATRELLRCGAPITEMNI
FT                   VRKHVSRIQGGRLAQASRAPVTTLIVSDVAGDDPSAIASGPTVADPSTFADALEILRRW
FT                   GAQVPASVQAHLECGARGDVPETPKPGDALFARVDHRMIATAHGSLQAAAALFRERGIT
FT                   PVVLGDTVTGEAREVARVYAALVREIRAYNAPFAAPVALISGGECTVTLPAGGGATKAR
FT                   GGRCSEFLLSLAVELDGMPGVHAIAADTDGIDGSEDNAGALADPTTLARAAAAGLPGLR
FT                   QLDAHDAWGLFDAIGDLVVTGPTRTNVNDYRAILIL"
FT   CDS_pept        506050..507084
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="H16_A0479"
FT                   /product="Dihydroorotase"
FT                   /function="Nucleotide transport and metabolism"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91629"
FT                   /db_xref="GOA:Q0KEE2"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEE2"
FT                   /inference="protein motif:COGS:COG0418"
FT                   /protein_id="CAJ91629.1"
FT                   /translation="MTQKLTITRPDDWHLHLRDGAALAAVLPDTARQFARAIIMPNLKP
FT                   PVTTVAQAQAYRARILAALPAGLQFEPLMTLYLTDNTTAEEIAAAKASGFVHGVKLYPA
FT                   GATTNSDAGVTDIRRCYPALEAMQRAGLPLLVHGEVTDPSIDIFDREAVFIDRVMTPLR
FT                   RDMPELKVVFEHITTKDAAEYVRDASGPVGATITAHHLLYNRNAIFTGGIRPHYYCLPV
FT                   LKRETHREALVAAAVSGSPRFFLGTDSAPHARGLKEHACGCAGCYTALHAMELYAEAFD
FT                   AAGALDKLEAFASFNGPAFYGLPRNTGTLTLEREDWELPAELPYGDTTLVPLRGGETLR
FT                   WKAR"
FT   CDS_pept        507105..507932
FT                   /transl_table=11
FT                   /gene="h16_A0480"
FT                   /locus_tag="H16_A0480"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91630"
FT                   /db_xref="InterPro:IPR021390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEE1"
FT                   /protein_id="CAJ91630.1"
FT                   /translation="MQAQAGDEPFVAALAGIDWSRPWFQLFAAQGAALAAAVQGGADLR
FT                   ALLSAHAAQLRLCNARGLPLRFIAQHALPEGSAYEAHIHATGEIPTRDNLHDFFNALTW
FT                   LHFPQAKRVLNQIQAEVIAREGVQTTRGSVRDAATLFDENAVLFVSTDQDLADALKGFA
FT                   WQRLLVESRPAWGRACTVVPFGHALLEKLVQPYKSVTAHAWVLPLAPQQAAGPWLDVML
FT                   AQSLAAAAQAGALRGGRSFAPLPVMGIPGWCDDNAEPGFYADTSVFRPGRRAD"
FT   CDS_pept        complement(508362..508784)
FT                   /transl_table=11
FT                   /gene="h16_A0481"
FT                   /locus_tag="H16_A0481"
FT                   /product="predicted redox protein, regulator of
FT                   disulfide-bond formation"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91631"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEE0"
FT                   /inference="protein motif:COGS:COG1765"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="CAJ91631.1"
FT                   /translation="MECKVTWMGADGMSFVAQTGSGHIVAMDGAPDGGGHNLAPRPMEM
FT                   VLLGTGGCTAYDVVLILKRGRQDVSGCSVQLQAERAGEDPKVFTRINFHFVVTGKNLNP
FT                   ATVERAIKLSHEKYCSASIMLAKTAEITHTMEIVEA"
FT   CDS_pept        509507..509935
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="H16_A0482"
FT                   /product="LSU ribosomal protein L13"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91632"
FT                   /db_xref="GOA:Q0KED9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KED9"
FT                   /inference="protein motif:PFAM:PF00572"
FT                   /protein_id="CAJ91632.1"
FT                   /translation="MKTFSAKPHEVKRDWYVIDATDKVLGRVASEVARRLRGKHKPEFT
FT                   PHVDTGDYIIIVNAAKLRVTGTKETDKKYYRHSGYPGGIYETTFGKMQQRFPGRALEKA
FT                   VKGMLPKGPLGYAMIKKLKVYAEAEHPHEAQQPKALEI"
FT   CDS_pept        509948..510340
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="H16_A0483"
FT                   /product="SSU ribosomal protein S9"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91633"
FT                   /db_xref="GOA:Q0KED8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KED8"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="CAJ91633.1"
FT                   /translation="MIGNWNYGTGRRKSAVARVFIKSGKGDIIVNGKPIKEYFARETSL
FT                   MIVRQPLELTAHAETFDIKVNVTGGGETGQAGAVRHGITRALIDYDATLKSALSKAGYV
FT                   TRDAREVERKKVGFHKARRRKQFSKR"
FT   CDS_pept        510596..511084
FT                   /transl_table=11
FT                   /gene="h16_A0484"
FT                   /locus_tag="H16_A0484"
FT                   /product="integral membrane protein involved in cell shape
FT                   determination"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91634"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KED7"
FT                   /inference="protein motif:COGS:COG1664"
FT                   /inference="protein motif:PFAM:PF04519"
FT                   /protein_id="CAJ91634.1"
FT                   /translation="MLFSKKKGLSIDTLIGEDTAVDGDLVFAGGLRLDGRVRGNVTAAP
FT                   GKPSMLVVSEKGMIEGEISVGHLVLNGTVKGPVQATDLLELQPHARVLGDVRYAALEMH
FT                   QGALVEGRLMPLVQGEIKALPNLVEAAPAVEVTEAADEAAVTDRATPAADTQPTEKAA"
FT   CDS_pept        511186..511554
FT                   /transl_table=11
FT                   /gene="h16_A0485"
FT                   /locus_tag="H16_A0485"
FT                   /product="iron sulfur cluster assembly protein"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91635"
FT                   /db_xref="GOA:Q0KED6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KED6"
FT                   /inference="protein motif:COGS:COG0316"
FT                   /inference="protein motif:PFAM:PF01521"
FT                   /protein_id="CAJ91635.1"
FT                   /translation="MNAVAEAPVTEDVPAPFVFTDSAADKVKQLIEEEGNAELKLRVFV
FT                   QGGGCSGFQYGFTFDEEVNEDDTTMVKNGVTLLIDSMSYQYLVGAEIDYKEDINGAQFV
FT                   IKNPNASTTCGCGSSFSV"
FT   CDS_pept        complement(511614..512411)
FT                   /transl_table=11
FT                   /gene="h16_A0486"
FT                   /locus_tag="H16_A0486"
FT                   /product="putative phytanoyl-CoA dioxygenase"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91636"
FT                   /db_xref="GOA:Q0KED5"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KED5"
FT                   /inference="protein motif:COGS:COG5285"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="CAJ91636.1"
FT                   /translation="MNITQEHIDTYQRDGVLVLRGAFTDWVERLRDGFAQNLAEPGAFA
FT                   IENVRPGESGRFFEDYCNWQRITPFDDFIRQSPAAAIAGRIMQSQAVQVFHEHILVKEP
FT                   GTAKPTPWHQDLPYYCVDGTQTASYWIPLDPVTQANTLRVVAGSHRWARLVRPKRWASN
FT                   ENFYGGNDAFMEMPDVEDGSYTLLAPELEPGDAVVFDFRTVHGAAGNTGSGRRRAFSAR
FT                   FLGDDVRFMLRPGRTSPPFPGIDQQTGERMREDWFPVVWRAAR"
FT   CDS_pept        512502..513407
FT                   /transl_table=11
FT                   /gene="h16_A0487"
FT                   /locus_tag="H16_A0487"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91637"
FT                   /db_xref="GOA:Q0KED4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KED4"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91637.1"
FT                   /translation="MIPFSFRQLEYFVAAAEHGSISAAARARHVSQPSVSTAIAQLEDT
FT                   LGEPLFRRQVSRGLSLTPAGQRLLGRARDILALAAGLTVDDATGRGLTGQLSLTCFQDL
FT                   GPYFVPRLLAGLRRHHPGISVTLFEADLATVHRTLQAGKAELALTYELGLDARTERRTL
FT                   AELAPYALLPAGHPLASGTDVSLADLAGERLILEDIPQTREYFLSLFWAHGLHPVLHQY
FT                   TQTFEMQRGLVAHGYGVALSCTRPAGDHSYDGVPIACLPLREPVTPQRVVLARSPAMRA
FT                   SPLAQAFMDWVEAGGAMRLP"
FT   CDS_pept        complement(513404..514534)
FT                   /transl_table=11
FT                   /gene="h16_A0488"
FT                   /locus_tag="H16_A0488"
FT                   /product="conserved hypothetical protein"
FT                   /function="Posttranslational modification, protein
FT                   turnover, chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91638"
FT                   /db_xref="GOA:Q0KED3"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KED3"
FT                   /inference="protein motif:PFAM:PF03702"
FT                   /inference="protein motif:COGS:COG2377"
FT                   /protein_id="CAJ91638.1"
FT                   /translation="MTQPVPGSERYIGIMSGTSMDGADAVLVDFSGARPAVLAAASQPF
FT                   PDTLRAAFSALQQPGEDEIHREALAANALAQVYADCVAALLSEAQVDAAAVAAIGAHGQ
FT                   TIRHRPGLYDGIGYTRQSQHPAHLAELAGIDVVADFRSRDLAAGGQGAPLVPALHHALF
FT                   GSDAETRVACNIGGISNISILPAAGGAVSGFDCGPGNALLDYWVGRHRGLPFDSNGDWA
FT                   ASGRVDAALLAQCLAEPYFSAAPPKSTGRDLFHPGWLEARLASFQHLAPADVQATLAAL
FT                   TAEAIARDMRTHAPDARRLIVCGGGARNAFVMARLTQALPGVAIETSDDYGVPVSQVEA
FT                   IAFAWLARQCLLRLPGNVPTVTGAAGPRVLGAIYPR"
FT   CDS_pept        complement(514546..515937)
FT                   /transl_table=11
FT                   /gene="nlpD"
FT                   /locus_tag="H16_A0489"
FT                   /product="membrane associated metalloendopeptidase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="3.4.-.-"
FT                   /note="1 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91639"
FT                   /db_xref="GOA:Q0KED2"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KED2"
FT                   /inference="protein motif:COGS:COG0739"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="CAJ91639.1"
FT                   /translation="MWSRLREVFARELVVLVDPTNPQHARRRKQLTASVGAIFTLGMAA
FT                   AMGVAPRSAFDDPLAPRTQQALRMPDVREQLEQLTDSQAVYVREERMQRGDTIASLLKR
FT                   LGVDDADAQAFIVKNPTARGLFNLNPGQAVQAEIDESNTLVSLQANLGGDAAASRELVI
FT                   ERVRAASDNTAATYKAKVQRVDNDVHYEMASGAISAGGFFKAMDAANVPDEVVQQMLSI
FT                   FSGVIDFHHDIASGDRFRIIYEAGFRDGTFVRNGRVVALELINRNQLHQALWFAPEDSK
FT                   DGGAYYTFDGRSMKRPFLRSPVEFSRVSSGFGGREHPLHHDWAQHKGVDFAAPTGTKVL
FT                   ATGDGVVEFVGQQNGYGNIVILNHANGYSTYYAHLSGFAGMRQGQPVRQGQLIGYVGST
FT                   GWATGPHLHYEFRFNDVPQNPLTITLMESPTLTGKSRQEFLTYTSGLLSRINALRTYNV
FT                   LTASN"
FT   CDS_pept        516183..517424
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="H16_A0490"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91640"
FT                   /db_xref="GOA:Q0KED1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KED1"
FT                   /inference="protein motif:COGS:COG0162"
FT                   /inference="protein motif:PFAM:tRNA-synt_1b"
FT                   /protein_id="CAJ91640.1"
FT                   /translation="MTEVATGPTAKYPLTPSVMQALEVSKRGCDELLIESEWAQKLARS
FT                   EATGVPLRIKLGLDPTAPDIHIGHTVVLNKLRQLQDLGHQVIFLIGDFTSTIGDPSGRN
FT                   STRPPLTREQIEANAQTYYRQASLVLDPARTEIRYNSEWCDPLGARGMIQLAAKYTVAR
FT                   MMERDDFTKRFRSGIPISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLVGRELQKE
FT                   YGQEPQCILTMPLLVGLDGVEKMSKSKGNYVGVTEAPNEMFGKLMSISDDLMWQYYTLL
FT                   SFRPLAEIELMKQEIALGRNPRDCKVLLAQEIVARFHSQADAEKALEDFNHRARGGVPD
FT                   DIPAVSLTGAPLGIAQLLKQANLVPSTSEANRNIEQGGVKIDGATVSDKATRVAAGTYV
FT                   VQVGKRRFARVTLA"
FT   CDS_pept        517435..517896
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="H16_A0491"
FT                   /product="D-Tyrosyl-tRNA(Tyr) deacylase"
FT                   /function="General function prediction only"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91641"
FT                   /db_xref="GOA:Q0KED0"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KED0"
FT                   /inference="protein motif:CDD:cd00563"
FT                   /protein_id="CAJ91641.1"
FT                   /translation="MIALIQRVAQARVTVEGRTTGEIGAGLLALVCAERGDTEAQAERL
FT                   LAKMLSYRVFSDAAGKMNLPVQNMDGNGNAGGLLVVSQFTLAADTNSGTRPSFTPAASP
FT                   EDGRRLYEHFVAQARAAHPQVQTGEFGAMMQVSLVNDGPVTFWLRVPPA"
FT   CDS_pept        517948..518595
FT                   /transl_table=11
FT                   /gene="h16_A0492"
FT                   /locus_tag="H16_A0492"
FT                   /product="Phospholipid-binding protein"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91642"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEC9"
FT                   /inference="protein motif:COGS:COG1881"
FT                   /inference="protein motif:CDD:cd00865"
FT                   /inference="protein motif:CDD:cd00457"
FT                   /protein_id="CAJ91642.1"
FT                   /translation="MKVWSKSFNDNAPIPGEFAFCVPDAAAHVALSNNRNPDLRWEDAP
FT                   AETRSFVLICHDRDVPSKGDDVNQEGREVPAALPRVDFFHWVLVDIPPGLTSIAAGSHS
FT                   DGVIARGKPGPEATGGTATAGGLRHGINDYTGWFAGDADMKGDYYGYDGPCPPWNDTLL
FT                   HHYVFTLYALDIDRLPLDGTFTGAQVREAIQGHVLAQASLTGTYTLNPNLAK"
FT   CDS_pept        518660..519334
FT                   /transl_table=11
FT                   /gene="pgam2"
FT                   /locus_tag="H16_A0493"
FT                   /product="phosphoglycerate mutase 2 protein"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91643"
FT                   /db_xref="GOA:Q0KEC8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEC8"
FT                   /inference="protein motif:COGS:COG0406"
FT                   /inference="protein motif:PFAM:PGAM"
FT                   /protein_id="CAJ91643.1"
FT                   /translation="MSQSPGPHSLAYTHLIVIRHGETAWNRERRLQGQLDIPLNETGRA
FT                   QARALATALAGEPIDAVYASDLSRAMETAAPLAEVLGLQVRPDARLRERSYGTLQGKTY
FT                   AEVAEHLPEDFARWQARVPDYAPPEGESLLGFHERAVEVVLALSRRHPGERIALVAHGG
FT                   VLDCLYREATGMTLEAPRQHELLNASVNRLRSDSSHLTLAQWGDVSHLENLSLDEVDRR
FT                   VP"
FT   CDS_pept        complement(519337..520062)
FT                   /transl_table=11
FT                   /gene="h16_A0494"
FT                   /locus_tag="H16_A0494"
FT                   /product="conserved hypothetical protein"
FT                   /function="Function unknown"
FT                   /note="4 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91644"
FT                   /db_xref="GOA:Q0KEC7"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEC7"
FT                   /inference="protein motif:COGS:COG1738"
FT                   /inference="protein motif:PFAM:PF02592"
FT                   /protein_id="CAJ91644.1"
FT                   /translation="MSAIPASAGPAGRVYRYYDFVMVAFVTVLLCSNLIGAAKAAQVTL
FT                   PVIGTVTFGAGVLFFPISYIFGDVLTEVYGYGRDRRVVWAGFAALAFATFMSLVVLNMP
FT                   VAPFMADYQKSLQDVFGNTWRIALGSLIAFCCGSFTNSYVLAKMKLWTSGRWLWTRTIG
FT                   SSLAGELVDSSLFYVIAFYGIWPLEKVIQVAVAQYVLKTGWEVVMTPVTYKVVGFLKRA
FT                   ENEDYFDRNTDFTPFRVRV"
FT   CDS_pept        complement(520230..520814)
FT                   /transl_table=11
FT                   /gene="h16_A0495"
FT                   /locus_tag="H16_A0495"
FT                   /product="conserved hypothetical protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91645"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEC6"
FT                   /inference="protein motif:COGS:COG2930"
FT                   /protein_id="CAJ91645.1"
FT                   /translation="MNRRHFVTRVAGSGLLVATAMAAGCTTTGTSASKDPVAKKQEIDA
FT                   GVDGALNRLFSANPGARDLAQRAQGVLVFPRVISAGLVVGGEYGEGALRSKGATVGYYS
FT                   TTQASVGLTAGGQSKAVIIMFMTPEAYNKFVASKGWTAGADANVAVAKVGADGRLDTLT
FT                   SQQPVIAFVQTNAGLMFDVSVNGSKISKLDI"
FT   CDS_pept        complement(520859..521452)
FT                   /transl_table=11
FT                   /gene="h16_A0496"
FT                   /locus_tag="H16_A0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91646"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEC5"
FT                   /protein_id="CAJ91646.1"
FT                   /translation="MIRHSSSLLAAALAATAFAAGSANAQRPPAPVGVAEEAVISGKIV
FT                   DIDPESKAVLVQGPRGNVVELVAGDEARNFGQIRKGDILTVARGAALVAALEPVDSKAT
FT                   ALAESVDRTTRAAEGGKPGIMREITTTVTAQITKVDPAKRLITFRGPRETLRTVKVQDP
FT                   AIDLNGIKQGQMAKIVYREVVAITVKAPAAAAAN"
FT   sig_peptide     complement(521375..521452)
FT                   /gene="h16_A0496"
FT                   /locus_tag="H16_A0496"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(521655..522713)
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="H16_A0497"
FT                   /product="holliday junction resolvasome, helicase subunit
FT                   RuvB"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91647"
FT                   /db_xref="GOA:Q0KEC4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEC4"
FT                   /inference="protein motif:COGS:COG2255"
FT                   /inference="protein motif:PFAM:PF05491"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /inference="protein motif:PFAM:PF05496"
FT                   /protein_id="CAJ91647.1"
FT                   /translation="MIETDKLAAPARVIAATPASSQEEAFERALRPKLLDEYVGQEKVR
FT                   GQLDIFMHAARNRREALDHVLLFGPPGLGKTTLAHIIAREMGVNLRQTSGPVLERPGDL
FT                   AALLTNLEANDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSVKLDLQPFT
FT                   LVGATTRAGMLTNPLRDRFGIVARLEFYTADELARIVTRSAQLLHARIDPQGALEIARR
FT                   ARGTPRIANRLLRRVRDYAEVKGDGNITRAMADAALAMLDVDSVGFDLMDRKLLEAVLH
FT                   KFGGGPVGVDNLAAAIGEERDTIEDVLEPYLIQQGYLQRTPRGRVATAAAYRHFGLANP
FT                   QGSGASELFGDA"
FT   CDS_pept        complement(522772..523353)
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="H16_A0498"
FT                   /product="holliday junction resolvasome, DNA-binding
FT                   subunit RuvA"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="3.1.4.43"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91648"
FT                   /db_xref="GOA:Q0KEC3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEC3"
FT                   /inference="protein motif:COGS:COG0632"
FT                   /inference="protein motif:PFAM:PF01330"
FT                   /protein_id="CAJ91648.1"
FT                   /translation="MIGRIAGTLIEKNPPHLLVDCHGVGYEVDVPMSTFYNLPAVGQPV
FT                   TLLTQLIVREDAHLLYGFGTASERNTFRELIKITGIGARMALAVLSGMSVPELAQAITL
FT                   QEAGRLTRIPGIGKKTAERLLLELKGKLGAELGHVPGTPAVPDSAVDVLNALLALGYSE
FT                   KEAAAAIKQVPAGTGVSDGIKLALKALSKA"
FT   CDS_pept        complement(523432..524664)
FT                   /transl_table=11
FT                   /gene="gdpD"
FT                   /locus_tag="H16_A0499"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /function="Energy production and conversion"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91649"
FT                   /db_xref="GOA:Q0KEC2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEC2"
FT                   /inference="protein motif:COGS:COG0584"
FT                   /inference="protein motif:PFAM:GDPD"
FT                   /protein_id="CAJ91649.1"
FT                   /translation="MPSQSRLSAPRRRPSLFPVLAFRRWLFPAAAACAALVAGCATAPR
FT                   PKPVSAAPVPAPAASAAPAAAATQPPKPLVIAHRGASALRPEHTLAAYAKAIEDGADAI
FT                   EPDLVMTRDGVLVARHENDITGTTNVAELPQFAERKRTKVIDGERLSGWFTEDFTLAEL
FT                   KTLRARERIPRLRPDNARLNDQFEVPTFDEIVRLAEQAALRTGKPIGIYAELKHPSYFR
FT                   GIGLPLEDKLVAALRAQPYLRNAPVFIQCFETGSLRALRRTLGSGQHNVKLVQLIGNPR
FT                   KGPADWKLAGDGRTFGDMLGATGLREVAAYADGIGPEKSSVVPRDAQGALAAPTPVVRQ
FT                   AHAAGLFVHPYTFRPENSFLPKVLQAGGDDATRSPSGMEREVQAFIAAGIDGFFTDDPA
FT                   LGRRAVDTPAR"
FT   CDS_pept        complement(524745..525290)
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="H16_A0500"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="3.1.22.4"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91650"
FT                   /db_xref="GOA:Q0KEC1"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEC1"
FT                   /inference="protein motif:COGS:COG0817"
FT                   /inference="protein motif:CDD:cd00529"
FT                   /inference="protein motif:PFAM:PF02075"
FT                   /protein_id="CAJ91650.1"
FT                   /translation="MRILGIDPGLRTTGFGVIEKHGNKLAYVASGTIKSDGNSTLPERL
FT                   KTLYDGISEVSRTYAPDCAAIEKVFVNVNPQSTLLLGQARGAAICGLVGYGLPVFEYTA
FT                   LQLKVAVVGYGRANKAQVQEMVTRLLMLPGQPGSDAADALGVAICHANGSDTLGTLSGL
FT                   APDLVRKGMRVRRGRLVG"
FT   CDS_pept        complement(525438..527012)
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="H16_A0501"
FT                   /product="phosphoribosylaminoimidazole carboxamide
FT                   formyltransferase and imp cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91651"
FT                   /db_xref="GOA:Q0KEC0"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEC0"
FT                   /inference="protein motif:PFAM:PF01808"
FT                   /protein_id="CAJ91651.1"
FT                   /translation="MIKQALLSVSDKTGIVDFARELNALGVTLLSTGGTAKLLADSGLP
FT                   VTEVADYTGFPEMLDGRVKTLHPKVHGGILARRDLPEHMAALAEHDIPTIDLLVVNLYP
FT                   FQQTVAKDDCTLPDAIENIDIGGPTMLRSAAKNHRDVTVIVDPADYAVVLDEMRANANS
FT                   VGYDTNFRLATKVFAHTAQYDGAITNYLTSLGADKSHQGRSAYPQTLNLAFDKVQEMRY
FT                   GENPHQSAAFYRDLRAVDGALANYVQLQGKELSYNNIADADAAWECVKSFDAASGAACV
FT                   IIKHANPCGVALGANALEAYDKAFKTDSTSAFGGIIAFNVELDETAAQAVARQFVEVLI
FT                   APSFSAGARAVFAAKQNVRLLEIPLGQGINQYDFKRVGGGLLVQSPDARNVQPSELRVV
FT                   TRRHPNPKEMDDLMFAWRVAKFVKSNAIVFCGGGMTLGVGAGQMSRVDSARIASIKAQN
FT                   AGLTLAGSAVASDAFFPFRDGLDVVVDAGATCVIQPGGSMRDDEVIAAADERGIAMVVT
FT                   GTRHFRH"
FT   CDS_pept        complement(527035..527268)
FT                   /transl_table=11
FT                   /gene="h16_A0502"
FT                   /locus_tag="H16_A0502"
FT                   /product="DNA-binding protein Fis (Factor for inversion
FT                   stimulation)"
FT                   /function="Transcription / DNA replication,
FT                   recombination,and repair"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91652"
FT                   /db_xref="GOA:Q0KEB9"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEB9"
FT                   /inference="protein motif:COGS:COG2901"
FT                   /inference="protein motif:PFAM:PF02954"
FT                   /protein_id="CAJ91652.1"
FT                   /translation="MSRNAIDQCIRESLDTYFRDLDGEEPSNMYNMVLEAVERPLLEAV
FT                   MVRAERNQSLAAAYLGINRNTLRKKLQQHGLL"
FT   CDS_pept        complement(527265..528326)
FT                   /transl_table=11
FT                   /gene="dus1"
FT                   /gene_synonym="tRNA-dihydrouridine synthase"
FT                   /locus_tag="H16_A0503"
FT                   /product="transfer RNA-dihydrouridine synthase"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91653"
FT                   /db_xref="GOA:Q0KEB8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEB8"
FT                   /inference="protein motif:COGS:COG0042"
FT                   /inference="protein motif:PFAM:PF01207"
FT                   /protein_id="CAJ91653.1"
FT                   /translation="MQIGPHQLRNNLFVAPMAGVTDRPFRQLCKQLGAGYAVSEMVASN
FT                   AQLWKSEKTMRRANHAGEVEPIAVQIAGAEPSMMAEAARYNVDRGAQIIDINMGCPAKK
FT                   VCNVAAGSALLQNEPLVVRIVQAVVGAVGDRVPVTLKIRTGWNRENRNALRIAHMVEDA
FT                   GISMLTIHGRTRADLYHGNAEYETIAAVKAAVSIPVVANGDITTPQKAKQVLALTGADA
FT                   IMIGRAAQGRPWLFREIEHFLKTGEMLPSPEVAEIRAIMNAHLEDHYAFYGEFTGVRTA
FT                   RKHIAWYTRGLRGANLFRHRMNTLESTAEQLAAVNAFFDEQAQISDRLVYVDDAAQDQD
FT                   EANNNKNGELLAA"
FT   CDS_pept        complement(528614..529852)
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="H16_A0504"
FT                   /product="2-Polyprenyl-6-methoxyphenol hydroxylase or
FT                   related FAD-dependent oxidoreductase"
FT                   /function="Coenzyme metabolism / Energy production and
FT                   conversion"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91654"
FT                   /db_xref="GOA:Q0KEB7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEB7"
FT                   /inference="protein motif:COGS:COG0654"
FT                   /inference="protein motif:PFAM:PF01360"
FT                   /protein_id="CAJ91654.1"
FT                   /translation="MPAAQPDFQSLRDIAIVGGGPVGLALACQLLRTTSWRLTLVDAAT
FT                   PARAARDPRAIALSHGSRQLLEQIGAWPVPGSPIEHIHVSQRGRFGHVRLHHDDYGVPA
FT                   LGYVVRYGDLCEALERALAHAAQAAGEGRLQRVFETRIDQIAQDPAPSAADDPDAGAVQ
FT                   LAGTGHDGQVAHLAARLVVQAEGGLFHQQAAHQGRGARTRDYRQTAVIAHVTCSRPQPG
FT                   WAWERFTDEGPLALLPHEEHGVPGYALVWCCPPDQAARRIALPEAEFAAELGRAFGDRM
FT                   GHFTLAGKRHAFPLGLNAAPVTVNGRVAAVGNAAQTLHPVAGQGLNLGLRDAFALADSL
FT                   RSACTPQALQAFASRHRLDRAVTIGVTDLLPRVFGIAYPLAAHARGASLAVLACLPPLR
FT                   HALARHMMFGMRR"
FT   CDS_pept        complement(529833..530312)
FT                   /transl_table=11
FT                   /gene="h16_A0505"
FT                   /locus_tag="H16_A0505"
FT                   /product="Hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91655"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEB6"
FT                   /protein_id="CAJ91655.1"
FT                   /translation="MIGWLRRIFPGQARSGSNAGSDRRPDPSEPFIINLYDDRVVVHRP
FT                   DGQREEVAWDTLERVVVRVSDRAPWAGTAWLILIGTPDSGQGCVAPLNAANHGALLEQL
FT                   RALPGFNHQKLENALRDAAAGKSRSDAICWKRDAAAPTEADAGHAGGSDDAGRAA"
FT   CDS_pept        complement(530309..531712)
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="H16_A0506"
FT                   /product="Peptidase D ( Xaa-Pro aminopeptidase)"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91656"
FT                   /db_xref="GOA:Q0KEB5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEB5"
FT                   /inference="protein motif:MEROPS:M24.004"
FT                   /inference="protein motif:CDD:cd01087"
FT                   /inference="protein motif:COGS:COG0006"
FT                   /protein_id="CAJ91656.1"
FT                   /translation="MSSPDNALLAACRDRRARVLQHLRAGGGGVAILPTAPEAMRNRDS
FT                   DYPYRHDSYFYYLSGFTEPEAVLVLVAGAPGDPADADRSILFCRPKHEEREIWDGFRFG
FT                   PDGARAVFGFDEAHSVEEIDAALPPLLANRAQIAYPLADSTRTDVQMRRWMDAVRMQGR
FT                   AGVAAPSVALDIRTVLDEMRLFKDAGELATMRRAAQISAGAHVRAMQATRAGLREYHLE
FT                   AELLYEFRRHGAQSVAYNSIVAAGPNACVLHYRAGPAELRDGDLCLIDAGCEFDGYASD
FT                   ITRTFPVSGRFSPAQRELYDLVVAAQDAAIAETRAGVPYNVPHDAAVRVLAQGMLDTGL
FT                   LDRNKEGTLDDVLASGSYRRFYMHRTGHWLGMDVHDVGEYRVASHGGEGERPWRPLQPG
FT                   MVLTIEPGIYVRPAEDVPERYWHIGIRIEDDAVVTDGDCELITRGVPVLADEIEALMRD
FT                   NANAAGGLR"
FT   CDS_pept        complement(531819..532562)
FT                   /transl_table=11
FT                   /gene="h16_A0507"
FT                   /locus_tag="H16_A0507"
FT                   /product="Nucleoside-diphosphate-sugar pyrophosphorylase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91657"
FT                   /db_xref="GOA:Q0KEB4"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEB4"
FT                   /inference="protein motif:COGS:COG1209"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="CAJ91657.1"
FT                   /translation="MKAMIFAAGRGDRMRPLTDTCPKPLLAVGGKPLIVWKIEALARAG
FT                   LRDIVINHAWLGGQIEAALGDGSRFGVRLAYSAEGTALETAGGIAQALPLLSAHPERGE
FT                   IFLAVSGDIFCDYDFRRLLPRAHDMAGAPAPRMHLVMVPNPDFHPNGDFTLQPNGLLTL
FT                   DGTLANGGERLTFGNIGLYDTRLFTAIEPGTKMPMTPYYWEAIEAGAATGERFDGRWEN
FT                   VGTPAQLAELDAALATAAPVAAHGR"
FT   CDS_pept        complement(532562..532885)
FT                   /transl_table=11
FT                   /gene="h16_A0508"
FT                   /locus_tag="H16_A0508"
FT                   /product="predicted membrane protein"
FT                   /function="Function unknown"
FT                   /note="1 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91658"
FT                   /db_xref="GOA:Q0KEB3"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEB3"
FT                   /inference="protein motif:COGS:COG4392"
FT                   /protein_id="CAJ91658.1"
FT                   /translation="MSAMTLLWVFLAAGLATFLIRLSFIAVEGRVRLPSWFRTALQFVP
FT                   AAMLSALIAPDLLMQHGELALTPANARLVAGVVAILIAARTRSVGWTIAGGMAALLALE
FT                   ALF"
FT   CDS_pept        complement(532882..533685)
FT                   /transl_table=11
FT                   /gene="h16_A0509"
FT                   /locus_tag="H16_A0509"
FT                   /product="predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /function="Amino acid transport and metabolism"
FT                   /note="6 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91659"
FT                   /db_xref="GOA:Q0KEB2"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEB2"
FT                   /inference="protein motif:COGS:COG1296"
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /protein_id="CAJ91659.1"
FT                   /translation="MPDNQPVLRDHRAPAITAAGEWLAGARALAPMLLGVVPFGLIYGV
FT                   LAVGAGMPAWLACAMSVVVFGGASQMILTQLWTAGTPAVVITLTVAMVNLRHALYSATI
FT                   APTLAHLPRRWKALIAYLLTDEAFAAMTHRLGDSGPRARYRHWYYFGGGFALWASWQLS
FT                   TLAGVLVGAQVPRDWPLDFFLPLTFIGIIVPGLKHRSHVAAALAASVLAVACYSLPHKL
FT                   GLMVAALGGIAVGMLLLGRGNRPGQRPASRGADATPGGTAGKEAA"
FT   CDS_pept        complement(533690..534724)
FT                   /transl_table=11
FT                   /gene="h16_A0510"
FT                   /locus_tag="H16_A0510"
FT                   /product="predicted phosphotransferase to Ser/Thr protein
FT                   kinases"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91660"
FT                   /db_xref="GOA:Q0KEB1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEB1"
FT                   /inference="protein motif:COGS:COG3178"
FT                   /protein_id="CAJ91660.1"
FT                   /translation="MAALPHDPRLDQLKAWVSGLGPTWSADPDSCAPASADASFRRYFR
FT                   VSTGHPAHPTAIVMDAPPAHEDCRPFIHVCGLFGAAGVTVPTVLAQDLEQGFLLLADLG
FT                   NQTYLSRLDDSTAHAMYADAAAALVRIQAATRPGELPAYDRALLQRELDLFPQWYVARH
FT                   LGATLTEAQQADLREVTEALLTNILAQPQVYVHRDFHSRNLMVLDGGANPGVLDFQDAV
FT                   IGPITYDAVSLWRDAYIEWDEEQQLDWLIRYWERARKAGLPVSADFGEFYRDFEWMGLQ
FT                   RHLKVLGIFARLYHRDGKDGYLANLPLVMKYTRQVAGRYTELRKLIRLLDALEGVASPA
FT                   GYTF"
FT   CDS_pept        534941..537382
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /locus_tag="H16_A0511"
FT                   /product="organic solvent tolerance protein"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /note="1 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91661"
FT                   /db_xref="GOA:Q0KEB0"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEB0"
FT                   /inference="protein motif:COGS:COG1452"
FT                   /inference="protein motif:PFAM:PF04453"
FT                   /protein_id="CAJ91661.1"
FT                   /translation="MTEQRRSPNNRALPSPAPTSVPARARRAGGLHAGALRPLVLAMAS
FT                   LSAGAHAQMSGSAIPDLDQVEPVFEAAPKAPPLPVESGELVPRLAEPGKQSDAGSDAPT
FT                   FIEADRMTGYSERGVELEGHAELRRDGGAIKGDKLTYDQDTDEAFAQGNVRMSRSGTLA
FT                   VGPEARMKVEANEGYMLSPDYYFQQTGGSGKAERIDFLDKDRSTARHASYTTCSPDNAD
FT                   WYFSANRIDLDNDRQVGVAYGGVLNFFGVPIAAAPAFSFPLNDDRRSGFLPPLMGYGSR
FT                   SGFDLTTPYYVNIAPNRDLTIYPRLMTERGLQLGGEYRYLGQGYNGRLRAEFLPDDKKT
FT                   NSNRWAYSIQHNQNLAKGLNAYLNVNRVSDDQYPDDFNRSVSQSTLRQYTQEGGVTYNW
FT                   QDFTFLARVQKFQTLRPSEPSYERVPQLNGKYIRYDLGGFDVQVEADYTRFRIPLTSTG
FT                   FQQPQGERMFIQPSISYPIVRAGWYVTPKVTFNATQYQMEAASNTPTVQNNFSRVLPTM
FT                   SLDSGMTFEREAPTVSRLFGVNYVQTLEPRLFYVYTPFRDQSQFPLFDTVQSDFGYGQI
FT                   FSENPFTGYDRVADNNKLTGGLTTRLIEADTGIERFRGTIAQRYDFTGQRVQINGTLAD
FT                   PKAGFSDLLAATTIQMFRGYYLDAGVQYNPDSDRINYGNVAVSYRPESRKVINAGYRYR
FT                   RPTSVTDNTAIDQFEVSSQWPITRRAYGIARFAFDLAASQMVDALAGVEYAADCWVGRV
FT                   VYQRFRNTTQGYTGRVFLQVEFRGLSKIGSNPLNILRLNVPGYEPVSAKPVPTTQFDHY
FT                   E"
FT   CDS_pept        537392..538867
FT                   /transl_table=11
FT                   /gene="h16_A0512"
FT                   /locus_tag="H16_A0512"
FT                   /product="Peptidyl-prolyl cis-trans isomerase (rotamase
FT                   c)protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91662"
FT                   /db_xref="GOA:Q0KEA9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEA9"
FT                   /inference="protein motif:COGS:COG0760"
FT                   /inference="protein motif:PFAM:Rotamase"
FT                   /protein_id="CAJ91662.1"
FT                   /translation="MKRQEFAVFSFLLTSWHRLLLPAVLAAMTVPAAAQLKAPGTAPRS
FT                   SGIFVPQASDVATPSSQPKLGVPQAGGQKRSQLVDEVVAVVNNSVITRRELLDRADEIE
FT                   GQLRAAGRPVPARADLLGEVLERLVMERVQTQAAQEAGIRVTDQEIDRAIESVAQQNRL
FT                   NATELRRRVEASGMTWTKYREELRKQVQVIRLREREVDSKVQVYDGEIDNYLAARGGQG
FT                   AASGPTEYNVAQILVRVPENASDAQKQAQRAKAEGLLKQAQGGADFAQLAQANSEGPEA
FT                   AQGGAMGFREIGRLPALFANAVVDLQAGGVAPQVVESAAGFHVVKLVAKRAAPASSPAA
FT                   ASKITQTQVRHILIRTGPNMPEAEARRQLSTLRDRITHGGDFADAAKRFSQDGSAQNGG
FT                   DLGWVSPGELVPEFEQAMSRLRPNEISEPVVTQFGVHLIQVLNRRETEMSPEKQRDFAR
FT                   AEVREQKLRAAYDDWVRQLRSQAYVEYRVNRQR"
FT   CDS_pept        538897..540000
FT                   /transl_table=11
FT                   /gene="pdxA1"
FT                   /locus_tag="H16_A0513"
FT                   /product="4-Hydroxythreonine-4-phosphate dehydrogenase"
FT                   /function="Coenzyme metabolism"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91663"
FT                   /db_xref="GOA:Q0KEA8"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEA8"
FT                   /inference="protein motif:PFAM:PF04166"
FT                   /protein_id="CAJ91663.1"
FT                   /translation="MPDPLALAISTGEPAGIGPDITIGALLQLAGANNGVGGGQYRFHV
FT                   LGDARLLADRAAALGATHAWERRIADGDVVVEDIPLAVACEAGRLDARNGPYVLKLLDA
FT                   AIRGCRARGKAAPRYAAMITAPVQKSTINDAGVPFTGHTEYLAESARVPRVVMMLAGPQ
FT                   PAHDGAMLRVALATTHLPLRAVPDALSVPLLVQTLSIIDADLRRYFGISRPRILVTGLN
FT                   PHAGESGHMGREEIDIITPALAQAKDAGIDARGPFPADTLFQPRHLRDADCVLAMYHDQ
FT                   GLAPLKYGTFGHGVNITLGLPFIRTSVDHGTALDLAGTGQAEHGSMIEAIRSAVTMAGH
FT                   ANGRRPGSNGATGSHPGHTHSGLQPPC"
FT   CDS_pept        540018..540860
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="H16_A0514"
FT                   /product="dimethyladenosine transferase (rRNA methylation)"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91664"
FT                   /db_xref="GOA:Q0KEA7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KEA7"
FT                   /inference="protein motif:COGS:COG0030"
FT                   /inference="protein motif:SMART:smart00650"
FT                   /inference="protein motif:PFAM:PF00398"
FT                   /protein_id="CAJ91664.1"
FT                   /translation="MRSNVHQGHVARKRFGQNFLVDDTIIHGIVNAISPQADDVLVEIG
FT                   PGLGALTDPLLERIPQMQVVELDRDLVERLRRRYGERLQVHAGDALAFDFDKLAVPGRP
FT                   LRIVGNLPYNISSPLLFHLMDFADHVRDQHFMLQKEVVERMVAEPGSKAFGRLSIMLQV
FT                   RYYMEHVLDVPPGAFNPPPKVDSAVVRMIPWPRHSDGRLRSPHADCDITVLGDVVTAAF
FT                   SQRRKVLRNTLSFLRDQVDFDAMGFDLGRRAEEVPVGEYVELARRLGGTPSGRAGQAA"
FT   CDS_pept        540917..541951
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="H16_A0515"
FT                   /product="Tryptophanyl-tRNA synthetase"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91665"
FT                   /db_xref="GOA:Q0KEA6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEA6"
FT                   /inference="protein motif:COGS:COG0180"
FT                   /inference="protein motif:PFAM:tRNA-synt_1b"
FT                   /protein_id="CAJ91665.1"
FT                   /translation="MTAQTQTNRRPVILTGDRPTGPLHLGHYVGSLKSRVTLQDTHEQY
FT                   VLLADTQAMTDNAHDPDKVRRNVLEVALDYLAVGIDPAKTTITVQSHLPALAELTLMYL
FT                   NFVTVARLERNPTIKEEIQARGFGRDIPAGFLCYPASQAADITAFKAHVVPVGEDQAPL
FT                   IEQTNEIVRRINHQVGREVLPECKALIPEFGRLPGVDGKAKMSKSLGNAIALGASPEQI
FT                   KAAVHSMYTDPNHLRVSDPGQVEGNVVFTYLDAFDPNTEEVKALKEHYRKGGLGDMVLK
FT                   RRVEGILQDMLAPIRARREELAKDPDYVFDILRQGTAKARALTQQTLDEVRDALGMFSF
FT                   EARR"
FT   CDS_pept        complement(542004..542909)
FT                   /transl_table=11
FT                   /gene="h16_A0516"
FT                   /locus_tag="H16_A0516"
FT                   /product="predicted permease, DMT superfamily"
FT                   /function="General function prediction only"
FT                   /note="10 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91666"
FT                   /db_xref="GOA:Q0KEA5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEA5"
FT                   /protein_id="CAJ91666.1"
FT                   /translation="MSTQALTRQPLDGIAVGLMVVLCAAWGLQQVVIKVTAPLMGAVLQ
FT                   AGVRSAVAALLVFGFAAWRGTPLWRRDGTLNAGLLAGLLFGAEFFCIFVGLGHTTASRM
FT                   AVFLYTAPIFTALGLHFVVPGERLHRGQWLGVALAFAGMALAFADGIAAPSAQGSTLPG
FT                   DALGILAGALWAATTLVVRASPLASAPASKTLLYQLAVSAVMLLAMAVAAGQTATVQID
FT                   GVVLASLFYQSVLIAFASYLTWFWLLRRYLASRLSVFSFLTPLFGVAFGVVLMHDAVGP
FT                   RFAVAALLVLAGIVLVNRRA"
FT   CDS_pept        complement(542922..543329)
FT                   /transl_table=11
FT                   /gene="gloA1"
FT                   /locus_tag="H16_A0517"
FT                   /product="lactoylglutathione lyase (methylglyoxalase)"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91667"
FT                   /db_xref="GOA:Q0KEA4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEA4"
FT                   /inference="protein motif:PFAM:Glyoxalase"
FT                   /protein_id="CAJ91667.1"
FT                   /translation="MRLLHTMLRVGDMQRSIDFYTRVLGMQLLRQSDNPEYKYRLAFVG
FT                   YGPESETAVLELTYNYGVDQYDLGTAYGHIALETDDAAAACERIRAAGGKVTREAGPVK
FT                   GGTTVIAFVEDPDGYKIELIERHSTRDARRP"
FT   CDS_pept        complement(543413..544273)
FT                   /transl_table=11
FT                   /gene="h16_A0518"
FT                   /locus_tag="H16_A0518"
FT                   /product="conserved hypothetical protein"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91668"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEA3"
FT                   /inference="protein motif:COGS:COG1451"
FT                   /protein_id="CAJ91668.1"
FT                   /translation="MKLLRPATDADGAQLELPLAESAQAPQPAAPPAPEPPQQPAWPVP
FT                   QPNARLLRIGERPLHYTLKRSARRTIGFTIDDRGLSITAPRWVTLADIESAILEKQRWI
FT                   FNKLGEWRHRESRRILPTVQWRDGASLPFLGQPLTLSLESPLGALLFDADRRVLHLALP
FT                   GHADEQQIKDRVQGWLQQQARRLLAERLDIYADKLGVRHTGFALTSAATRWGSCTADGK
FT                   IRLNWRLMHFPLSMIDYVAAHELAHLKEMNHGPRFWQTVESIFPEFRDARAQLRAHPPE
FT                   LLPTF"
FT   CDS_pept        complement(544270..545034)
FT                   /transl_table=11
FT                   /gene="plsC1"
FT                   /locus_tag="H16_A0519"
FT                   /product="1-Acylglycerol-3-phosphate O-acyltransferase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91669"
FT                   /db_xref="GOA:Q0KEA2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEA2"
FT                   /inference="protein motif:COGS:COG0204"
FT                   /inference="protein motif:SMART:smart00563"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="CAJ91669.1"
FT                   /translation="MTFLRSLLFALYLLVLTPPYACACFLVFPFMNADQRFRFVRGWPL
FT                   LVIWAARGICGIQYRIEGHEHMDVMLDKPVVLLSKHQSAWETVAYVALMPKPLCFVFKR
FT                   ELLLVPFFGWALGMLKMVHINRKEGTRAFASAARQGRERLAEGAWIIMFPEGTRTPSGL
FT                   EKARYKSGGARLAVETGAWVLPMAVNSGRVWPRNSFLKHPGMVTISVGPAIASANKTAD
FT                   QLNQEVAEWIERDMRRIDPQSYRSAAPGGPAA"
FT   sig_peptide     complement(544963..545034)
FT                   /gene="plsC1"
FT                   /locus_tag="H16_A0519"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(545076..545663)
FT                   /transl_table=11
FT                   /gene="h16_A0520"
FT                   /locus_tag="H16_A0520"
FT                   /product="histidinol phosphatase or related phosphatase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91670"
FT                   /db_xref="GOA:Q0KEA1"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEA1"
FT                   /inference="protein motif:COGS:COG0241"
FT                   /protein_id="CAJ91670.1"
FT                   /translation="MPQTPPKFVILDRDGVVNLDSDQFIKTPDEWVPIDGSLEAIAALN
FT                   QAGYRVVLASNQSGIGRGLFEMSALNAMHEKMHTLLARLGGRVDAVFFCPHTAADGCDC
FT                   RKPKPGMLEQISERFGIELRGVPIVGDSLRDLEAGVAVGCAPHLVRSGKGQKTLDQGAL
FT                   PPGTQVHDDLLAFARWLTGNGGAQRPPTHSAG"
FT   CDS_pept        complement(545685..547808)
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="H16_A0521"
FT                   /product="Glycyl-tRNA synthetase beta subunit"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91671"
FT                   /db_xref="GOA:Q0KEA0"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KEA0"
FT                   /inference="protein motif:COGS:COG0751"
FT                   /protein_id="CAJ91671.1"
FT                   /translation="MSQPMTDSLLIELFTEELPPKALARLGDAFAQGLFAGLGERDLLE
FT                   PGATVTPFATPRRLAALVSGVRRSAPDREQREKVLPLSVALDANGEPTAPLAKKLAALA
FT                   KSVGVAEIDWQSLERASDGKAEAFFYRYTARGAELAAAVQAALEDTIAKLPIPKVMSYQ
FT                   RPDGSTVHFVRPAHSLIALFGAEILPVTLLGLQASNLTQGHRFLSHGVIEIAHANDYAQ
FT                   RLESAGHVVASYAERRERMRAALLKEAGADQVIMPESLLDEVNSLVEWPVVYACHFEEA
FT                   FLAVPQECLILTMQTNQKYFALTDADGHLRNRFLIVSNLATETPQSIITGNERVVRPRL
FT                   ADAKFFFDQDRKKTLASRVPQLASVVYHNKIGTQLDRVQRLQQIAGHIADALNGSGVPT
FT                   DKAAAMRGAELAKADLLTDMVGEFPELQGTMGTYYARHDDEAEDVALACSEHYRPRFAG
FT                   DALPAGAVSTAVALADKLETLVGIWGIGLQPTGEKDPFALRRHALGILRMLIEKPLALS
FT                   LSSLLALTQQAFAGIAAVKPAPDAIADFLYDRVRGYLKDKGYTTNEVEAVVSLRPDQLH
FT                   DILGRMEAVRTFAALPEAEALAAANKRITNILRKNTEPVGAVDPALFREEAEGALHAAI
FT                   ERVRPAVEAAFASGDFTAALRDLAQLRDAVDRFFNDVMVMAEDAQLRANRLALLASLHA
FT                   MANRVADISKLAA"
FT   CDS_pept        complement(547845..548474)
FT                   /transl_table=11
FT                   /gene="h16_A0522"
FT                   /locus_tag="H16_A0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91672"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE99"
FT                   /protein_id="CAJ91672.1"
FT                   /translation="MTQLARSALCCAMAIAALAAAGNAIGARAQAAPSAQVLMLPAELS
FT                   NVCEADPQALQLAMARQWRPSLNALDQWAQLVRSFSCDLSGQRDLGWHRVPLRAYESAI
FT                   RYPLTWVEMETRNGRTRRTVKTYYSAAQLPPKIDFWVGGRIDEIRYDKRLRRIDARFPA
FT                   AGSRGGSNGAASAAAAAQCAYTTLQFRQQNGLWLLLGVEPNLSPRC"
FT   CDS_pept        complement(548471..549499)
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="H16_A0523"
FT                   /product="Glycyl-tRNA synthetase alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="GlyRS_alpha_core"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91673"
FT                   /db_xref="GOA:Q0KE98"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE98"
FT                   /inference="protein motif:CDD:cd00733"
FT                   /protein_id="CAJ91673.1"
FT                   /translation="MRRLRHAPRGLHAGRRDRARVPLPSLHMLTFQQMILTLQAYWDRQ
FT                   GCALLQPIDLEVGAGTSHVHTFLRALGPEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQ
FT                   YQVVLKPAPENILELYLGSLEALGLDLKQNDIRFVEDDWENPTLGAWGLGWEVWLNGME
FT                   VTQFTYFQQVGGIDCKPITGEITYGIERLAMYLQKVENVYDLIWTEWVENGETRRLTYG
FT                   DVYHQNEVEQSTYNFEHSNTEILFRHFAEHEGEAKRLMGNGDGAEEGQAAGTRLALPAY
FT                   EQVLKAAHTFNLLDARGAISVTERAAYIGRIRHLSRQVAQAYYDSREALGFPMCGNGGA
FT                   RA"
FT   CDS_pept        complement(550010..551620)
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="H16_A0524"
FT                   /product="Apolipoprotein N-acyltransferase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="2.3.1.-"
FT                   /note="7 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91674"
FT                   /db_xref="GOA:Q0KE97"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE97"
FT                   /inference="protein motif:COGS:COG0815"
FT                   /protein_id="CAJ91674.1"
FT                   /translation="MKRSAPILNGAAAADAAPAGVPGTRAHSRTATMARLLLAGVLGIA
FT                   HTQAFAPHDWWWLQILSLAGLAALMADAPRARLAAATGYAFGLGWFLSGIWWLYISMHV
FT                   YGEMPAWMAALAVVLFSGFLSLYPALAGALWHRLTARLPRATLLAPLAFGAAWGLTEWL
FT                   RGVVFTGFPWLSGGYAHADGPLAGFAPLLGVYGIGALAAAVAALLAAAVRGLGRGERGR
FT                   ALGALALALALPAAGAALAPLAWTTPAGKPLSVRLLQGNVAQDIKFEPAGIQRSIELYR
FT                   DMITAAPADLVVTPETAFPVILQELPVDVAVAVRDYALASGTTVLFGAAGADSPVDFTN
FT                   SVFGLGPETERLYRYNKHHLVPFGEFIPLGFRWFVDMMKMPLGDFRRGGLDQASLPVRG
FT                   VRVAPNICYEDLFGEEIAQTLRQQPAPANVLANLTNLAWFGDTIALDQHLQISRMRALE
FT                   TRRPMLRSTNTGMTAVVRPDGSVQQRLPTFTVGTLAAEVQGMQGLTPYIRWGNAPVLAL
FT                   FALVLGLAAWRVRKLRGAG"
FT   sig_peptide     complement(551567..551620)
FT                   /gene="lnt"
FT                   /locus_tag="H16_A0524"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(551617..552504)
FT                   /transl_table=11
FT                   /gene="corC"
FT                   /locus_tag="H16_A0525"
FT                   /product="Putative Mg2+ and Co2+ transporter"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91675"
FT                   /db_xref="GOA:Q0KE96"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE96"
FT                   /inference="protein motif:COGS:COG4535"
FT                   /inference="protein motif:PFAM:PF03471"
FT                   /protein_id="CAJ91675.1"
FT                   /translation="MNDPYPSSKPAYLKQADRPRSLLERLSDLISPEPDTRAELLEVLQ
FT                   EAHERNLIDADSLSMIEGVFQVSELTASDIMVPRAQMDMVNIADAPEAFIPFMQQTAHS
FT                   RFPVYEGSRDNIIGILLAKDLLRYYTDPAFDLRETLRPAVFIPESKRLNILLRDFRINR
FT                   NHIAMVVDEYGGVAGLVTIEDVLEQIVGDIEDEFDLDEDQDNILPMPDGSWRVHGLTEI
FT                   AQFNDAFGTAFSDHDVDTVGGLLSNHVGHVPHRGEVITLPPIRFEVLRADARQVHLLQV
FT                   HRESNGDNAGAAGA"
FT   CDS_pept        complement(552649..553395)
FT                   /transl_table=11
FT                   /gene="h16_A0526"
FT                   /locus_tag="H16_A0526"
FT                   /product="diacylglycerol kinase"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91676"
FT                   /db_xref="GOA:Q0KE95"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE95"
FT                   /inference="protein motif:COGS:COG0319"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="CAJ91676.1"
FT                   /translation="MKSQKSKSSAVSLTLFDGDGRARKSAAHALRVQLPDGRSLTLDLS
FT                   QAADGVVALLAEHTDTNQQAGLLVRPDNHDSLSVAVTATPVVTTTGTPATPPGLELEIQ
FT                   NGDGVGKRAGLPPRRKIETWVKSALYADAALTIRFVDEEEGRTLNRTYRGKDYATNVLT
FT                   FAYAENEEDPVTGDIVLCCPVVETEAREQRKPLEAHYAHLIVHGVLHAQGYEHEEDAEA
FT                   EEMEAIETETLQALGYADPYQGDRTV"
FT   CDS_pept        complement(553396..554394)
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="H16_A0527"
FT                   /product="phosphate starvation-inducible protein
FT                   PhoH,predicted ATPase"
FT                   /function="Signal transduction mechanisms"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91677"
FT                   /db_xref="GOA:Q0KE94"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE94"
FT                   /inference="protein motif:COGS:COG1702"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="CAJ91677.1"
FT                   /translation="MKVPSAEFVAPKDDNTRLQNLCGPLDENLRQIEQALDVNIQRRGH
FT                   RMTVRGGNAQDAATALERFYNQARTPLSIDDVQLGLVETRQLSAHGSYLPGNGDDVEER
FT                   EIGDESPVLHTRRTGLQGRTVAQRDYLRNILSHDLTLGVGPAGTGKTYLAVACAVDALE
FT                   RDAVKRIVLTRPAVEAGERLGFLPGDLAQKVDPYLRPLYDALYDLLGFDRTQKMFERQM
FT                   IEIAPLAYMRGRTLNHAFIILDEAQNTTPEQMKMFLTRIGFGSKAVITGDTTQIDLPRG
FT                   QKSGLVEALHVLRDVRGIACTRFTSIDVVRHPLVARIVDAYDEYHAQHKDA"
FT   CDS_pept        complement(554428..555780)
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="H16_A0528"
FT                   /product="2-Methylthioadenine synthetase"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91678"
FT                   /db_xref="GOA:Q0KE93"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE93"
FT                   /inference="protein motif:COGS:COG0621"
FT                   /inference="protein motif:SMART:smart00729"
FT                   /inference="protein motif:PFAM:PF00919"
FT                   /protein_id="CAJ91678.1"
FT                   /translation="MKKVFVKTYGCQMNEYDSDKMVDVLNASQGLEPTDNVEEADVILF
FT                   NTCSVREKAQEKVFSELGRMKALKAVKPDLVIGVGGCVASQEGASIVSRAPYVDVVFGP
FT                   QTLHRLPDLIARRQRTGQSQVDISFPEIEKFDHLPPARVEGPSAFVSIMEGCSKYCSYC
FT                   VVPYTRGEEVSRPFEDVLAEVAGLAEQGVREVTLLGQNVNAYRGKMGDTTEIADFALLI
FT                   EYVAEIPGIERIRYTTSHPKEFTSRLVELYGRCDKLVNHLHLPVQHASDRILMAMKRGY
FT                   SVLEYKSIIRKLRVLRPDMSMSSDFIVGFPGETDADFEKLMAMIEEIGYDTSFSFIFSP
FT                   RPGTPAANLHDDTPHEVKLRRLQRLQATIEENVQRISQNMVGTVQRILVEGPARKDPTE
FT                   LHGRTENNRVVNFALPGVPQAGRDRLVGQLVDVSITQAFPHSLRGEIVVRQ"
FT   CDS_pept        complement(555870..556271)
FT                   /transl_table=11
FT                   /gene="h16_A0529"
FT                   /locus_tag="H16_A0529"
FT                   /product="Hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE92"
FT                   /protein_id="CAJ91679.1"
FT                   /translation="MPAGRDARREAPESVQPGRARRLLPALACAAALLLGAASAMAQPV
FT                   RAIPDDAQAARLVIATPSAGAPQTATLDGKTVGVAPGLRLFGSDNQLLASAAVAGQKLP
FT                   VRYKLDLYGQLLTAWVLSEPEQKALKKKS"
FT   CDS_pept        complement(556385..558070)
FT                   /transl_table=11
FT                   /gene="eriC"
FT                   /locus_tag="H16_A0530"
FT                   /product="chloride channel protein"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91680"
FT                   /db_xref="GOA:Q0KE91"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE91"
FT                   /inference="protein motif:TCDB:1.A.11"
FT                   /inference="protein motif:COGS:COG0038"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /protein_id="CAJ91680.1"
FT                   /translation="MRLRFLEDQEVTLFAAIPVGIVAAIATTLFKEALDGAGVVLFSSH
FT                   ADVVAVFATLALAWRVVVPAVGGALAGSLLVLANRLAGSHGGATDYMEAVSSGSGRLPV
FT                   RITLLRALSSFFSIVSGSSVGKEGAMIQLAALCGSLFPSTRLERGGGSNMRRMLTACGA
FT                   AAGLATVYHTPFSAAVFVAEVVFGALAVQRLMPLFLASVAGAMVSQWHGGLQPLYPGLD
FT                   IAPDLRPHILLAAAALGVAAGIAGALFMRAAGFARSRFAAMPGGPVARLTLGGALVGVL
FT                   AMAVPEVVGNGYSTIQTILQEQPLSVPVAGVLLAKLVATVISMGSGAVGGVFTPSLFVG
FT                   AALGQLLAIGMQGTAAAAAPLLPLVGMSAFLAATSQAPLMSVLMVFEMTLAPALLLPSM
FT                   IGAVAAYYTASRCQTLSLYSVIAERAQASAAAEHARTLTLAGLCDPTDTVLDPNATLSA
FT                   AADKFAETGTRYLYLVEADGRLLGALSIHALQRAQREGAADDVLALAERDFPALTPDSR
FT                   LRDALAVFAEHGINRIPLVRDSAGRELMGTVSKQRVLQEASCLF"
FT   CDS_pept        558370..559932
FT                   /transl_table=11
FT                   /gene="rhlE1"
FT                   /locus_tag="H16_A0531"
FT                   /product="ATP-dependent RNA helicase"
FT                   /function="DNA replication, recombination, and repair /
FT                   Transcription / Translation, ribosomal structure and bi"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91681"
FT                   /db_xref="GOA:Q0KE90"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE90"
FT                   /inference="protein motif:COGS:COG0513"
FT                   /inference="protein motif:CDD:cd00268"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="CAJ91681.1"
FT                   /translation="MSFSELGLSDKIVRAVAEQGYTTPTPIQAQAIPAILKGGDLLAGA
FT                   QTGTGKTAGFTLPMLQLLSDSAARGANGAQRPARLPVRALVLTPTRELAAQVEESVRNY
FT                   GKYLRLRSMVMFGGVGINPQIEQLKRGVEIVVATPGRLLDHVSQRTIDLSQVELLVLDE
FT                   ADRMLDMGFIHDIRKILNVLPAKRQNLLFSATFSDDIRALADRLLNNPASIEVARRNTT
FT                   AETVDQRVYPVDRERKRELLAHLVRQHDWHQVLVFTRTKHGANRLAEQLTKDGLSALAI
FT                   HGNKSQSARTRALSEFKSGTLRLLVATDIAARGIDIDQLPHVVNFDLPNVPEDYVHRIG
FT                   RTGRAGAEGEAISLVCVDEIALLRDIERLIKRKLEQTVLPGFEVDPSIAPEPIQKGRQQ
FT                   RGGGGQGQGQGQGRGRAQARPAGNEGEGAQRQRPAREAQAAPRQAQGGQRGNGAANGNR
FT                   GGQPAGGARNPAPRRDGQEPARQQRAAAQPARQPHDAAPAPARNRRPAPQAALLGGNRK
FT                   PAR"
FT   CDS_pept        559951..560997
FT                   /transl_table=11
FT                   /gene="h16_A0532"
FT                   /locus_tag="H16_A0532"
FT                   /product="conserved hypothetical protein"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91682"
FT                   /db_xref="GOA:Q0KE89"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE89"
FT                   /inference="protein motif:PFAM:PF06111"
FT                   /inference="protein motif:COGS:COG2334"
FT                   /protein_id="CAJ91682.1"
FT                   /translation="MHASDTPADPGVPYAGLTPELMLDALEGAGLRPDGRLLALNSYEN
FT                   RVWQLGIEDAAPVIAKFYRPGRWTDAAILEEHAFVQQLADAEIPAVPAMVLAPGAAGTL
FT                   LHHAGFRFAVFPRCGGREPALDRSDTLTWLGRFIGRIHALGATQPYQARPALNLETFGV
FT                   APRDWLLASGCIPADLLPAWQSVADLALDGVRRCYERAGEVRLLRTHGDCHRGNVLWIG
FT                   EDDARGGTHGATGPHFVDFDDSRMAPAIQDIWMLLEGDRAAMQDQLADIVAGYEDFAEF
FT                   QPRELWLVEALRTLRLLHYSAWLASRWADPAFPAAFPWFGTARYWQDRILELREQVALM
FT                   DEAPLWGA"
FT   CDS_pept        complement(561044..561529)
FT                   /transl_table=11
FT                   /gene="h16_A0533"
FT                   /locus_tag="H16_A0533"
FT                   /product="universal stress protein, UspA family"
FT                   /function="Signal transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91683"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE88"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /inference="protein motif:COGS:COG0589"
FT                   /protein_id="CAJ91683.1"
FT                   /translation="MAHRLPTAPIQEISNMTNIVLATDGSAFSDAAARFIAEGKLLQSG
FT                   FTVHVVHVAPEVSGQVRAFVSKETIDDWHKEASEKAMATVCEILSAAKVPFERHPLHGF
FT                   APERIVACARSVDAAAIVMGTHGRGSFFDAVIGSVAGRVLAQAECPVLLVKAPEKKG"
FT   CDS_pept        561836..562903
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="H16_A0534"
FT                   /product="Predicted L-carnitine
FT                   dehydratase/alpha-methylacyl-CoA racemase"
FT                   /function="Energy production and conversion"
FT                   /EC_number="5.1.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91684"
FT                   /db_xref="GOA:Q0KE87"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE87"
FT                   /inference="protein motif:COGS:COG1804"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="CAJ91684.1"
FT                   /translation="MSERGNLLPLRGIKVVEFEGIGPGPLCGAMLAGLGAEVTLVTRPV
FT                   APDARRILRGQPVPPEMELEHGKRVVQLNLKSADDVAAALDLVAGADALIEGLRPGAME
FT                   RLGLGPKACHARNPRLVYGRMTGWGQTGPLSQSAGHDLNYIALTGLLSMAAREGSLPMV
FT                   PPTVMGDATGALGLAFGITSAILSARASGEGCVVDAAITDIVAMLGSLVQVSRAAGTLG
FT                   GPQPSPFHDSPFYDVFPCADGRAITLGALEPQFYRELLERLELTDIDPATQYDRAQWPA
FT                   VKARIAACIAGKSSTQWEALLGGTDVCFARVLTLDEAARHPHNQARGTYRLYRQGEREV
FT                   PRSAPAPRFLPAGTE"
FT   CDS_pept        562900..563277
FT                   /transl_table=11
FT                   /gene="h16_A0535"
FT                   /locus_tag="H16_A0535"
FT                   /product="putative carboxymuconolactone decarboxylase"
FT                   /function="Energy production and conversion"
FT                   /EC_number="4.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91685"
FT                   /db_xref="GOA:Q0KE86"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE86"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="CAJ91685.1"
FT                   /translation="MTWGRGTDAAASRIGLIGSATMRHPPRPETHAMAEPSLQQLVTEF
FT                   AWGTVWTRDGLDRKQRSLVSMLIALNRPQELAGHLRGALANGVTPQELRELMVHSAIYC
FT                   GFPAALDASRKLTEVLDAANG"
FT   CDS_pept        563439..564065
FT                   /transl_table=11
FT                   /gene="h16_A0536"
FT                   /locus_tag="H16_A0536"
FT                   /product="response regulator, NarL-family"
FT                   /function="Signal transduction mechanisms / Transcription"
FT                   /note="REC (residues 4 to 118, 9e-12) with a typical
FT                   phosphorylation pocket (1/2 DD,D54,S/T82,K105)"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91686"
FT                   /db_xref="GOA:Q0KE85"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE85"
FT                   /inference="protein motif:CDD:cd00156"
FT                   /inference="protein motif:SMART:smart00421"
FT                   /protein_id="CAJ91686.1"
FT                   /translation="MHLALIVDEPSRFRTTLSAEIRAELGAGEVLEMDGMQEAFRLVRE
FT                   QRPGLVLVDIECFGNPGIDFVRCVSATQPTVPLLVLSDSDATLASVRALRAGAHGFVVK
FT                   QRGLAEVMQAVRGVLSGYLVFPMHTLETVRQIGEQRESGFARLSNREITILQYLARGHS
FT                   NKSIAAQLLISSKTVSTHKANIMAKLNVGSLVEMVDYARRHQLVW"
FT   CDS_pept        564150..565742
FT                   /transl_table=11
FT                   /gene="h16_A0537"
FT                   /locus_tag="H16_A0537"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91687"
FT                   /db_xref="GOA:Q0KE84"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE84"
FT                   /inference="protein motif:COGS:COG2989"
FT                   /protein_id="CAJ91687.1"
FT                   /translation="MPPTLNAAARRLGAVVLACAAACQATPAFANEPMWFAQGRPVPAA
FT                   RQAVDALAAAAADGLDPRDYDADALRQPVAQAASGPALPPDAAARVDAALSAAMERMLA
FT                   DLHGGRVNPRAVHANFAPQAERPFDAAIWLRDAVRQQRLPDAIRQAAPTFPLYGTLREA
FT                   LARYREIAKQPAWGQPLPPLPASKLTPGQPWAGAAALAARLVALGDLPAGTQVPARYEG
FT                   TLVDGVKAFQSRHGLEADGVIGAATLAQLNLPIASRVRQIELTMERLRWTPLDGPRMIV
FT                   VNVPEFMLRAYEIRDGKLDIKLEMKVIVGKALDTRTPLFEEDMRYIEFSPYWNIPPSIA
FT                   RRETVPHLRRDPAYFNRQGLEFVTGDGKAVTTLSEENLEAVLNGRMRIRQRPGPLNALG
FT                   DIKFVFPNNENIYLHHTPSPQLFKRGRRDFSHGCIRVEAPVALAQFVLHDMPDWNETRI
FT                   REAMTRGKSNTVRLQQPLPVVLAYGTVIARADGRVSFLPDIYGHDKLLEKALRQRNGRP
FT                   QQPAIASASGTTR"
FT   sig_peptide     564150..564242
FT                   /gene="h16_A0537"
FT                   /locus_tag="H16_A0537"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        565773..566360
FT                   /transl_table=11
FT                   /gene="h16_A0538"
FT                   /locus_tag="H16_A0538"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91688"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE83"
FT                   /inference="protein motif:PFAM:PF05951"
FT                   /inference="protein motif:COGS:COG3108"
FT                   /protein_id="CAJ91688.1"
FT                   /translation="MTDATRQARRRFLHTAGGLALAAGLMPLAPRQALAGLPANRALAG
FT                   LPDARTLAFDHTHTGERVSLVYAVGDRFVPDALTTLNGFLRDHYSGKVGMIDPQLFDLL
FT                   FQVRRELGTDQPFQVISGYRSPTTNSRLRNTRGGGVARHSLHMDGKAIDIRLAGVPLAD
FT                   VRDAAKSLQGGGVGFYESDQFVHIDTGRVRYW"
FT   sig_peptide     565773..565880
FT                   /gene="h16_A0538"
FT                   /locus_tag="H16_A0538"
FT                   /inference="protein motif:SignalP:2.0"
FT   tRNA            complement(566469..566545)
FT                   /gene="tRNA-Met (CAT)"
FT                   /locus_tag="H16_A0539"
FT                   /product="transfer RNA-Met (CAT)"
FT                   /note="tRNA-M1 gene"
FT   CDS_pept        complement(566679..568376)
FT                   /transl_table=11
FT                   /gene="h16_A0540"
FT                   /locus_tag="H16_A0540"
FT                   /product="Putative MFS transporter, MHS family"
FT                   /note="11 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91689"
FT                   /db_xref="GOA:Q0KE82"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE82"
FT                   /inference="protein motif:TCDB:2.A.1.6"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG2814"
FT                   /protein_id="CAJ91689.1"
FT                   /translation="MANVQNVAVPAGGAQNAPMTAEERKVIFASSLGTVFEWYDFYLYG
FT                   SLAAIIAKQFFAGLDPTSAFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLVTIL
FT                   LMGLSTFIVGLLPGYATIGWAAPIILIALRMLQGLALGGEYGGAATYVAEHAPHGKRGA
FT                   YTSWIQTTATLGLFLSLIVILLCREMTGPNFETWGWRIPFLVSILLLGVSVYIRLSMNE
FT                   SPAFQRMKAEGKTSKAPLTESFGQWRNLKIVILALLGLTAGQAVVWYTGQFYALFFLTQ
FT                   VLKVDAKTANLLIAGALVLGTPFFIFFGSLSDKIGRKWIIMAGCALAVLTYFPLFKAMT
FT                   HYANPALERAQKSAQIVVTADPKQCSFQGSPIAREIDFRSSCDIAKRTLAQASASYEVV
FT                   EAPAGTVATVKIGDKEIKAFDAQLVNGHSFDEPSKKQIAAFKKEVGESMASAGYPTKAD
FT                   PAQMNTIMVLVILVILVIYVTMVYGPIAAMLVELFPTRIRYTSMSLPYHIGNGWFGGLL
FT                   PTISFALVAQNGNIYYGLWYPIIIAAITFVIGALFIRETKDVNIYAND"
FT   CDS_pept        complement(568620..568955)
FT                   /transl_table=11
FT                   /gene="h16_A0541"
FT                   /locus_tag="H16_A0541"
FT                   /product="predicted membrane protein"
FT                   /function="Function unknown"
FT                   /note="2 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91690"
FT                   /db_xref="GOA:Q0KE81"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE81"
FT                   /inference="protein motif:COGS:COG4327"
FT                   /protein_id="CAJ91690.1"
FT                   /translation="MNDSPAPDSAEARQRQAWRRNLRWICGLLAIWFTVTFVVAWFARD
FT                   LRFDFFGWPFSFWVGAQGALVVYVLMAALYAWRMNRADGEADADSLAAPAPAPSQGASR
FT                   GTGTDAA"
FT   CDS_pept        complement(568952..570403)
FT                   /transl_table=11
FT                   /gene="h16_A0542"
FT                   /locus_tag="H16_A0542"
FT                   /product="signal transduction histidine kinase"
FT                   /function="Signal transduction mechanisms"
FT                   /EC_number="2.7.3.-"
FT                   /note="2 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91691"
FT                   /db_xref="GOA:Q0KE80"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE80"
FT                   /inference="protein motif:COGS:COG0642"
FT                   /protein_id="CAJ91691.1"
FT                   /translation="MPHLEESAANSAPRSLFGEILDWMLAPLLLLWPMSIAVTYLVAKS
FT                   IANGPFDRALEASAIVLSQQVREVNGRITLQLPLSAREILRADETDNIYYQVVGKRGEY
FT                   IAGDHDLPLPSEEDQGHAGLVSLRDDRVAGNDVRVAYTYIDLKQVSGTQPVLVQVAETL
FT                   DKRARLANEIIKGVILPQFVILPLAVVLVWFGLSRGLAPLTAIQQRIRARNPGDTSPID
FT                   ERAAPQEITPLVGSFNDLLARLDQSVQTQKRFIADAAHQMKTPLAGLRMQAELAQREQS
FT                   PEELRRSLAQIAGSSERTAHLVTQLLSLARMENLAGTGGMAALDLAALAREVVKDWLPQ
FT                   AWARDIDLGLDADEHPVMVQGNRLMLTEMLNNLLDNAIRYTPRGGHATVRVSADAFEPF
FT                   AYLDVEDTGPGIAPAERERVMERFYRVLGTNTEGSGLGLAIVREIVQQHGGDVQISDHV
FT                   YQQSPRLAGAHFRVTLRRPDYLPPA"
FT   CDS_pept        complement(570559..571248)
FT                   /transl_table=11
FT                   /gene="h16_A0543"
FT                   /locus_tag="H16_A0543"
FT                   /product="response regulator, OmpR-family"
FT                   /function="Signal transduction mechanisms / Transcription"
FT                   /note="REC (residues 3 to 115, 8e-25) with a complete
FT                   phosphorylation pocket (DD-D48-S79-K96)"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91692"
FT                   /db_xref="GOA:Q0KE79"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE79"
FT                   /inference="protein motif:CDD:cd00156"
FT                   /inference="protein motif:COGS:COG0745"
FT                   /inference="protein motif:CDD:cd00383"
FT                   /protein_id="CAJ91692.1"
FT                   /translation="MRILIAEDDDVLADGLTRSLRHSGYAVDHVTNGLEADSALSTQTF
FT                   DLLILDLGLPRMSGLEVLKRLRARGAMLPVLILTAADSVDERVKGLDLGADDYMAKPFA
FT                   LSELEARVRALVRRGAGGGATLMRHGPLAYDQVGRIAYLNEQMLDLSAREIGLLEILLT
FT                   RSGRLVSKEQLVDHLCEWGEEVSNNAIEVYVHRLRKKIEVGGIRIATVRGLGYCLEKFQ
FT                   PAVATHH"
FT   CDS_pept        571475..572539
FT                   /transl_table=11
FT                   /gene="cA"
FT                   /locus_tag="H16_A0544"
FT                   /product="Recobination protein RecA"
FT                   /function="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91693"
FT                   /db_xref="GOA:Q0KE78"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE78"
FT                   /inference="protein motif:PFAM:PF00154"
FT                   /inference="protein motif:PFAM:recA"
FT                   /protein_id="CAJ91693.1"
FT                   /translation="MDDKKAGAGVSAEKQKALAAALSQIEKQFGKGSIMRLGDGEVEKD
FT                   IQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDA
FT                   EHALDVSYANKLGVNVGDLLISQPDTGEQALEITDALVRSGSIDLIVIDSVAALVPKAE
FT                   IEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKIGVMFGSPETTTGGN
FT                   ALKFYASVRLDIRRIGSIKKGDDVIGNETKVKVVKNKVSPPFREAFFDILYGQGISRQG
FT                   EIIDLGVDAKIVEKSGAWYSYNGDKIGQGKDNAREYLRENPDIADEIENKVRAALGVVA
FT                   MNPTAAATPVAVED"
FT   CDS_pept        572641..573117
FT                   /transl_table=11
FT                   /gene="h16_A0545"
FT                   /locus_tag="H16_A0545"
FT                   /product="Uncharacterized protein conserved in
FT                   bacteria,putative regulatory protein"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91694"
FT                   /db_xref="GOA:Q0KE77"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE77"
FT                   /inference="protein motif:COGS:COG2137"
FT                   /inference="protein motif:PFAM:PF02631"
FT                   /protein_id="CAJ91694.1"
FT                   /translation="MATRPPLSLKARAVGYLSRREHSRAELARKLAPHAESAEQLEQLL
FT                   DALERENWLSNQRFADSLVHRRGARYGTARVMQEAKTHKLGSEQLGDLQERLRATEVER
FT                   AREVWRKRFGTPPDTPEARARQIRFMVARGFSRSVVGKIIQGADEDYGDDGGEA"
FT   CDS_pept        573261..573956
FT                   /transl_table=11
FT                   /gene="h16_A0546"
FT                   /locus_tag="H16_A0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91695"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE76"
FT                   /protein_id="CAJ91695.1"
FT                   /translation="MPLSQPVNRSQRHRRAITAEAYQREDGLWDIEVRLTDTKPRDIEL
FT                   AGDRVRPVGQPLHDLWLRVTINEEMTVLDAEACSDWVPYPSHCDTIGPAYRKLIGLNLR
FT                   KGFRKAVRERLGGMHGCSHLTEAAGVLPSTAIQAFAGEVINIRDNGEDDPNPEPPYQLN
FT                   GCHALRFDGEVVRQFYPRWYGHQPTPKVRAEAAPAVATAPQAPPAANGDRGNDGNDAVP
FT                   AERPTGTSG"
FT   CDS_pept        574046..575212
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="H16_A0547"
FT                   /product="Succinyl-CoA synthetase beta chain"
FT                   /function="Energy production and conversion"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91696"
FT                   /db_xref="GOA:Q0KE75"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE75"
FT                   /inference="protein motif:PFAM:ligase-CoA"
FT                   /inference="protein motif:PFAM:ATP-grasp"
FT                   /protein_id="CAJ91696.1"
FT                   /translation="MNIHEYQGKEILRKYNVPVPRGIPAFSVDEALKAAETLGGPVWVV
FT                   KAQIHAGGRGKGGGVKVAKSIDDVKTYASNILGMQLVTHQTGPEGKKVNRLLIEEGADI
FT                   KKELYVSLVVDRVSQKVALMASSEGGMDIEEVAAHSPEKIHTLIIEPSVGLTDAEADDI
FT                   ARKIGVPDTSVAQARQALQGLYKAFYETDASLAEINPLILTGDGKVIALDAKFNFDSNA
FT                   LFRHPEIVAYRDLDEEDANEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGG
FT                   EPANFLDVGGGATTEKVTEAFKLMLSNKNVQAILVNIFGGIMRCDVIAEGVISASKAVH
FT                   LTVPLVVRMKGTNEDLGKKMLADSGLPIISADTMEEAAQKVVAAAAGK"
FT   CDS_pept        575312..576193
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="H16_A0548"
FT                   /product="Succinyl-CoA synthetase alpha chain"
FT                   /function="Energy production and conversion"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91697"
FT                   /db_xref="GOA:Q0KE74"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE74"
FT                   /inference="protein motif:PFAM:CoA_binding"
FT                   /inference="protein motif:PFAM:ligase-CoA"
FT                   /inference="protein motif:COGS:COG0074"
FT                   /protein_id="CAJ91697.1"
FT                   /translation="MSILINKDTKVITQGITGKTGQFHTRGCRDYANGKNCFVAGVNPK
FT                   KAGEDFEGIPIYASVKDAKAQTGATVSVIYVPPAGAAAAIWEAVDADLDLVVCITEGIP
FT                   VRDMMEVKDRMRREKKKTLLLGPNCPGLITPDEIKIGIMPGHIHKKGRIGVVSRSGTLT
FT                   YEAVGQLTALGLGQSSAVGIGGDPINGLKHIDVMKMFNDDPETDAVVMIGEIGGPDEAN
FT                   AAYWIKENMKKPVVGFIAGVTAPPGKRMGHAGALISGGADTAQAKLEIMEACGIKVTKN
FT                   PSEMGRLLKAML"
FT   CDS_pept        576429..577124
FT                   /transl_table=11
FT                   /gene="h16_A0549"
FT                   /locus_tag="H16_A0549"
FT                   /product="integral membrane protein"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91698"
FT                   /db_xref="GOA:Q0KE73"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE73"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="CAJ91698.1"
FT                   /translation="MELLSSTTFWIALGSIILTNIVLSGDNAVVIALASRNLPPAQQKK
FT                   AIFWGSAAAIIMRVVLTVAAVKLLSLPYLKIVGAMLLVYIGVQLLTGDDDEEGHDGKDN
FT                   IWAAIRTILIADLVMSLDNVVAVAAAAQKGPEGSQLMLLIIGLGLSIPLIVFGSTLLLK
FT                   VMERFPVIIVLGAALLGYLAGEMLVSDPVDAAWFEVHVPHAHLVFGAAGAILVVIMGKL
FT                   LSRRSAQAA"
FT   CDS_pept        577442..577936
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="H16_A0550"
FT                   /product="Type IV pilus structural subunit PilA"
FT                   /function="Cell motility and secretion / Intracellular
FT                   trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91699"
FT                   /db_xref="GOA:Q0KE72"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE72"
FT                   /inference="protein motif:COGS:COG4969"
FT                   /inference="protein motif:PFAM:PF00114"
FT                   /protein_id="CAJ91699.1"
FT                   /translation="MQRVQQLKKLGRRVQKGFTLIELMIVVAIIGILAAIAIPQYQDYV
FT                   TRSRWSSPLTEIAPLKQAIAQCAQVSGGNLTACGTLAQLTAATGYPAVPAPAGVTLLFG
FT                   AGAPTAPTATTTTIELTAAANNLGLANGCVVTLTGTANANSIVWTGVTTGATCTRAQTG
FT                   I"
FT   CDS_pept        578029..579828
FT                   /transl_table=11
FT                   /gene="h16_A0551"
FT                   /locus_tag="H16_A0551"
FT                   /product="O-antigen ligase and related enzymes"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91700"
FT                   /db_xref="GOA:Q0KE71"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE71"
FT                   /inference="protein motif:PFAM:Wzy_C"
FT                   /inference="protein motif:COGS:COG3307"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="CAJ91700.1"
FT                   /translation="MQPSRPFLPSAALIAAIAVPLLVSRHTLPLATFYGEWTAALCVIA
FT                   VLAIHAGRRPAASPAVSLPWVSLLFLCLVAVGLALGATGHHDVTGSRLITVLTLFLGAT
FT                   VACTAWSYRGTTAASVQNIGDTLATAFLIAGLLGTLTQWVQLFHLEPRAFGLVSTYFYD
FT                   NNRRLWGNLNQPNHQATVEGLALVASVWLASRGRLRFPMWLAAVTLLESGIVLSGSRTG
FT                   VLHVGLAAFYALAAAWLARGARRDSDPMQRPVGLIVAAVAMLAMLLILQPAIRAAGQAF
FT                   DWRLFDTIAQLEAEDQLSARGALWTHALAIFRSHPWFGVGWGEFGWAQFQQLQQVGVKV
FT                   EMSLHAHNAILDLLAKTGIVGTAGVGLILLAWLWRVIRVRLWHGDSEERKQTVLVLTWL
FT                   AMLCAHSMLEYPLHYLYFFLPFCFMLGWLEPSGFGRWRVPMPVARGLALAFVVVAVAVL
FT                   ATMWQDYRRAEAREYASSEGRNALPMPRFWFRQHAQADAAGLATITPANAAELLPAHIA
FT                   AVHLLPTPTMIARTAWLLALTGDPAQGRQWMERLRWYYLGDEVAQYAEIAKACRDLTPD
FT                   ERPQVFCAWVGDRSRRYSEWRRD"
FT   CDS_pept        complement(579830..580345)
FT                   /transl_table=11
FT                   /gene="h16_A0552"
FT                   /locus_tag="H16_A0552"
FT                   /product="Hypothetical protein"
FT                   /note="3 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91701"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE70"
FT                   /protein_id="CAJ91701.1"
FT                   /translation="MHALTRATLAVATLTLGACAVMPAGPSVMVLPGTGKSFDQFRADD
FT                   YNCRQFAFGRVGGVSSSQAANNAAVGSAVVGTALGAAAGAAFNGGSGAAVGAGVGLLTG
FT                   AAVGAGNAQYAGYGTQQQYDAAYVQCMYASGNRVPAPGRVAAAPPSPRYYYYPPPPPPV
FT                   YYSPYPYY"
FT   sig_peptide     complement(580253..580345)
FT                   /gene="h16_A0552"
FT                   /locus_tag="H16_A0552"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(580360..580794)
FT                   /transl_table=11
FT                   /gene="h16_A0553"
FT                   /locus_tag="H16_A0553"
FT                   /product="Hypothetical protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91702"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE69"
FT                   /protein_id="CAJ91702.1"
FT                   /translation="MNGRMLCQIALALAATAASGAALAGRADLHDAALHDSDARGGFIK
FT                   TRTSVGVGLYFGPGVFYGGYPYGYPAPYYYPPAVVTAPAAPPQYIEQGPNGPVPVPGPD
FT                   GVAPQQGWWYHCDQPEGYYPYVQACPGGWQRIPAQPPANS"
FT   CDS_pept        complement(581024..581503)
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="H16_A0554"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /function="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91703"
FT                   /db_xref="GOA:Q0KE68"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE68"
FT                   /inference="protein motif:CDD:cd01420"
FT                   /inference="protein motif:CDD:cd00528"
FT                   /protein_id="CAJ91703.1"
FT                   /translation="MTQLTHFDTAGQAHMVDVGDKASTHRVAVATGTITMQPATFTLVR
FT                   DGSAKKGDVIGIARVAAIMATKRTADLIPLCHPIGLTKVAVEFALDEATATVACTVRTE
FT                   TRGQTGVEMEALTGVQVALLTIYDMCKAVDRGMVIGNVKLLEKHGGKSGDWVAAG"
FT   CDS_pept        581705..583438
FT                   /transl_table=11
FT                   /gene="h16_A0555"
FT                   /locus_tag="H16_A0555"
FT                   /product="zinc metalloprotease"
FT                   /function="General function prediction only"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91704"
FT                   /db_xref="GOA:Q0KE67"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE67"
FT                   /inference="protein motif:COGS:COG4783"
FT                   /protein_id="CAJ91704.1"
FT                   /translation="MPRWRRMDAMAAAAGGAAGADVRGAGLAPGYAAHGPGASTPVAAA
FT                   PAARPPQPVPAISGEASDQVYDNLNRSVKAGQKSEFGLRTNNAVVEAGGVQLPDLGDPS
FT                   TASLSPDMEKRLGDRIMRDIRRDPLYVPDPLLSDYLNALGYRLVQAARRQNISGSTGAG
FT                   TFATGFDLFAVRDRSINAFALPGGYIGVHTGLLVQSDTESELASVLGHEIGHVMQRHIA
FT                   RGITSQDQSMWIALASMVLAGLAATRSPDAAAALAMGGQGAAIANQLSFSRGAEREADR
FT                   VGFQILTAAGFDPHGMPDFFMRLQRASGTAENSVPSYVRTHPLTSERIADMQDRVSHAS
FT                   KRKVANTPEYECARMRARVIQESSPSDLQNLRAALRTQLPGATALRAPALHYGLAFTEQ
FT                   RLGRYPAAEQELAEARRLYGNIPGASSGSPMLDVMAVELARAQGRVPEALSQASASMKA
FT                   FALSHAVAIAYADTLVGSGRYEEAVRFLRERTRQETSRSEWWELLARAYAGQGKRLQQH
FT                   QALAEKYAMDGAYQAAIEQLQIARKAGDGDFYTLSEVDARLHQLERQYREDKQDSKGMP
FT                   N"
FT   CDS_pept        complement(583448..584038)
FT                   /transl_table=11
FT                   /gene="h16_A0556"
FT                   /locus_tag="H16_A0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91705"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE66"
FT                   /protein_id="CAJ91705.1"
FT                   /translation="MDEIVRQAMARWPNVPNAYGWLALDRRGQWRLRNEYAQQHGLSGD
FT                   PIRHEALIGFIERNYLCDERGAWYFQNGPQRVFVSLGYAPWVVRLHEGALRTTTQQAFT
FT                   LQACYADEHGNVVLAGTVEGMAQGSPPAQQAALLHDHDLELFSGASTWHGEACGTDLGV
FT                   FHHDGRDIPIEPVAESEVPRRFGFVRQPAPPAG"
FT   CDS_pept        complement(584079..585173)
FT                   /transl_table=11
FT                   /gene="h16_A0557"
FT                   /locus_tag="H16_A0557"
FT                   /product="predicted hydrolase of the alpha/beta-hydrolase
FT                   fold"
FT                   /function="General function prediction only"
FT                   /note="2 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91706"
FT                   /db_xref="GOA:Q0KE65"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE65"
FT                   /inference="protein motif:COGS:COG0429"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="CAJ91706.1"
FT                   /translation="MTQLPHHRLPQAVHAAQADPATAPGHGYGEGVPMPWWLRGGHAQT
FT                   IIPARFTRRPPRVSFRRERWDTPDQDFIDLDWTTHPVRPDTPLVVMFHGLEGDSGSHYA
FT                   QALMHALSLRGWQGVVPHFRGCSGELNLAPRFYHSGDSAEIRWVLERMRQRHCANGRKL
FT                   LVVGISLGGNALLRFLGEDGTSAGHVHAAAAISAPLDLAAGGAALSAGFNLVYTRMFLQ
FT                   TLKRKSLAKLGQFPGLFDRDTMLASRDLYAFDNVVTAPLHGFVDTDDYWRRAASKPVLR
FT                   DITVPTLVLNARNDPFLPARHLPGPADASPQVWLEQPEHGGHVGFMTPPEGWRRHLPLL
FT                   PDGRFSGDIEWLPARILRFFDGMM"
FT   CDS_pept        complement(585220..585660)
FT                   /transl_table=11
FT                   /gene="h16_A0558"
FT                   /locus_tag="H16_A0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91707"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE64"
FT                   /protein_id="CAJ91707.1"
FT                   /translation="MPRFARLFDSAEDIVEAFREALKLRDADGALRLWLDEDSITCVLP
FT                   DGQRLIGHEQLRQAFLQLLEEQPVLVDAIETSSHASMAVSIFDVTEALRFGGDRVEADL
FT                   YVHTTYVLMQNHEGWRLAHIHCSPANAVQVAAVAAAPGQALH"
FT   CDS_pept        complement(585692..586714)
FT                   /transl_table=11
FT                   /gene="rfaF3"
FT                   /locus_tag="H16_A0559"
FT                   /product="ADP-heptose:LPS heptosyltransferase III"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91708"
FT                   /db_xref="GOA:Q0KE63"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE63"
FT                   /inference="protein motif:COGS:COG0859"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="CAJ91708.1"
FT                   /translation="MKKALVIAPNWIGDALMAQPLFALLKARHPRLVIDALAPKWVAPV
FT                   LARMPEIGRVFPSDLAHGKLQLSARLMFAQQLKNEGYDLAYVLPNSLKSALVPWLAGIP
FT                   LRIGYRGEARFGLLNVRHANPPRDKRPPMVEHYARLALKPGARLPEDLPEPRLRVDPTR
FT                   MAATAERFGIAPHTRVIAFCPGAEFGPAKRWPAGHFARLAQMLRRSYPYAQMITLGSAK
FT                   DAEIAAEIVSEAPFVRNLCGQTSLDDAVDLLALSEAAVCNDSGLMHVTAALNRPQVAVF
FT                   GSSDPRHTPPLSQAASIMWLQLECSPCFKRECPLGHLRCLKEIEPEMVFVELRKLLHRP
FT                   "
FT   CDS_pept        complement(586833..587027)
FT                   /transl_table=11
FT                   /gene="h16_A0560"
FT                   /locus_tag="H16_A0560"
FT                   /product="conserved hypothetical protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91709"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE62"
FT                   /inference="protein motif:COGS:COG4391"
FT                   /protein_id="CAJ91709.1"
FT                   /translation="MTQTATIIEIGAEDIPLHCPTANTPAWNYHPRVFLDVADTGEAKC
FT                   PYCGTVYKLKPGTVLKGHH"
FT   CDS_pept        complement(587125..588045)
FT                   /transl_table=11
FT                   /gene="h16_A0561"
FT                   /locus_tag="H16_A0561"
FT                   /product="Branched-chain amino acid aminotransferase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91710"
FT                   /db_xref="GOA:Q0KE61"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE61"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /inference="protein motif:COGS:COG0115"
FT                   /protein_id="CAJ91710.1"
FT                   /translation="MSMADRDGKIWMDGKLIEWRDAKIHVLTHTLHYGMGVFEGVRAYK
FT                   TPEGTAIFRLKEHTRRLFNSAKIFQMVMPFDEATLEAAQREVVRANKLESCYIRPIVWV
FT                   GDEKLGVSAKGNTIHVAIAAWPWGAYLGEEGMERGIRVKTSSFTRHHVNVSLVRAKASG
FT                   YYINSILANQEATGLGYDEALLLDTEGYVSEGSGENVFIVRNGVIYTPDLASCLDGITR
FT                   DATLTIARDLGIEVREKRITRDEMYCADEAFFTGTAAEVTPIRELDDRVIGEGRRGPVT
FT                   KQIQDAFFAAVGGTNEKYKKWLTLV"
FT   CDS_pept        588161..591232
FT                   /transl_table=11
FT                   /gene="h16_A0562"
FT                   /locus_tag="H16_A0562"
FT                   /product="Superfamily II DNA/RNA helicase, SNF2 family"
FT                   /function="Transcription / DNA replication,
FT                   recombination,and repair"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91711"
FT                   /db_xref="GOA:Q0KE60"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE60"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="CAJ91711.1"
FT                   /translation="MPCSAHRAAALAALIPTLAVPLTPHPGPDVPPDRASDPGGASAPQ
FT                   AGWQQALEALRALAGSEPAAGGEGGRRLLWALTLDADGAPGTIEPLEQVRGARGWGKPR
FT                   PVPLARVAEDDRLAPWDARVARAIRRDQSHNRRYVLDRAAAAMALVGHPGVVLAHAPSQ
FT                   TLEVVEDAPALEAVRSAGRYVLRMFPPVREAPAMEALLPAAARQEAEALRQLTVVRDGP
FT                   HRLRLIRFTPAQFEAARLIGDGLAIPEDGHAQLDQTLRALAGQFQVQADQTGGSRAVEA
FT                   DARLRAEVAPLGGLAGRGISLRLVVTPLGPLGPRLAPGAGRERLMAAVRGETLATQRDL
FT                   DAELASVAEVFAALPQLVALAPPGGEYTWMLDDPEDALAVVEALPGLPAVQAVEWPRGK
FT                   EIRVLPADLRQLGVQIESRGAWYRLAGELRVAEGLVLELGKLIDWTGSHAGRFVPMGQG
FT                   VYVALTRTLRGRLRDLAGVGEHVPDGIRVPQMATPWLDDVLAGAGVDPDAHFRQRIARL
FT                   RAAREADIALPATLAAELRPYQEAGYRWAMTLAASGLGACLADDMGLGKTLQALAVLVA
FT                   RAGGGAALVIAPTSVCGNWAAEARRFAPTLNVHVYAEGDRETLLAQAGPHDLVIISYTL
FT                   LQQASKAFCAREWHTVVADEAQAFKNAVTRRAQAMFALPSGFRMALTGTPVENRLAELW
FT                   SVMRFCNPGLLGSLARFNEHFANPIERGGMREARQRLRRMIAPFVLRRTKTQVLDELPP
FT                   RTELVIRVEPEPVEAAHYEALRRQAQTEAEAALARVEAARKATKGAPAGARARALAQAQ
FT                   HQAQARIHVLAQLMRLRRAACDPRLVTPELSGQLSEGAKVRAFVELASELAASGHKTLV
FT                   FSQFVDFLQLLRQGLERAGLALQYLDGATPAAERTRRVAAFQAGEGDVFLISLKAGGFG
FT                   LNLTAADYVIIADPWWNPAAEDQAMGRAHRIGQQRPVTVYRLINAGTIEERIVDLHRDK
FT                   RALADGLLEADDDSAAGTGAPLPDVDELVGLLRR"
FT   CDS_pept        591414..592433
FT                   /transl_table=11
FT                   /gene="h16_A0563"
FT                   /locus_tag="H16_A0563"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91712"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE59"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /protein_id="CAJ91712.1"
FT                   /translation="MPTSSRLLPRLSFRSATGLAALCAAAAISTVSSPARAQGEWPTQP
FT                   VTILMGFTAGSGVDIVGRTLQESLQKSLKATIIYDYRPGAGGNVASEVVAHARPDGYTL
FT                   LLGTAATHGINPALYKNLPFDAEADFTPIAPLVEVSNVLTVNPAVLDVKSVKEFIEKVK
FT                   ANPGKYNFASTGNGTGTHLAFAEFNARAGLDMVHVPYKGGPDALQAVVKGEVCCIFNQV
FT                   QSVLPQYRAGKVRLLGVTTKQRVQVIPDVPTIAESGLPGFNSTIWFGFFGPKGLDPKIA
FT                   RKVNDAVKVALETPAIRQKLIDAGNTPRVETVDQFKATVKGDRQKWAGVVKTVGASID"
FT   sig_peptide     591414..591527
FT                   /gene="h16_A0563"
FT                   /locus_tag="H16_A0563"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(592450..593592)
FT                   /transl_table=11
FT                   /gene="h16_A0564"
FT                   /locus_tag="H16_A0564"
FT                   /product="transcriptional regulator, LuxR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91713"
FT                   /db_xref="GOA:Q0KE58"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE58"
FT                   /inference="protein motif:COGS:COG2771"
FT                   /protein_id="CAJ91713.1"
FT                   /translation="MSDTQMHDTIRALYEGIFDADAWQRSLGALCQASGSTHAHLLVLD
FT                   TVNERVLVNQEVNPMPEAVAAYSEHYVAIDPALPFARRMSVGNWYIDSRELGAQAMRKS
FT                   PFYGEFLRQFEQSSVMACLIERQPHYDVFLSLQRPQGHDHYSPEDARALDWAIPHMRHA
FT                   MALRDRTHQVSTLAHASAQLMERLPFGVIVFRDDGKPLLANSIGETWVRRLLPAVSVET
FT                   RAVAPPAIAVREEADWQLSRPFAEALRAACNPANPQPAQALRAVDSAGRQAQVVLLPLP
FT                   PAHHLAMDWQRPSVLVAIHEPGTAPMTLPAVLRDLYGLTPAETRLALQLSSGIGLPEAC
FT                   ELIGIRRETGRTQLKAIFTKTGTGTQAQLAHLLTRLGVRT"
FT   CDS_pept        complement(593693..594799)
FT                   /transl_table=11
FT                   /gene="h16_A0565"
FT                   /locus_tag="H16_A0565"
FT                   /product="transcriptional regulator, LuxR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91714"
FT                   /db_xref="GOA:Q0KE57"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE57"
FT                   /inference="protein motif:COGS:COG2771"
FT                   /protein_id="CAJ91714.1"
FT                   /translation="MKEADMHGAIRGLYEGILDPGAWQQSLHTLTELADTAHASMMVWD
FT                   TVRDQVTVNEIVNPVVELFSEYESDYQAIDPAKQYAPRLRPGDWYIDARELGEGTMARH
FT                   PFYRDFFHRYDLRSYVACLVERQPHYEVYFSMQRARTQPLFSPDDTRGMDWIIPHMRSA
FT                   MAMRDRTLGLTVLARLSTQLVERLNFALLVFSPQRQVLLSNRAGERWARRLDPAGKVSD
FT                   WNLSRPFADMVQAACDPQRAVAAQAARATDGNGACAQVIVLPLPPSHAFAAQWQEPAAL
FT                   VIVHEQDSAPLLLAPVLRDLYGLTPAETRLTTQLATGQGLPEASQQLNIRHETARTQLK
FT                   AIFHKTGCNSQAQLTHLLSRLGAALDEA"
FT   CDS_pept        595182..596378
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="H16_A0566"
FT                   /product="phosphoglycerate kinase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91715"
FT                   /db_xref="GOA:Q0KE56"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE56"
FT                   /inference="protein motif:PFAM:PGK"
FT                   /inference="protein motif:COGS:COG0126"
FT                   /protein_id="CAJ91715.1"
FT                   /translation="MTSVLRLSDLISQGKISGKRVFIRADLNVPQDDAGNITEDTRIRA
FT                   SVPAIEACLAGGAAVMVTSHLGRPTEGEFKPEDSLAPIATRLSELLGKPVKLVQNWVDG
FT                   VEVAPGQVVLLENCRVNKGEKKNSDELARKMAKLCDVYVNDAFGTAHRAEATTHGIAKY
FT                   APIACAGPLLAAEIDALGKALGQPARPLVAIVAGSKVSTKLTILKSLADKVDNLIVGGG
FT                   IANTFMLAAGLKIGKSLAEADLVGDAKTIIDIMARRGASVPIPVDVVCAKEFSATAAAT
FT                   VKDVKDVADDDMILDIGPRTAAMLAEQLKAAGTIVWNGPVGVFEFDQFGNGTKVLAQAI
FT                   AESKAFSIAGGGDTLAAIAKYGIADRVGYISTGGGAFLEFLEGKKLPAFEVLEQRAAG"
FT   CDS_pept        596433..597869
FT                   /transl_table=11
FT                   /gene="pyk1"
FT                   /locus_tag="H16_A0567"
FT                   /product="pyruvate kinase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91716"
FT                   /db_xref="GOA:Q0KE55"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE55"
FT                   /inference="protein motif:COGS:COG0469"
FT                   /inference="protein motif:PFAM:PK"
FT                   /protein_id="CAJ91716.1"
FT                   /translation="MTRSTKIVATIGPASSSLEILTRMIAAGVDVVRLNFSHGTAQDHL
FT                   DRARLVREAAQACGREVAIMADLQGPKIRVGKFEHGKITLKVGDPFILDSSCQLGNEQR
FT                   AGLDYQDLPRDVGPGDLLLLNDGLIVLVVDRVFGSEIFTTVRVGGELSNNKGINRQGGG
FT                   LSAPALTAKDMDDIKTAMALGADYVAVSFPKNATDMEMARQLTAVAGQPHGHKARMIAK
FT                   IERAEAIRPGVLEEILQASDGIMVARGDLAVEVGNAAVPALQKRMIKLAREANKLTITA
FT                   TQMMESMIVNPVPTRAEVSDVANAVLDGTDAVMLSAETAAGRYPVETVEAMAAVCIEAE
FT                   KSEVVQLDTDFLNQTFSRIDQSVAMGALFTAYHLQVKAIAALTDSGATALWMSRHRIHV
FT                   PIYAMTPNLASQRKMQLYRNVVPLPLQSSADRDTALEQAEELLLAQGVVQRGDFIVLTI
FT                   GEPMGQPGGTNTLKIVRVGY"
FT   CDS_pept        597920..598984
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="H16_A0568"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91717"
FT                   /db_xref="GOA:Q0KE54"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE54"
FT                   /inference="protein motif:COGS:COG0191"
FT                   /protein_id="CAJ91717.1"
FT                   /translation="MPLVSMRQLLDHAAENSYGLPAFNVNNLEQVQAIMQAADEVNAPV
FT                   IMQASAGARKYAGEHFLRHLIEAAVEAYPHIPVVMHQDHGQSPAICQGAIDLGFSSVMM
FT                   DGSLREDGKTPAEYEYNIDVTRKVVQLAHAVGVTVEGELGCLGSLETGEAGEEDGIGAV
FT                   GVLDHSMLLTDPEQAADFVKATQLDALAIAIGTSHGAYKFTRKPTGDILAISRIKEIHA
FT                   RIPNTHLVMHGSSSVPQELLEEIRKFGGDMKETYGVPVEEIQEAIKYGVRKINIDTDIR
FT                   LAMTGAIRRFFAENPSKFDPREYLKPAREAAKQVCKARYIAFGCEGQAGKIKPIGLTDI
FT                   AQQYKAGKLSQVVQ"
FT   CDS_pept        599089..599997
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="H16_A0569"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase (SAICAR synthetase)"
FT                   /function="Nucleotide transport and metabolism"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91718"
FT                   /db_xref="GOA:Q0KE53"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE53"
FT                   /inference="protein motif:CDD:cd01414"
FT                   /inference="protein motif:PFAM:PF01259"
FT                   /protein_id="CAJ91718.1"
FT                   /translation="MSNALYQSSINSLPLLGHGKVRDNYAVGNDKLLIVTTDRLSAFDV
FT                   IMGEPIPDKGRVLNQMANFWFRKLAHIVPNHETGIAPETVVAPEEVEQVKGRAVVVKRL
FT                   RPILVEAVVRGYLAGSGWKDYQATGKVCGIELPAGLQNAQKLPEPIFTPAAKAEMGEHD
FT                   ENISFAEVEARIGIALARQMRDISIRLYKEAAEFAATRGIIIADTKFEFGLDDNGVLTL
FT                   MDEVLTADSSRFWPADSYQVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPQLPDEV
FT                   IEKTAAKYREALTRLTGEELQ"
FT   CDS_pept        600157..600654
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="H16_A0570"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /function="Nucleotide transport and metabolism"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91719"
FT                   /db_xref="GOA:Q0KE52"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE52"
FT                   /inference="protein motif:COGS:COG0041"
FT                   /inference="protein motif:PFAM:PF00731"
FT                   /protein_id="CAJ91719.1"
FT                   /translation="MSKQDKPLVGVVMGSSSDWDVMQHAVAMLKDFGVPFEAQVVSAHR
FT                   MADDMFRYAESARSRGIRAIIAGAGGAAHLPGMIAAKTIVPVFGVPVPSKYLRGEDSLL
FT                   SIVQMPKGVPVATFAIGEAGAANAALHAIATLATTDEALAGALEAFRAKQTEAARAMTL
FT                   PL"
FT   CDS_pept        600697..601941
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="H16_A0571"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /function="Nucleotide transport and metabolism"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91720"
FT                   /db_xref="GOA:Q0KE51"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE51"
FT                   /inference="protein motif:COGS:COG0026"
FT                   /inference="protein motif:PFAM:ATP-grasp"
FT                   /inference="protein motif:PFAM:CPSase_L_D2"
FT                   /protein_id="CAJ91720.1"
FT                   /translation="MPTDIHPYLSEAHTPESRAEFGVDRPDAPILPGAWLGMLGGGQLG
FT                   RMFTHAAQAMGYRVCVLDPDQDSPAGSVADKHICAQYTDEAALAEMGKLCQAVSTEFEN
FT                   VPSLSLDRLEQLGAFVAPRGYCVSIAQNRIGEKKFFAACAERTGVSPAPHWVIQHDADV
FT                   DQLPDHVLPGILKTARMGYDGKGQARVKTRDDVRAAWNAMQHVPCVLEQMLPLAYEVSV
FT                   LAARAADGSTATWPLAENVHRDGILFSTVMPSTSVSPEIADRARAAAAAIATEMGYVGV
FT                   LCIEFFVLTDGSLVANEMAPRPHNSGHITMDACETSQFEQQVRAMARLPLGSTRQHSAG
FT                   KMLNLLGDVWFEFGLERTPSWDEVVAQPGAKLHLYGKGDARPSRKMGHVNCVGEHAEAA
FT                   DAAFAAAAQALHIPL"
FT   CDS_pept        601976..602953
FT                   /transl_table=11
FT                   /gene="sua"
FT                   /locus_tag="H16_A0572"
FT                   /product="putative translation factor (SUA5)"
FT                   /function="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91721"
FT                   /db_xref="GOA:Q0KE50"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE50"
FT                   /inference="protein motif:COGS:COG0009"
FT                   /inference="protein motif:PFAM:PF01300"
FT                   /protein_id="CAJ91721.1"
FT                   /translation="MPTAAELDEAVRLLEAGQLVAFPTETVYGLGADAENPEAVARIFA
FT                   LKGRPSNHPVIVHVVDGADIGYWTDEVPEAAQQLIDAFWPGPLTLILKRAAHIHPAVAG
FT                   GQDSIGVRCPSHPVAQALLARFKRGRGGIAAPSANKFGQVSPTTAQHVRDEFGDAVYVL
FT                   EGDGVEVGIESTIVDLSRLDQGIGPVLLRPGAITAAMMAQVLGAAPLPPDAAAPRASGT
FT                   LKAHYAPHTPLLLADAQAASAQLASLPDDARVAWVGRAPLVDQRCTWVQAPADAAAYAR
FT                   ELYRLLRKLDKQGYTQLMFEVLPEGQDWAGVRDRLERAAAAFGG"
FT   CDS_pept        complement(603156..603482)
FT                   /transl_table=11
FT                   /gene="h16_A0573"
FT                   /locus_tag="H16_A0573"
FT                   /product="predicted membrane protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91722"
FT                   /db_xref="GOA:Q0KE49"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE49"
FT                   /inference="protein motif:COGS:COG4392"
FT                   /inference="protein motif:PFAM:PF06063"
FT                   /protein_id="CAJ91722.1"
FT                   /translation="MSHLEIWIAILGMAVVTIVTRALFLMAGEHVTVPDRIARALRYAP
FT                   AAALAAIILPDLMTWQGHFTVAFSNDKLMAGIAATLFYLLTRKMVGMIVVGMAVYTALR
FT                   LLGG"
FT   CDS_pept        complement(603479..604285)
FT                   /transl_table=11
FT                   /gene="h16_A0574"
FT                   /locus_tag="H16_A0574"
FT                   /product="Branched-chain amino acid transport protein"
FT                   /function="Amino acid transport and metabolism"
FT                   /note="6 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91723"
FT                   /db_xref="GOA:Q0KE48"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE48"
FT                   /inference="protein motif:COGS:COG1296"
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /protein_id="CAJ91723.1"
FT                   /translation="MWLRLWHRFAPAERAGFIDGARYFAPSLPAVFSWGLVTGVAMSKS
FT                   VMTVPEAIGMSLLVYAGSAQLAVLPLFAAGLPLWTIWLTAAVVNLRFVIFSAGMQPHFS
FT                   YMPLWRRTILGSFNGDLHFVYFLQKYSTPGYEPGKEGYFWGMALTNFCMWQLSSIIGIV
FT                   LASLFPDSWGLGLAGTMALIPVMIATINSRSTLLAVVVSAVLALLCFDLPYRLSLVVAV
FT                   VGAIAAGMASDDLAARAALRGIRRRKPKAPEVTNAAAPETPPGDRA"
FT   CDS_pept        complement(604496..606097)
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="H16_A0575"
FT                   /product="D-Alanyl-D-alanine carboxypeptidase, S13 family"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="3.4.16.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91724"
FT                   /db_xref="GOA:Q0KE47"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE47"
FT                   /inference="protein motif:MEROPS:S13.UPW"
FT                   /inference="protein motif:COGS:COG2027"
FT                   /inference="protein motif:PFAM:PF02113"
FT                   /protein_id="CAJ91724.1"
FT                   /translation="MAAMPRTIAAPTASRPGALLRCLSPLLSPILAAVLLAGGPAPTPA
FT                   QAKAPAKTVKAAKAAKAATAAKTAADPALVSAGVPTPVAAALRRAGVPASAASFYVVRL
FT                   GAGTARASWNAQQPMNPASTMKLVTTFAGLQLLGPDYRWQTSLYADAQPGFDGTVNGNV
FT                   YLRGHGDPKLVPEEMAKLVAKARAGGATGINGDLVLDRSYFADGLDGNGTIDGEVQRAY
FT                   NVGPDALLYAFKTLSFTLTPDPASQTVAVSVTPELAQLKLDNRLTLTNGRCGDWQSSAS
FT                   PSVLPQADGTVLASFSGDYASDCGEHVLNIATLSHAEFTWGGFVAEWQRAGGRFAHMPA
FT                   LRSGKVPRGAVLLARHYGLPLADIVRDINKFSNNVMARQLFLTIGAEMDRGGPASTGRS
FT                   IRVVQRWLARQGLDMPGLVLDNGSGLSREERISAYDMARLLQQAAASNVGPVLIDSLPV
FT                   LGVDGTLRNRLTRANAAGNGYLKTGTLADVRALAGYVDAADGGRYVVVSMINHPNAAQA
FT                   LEAHDALLQWVYRGAP"
FT   CDS_pept        complement(606146..606733)
FT                   /transl_table=11
FT                   /gene="h16_A0576"
FT                   /locus_tag="H16_A0576"
FT                   /product="transcriptional regulator, MarR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91725"
FT                   /db_xref="GOA:Q0KE46"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE46"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /inference="protein motif:SMART:smart00347"
FT                   /protein_id="CAJ91725.1"
FT                   /translation="MNPDASGTPPAAPPRPRSTTAASARRKARDPLAPDPAASGGADAG
FT                   FDPHVPNIDYGVLDNLIGYAIRRAQIRIYEDFVLSLAQWQITPPRFSALIIISRNPHLK
FT                   LTELAQILGIARSGAVLLVDALEEMNLVARRPAAGDRRAYSLVLTAAGRRTLEAATQAV
FT                   VAHDAHVGSALSEAEQATLKSLLARLAPPRAG"
FT   CDS_pept        complement(606730..607914)
FT                   /transl_table=11
FT                   /gene="h16_A0577"
FT                   /locus_tag="H16_A0577"
FT                   /product="ABC-type transporter, periplasmic component: HAAT
FT                   family"
FT                   /function="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91726"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE45"
FT                   /inference="protein motif:TCDB:3.A.1.4"
FT                   /inference="protein motif:COGS:COG0683"
FT                   /protein_id="CAJ91726.1"
FT                   /translation="MQNKTIERGDTMAPLTTTKLARLALAAALAFSAGSALADITVGVS
FT                   LSTTGPSASLGIPQKNSLAYLPQKIGGEAVRYIVLDDASDPTQGAKVARRFVSEDKVDI
FT                   ILGSSAVAPSIAIAEVADEAQTVQLAFSPIELKPGRGGWTFRLAQPVRLMANAVAATAK
FT                   TNGVKTIGFIGFADAYGETWLKDFTAAASANGIRLIATERYGRADTSVTAQAIKLIAAK
FT                   PDAILIAGAGTGAALPHTTLRERGYGGTIYHTHGAATKDLIRIGGRMVNGAILPAGPVI
FT                   VPEQLPAGDPVRKPGLDYVTRYEKQYGADSRTQFGAHAYDAGLVLERIVPVALRHARPG
FT                   TPAFRQALRQALETERDIVVSHGVLNYSGQDHYGFDQRGRVMLTIDNGNWKLLK"
FT   sig_peptide     complement(607831..607914)
FT                   /gene="h16_A0577"
FT                   /locus_tag="H16_A0577"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(607933..609186)
FT                   /transl_table=11
FT                   /gene="h16_A0578"
FT                   /locus_tag="H16_A0578"
FT                   /product="2-Polyprenyl-6-methoxyphenol hydroxylase or
FT                   related FAD-dependent oxidoreductase"
FT                   /function="Coenzyme metabolism / Energy production and
FT                   conversion"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91727"
FT                   /db_xref="GOA:Q0KE44"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE44"
FT                   /inference="protein motif:COGS:COG0654"
FT                   /inference="protein motif:PFAM:Monooxygenase"
FT                   /protein_id="CAJ91727.1"
FT                   /translation="MKIAIAGGGIGGLTLALLCHRHGIEAEVWEASETLRPLGVGINLL
FT                   PHAVRILSELGLRDALADIAIETSSLSYYNKRGQRIWHEPRGLAAGYDWPQFSIHRGEF
FT                   QMLLHRTAVERLGAGAVHTGHGFETVLDTGAGGQARFGLRRRSDNAEVEASADVLVGAD
FT                   GIHSAVRRHFYPTGDLPRFSRRLLWRAVTEAPPYLDGRSMFMAGHQDQKFVAYPISEPL
FT                   RRQGRSLVNWIAELRVPDSVPDTPPRSDWNKQVDKSVFCAAFADWRWDWIDIPALIDGA
FT                   EAIYEFPMVDKDPLPRWTFDRVTLLGDAAHPMYPIGSNGSAQAILDARYLLDSLLGTPD
FT                   TGYALREYEAERLPRTAGIVLRNRMNGPEQVMQLAEERAPQGFADIDQVIPRAELEAIS
FT                   LRYKQLAGFDRQSMQGRR"
FT   CDS_pept        complement(609343..609795)
FT                   /transl_table=11
FT                   /gene="h16_A0579"
FT                   /locus_tag="H16_A0579"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91728"
FT                   /db_xref="GOA:Q0KE43"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE43"
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /protein_id="CAJ91728.1"
FT                   /translation="MRKTWDRIRHAVGFEVVGLLIFAPLASWAFGYELHEMGVIGAVAS
FT                   LIATGWNYLYNVLFDKGMLRFTGQLRKSVPVRVLHAVLFELGLLVVFLPSVAWYLDISL
FT                   VDALIMDLAVAGFYMVYALVYNWLYDIVFPVPSLQAQAKPEGAALG"
FT   CDS_pept        609907..610812
FT                   /transl_table=11
FT                   /gene="h16_A0580"
FT                   /locus_tag="H16_A0580"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91729"
FT                   /db_xref="GOA:Q0KE42"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE42"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91729.1"
FT                   /translation="MSLSIEQLQAFVAAADTGSFSAAARRLGKAQSVVSAAVSNLEIDA
FT                   GNALFDRSARYPVLTPAGERLLAEARVILERCEHFRGVAKSLGEGVETRLVLAVDELYP
FT                   EETLGMLLEEFSSRFPAVELELLFPLMEDVSRLVLEGGADLGIMWRQEVLPPALGFHAL
FT                   GWVPMQILCAPEHPLAGQRVDWEELKRYRQLMVATRSDSEEKMRLRVAADVWWVESQWV
FT                   IVELVKRGLGWAFVPWHVVANSPAAARLVTPPLAFQQQDWPVAMELVWHKQRPLGKAAT
FT                   WLRERICQQPLPRAPAASAG"
FT   CDS_pept        complement(610799..612292)
FT                   /transl_table=11
FT                   /gene="acrC1"
FT                   /locus_tag="H16_A0581"
FT                   /product="Cation/multidrug efflux system outer membrane
FT                   porin"
FT                   /function="Cell envelope biogenesis, outer membrane /
FT                   Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91730"
FT                   /db_xref="GOA:Q0KE41"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE41"
FT                   /inference="protein motif:COGS:COG1538"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="CAJ91730.1"
FT                   /translation="MRRLDMTVLSRLLTHALPVSLACALLLAGCAVGPDYQRPDAPVSA
FT                   SFKEADAATPAWTGDWKPAEPQDALARADWWTVFGDAQLDALMSEVQISNQNIKAAEAQ
FT                   YRQAVASLQAARAGFFPTVDAQAGASRARGASGSTLNGQSATLGATWEIDVWGRVRRQV
FT                   ESSEASAQASQADLASTLLSTQATLAQSYFLLRVADAQKALLDRTVADYQKSLQLVQNQ
FT                   YAAGTAQRSDVLQSETQLKSAQAQQIDIQITRAQLEHAIAVLVGKPPAALTLVADDFRT
FT                   ALPRVPAAVPSQLLERRPDIGAAERRMASANAQIGVAQAAYYPTLSLSASGGLTASTLA
FT                   RWMSLPDRIWSIGGGLAGTLFDGGLRSAAKAQAVAAYDQAVANYRQTVLGAFQEVEDNL
FT                   AAQRLLEQEAVVQNDALRSAREALVLVNNRYRAGTAGLLDVLTAQTSAYTAERTALSIA
FT                   GRQYTAAVVLIKALGGGWHAPGAEAAPAQAGSNQAVSQR"
FT   sig_peptide     complement(612197..612292)
FT                   /gene="acrC1"
FT                   /locus_tag="H16_A0581"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(612295..615594)
FT                   /transl_table=11
FT                   /gene="acrB1a"
FT                   /locus_tag="H16_A0582"
FT                   /product="Cation/multidrug efflux pump"
FT                   /function="Defense mechanisms"
FT                   /note="9 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91731"
FT                   /db_xref="GOA:Q0KE40"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE40"
FT                   /inference="protein motif:COGS:COG0841"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="CAJ91731.1"
FT                   /translation="MNLSAAFIHRPVATALLTLGILLAGLAALRLLPVSPLPQVDFPTI
FT                   SVSASLPGASPETMAATVATPLERALGTIAGVTEITSSSSLGSTRVTLQFDLSRNIDGA
FT                   ARDVQAAINASRATLPTSLPNNPTYRKVNPADAPIMIIALTSPTMTRGQLYDAASTILA
FT                   QKLSQVDGVGQVTIGGASLPAVRVELNPTALNNYGISLEDVRNTISATNANRPLGTLEN
FT                   AASNWQVYANDQAMKAEDYMPLIIRYATPGTFSSTSAGALIASTANAAASGGVSTKVVN
FT                   GVTVTTLTTSSGTTTITSGATGGTSATSGPNSFAVPVRLRDVANVVDSVQDIRNAGSAN
FT                   GKPSVLLVLNRSPGANIIETVDRVNEMLPQLQKMIPAAISMDVMMDRTPTIRASLREVE
FT                   NTLMISVALVIMVVFVFLRNVRATLIPSVAVPVSLIGTFSVMYLAGFSLNNLSLMALTI
FT                   ATGFVVDDAIVVLENISRHIEEGMKPLAAALRGAREVGFTVLSMSLSLIAVFIPLLMMG
FT                   GIVGRLFQEFAITLSVAILVSLVVSLTTTPMMCARMLRPPEPEKQGRFFRATERMFQWL
FT                   HDGYARSLSTALRLSPLVWLVLIATIALNVYLYVIVPKGFFPQQDTGRLIGFIRADQAT
FT                   SFQAMRGKLDNFIKIVQSDPAVVNVTGFTGGSQRNTGQMFVTLKPLSERNESADAIIAR
FT                   LRGKLSKEPGASLFLQSVQDIRIGGRQSSSQYQFTLQSDDLEVLRAWEPKVRAALSNLK
FT                   GLEDIDTDTNDKGLQTSVIIDRDAASRLGVTAQQVDAVLNDAFGQRLVSTIYHPLNQYR
FT                   VVMELSQEYLQGPDALKDIYVVTGNGNRVPLAAFARVTPSSTPLGVNHQGQFAASTISF
FT                   NLAEGTSLSQATDAITREMARIGVPETLRANFQGGAKAFQDSLKSQPILILAALITIYI
FT                   VLGVLYESYVHPLTILSTLPSAGVGALLALLASKTDFSIIALIGVILLIGIVKKNAIMM
FT                   IDFAIDAERRDGLSPRDAIYRACLLRFRPILMTTMAALLGAVPLAIGRGDGAELRAPLG
FT                   ISIVGGLVVSQLLTLYTTPVVYLTLDRWRLKVKAWRQRRRGAGTPDQPAAV"
FT   sig_peptide     complement(615511..615594)
FT                   /gene="acrB1a"
FT                   /locus_tag="H16_A0582"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(615597..618719)
FT                   /transl_table=11
FT                   /gene="acrB1b"
FT                   /locus_tag="H16_A0583"
FT                   /product="Cation/multidrug efflux pump"
FT                   /function="Defense mechanisms"
FT                   /note="9 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91732"
FT                   /db_xref="GOA:Q0KE39"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE39"
FT                   /inference="protein motif:COGS:COG0841"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="CAJ91732.1"
FT                   /translation="MNPSRLFIERPVATALLMLAILLSGLVAYRLLPLSALPEVDYPTI
FT                   QVTTLYPGASPDVMTSSVTAPLERQFGQMPGLKQMSSSSSGGASVITLQFELTLPLDVA
FT                   EQEVQAAINAGSNLLPSDLPMPPVYSKVNPADAPIMTIAMTSDTMPLPRLQDMVDTRVA
FT                   QKISQIQGVGLVTISGGQRPAVRIQANPAALASLGMSIDDLRTAIGASNVNGAKGSFDG
FT                   PARASTIDANDQLRSADEYRQIILGYRNGAPIRITDVAEIVDGPENSRLAAWANDKPAI
FT                   VLNIQRQPGANVIEVVDRIKALLPQLQNALPASVHVQLLTDRTTTIRASVEDVQFELLL
FT                   AIALVVLVIFLFLRNIPATIIPGVAVPLSLVGTFGVMYLAGFSINNLTLMALTIATGFV
FT                   VDDAIVMIENIMRYIEKGDSPMAAALKGSKQIGFTIISLTFSLVAVLIPLLFMGDVVGR
FT                   LFREFAITLAVSILISAVVSLTLTPMMCARLLHHVPEEKLSRFHRASGRFFDNVIERYG
FT                   RALEWVLDRQKATLVVAVATLVLTGLLYLLVPKGFFPVQDTGVIQGITEAAQTTSFDAM
FT                   ARRQQAVAKVVMQDPAVASLSSFIGVDGTNTTLNAGRMLINLKPKGERDPIDVVTQRLQ
FT                   QAVHELGGVSLYTQPVQDLTIEDKVSRTQYQFTVEDPDPATLAAWVPKLVERLRQEPEL
FT                   RDVTSDQQNNGLRAYVDIDRDAAARFGITTAVIDSALYSAFGQRLVSTIFTQSSQYRVV
FT                   LETMPEFRKNPQSLADLRLPSSSGGQVPLGAFARITERTGPLVINHQGQFPAATISFNL
FT                   APGESLGAAVDKITRVEQELGLPISMQTSFQGAALAFRASLSNTLWLILAAVVTMYIVL
FT                   GVLYESTIHPVTILSTLPSAGVGALLALLLAGQDLGIIAIIGIILLIGIVKKNAIMMID
FT                   FALEAEREGGMKPRDAIFQACLLRFRPILMTTMAALLAALPLMLGSGIGSELRRPLGVT
FT                   MVGGLLVSQVLTLFTTPVIYLAFDRVATRVKGWRKRRFGDPEEGGTGEEPV"
FT   sig_peptide     complement(618633..618719)
FT                   /gene="acrB1b"
FT                   /locus_tag="H16_A0583"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(618729..620180)
FT                   /transl_table=11
FT                   /gene="acrA1"
FT                   /locus_tag="H16_A0584"
FT                   /product="Cation/multidrug efflux system, mebrane-fusion
FT                   component"
FT                   /function="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91733"
FT                   /db_xref="GOA:Q0KE38"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE38"
FT                   /inference="protein motif:TCDB:8.A.1"
FT                   /inference="protein motif:COGS:COG0845"
FT                   /protein_id="CAJ91733.1"
FT                   /translation="MSNPEQGQPTPSPTPSSPAPEGTPPRRTGRRRLTAGVLVLLLAGG
FT                   AWYWYAHRGQAPQETAGAAGAQRGASGPGARGGAGGPGMPRSPVVVATVAKRDMDVVLN
FT                   GLGHVTPVSNVTVRAQVSGPLLKVLFKEGQMVKAGDVLAEIDPRPFQAALDQAVGQLAR
FT                   DQALLQNARLDQQRYRTLLGQDSISKQQVDTQDALVRQYEGVVKTDQGNVANARLQLGY
FT                   TRIVAPVSGRIGLRQVDPGNIVNTSDTNGIALITQIQPIAVMYTIPEDNLPSVLKKLNA
FT                   GEELPVQAWDRQVRNQLGEGTLLTTDNQIDTTTGTVKLKAVFPNADGMLFPNQFVNVRT
FT                   RVDTLRDATVIPVAAIQRGQQGTFVYTVDDSSKVKVQVVTLGPGDGSRNAVLKGLEPGQ
FT                   RVVVDGADRLKEGMTVEAVDPAARAAAVVPASQPRGRGRRNRDGGGASGAHADASGAAA
FT                   PGAAGEHRRHRQAGASAPPAGGAQQ"
FT   CDS_pept        620519..621262
FT                   /transl_table=11
FT                   /gene="h16_A0586"
FT                   /locus_tag="H16_A0586"
FT                   /product="response regulator, OmpR-family"
FT                   /function="Signal transduction mechanisms / Transcription"
FT                   /note="REC (residues 9 to 121, 1e-27) with a complete
FT                   phosphorylation pocket (DD-D55-S78-K96)"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91734"
FT                   /db_xref="GOA:Q0KE37"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE37"
FT                   /inference="protein motif:CDD:cd00156"
FT                   /inference="protein motif:COGS:COG0745"
FT                   /inference="protein motif:CDD:cd00383"
FT                   /protein_id="CAJ91734.1"
FT                   /translation="MRTNQPTQILVVDDDPELRDLLREYLTQQGFAVSVMHDGDGLQAR
FT                   LERERPALIVLDLMMPKVDGLTALRNLRAKNDDIPVILLTARSDEIDRIVGLEIGADDY
FT                   LGKPFSPRELLARINAVLRRKLARPAAAPEDRESVAFGPFRVNFRQRTLGRAGQTLSIS
FT                   DTEFALLKLLLMHPLEVLSRERIVELMYGSASGISDRGIDVQIWRLRRLLDEDAQRPRY
FT                   IQTVRGRGYTFVPDEAEEMSAGLPE"
FT   CDS_pept        621315..622586
FT                   /transl_table=11
FT                   /gene="h16_A0587"
FT                   /locus_tag="H16_A0587"
FT                   /product="signal transduction histidine kinase"
FT                   /function="Signal transduction mechanisms"
FT                   /EC_number="2.7.3.-"
FT                   /note="2 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91735"
FT                   /db_xref="GOA:Q0KE36"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE36"
FT                   /inference="protein motif:COGS:COG0642"
FT                   /inference="protein motif:SMART:smart00387"
FT                   /protein_id="CAJ91735.1"
FT                   /translation="MKLRRIDTLFGRIALLIAAVLVISHFSWLAILRMDRRQQQVDYSV
FT                   EQMLFQLDSIERALDARPPAKLPSLVETANTADAEEHAVVPKGGRSRRLVEQFIGRLPQ
FT                   GTEIRLEDETTPRIWIKLPSRARWIAMPILWVHNPPPDNRLVPGVMLVVGVAIVFAVLI
FT                   AWQIQRPVRDMANAAELLSRQHAVPPLRERGPHELRQLIERFNRMVADLARIDQERNTM
FT                   LAGIAHDLKTPLARLRLRAEMLADPKAAAGVTRDVESMSAIVEQFLSFAQTSESTARPV
FT                   PVDRRVNELAASLAEQERQVVLSLGAGEGFRMIATQLDRIVGNLVDNAYAYGKPPVCIA
FT                   TARTPEGYLLVVEDQGAGIPEDDKERATLPFVRLDPARGGNAHSGLGLAIVDRLVRQAG
FT                   GKLNLVNADGGGFRVEMLFGAAEA"
FT   CDS_pept        complement(622616..623224)
FT                   /transl_table=11
FT                   /gene="h16_A0588"
FT                   /locus_tag="H16_A0588"
FT                   /product="predicted membrane protein"
FT                   /function="Function unknown"
FT                   /note="4 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91736"
FT                   /db_xref="GOA:Q0KE35"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE35"
FT                   /inference="protein motif:COGS:COG0344"
FT                   /inference="protein motif:PFAM:PF02660"
FT                   /protein_id="CAJ91736.1"
FT                   /translation="MANLLFALAAYLIGSVSFAVVVSKLMGLPDPHSYGSGNPGATNVL
FT                   RTGNKKAAILTLIGDALKGWLAVWLAARFGPAYGLNETGLAMVALAVFLGHLFPVYHRF
FT                   AGGKGVATAAGILLAIDPILGLGTLATWLIIAFFFRYSSLAALVAAIFAPFFHVLMNGV
FT                   DVMTGAIFVISVLLIARHRQNIAKLLAGKESRIGEKKKV"
FT   CDS_pept        complement(623335..623826)
FT                   /transl_table=11
FT                   /gene="ebsC"
FT                   /locus_tag="H16_A0589"
FT                   /product="uncharacterized conserved protein"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91737"
FT                   /db_xref="GOA:Q0KE34"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE34"
FT                   /inference="protein motif:COGS:COG2606"
FT                   /inference="protein motif:CDD:cd00002"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="CAJ91737.1"
FT                   /translation="MSKTRHVSETPATQYLRKHGVAFGEHPYDYVEHGGTGESARQLGV
FT                   PEHDVIKTLIMEDERAQPLVVLMHGDCSVSTKNLARQAGRKSVQPCKPEVAQRHSGYMV
FT                   GGTSPFGTRKRMPVYVESTVLELARIYINGGRRGYLVSVDPKLLPMLVDAQPVQCALPD
FT                   "
FT   CDS_pept        complement(623850..624788)
FT                   /transl_table=11
FT                   /gene="xerD1"
FT                   /locus_tag="H16_A0590"
FT                   /product="Site-specific recombinase XerD"
FT                   /function="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91738"
FT                   /db_xref="GOA:Q0KE33"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE33"
FT                   /inference="protein motif:COGS:COG4974"
FT                   /inference="protein motif:CDD:cd00798"
FT                   /inference="protein motif:COGS:COG4973"
FT                   /inference="protein motif:CDD:cd01193"
FT                   /protein_id="CAJ91738.1"
FT                   /translation="MSGAAQAPDIAAAPSDADVALVSRFCDALWLEDGLSRNTIDAYRR
FT                   DLTLLARWLQHEHRGELPGADDGALSAYFNARHTQSRASSANRRLAVFRRFYQWALREH
FT                   LVEADPCLLLRPAKQPPRYPKTLTESQVDALLEAPDTDTPLGLRDRTMLELMYASGLRV
FT                   SELTQMKTIEIGLNEGVARVVGGKGDKERLVPFGQQAGDWLRRYLASARPALLAGRACD
FT                   ALFVTQRGEGMTRQAFWHLIKRHARDAGVHAPLSPHTLRHAFATHLLNHGADLRVVQLL
FT                   LGHADISTTQIYTHVARERLRELHQQHHPRG"
FT   CDS_pept        complement(624785..625264)
FT                   /transl_table=11
FT                   /gene="h16_A0591"
FT                   /locus_tag="H16_A0591"
FT                   /product="Methylated-DNA [protein]-cysteine
FT                   S-methyltransferase"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91739"
FT                   /db_xref="GOA:Q0KE32"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE32"
FT                   /inference="protein motif:PFAM:PF01035"
FT                   /inference="protein motif:COGS:COG3695"
FT                   /protein_id="CAJ91739.1"
FT                   /translation="MPATYDAILPAPFGKIGVRTDGARIRAIVYLPGHVEARAPADALT
FT                   QQLAAQLEAYYANPDAAFDLPLAPAGSDFQQRVWQAISAVPRGAVTTYGTIAEAIGAMP
FT                   RAVGQACGQNPFPIVIPCHRVVSARGIGGFSPHAEDGFYLDVKRWLLRHEGAMLI"
FT   CDS_pept        complement(625371..626339)
FT                   /transl_table=11
FT                   /gene="h16_A0592"
FT                   /locus_tag="H16_A0592"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91740"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE31"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /protein_id="CAJ91740.1"
FT                   /translation="MQAGKLALTLALAAAATAAQAQSYPTKPIRLIIPFAPGGTTDIVG
FT                   RGAADQMSRILGQPVVVENRAGGGGSIGADAIAKAAPDGYTIGISTVSTMAVNPACNPK
FT                   LSYDPIKDFKPITNLANVANVIAVNPSFPAKDYKEFLAVLKANPGKYSYASSGTCGFGH
FT                   MLGEQFKVSTKTFMVHIPYRGAGPALNDVLAGQVPIMVDNLPSSIPYIKAGKLRPIVVA
FT                   WNKRLESMPNVPTFGEMGLKEPNDPAWYGLVAPAGTPDDVIKKLNEAAVKALQDKDFQQ
FT                   RLRTAGAEPSGNTPAQHAAEIKKEFDKMKNLVKVQNIKLEQ"
FT   sig_peptide     complement(626274..626339)
FT                   /gene="h16_A0592"
FT                   /locus_tag="H16_A0592"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(626443..627006)
FT                   /transl_table=11
FT                   /gene="h16_A0593"
FT                   /locus_tag="H16_A0593"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91741"
FT                   /db_xref="GOA:Q0KE30"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE30"
FT                   /protein_id="CAJ91741.1"
FT                   /translation="MALCAATAAGAVPVPARSVEIEGIRFDDAARVGGKELQLNGTALR
FT                   AGFLAKGYVAALYLQEKARNAALVLGTPGAKRLQLRMLRETEPPDVVRAIRQGIRNNHS
FT                   EQQMQGLATRLVQFERTLGEVGTAHKGDVINLDFSPQTGTVIAINGTPRGRPIPGEDFY
FT                   QAVLRVFLGERPVDAEVKRGLLGG"
FT   sig_peptide     complement(626944..627006)
FT                   /gene="h16_A0593"
FT                   /locus_tag="H16_A0593"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        627302..628195
FT                   /transl_table=11
FT                   /gene="h16_A0594"
FT                   /locus_tag="H16_A0594"
FT                   /product="predicted permease"
FT                   /function="General function prediction only"
FT                   /note="8 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91742"
FT                   /db_xref="GOA:Q0KE29"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE29"
FT                   /inference="protein motif:COGS:COG0679"
FT                   /protein_id="CAJ91742.1"
FT                   /translation="MSSALLLVPDFSLILIGWLLVRYTPFDRAFWGGVERLVYFVLFPA
FT                   LLLQSTNTAVLDFSSTSAMLGLALLVMATGMAGGYAVKWVLRPDALSFASGLQTAFRFN
FT                   SYIGLALASRLGGSEGLALMAVIVGCTVPLCNVAAVWALARHGQTALWKELARNPLILA
FT                   TAGGLLTNLMGLHAPEVLGMTLNRLGSASTALGLMTVGAGLQMSGATGTAGPVAWWTGV
FT                   KLLAMPCVAWLVGRHLPLTALQYQIVVLYASLPTASSAYILAVRMGGNGPMVAATISLM
FT                   TVAAIVTTPLWLALVS"
FT   CDS_pept        complement(628192..629397)
FT                   /transl_table=11
FT                   /gene="h16_A0595"
FT                   /locus_tag="H16_A0595"
FT                   /product="Uncharacterized Fe-S protein"
FT                   /function="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91743"
FT                   /db_xref="GOA:Q0KE28"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE28"
FT                   /inference="protein motif:COGS:COG1600"
FT                   /protein_id="CAJ91743.1"
FT                   /translation="MIDRVAPGQADAPPTPVPGTAAHLAAGPGELAALAASIRAWGAEL
FT                   GFASVRIADVDLSHAEPGLMAWLAQGYHGDMDYMANHGLRRARPAELVPGTVRAIVARM
FT                   PYLPAAGAQAGATDWRRHELARLDDPATAVVSLYARGRDYHKVLRSRLQQLASRIEAEI
FT                   GKFGYRVFTDSAPVMEVALASQGGLGWRGKHTLLLDRDGGSMFFLGEILVDIPLPADAP
FT                   ESGHCGNCHRCLDICPTRAIVAPYRLTRAACISYLTIEHKGPIPVEFRAPMGNRVYGCD
FT                   DCQLACPWNKFAHVAMVPDFDVRNGLDAPDMVALFQWTEAEFNQRLEGSPIRRIGHERW
FT                   LRNLAVGLGNSLRAALSGTRAEDAALAARIRAALLERRESATPLVREHIDWALAQGGPP
FT                   PD"
FT   CDS_pept        629414..629926
FT                   /transl_table=11
FT                   /gene="h16_A0596"
FT                   /locus_tag="H16_A0596"
FT                   /product="Predicted ATPase or kinase"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91744"
FT                   /db_xref="GOA:Q0KE27"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE27"
FT                   /inference="protein motif:COGS:COG0802"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="CAJ91744.1"
FT                   /translation="MPLLEERTLTLPDEAATARLGAALAAAVQAMPPRTVHVQLSGDLG
FT                   AGKTTLTRTILRALGHAGKVRSPTYTLCEPYEVARADGSPLTVYHFDLYRFADPEEWID
FT                   AGFRDCFAEPAFNLVEWPEKAGRLLGEPDLHMLLQSDMAGADDAGERRIATMRAYTHTG
FT                   LTLLNAC"
FT   CDS_pept        629920..631422
FT                   /transl_table=11
FT                   /gene="amiC"
FT                   /locus_tag="H16_A0597"
FT                   /product="N-Acetylmuramoyl-L-alanine amidase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91745"
FT                   /db_xref="GOA:Q0KE26"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE26"
FT                   /inference="protein motif:COGS:COG0860"
FT                   /protein_id="CAJ91745.1"
FT                   /translation="MLIKRLATDRPDGPDGLLQARRKWMAQALKLGAGTAVLTLAGPQI
FT                   AFGAGIVAVRVWPAEDYTRVTIESDSPLAAVHQMIRDPDRLVVDIDGLDLSPTLRELVA
FT                   KITPNDPYIQTVRVGQNRPRVVRMVFDLKENVAPQVFTLAPIGSYRNRLVFDLYPVNPP
FT                   DPLWKLVRDTEEKQRRFATSDPAPGNDGIAGAPAGAEEDAIGALVRRFDEKGEVPPTTA
FT                   PLPPPVASARPRPSAPPVPSPNAPVVPPVARDNPTAERPFKMRRLLTVAIDPGHGGEDP
FT                   GAIGAAGSREKDVVLQIAHRLRAKIDAQPNMRAMMTRDADFFVPLNVRVQKARRVQADL
FT                   FVSIHADAFLSPEARGASVFALSERGASSTAARWLANKENASDLIGGANMGNKDAQVAR
FT                   VLLDLSTTAQINDSLQVGKAVLGEIGGINKLHKGSVEQAGFAVLKAPDIPSILIETAFI
FT                   SNPEEERKLNDNAHQEQLANAILKGIRSYFARNPPLSKNPSV"
FT   CDS_pept        complement(631479..632504)
FT                   /transl_table=11
FT                   /gene="h16_A0598"
FT                   /locus_tag="H16_A0598"
FT                   /product="putative sodium-dependent transporter"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91746"
FT                   /db_xref="GOA:Q0KE25"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE25"
FT                   /inference="protein motif:COGS:COG0385"
FT                   /protein_id="CAJ91746.1"
FT                   /translation="MSRIVRKLKKLYDLIDRFVLVMLTAIAIALAAPEIGAGDGPLHLG
FT                   VVTSLGVALVFFLHGAALSRDKLVSGAKHWRLHVFVQTFTYVVFPVVGVLLMLSLRNTL
FT                   PPDLLLGVFFLCALPSTVSSSVAMTSMARGNVSGAIFNATISGLIGMLVTPLLMGLVIS
FT                   ASGASMPLGKALTGVALQLLLPFALGQMLRPLIGSWLAKKKHITNKIDRGVIVLIVYSS
FT                   FCDATAQGLWHQYQWQTIGAVMLIAAVLLFVVLGFTTLTARRLGFSVEDEITAVFCGSK
FT                   KSLANGIPMAKILFAGHPALGLLVLPLMVYHQLQLIVCSVIASRYADRDALQEDQAAAR
FT                   A"
FT   sig_peptide     complement(632409..632504)
FT                   /gene="h16_A0598"
FT                   /locus_tag="H16_A0598"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        632608..633525
FT                   /transl_table=11
FT                   /gene="h16_A0599"
FT                   /locus_tag="H16_A0599"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91747"
FT                   /db_xref="GOA:Q0KE24"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE24"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91747.1"
FT                   /translation="MNYTLRQLRVFLAVANTGGFSRAADVVGLTQPAVSRGVAELEEAL
FT                   GVRLLDRTTREVVLTEAGHALAPALERLLGQLDDTLEETRQLGERYRGRVVIAGAPTIS
FT                   ARLMPLYVAACAAQYPEIRLTVRDNVQADGLEQVRAGAVDFGVLIDPLVRDGLVVEPVA
FT                   TDPFCFVCRRDHPLAQSPSVPWAALHGMQLVLLDFASGSRPLIDRVFGRHGVVPLVVQE
FT                   LGHSASVFGMVEAGIGASVLPSFSLPLPAASPLVWRPLVPCEERSIVMVRREDRSLSPA
FT                   AAAVWDLVRRLTVRAEAPAMSAAA"
FT   CDS_pept        complement(633541..634320)
FT                   /transl_table=11
FT                   /gene="h16_A0600"
FT                   /locus_tag="H16_A0600"
FT                   /product="SAM-dependent methyltransferase"
FT                   /function="General function prediction only"
FT                   /note="unknown EC_number=2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91748"
FT                   /db_xref="GOA:Q0KE23"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE23"
FT                   /inference="protein motif:COGS:COG2226"
FT                   /inference="protein motif:PFAM:PF01209"
FT                   /inference="protein motif:COGS:COG0500"
FT                   /protein_id="CAJ91748.1"
FT                   /translation="MQQQELVAAQFGATASAYLTSAVHASGADLQQLKDELAALIPAAN
FT                   RPRSRVLDLGCGAGHASFAAAAIAGEVTAYDLSADMLAVVEAAARERGLANIRTRQGAA
FT                   EQLPFDDASFCAVVSRMSAHHWRDVPSALAEIRRVLKPGGKVVLIDIAGAPDPLRDTWL
FT                   QSVELLRDPSHVRDYTPAGWQSMFEAAGFGADGIAVSDIWRIGIEFDSWVRRMRTAPVA
FT                   VEAIRHLWQMAPAEVRAHYRVQADGSFELEAVMVTAR"
FT   CDS_pept        634476..635288
FT                   /transl_table=11
FT                   /gene="h16_A0601"
FT                   /locus_tag="H16_A0601"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91749"
FT                   /db_xref="GOA:Q0KE22"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE22"
FT                   /protein_id="CAJ91749.1"
FT                   /translation="MPLSADPAVVPSASPSSRESVLGAFLRAHRERLAPADVGLAPGRR
FT                   RRTPGLRREEVAQLAGLSATWVTWLEQGRPVSLSARALASLAAALRLSRAERAYLFELA
FT                   GRRDPQQAADETVPPVVLASVHAIGGPAYLLDRQWTALAWNDAAADLFIGWLDAASAER
FT                   NLLRAMFVSPGLMALVEDWPHRAARLVAEFRAHSIRHADEAPTRTLIEGLMAESAAFRD
FT                   AWLSQDVEDREGGRRGFHHPQQGALQFEQLTLVPAAAPGLMLVMLLPG"
FT   CDS_pept        complement(635307..636065)
FT                   /transl_table=11
FT                   /gene="h16_A0602"
FT                   /locus_tag="H16_A0602"
FT                   /product="Short-chain alcohol
FT                   dehydrogenase/3-hydroxyacyl-CoA dehydrogenase"
FT                   /function="Lipid metabolism"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91750"
FT                   /db_xref="GOA:Q0KE21"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE21"
FT                   /inference="protein motif:COGS:COG1028"
FT                   /protein_id="CAJ91750.1"
FT                   /translation="MQIQGNVFIVTGGASGLGAGTARMLAEAGARVVIADLNESAGQAL
FT                   ATELGGQFVRCDVTSEADGQAVVAAAQALGRLSGIVNCAGIATANKTVGKNGPHPLEAF
FT                   DKTIRINLVGTFNMIRLAAAAMVQNTPDSEGERGVIINTASVAAFDGQIGQAAYAASKG
FT                   GVVAMTLAIARDLSRDGVRCMTIAPGIFETPMLLGMPQEVQDALGRMVPFPPRLGRPAE
FT                   YAKLARSIIENTMLNGEVIRLDGAIRMQPK"
FT   CDS_pept        complement(636282..636947)
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="H16_A0603"
FT                   /product="adenylate kinase"
FT                   /function="Nucleotide transport and metabolism"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91751"
FT                   /db_xref="GOA:Q0KE20"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE20"
FT                   /inference="protein motif:PFAM:PF00406"
FT                   /inference="protein motif:COGS:COG0563"
FT                   /protein_id="CAJ91751.1"
FT                   /translation="MRLILLGAPGAGKGTQAKFICEKFGIPQISTGDMLRAAVKAGTPL
FT                   GVEAKKVMDAGGLVSDDIIIGLVKDRLKEDDCKNGYLFDGFPRTIPQAEAMKEAGVAID
FT                   YVLEIDVPFDAIIERMSGRRVHVASGRTYHVKYNPPKTEGVDDETGEALIQRDDDKEET
FT                   VKKRLDVYSQQTRPLVDYYSEWAAKGDASAKVAPPQYRKILGVGNVDEITARVFEALK"
FT   CDS_pept        complement(637329..638138)
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="H16_A0604"
FT                   /product="3-Deoxy-manno-octulosonate cytidylyltransferase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91752"
FT                   /db_xref="GOA:Q0KE19"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE19"
FT                   /inference="protein motif:COGS:COG1212"
FT                   /inference="protein motif:PFAM:PF02348"
FT                   /protein_id="CAJ91752.1"
FT                   /translation="MTVPAFTVVIPARLASTRLPDKPLADIGGRPMIVRVAERAHASSA
FT                   QRTVVATDAPAVAQACAAHGIEAVLTRADHPSGTDRLSEVAAQLGLADDAIVVNVQGDE
FT                   PLIEPSLIDEVALHLAHHADCAIATAAHPLQDIAEVFNPNVVKVVCDAAGRALYFSRAP
FT                   IPWARDAWSGVPAVPAALAQVPLPGMPVLRHIGLYAYRAGFLRRFPTLAAAPLEQTEAL
FT                   EQLRAMWHGERIAVLQTSAAPAPGVDTPADLERVRALWAQSMAQEGP"
FT   CDS_pept        complement(638148..638354)
FT                   /transl_table=11
FT                   /gene="h16_A0605"
FT                   /locus_tag="H16_A0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91753"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR038053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE18"
FT                   /inference="protein motif:PFAM:PF03966"
FT                   /protein_id="CAJ91753.1"
FT                   /translation="MDNRLLEILVCPLCKGKLEYDRAAQELICHADKLAYPIRDGIPVM
FT                   LADEARQSVPGRAVNPDGPASGN"
FT   CDS_pept        complement(638335..639438)
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="H16_A0606"
FT                   /product="Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /EC_number="2.7.1.130"
FT                   /note="2 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91754"
FT                   /db_xref="GOA:Q0KE17"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0KE17"
FT                   /inference="protein motif:COGS:COG1663"
FT                   /inference="protein motif:PFAM:PF02606"
FT                   /protein_id="CAJ91754.1"
FT                   /translation="MPVPRHALADFVTAQWQRRGWFAWAMLPFSLLFGLIARVRRHGYQ
FT                   RGWFKSTRLPMPVVVVGNVTVGGTGKTPAVIALAQALTEAGLRPGVVSRGYGVELKHPR
FT                   RVKPTSKASDVGDEPLLIARATDVPVWVFPDRALCAQTMLVSHPGVNVLLLDDGLQHYK
FT                   LQRDFEIVMFDSRMGGNGLLLPAGPLREPLSRPRDATLINDPNFRATPDRPGMYGMRLE
FT                   LDDAWQLADPTMARPVSAFAGRRVLAAAGIGNPERFFASLRGAGLTPKTLPLPDHYDFV
FT                   ADPFVDHPDALDADVILITEKDAVKCERFDDPRIWVVPTRPVIDAGLIEKIRRAVLAQI
FT                   KPAPTAPATTPGAAGRNEEHRDGQPAA"
FT   CDS_pept        complement(639589..640020)
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="H16_A0607"
FT                   /product="biopolymer transport protein"
FT                   /function="Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91755"
FT                   /db_xref="GOA:Q0KE16"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE16"
FT                   /inference="protein motif:COGS:COG0848"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="CAJ91755.1"
FT                   /translation="MHFRSRQRREEPEINLIPLIDVLLVILIFLMITTTYSRFTELQIQ
FT                   LPTADAERAQQRPQEIVVSVSSRGVYSVNRQVMEQKDVTSLADQLRAASGTNSGGQPPV
FT                   VIVNADAQASHQAVINVMEAARLAGLSRLTFATQSAQPR"
FT   CDS_pept        complement(640042..640761)
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="H16_A0608"
FT                   /product="biopolymer transport channel protein"
FT                   /function="Intracellular trafficking and secretion"
FT                   /note="4 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91756"
FT                   /db_xref="GOA:Q0KE15"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE15"
FT                   /inference="protein motif:COGS:COG0811"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="CAJ91756.1"
FT                   /translation="MPERAPPAARRASRHAVQVVWGFVIRLSIPGVQLFSIIQAAGWPI
FT                   WPLLLASVIALALIVERFLTLKRSRVLPARLYEEALAAAQQRRATPEVVNTLEQNSPLG
FT                   RVLAAGLRHVVLQPHTSRDAAKDVVEEAGRVVAHELERYLNALGTIASVAPLMGLLGTV
FT                   IGMIEIFGSQGGTGASPEQLAHGISVALYNTAFGLIVAIPALIFWRYFRRRVDDYVAEL
FT                   EFRATSFLDAILPQRRA"
FT   CDS_pept        641690..643120
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="H16_A0609"
FT                   /product="Exodeoxyribonuclease VII, large subunit"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91757"
FT                   /db_xref="GOA:Q0KE14"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE14"
FT                   /inference="protein motif:COGS:COG1570"
FT                   /inference="protein motif:PFAM:PF02601"
FT                   /protein_id="CAJ91757.1"
FT                   /translation="MLWTCPIHAACHQCAMPDLPNFSRDPSSTAPRSGRDVIPVGELNH
FT                   TIARLLERSFPLAWVRGEISNFTRAASGHWYFSLKDARAQIRCVMFRGRNQHVDFQPRE
FT                   GEAVEVRAVVTMYEARGEVQLGVEAMRRAGLGNLYEAFLRLKEKLAQAGLFAPERKRPV
FT                   PAHPRTIGVVTSLQAAALRDVLTTLRRRAPHVPVLVYPVPVQGAGAAQKIADMLDAASA
FT                   RRECDVLILCRGGGSIEDLWSFNEEVVAQAIARCALPVISGVGHETDFTIADFVADVRA
FT                   PTPTGAAELVSPDRAHLLAQAMRARDALTQCMRRGLDLRAQHLDWLARRVRSPQAQLQE
FT                   RRARVDNLARHLRSALRDTVVSQRHRQQLLAMRWSACRPDASAAHADVARLWQRLQAAA
FT                   VRQHERAGQRLARSAGALELLAPQRTLERGYAVLLDQRGRALRSPAEIRAGSVVEAHLA
FT                   KGVADLAIAGVQAKLPDF"
FT   CDS_pept        643332..643913
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="H16_A0610"
FT                   /product="superoxide dismutase"
FT                   /function="Inorganic ion transport and metabolism"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91758"
FT                   /db_xref="GOA:Q0KE13"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE13"
FT                   /inference="protein motif:COGS:COG0605"
FT                   /inference="protein motif:PFAM:PF02777"
FT                   /inference="protein motif:PFAM:PF00081"
FT                   /protein_id="CAJ91758.1"
FT                   /translation="MEHKLPPLPYAHDALAPHISKETLEFHHDKHHQTYVTNLNNLIKG
FT                   TEFENSTLEEIVKKSSGGIFNNAAQVWNHTFYWDSMKPNGGGQPTGALADAINAKWGSF
FT                   DKFKEEFTKTAVGTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTCDVWEHAY
FT                   YIDYRNARPKYVEAFWNVVNWDFAGKNFAG"
FT   CDS_pept        complement(644100..647201)
FT                   /transl_table=11
FT                   /gene="acrB2"
FT                   /locus_tag="H16_A0611"
FT                   /product="Cation/multidrug efflux pump"
FT                   /function="Defense mechanisms"
FT                   /note="11 TMHs"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91759"
FT                   /db_xref="GOA:Q0KE12"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE12"
FT                   /inference="protein motif:COGS:COG0841"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="CAJ91759.1"
FT                   /translation="MSGFNLSALAVRERAVTLFLIILISVAGFVAFFQLGRAEDPPFTV
FT                   KSMIFITAWPGATAQEMQDQVAEKLEKRMQELRYYDRTETYTRPGLAFTTVTLLDSTPP
FT                   KEVPEEFYQARKKLGDEARSLPAGVIGPLINDEYSDVTFGLFALKARGEPQRLLVREAE
FT                   TIRQRLLHVAGVKKVNIIGEQAERIYLSFSHDRLATLGVTPQDIFAALNSQNVLTPAGS
FT                   IDTDGPQVFVRLDGAFDKLQRIRDTPVVAHGRTLKLSDIATVERGYQDPATFVVRNKGE
FT                   PALLLGIVMRDGWNGLDLGKSLEAEVAKVNAELPLGMELSKVTDQAVNIKSAVEEFMVK
FT                   FFAALIVVLVVSFVSMGWRVGIVVAAAVPLTLAAVFVVMAATGKSFDRITLGSLILALG
FT                   LLVDDAIIAIEMMVVKMEEGYGRIAASAYAWSHTAAPMLSGTLVTAVGFMPNGFAKSSA
FT                   GEYTGNQFWIVGIALIASWIVAVVFTPYLGVKLLPEMTKVEGGHGAIYATPNYQRFRGL
FT                   LGRVIGRKWLVAAIVVGLFATSVVGMGAVRKQFFPTSDRPEVLVEVQMPYGTSIEQTSA
FT                   AAEKVEAWLDKQPEAKIVTSYIGQGAPRFYLAMSPELPDPSFAKIVVRTDNQEERDVLK
FT                   GRLRQAIAEGLSPGARVRVTQLVFGPYSPFPVAFRVMGPDPDKLRAIAEQVEGVMDASP
FT                   LMRTVNTDWGPRVPGLHFTLQQDRLQAVGLTSHDVAQQLEFLLTGVPVTEVREDIRSVQ
FT                   VVARAAGDIRLDPERIAGFTLIGANGGRVPLSQVGTVDVRMEDPILRRRDRTPTITVRG
FT                   DIADNQQPPDVSKAILAQLQPVIQKLPSGYRIEMAGSIEESGKANKALAPLFPIMLAIT
FT                   LLIIMFQVRSMAGMVMVILTSPLGLIGVVPTLLLFHQPFGINALVGLVALSGILMRNTL
FT                   ILIGQIQGNLKEGLSPYDAVVEATVQRARPVLLTAVAAILAFIPLTHSVFWGTLAYTLI
FT                   GGTLAGTLLTLVFLPAMYAIWFRIRPPAQVAVQEAPVGEVAEVA"
FT   sig_peptide     complement(647085..647201)
FT                   /gene="acrB2"
FT                   /locus_tag="H16_A0611"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(647198..648385)
FT                   /transl_table=11
FT                   /gene="acrA2"
FT                   /locus_tag="H16_A0612"
FT                   /product="Cation/multidrug efflux system, mebrane-fusion
FT                   component"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91760"
FT                   /db_xref="GOA:Q0KE11"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE11"
FT                   /inference="protein motif:COGS:COG0845"
FT                   /protein_id="CAJ91760.1"
FT                   /translation="MLQRRFSASTVTHAATSAPAFAAMCLLPLALAACSGKPQPDPRVQ
FT                   APLVRVENVQDASAARRAFTGIVAARVQSDLGFRVSGKVLERLVDTGQSVKRGQPLMRL
FT                   DPVDLKLAARARQEAVAAAKARATQLAADEERYRDLVAAGAVSASAYDQIKASADSARA
FT                   QLRAEEAQADVARNASDYAVLLADADGVVVETLAEPGQVVNAGQVVARLARAGQREAII
FT                   HLPETLRPPVGSTARATLYGKDGMAVTATLRQLSDAADRQTRTYEARYVLGGALTDAPL
FT                   GATVTLQVADPQEASQSGLQVPIGALHDPGKGPGVWVLTGTPAHVTWRPVTVRAISDDA
FT                   AKVEGQIQPGDRVVALGAHLLNEGQQVRLASEVKVAEAATDGKGRNPVNGVREQQ"
FT   sig_peptide     complement(648317..648385)
FT                   /gene="acrA2"
FT                   /locus_tag="H16_A0612"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(648489..649106)
FT                   /transl_table=11
FT                   /gene="h16_A0613"
FT                   /locus_tag="H16_A0613"
FT                   /product="transcriptional regulator, TetR/AcrR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91761"
FT                   /db_xref="GOA:Q0KE10"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE10"
FT                   /inference="protein motif:COGS:COG1309"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="CAJ91761.1"
FT                   /translation="MTDTQPTTPQPRGPVDHGVRNQIVEAATEHFSLYGYEKTTVSDLA
FT                   KAIGFSKAYVYKFFDSKQAIGEVICCNCLNQMRQAVDEAVAGADSASERLRRLFGTLAE
FT                   AGSRLFFQDRKLYAIAVVACEEQWASARAYDAHMQQLILQIVREGRESGEFERKTPLDE
FT                   TAHAIYLVMKPYLDPLQLQHNLDFVEVAPAQLSSLILRSLAP"
FT   CDS_pept        649160..650716
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="H16_A0614"
FT                   /product="outer membrane protein"
FT                   /function="Cell envelope biogenesis, outer membrane /
FT                   Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91762"
FT                   /db_xref="GOA:Q0KE09"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE09"
FT                   /inference="protein motif:COGS:COG1538"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="CAJ91762.1"
FT                   /translation="MVTSHEKSSTMLFRQPMHSRRLPSRSRSLTHLSGLVAAVTALAAL
FT                   AGCAVGPDYRKPEVPTADRFLGQRDVEQRRAATRADLEVWWEGFGDPQLTRFVRLALDQ
FT                   NLNLAVASARVTQAGAGLRFATAALLPSGAVSAQAAKQYQSLETPLGRVLNATPNFDRH
FT                   GSLYEADLTASWEIDIFGGLRREREASQAEYQASEAGLAATRVEVAAQAADTYVTIRGL
FT                   QARLSIARQQVDTQQKLVSTVRLLYAKGLAAALEVQQAEGALAQVEATIPELEAGLDAA
FT                   LNAMDVLLGSQPGTYRAELADIKAIPAAPRIEATGTPADLLRRRPDLIVAERRLAASNA
FT                   RIGAAIAEYYPKVSLSGLLGSATTVASGNLFSASANQAAGVAGLRWRLFDFGRIGAQID
FT                   QAKGQEAEALAGYRLAVLHASEDVENAFTALVKREEQTNALERGEQALRQARNSSFAAY
FT                   EKGVVRLIEVLLADENLLKTSDAKAQAEAQSARAAIAAFKALGGGWQAAAVPPAPGGTV
FT                   L"
FT   CDS_pept        651329..652153
FT                   /transl_table=11
FT                   /gene="hpaI1"
FT                   /locus_tag="H16_A0615"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /function="Carbohydrate transport and metabolism"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91763"
FT                   /db_xref="GOA:Q0KE08"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE08"
FT                   /inference="protein motif:COGS:COG3836"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="CAJ91763.1"
FT                   /translation="MHRLRWRPCPGAIMTTTVPAAKGINRLKSMWRNGQATLGAIATIP
FT                   SVQTIQIMAHAGLDWVLIDMEHGAIDAGTAHAMICATSGTPLVPLVRVAATNAWQAKVP
FT                   LDLGALGVCFPMTTTRAAAEAAVRAVRYPPEGDRFWGPFYAPPRWGLTMREYLDCADGE
FT                   VLAIGTIEHVDAIGNIEDIVATPGLDLVFIGPGDLATSMGYRGRTDLPEVQAVIAQLET
FT                   PILKSRVLLGGVAPTTDLANAMIARGYRAVVIGMDWSLLQRGLASVVDGISR"
FT   CDS_pept        complement(652469..653050)
FT                   /transl_table=11
FT                   /gene="h16_A0616"
FT                   /locus_tag="H16_A0616"
FT                   /product="Putative NADPH-quinone reductase"
FT                   /function="General function prediction only"
FT                   /EC_number="1.6.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91764"
FT                   /db_xref="GOA:Q0KE07"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE07"
FT                   /inference="protein motif:COGS:COG2249"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="CAJ91764.1"
FT                   /translation="MSKRIVIIQGHPDPSGQRLLHALADAYAQGATTAGHGVRRIEVAK
FT                   LDFPLLRTQAEFETGTLPPALEQPREDMRWAEHWVFLFPLWHGTMPALFKGFLEHIFRP
FT                   GFAMDYKEKGFPRRLLAGRSARIIVTMGMPALLYRWYFGAYGVRGFERSMLSFAGIKPI
FT                   RENLYGLTFANERTRTRWLENMRAHGAHGN"
FT   CDS_pept        complement(653092..654435)
FT                   /transl_table=11
FT                   /gene="h16_A0617"
FT                   /locus_tag="H16_A0617"
FT                   /product="carboxylesterase type B"
FT                   /function="General function prediction only"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91765"
FT                   /db_xref="GOA:Q0KE06"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE06"
FT                   /inference="protein motif:CDD:cd00312"
FT                   /protein_id="CAJ91765.1"
FT                   /translation="MTIHYPSANLSGEPAMYPIVETRLGKVRGLRCDGVYAFKGIPYAG
FT                   PPFGMNRLRPPQSAAPWRGVRDALSFGPKSPQIAYPPGIAEALGELVGGGEDCLGDGLA
FT                   NLGLLDQIAALEWVQQNIDAFGGDPGQVTIFGQSAGGMSVATLLTVPRAQGLFRRAIVE
FT                   SGNTPHVTSANTAKRIGHRLAALLKVDPTREAIASTTPAQVLQAQAQLREELTADPDPA
FT                   FWGEVALSSLPWAPTVDGAILPAPPIDAIRAGVAANTALLVGSNTKETRLFLVPSGAID
FT                   RITEASVLALVAAYGLSAGGLSGYRAAHPTATAGELFSEIQTDWYWRIPAVRLADAHAA
FT                   NARISTYMYEFAWRSPQLGGRLGAAHGVEIPFIFDTLGPGAEALVGPTPPQSLADAMHR
FT                   AWVAFAVNGDCGWPTYDPVHRSTMRFDTPSAVVDDPLAVRLALWHGVP"
FT   CDS_pept        655092..656147
FT                   /transl_table=11
FT                   /gene="h16_A0618"
FT                   /locus_tag="H16_A0618"
FT                   /product="NADPH:quinone reductase or related Zn-dependent
FT                   oxidoreductase"
FT                   /function="Energy production and conversion"
FT                   /EC_number="1.6.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91766"
FT                   /db_xref="GOA:Q0KE05"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE05"
FT                   /inference="protein motif:COGS:COG0604"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="CAJ91766.1"
FT                   /translation="MKHRRIIVTNYGGPDALHVVEEECPEPKVGEVRVRVLAAGVGQPD
FT                   LMMREGFHPETPPLPFTPGWDLVGMVDKLGSGVSGVEPGQIIAALPISGAYAEFVCLAQ
FT                   RELVPVPPGVDVAEAVSLVLNYVTAYQMLHRCAKVEPGQQVLIHGAAGGVGSALLQLGR
FT                   LAGLQMYGTCSSQDAMAVSGLGGIPIDYQRLDFVEEIRRLTGDGVDVVFDGIGGSNIWR
FT                   SRDALHPRGKVVAYGLTASLRGGRLASGRSGRRNRFQRLAIFGVCIVGGWLLPGRKRVV
FT                   PYSIQWLKRMKPALFRQDLTVLLDLLQQERIKPLIARKFSLSEAKLAHELLGEKGVAGK
FT                   IVLMTNEALMG"
FT   CDS_pept        656464..657090
FT                   /transl_table=11
FT                   /gene="h16_A0619"
FT                   /locus_tag="H16_A0619"
FT                   /product="YcaC related amidohydrolase"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91767"
FT                   /db_xref="GOA:Q0KE04"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE04"
FT                   /inference="protein motif:CDD:cd01012"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="CAJ91767.1"
FT                   /translation="MSKPYKRLDKNDAAVLLVDHQAGLLSLVRDIEPDKFKNNVLAVAD
FT                   LAKYFKLPTVLTTSFEDGPNGPLVPELKQIFPDAPFIPRPGQINAWDNEDFVKAVKATG
FT                   RKQLIIAGVVTEVCVAFPALSAMAEGYDVFVATDASGTFNEVTRHSAWNRMAEAGAQLM
FT                   TWFGIACELHRDWRNDIEGLGTLFSNHIPDYRNLITSYTTVKAGQ"
FT   CDS_pept        657138..657449
FT                   /transl_table=11
FT                   /gene="h16_A0620"
FT                   /locus_tag="H16_A0620"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91768"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE03"
FT                   /protein_id="CAJ91768.1"
FT                   /translation="MLDIQPSLTLVPAAGIKLTFACDFIWRATTHDAVYTSAGIPVPGT
FT                   AGRSGQYSSSQLSVDVAWQASRHVLVNGGAVYVDESRTLKAVGGHNTRFLYLALGYTF"
FT   CDS_pept        657932..659026
FT                   /transl_table=11
FT                   /gene="h16_A0621"
FT                   /locus_tag="H16_A0621"
FT                   /product="outer membrane protein (porin)"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91769"
FT                   /db_xref="GOA:Q0KE02"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE02"
FT                   /inference="protein motif:CDD:cd00342"
FT                   /inference="protein motif:COGS:COG3203"
FT                   /protein_id="CAJ91769.1"
FT                   /translation="MKNPLAGAAFAALAACCTGAFAQSNVTLYGRLNTSMEYSDASTAS
FT                   DGTKLGGTGRLTNNRSVFGMRGEESLYGSLKAIWQIESNISLDTGSGQLASRNTRIGLA
FT                   GSAGSFFMGNWTTPYLEATSSYDPFYPTTAGYMALIGNGSTPTSDNVQDTSSFDRRQKN
FT                   SVHYRSPKWNGFSGGVTWGINEERITVPRNPSLWSFAGAYDNGPLNVVLAYERHNNYQT
FT                   AGRDDEGMKIGLSYQFPTTKVSAIYERLHYRTATGDLKRDAYYASVVQKLWTGSLRAGV
FT                   GVAGNGRGNATETVGFFRSGADTGAVQATLGYEYPLSKRTSVFGFYSRIFNKKNATYDF
FT                   AINELGISAGADPQTVALGMRHVF"
FT   sig_peptide     657932..658000
FT                   /gene="h16_A0621"
FT                   /locus_tag="H16_A0621"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        659073..660053
FT                   /transl_table=11
FT                   /gene="h16_A0622"
FT                   /locus_tag="H16_A0622"
FT                   /product="probable extra-cytoplasmic solute receptor"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91770"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE01"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /inference="protein motif:COGS:COG3181"
FT                   /protein_id="CAJ91770.1"
FT                   /translation="MKFQNILRAALATALCLPLLHGAAQAEAYPDKPIRMIVPFAAGSA
FT                   TDLLARIVSAEIGTSSNMQIVVDNRPGAGGTIGTAVVAKAPADGYTLLLTSAGHAVNPT
FT                   LYPKLPYDTTRDLKGISTVATMPYLLVVSASSPYRTLKDLLAAARARPDSVTYSSAGSG
FT                   SSSHLSGELFNVTAGVQTRHIPYKGAPAAITDVMSGRVDMFFAPSITALQFVKDGKLRI
FT                   LGVATAARVPSLPDVPTIAEAGVPGYVFDAWFGVLAPAGTPKDVVARLNTAMQQALSAP
FT                   ATKEKLIAQGAEAKPSTPAAFDKLIAADIAKLEPIVKRSGAQPGQ"
FT   sig_peptide     659073..659153
FT                   /gene="h16_A0622"
FT                   /locus_tag="H16_A0622"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        660113..661822
FT                   /transl_table=11
FT                   /gene="h16_A0623"
FT                   /locus_tag="H16_A0623"
FT                   /product="predicted metal-dependent hydrolase with the
FT                   TIM-barrel fold"
FT                   /function="General function prediction only"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91771"
FT                   /db_xref="GOA:Q0KE00"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KE00"
FT                   /inference="protein motif:COGS:COG1574"
FT                   /inference="protein motif:CDD:cd01300"
FT                   /protein_id="CAJ91771.1"
FT                   /translation="MRCIARALAHAMAVGCLVAASGAQAQAGAYADRILVNGTVLTMNA
FT                   TDTVAQALAIRGDRIAAVGTSRDIRRLAGPRTEVIDLGGRTVIPGLIDTHIHAIRGGQS
FT                   YAFETYWYEGETTSLAAGLGLLRKTALSRGPGKWVAVTGSWHPDQFTEKRAPTPAELTA
FT                   LLPDNPAYVQYLYDYALVNARAIEALKLDQPDALPPGIRVERDSEGRPTGRIFGAIRPL
FT                   SALFGRILAQSQVDARASLQSFFSRLNSLGVTALIDPTAGPGPAYDPLYALWREDSLSL
FT                   RVGYRIPTMVAGNEAEWFRNTLAYLPPRLGDGKLRFLGPGEMLVFGMDDGVKMGPGFQP
FT                   SAKDREELLKVATFAASRGYPVEIHAYTDDAASAILDVFEEVGKCHDLGKLRWAMAHLN
FT                   TGKPETFRRMKALGLSYTVQMGPYFEAGAIGHANDHHVAEAAPPVRLALQHGLKVAGGT
FT                   DATRIGIPGVWRALEFHVGGYSIGKEVRRKEDFRLSRLEALRLYTANAAWISFDEASRG
FT                   TLEAGKLADLAVLDKPYLTVPVEDIHRIRSVLTMVDGKVVHADGGFAARKAR"
FT   sig_peptide     660113..660190
FT                   /gene="h16_A0623"
FT                   /locus_tag="H16_A0623"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        661859..662251
FT                   /transl_table=11
FT                   /gene="hpaF"
FT                   /locus_tag="H16_A0624"
FT                   /product="5-Carboxymethyl-2-hydroxymuconate isomerase"
FT                   /function="Amino acid transport and metabolism"
FT                   /EC_number="5.3.3.10"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91772"
FT                   /db_xref="GOA:Q0KDZ9"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDZ9"
FT                   /inference="protein motif:PFAM:PF02962"
FT                   /inference="protein motif:COGS:COG3232"
FT                   /protein_id="CAJ91772.1"
FT                   /translation="MPHLIVEYTHNLAPVVRIDALLAGLSAVLIAQDGAFPVGGIRARA
FT                   LCLESYRMADGSSDDAFVHVTLAVARGRSQDVLDRTVSALFDTLTAHFAEPYRRRYLAL
FT                   SLELREFAGAYRSLNNIHQRYNTTAA"
FT   CDS_pept        662307..663398
FT                   /transl_table=11
FT                   /gene="h16_A0625"
FT                   /locus_tag="H16_A0625"
FT                   /product="outer membrane protein (porin)"
FT                   /function="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91773"
FT                   /db_xref="GOA:Q0KDZ8"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDZ8"
FT                   /inference="protein motif:CDD:cd00342"
FT                   /inference="protein motif:COGS:COG3203"
FT                   /protein_id="CAJ91773.1"
FT                   /translation="MKIGTMGAALLALSPTLAAAQSVTMYGVIDTGVEYVNKVGAGGDS
FT                   LVRMPTLTGTVPSRWGLRGTEDLGGGLKSVFVLESGFAPDTGGANQGGRLFGRQALVGL
FT                   SGKWGQLSLGRQYTMLFWANLDSDILGPNVYGAASLDSYLPNTRADNAVAYKGTFGGLT
FT                   VGATYSFGRDAINAGPSPAGTNCAGENPASKSACREWSALIRYEHKGWGVTAAYDSLRG
FT                   GPGAFGGLGNKSLTDDRLSLSGYVLLSRAKLGVGVIRRDNEGSATPRSELWYGGMAYDI
FT                   TPAFTLAGQVYYLKFHDSANKAMLYALRGAYAFSKRTSVYATAGFIDNGGQLAQSVSAG
FT                   AAGSNPRAGGSQFGAMVGVKHVF"
FT   sig_peptide     662307..662369
FT                   /gene="h16_A0625"
FT                   /locus_tag="H16_A0625"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        663643..666252
FT                   /transl_table=11
FT                   /gene="h16_A0626"
FT                   /locus_tag="H16_A0626"
FT                   /product="VgrG protein, uncharacterized protein conserved
FT                   in bacteria"
FT                   /function="Function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91774"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDZ7"
FT                   /inference="protein motif:COGS:COG3501"
FT                   /inference="protein motif:COGS:COG4253"
FT                   /inference="protein motif:PFAM:PF04524"
FT                   /protein_id="CAJ91774.1"
FT                   /translation="MGIRDNLPFPARTVTVSGPALPDILGQSPFTFVRLEGKEGVCGLF
FT                   EYDIELKTPDKAYNFHGPEGNFDLREMSGRELTVHIELDGMGTGLAGRIGAGTREISGI
FT                   VDRARYLRAEGRHFVYGLTLRPWLWIASQNRNSRVFENRTDIEIIEEVLSAYSFPVERR
FT                   LDVAKYPRRVYRTQCDESDYTFIARLMQHWGISWFFEHSDGKHRLVLVDHVGGYFSMPS
FT                   EAYQALEIHPPGARVDQEHLDAFSVVDAVVAGKYTTNAYSFTQPRGNLSASSSDPRDTG
FT                   LNTGALHQEVYDFPSEHAQPATDNRPWDEGDMIARIRMEEIRSRGLRCFGAGNLRAVVP
FT                   GCTMHVKGHPQHAANREYVVLNTSLRLEDVAEASGEGQRWHCRVEFECHPTHEVFRPAL
FT                   SIPWPVVTGPQSATVVGPEGHIVWPDRFGRVRVQFPWDRFNRMSCWVRVATPWAGSQYG
FT                   QVSIPRIGSEVLVMFLDGGDPDKPIVMGAVPNSLNMPPWQLPHQHALTGIRSREHDGSS
FT                   SGHLVFDDTKGQIQSQLSSDYQRSQLSLGYLSRIEDNRGRQDHRGNGFELRTDGHGAVR
FT                   GGDGLLISTEPRPDARAHHKDMGETVDRLQQAQHAHDTMGQLAQHHHAQDEEQQDVAKA
FT                   LKAQDEEIRGSGEVNGELTAPHLVLASAAGLAATTAKSTQLHSGEHLAVTTGKHASIVS
FT                   SGGIFASAARRIALFAHSLGIRLVAATDHIALEAQDGDIKGTAKRNIHFRALGDIVFEA
FT                   DQGILFKVGQTYMRVTPSQIVEGMGGVRQIHATDFSVDGPDGMNPSALALPQSDFDQEV
FT                   YLHLPDGSPARNWKFRLTQSDGNVIEGLTGPDGLTKFQQSQGAENIMIQILESASGH"
FT   CDS_pept        666242..668068
FT                   /transl_table=11
FT                   /gene="h16_A0627"
FT                   /locus_tag="H16_A0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91775"
FT                   /db_xref="GOA:Q0KDZ6"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDZ6"
FT                   /protein_id="CAJ91775.1"
FT                   /translation="MATDRIHLKTGEEIGGHAGAVVALTPSTDTRRASLPVPPDKVIPV
FT                   IFLPGIMGSHLRMSRKRQEDLKRDDNIAWRPDDTGDTLARRNDSPGRRQMNFDPDETEV
FT                   DRYEITEDAGKFDMTGEETVNSDKRHANVPDGLPDIGLLMSAPLPPAAEQWKAKRGKHE
FT                   ATAAQKARWRGWSEVMFETYGEVIKLMEAHLNDMLVAGELSPAWKKGKKVEVLGVNPAY
FT                   WGGAGDALTEADVLRVANCWYPVYAMGYNWLESNGTSAKKLARRIDEIIGMYKANGRQC
FT                   KKVIVVTHSMGGLVARALLHPDYGNAQDKILGVYHSVQPALGAGAAYKRVRTGSDVQDN
FT                   LVGNIARNVMGRTGKEVTAVFANASGPLELLPTASYPRGWLRLQTGDYRQAMALPIASD
FT                   APLKAYLSDLDLHQKLGVDKPAPPMAVGDPVYDIYTRNPKCWWRLLNPDWINPANKPYV
FT                   DMDADTAAKWKIAEAQKFHKKIKDLYHPTTYASYGEDSSQKCYGSVTWRADTADLAPHG
FT                   DPLTWTIESEDAEGRIVVRTRGNQTLTLRLEPPTDAGDQTVPAKASAEAVRGTLFRQTG
FT                   YEHQGSYQNDQVLASALYSIIKIANTAPWWGI"
FT   CDS_pept        668065..669276
FT                   /transl_table=11
FT                   /gene="h16_A0628"
FT                   /locus_tag="H16_A0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91776"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDZ5"
FT                   /protein_id="CAJ91776.1"
FT                   /translation="MTRCGFTTILAGLLLAGCQSFAYPENKMSEPVALSPRLQTLFAKT
FT                   KPVCFGRYVMEVPAEAKLLWGFQDFPGEIVTHVGAAGRLMEMAETYRAAQLAKDKTAEI
FT                   TYFGRGPTEHSVQVRWFPSDVAKQYGAEGTYTFVTAGPHLYEWSGGRKNPELIRALRAR
FT                   DNAEIPTAPGVCIDHGFVADASGSYQEIFGAGIRLPSLPDVSFSVDSNKLASVDGEPGL
FT                   LTSIAEQRKYLGSRYPKLTTLREGKRTVGVWQGEESLVRRADGTHDFEWEAVGRERTTL
FT                   HPAVIGAKMYTKVAANRIGAADQASLTDEEAVALWDRLLDGVRFRVNAPPTQTGDPVTV
FT                   RSGETTPLSGIWRASLPPEHPQADWVASKSGILRQKGMPMIRFGLLPSDEALVVWTWMG
FT                   EAST"
FT   CDS_pept        669344..669784
FT                   /transl_table=11
FT                   /gene="h16_A0629"
FT                   /locus_tag="H16_A0629"
FT                   /product="hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91777"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDZ4"
FT                   /protein_id="CAJ91777.1"
FT                   /translation="MIHRALAIISMTALLMVGGQSYAAPENGKLESVAMSPRLQTLFAK
FT                   TKQVCFGRYAMEVPAEANLGSGAQYFSRERSTLHPAWIHANMRTEVVAADKASLSDEEA
FT                   IVLWDKLLEGVRFRVNAPPTQTGDMTDHNGVVATGSPKIQAP"
FT   CDS_pept        complement(669840..670787)
FT                   /transl_table=11
FT                   /gene="h16_A0630"
FT                   /locus_tag="H16_A0630"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91778"
FT                   /db_xref="GOA:Q0KDZ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDZ3"
FT                   /inference="protein motif:COGS:COG0583"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="CAJ91778.1"
FT                   /translation="MTMDLRQLRYFKVLATLQHFGRASAALHIAQPALSRQIRLLEEEL
FT                   GVRLLERHVRGATPTPEGLVLLDRASFLLRYADQVKVDIADLAASPRGLVALGLTPALA
FT                   PLLFIPLAEALRQRYPEIRLRLVENFAPALQDALLQGTLDVGLLSGPVSSPGVSVVPLV
FT                   AESLCAIGPWGAASLGDGPVDIEQLQGLPLILTGVSKSGVRLALEALAARQRVELQVTM
FT                   EVESIEVARRLVVRGFGWTVHFAAAIRDELQAQRLQALPIRGLELHRMIGYAAARPPSR
FT                   ATLAVMETLRDVARELAVDGNWPNSRLLGEVLDS"
FT   CDS_pept        complement(670864..671877)
FT                   /transl_table=11
FT                   /gene="h16_A0631"
FT                   /locus_tag="H16_A0631"
FT                   /product="transcriptional regulator, LacI-family"
FT                   /function="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91779"
FT                   /db_xref="GOA:Q0KDZ2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDZ2"
FT                   /inference="protein motif:COGS:COG1609"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /inference="protein motif:COGS:COG1879"
FT                   /inference="protein motif:SMART:smart00354"
FT                   /protein_id="CAJ91779.1"
FT                   /translation="MSKPTIKQIAEALDVHPSTVSRVLNPETRHRIGDELVARVLKAAQ
FT                   DLHYSPNRIAAALRTRRSGTIGVVVPDIGSPVFPPIVLGIENALSRHRYIPIVANAGGD
FT                   KARQTFIVDQLLARQVDGLILATAERNDPVVAHCLAQGVPIVMVNRSDDAGRVSSVVGD
FT                   SRQAMALAVGHLHALGHRRIGHVAGPSSLSTGHEREAGFLQAVADLGLSASQCPVERAP
FT                   AYTEDAGQAACAQLLSRRQRITAVVAANDFLALGCYAAVRAAGGSCPSDLSVVGHNDML
FT                   LMHAVSPALTTIRVPFYEMGTRAAALMLGALDGSIATTARTLLTPELVVRASTRPL"
FT   CDS_pept        672103..673044
FT                   /transl_table=11
FT                   /gene="h16_A0632"
FT                   /locus_tag="H16_A0632"
FT                   /product="NADPH:quinone reductase or related Zn-dependent
FT                   oxidoreductase"
FT                   /function="Energy production and conversion"
FT                   /EC_number="1.6.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91780"
FT                   /db_xref="GOA:Q0KDZ1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDZ1"
FT                   /inference="protein motif:COGS:COG0604"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="CAJ91780.1"
FT                   /translation="MKGAVSLAGRAPVYQEFDDPTPAGGQVVVDVGAAALSRLDMAIAE
FT                   GRHYIKPAAGSFVVGREGVGRLADGQRVYFNVNAPVAPFGSMAQRALVDPALTFPVPDG
FT                   IDDERAAALGNAGLAAWLPLSWRARMQPGETVLVLGATGISGLLAVAAAKLLGAGRVIA
FT                   AGRNVQALQRARRLGADAVVPLDQPGDLLDAYRNAADGNVDIVLDYLCGAPAEAALLAL
FT                   GHGGRLVHIGTTVAPTIAFAGAAARKACFDIMGFAYYHAPVAVQAQAYAELCRHTAAGR
FT                   MEIDIVSAPLEDVGQVWAAQARGARQRFVLVP"
FT   CDS_pept        complement(673308..674285)
FT                   /transl_table=11
FT                   /gene="pcaH2"
FT                   /locus_tag="H16_A0633"
FT                   /product="Protocatechuate 3,4-dioxygenase beta subunit"
FT                   /function="Secondary metabolites biosynthesis,
FT                   transport,and catabolism"
FT                   /EC_number="1.13.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91781"
FT                   /db_xref="GOA:Q0KDZ0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDZ0"
FT                   /inference="protein motif:PFAM:PF00775"
FT                   /inference="protein motif:COGS:COG3485"
FT                   /protein_id="CAJ91781.1"
FT                   /translation="MSVSSPGNIHSFNHQEPTIMTSASAESALAPSASNAQSIPATPEA
FT                   LLKAVLKANSGTHDPRTRTILDALIRHAHAFASEVQLTYEELHHGLDFMVRIGQATGPK
FT                   KHEGILLADILGLATLVLLMDAKAVLAAGGTEPALIGPFWRANQPVRANGAHIATPDTT
FT                   GDPLFVQGRVVSIDGTPIAGARVETWQAAPSGLYENQDEHQEDMNLRGAFETDADGRFW
FT                   FESVRPSGYGVPIDGPCGDLLALQNRDHMRPAHLHFIAIAPGHKVLTTQIFDALDPFAF
FT                   SDAAFGAVGSLLRDFEPVDGGGFRLDVELKLEPGETRLPKPPLP"
FT   CDS_pept        complement(674623..675177)
FT                   /transl_table=11
FT                   /gene="h16_A0634"
FT                   /locus_tag="H16_A0634"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91782"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDY9"
FT                   /protein_id="CAJ91782.1"
FT                   /translation="MDPTPQEMEATRIARWGKVKPYGETFIESRLPGMKKNIYKIMNRG
FT                   VLENKGVEPAIPGNHRFGVTFIEIPVGQGASLHAHKTEEVFCPLNGQMEVIWGEKGQYS
FT                   LMLNQWDVISCPIGVMRGFRNPNDHALVVYSVVGGTDEECGRIAWHPDVVKAAEATGLV
FT                   YGKDGYITETEADKAEHRAAD"
FT   CDS_pept        complement(675392..676096)
FT                   /transl_table=11
FT                   /gene="h16_A0635"
FT                   /locus_tag="H16_A0635"
FT                   /product="Uracil-DNA glycosylase"
FT                   /function="DNA replication, recombination, and repair"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:H16_A0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ91783"
FT                   /db_xref="GOA:Q0KDY8"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q0KDY8"
FT                   /inference="protein motif:COGS:COG1573"
FT                   /inference="protein motif:PFAM:PF03167"
FT                   /protein_id="CAJ91783.1"
FT                   /translation="MRHPRPWPTLKNRRPKLPPDETDSSTARRAPMPEHRKLPVSRDEL
FT                   NQCRRCPLWRNATQGVPGAG